BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF014G06

Length=767
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAJ38386.1|  alpha tubulin                                          424   4e-147   Plantago major [cart-track plant]
gb|AHM93474.1|  alpha-tubulin                                           426   1e-146   Camellia chekiangoleosa
ref|XP_004252814.1|  PREDICTED: tubulin alpha-2 chain-like              421   1e-146   Solanum lycopersicum
gb|KJB58759.1|  hypothetical protein B456_009G224800                    423   1e-145   Gossypium raimondii
gb|EPS62716.1|  alpha-tubulin                                           425   2e-145   Genlisea aurea
gb|AHJ80819.1|  Tua1                                                    418   6e-145   Eragrostis tef [tef]
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     426   6e-145   Nicotiana sylvestris
emb|CAD13176.1|  alpha-tubulin                                          426   7e-145   Nicotiana tabacum [American tobacco]
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     426   7e-145   Nicotiana tomentosiformis
gb|ABB02631.1|  unknown                                                 426   7e-145   Solanum tuberosum [potatoes]
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     426   8e-145   
gb|ABP65320.1|  alpha tubulin                                           426   8e-145   Capsicum annuum
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   425   9e-145   Nicotiana tomentosiformis
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              425   1e-144   Nicotiana tomentosiformis
gb|KJB32211.1|  hypothetical protein B456_005G229600                    422   1e-144   Gossypium raimondii
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              425   1e-144   
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              425   1e-144   Solanum lycopersicum
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                425   1e-144   Solanum tuberosum [potatoes]
gb|AAW57310.1|  alpha-tubulin                                           418   1e-144   Ceratopteris richardii
gb|AAW57309.1|  alpha-tubulin                                           418   2e-144   Ceratopteris richardii
gb|AAW57305.1|  alpha-tubulin                                           419   2e-144   Ceratopteris richardii
dbj|BAB19779.1|  alpha tubulin                                          424   3e-144   Nicotiana tabacum [American tobacco]
emb|CAA52158.1|  alpha tubulin                                          417   3e-144   Zea mays [maize]
ref|WP_039310890.1|  hypothetical protein                               424   3e-144   
gb|ABC59068.2|  alpha tubulin 1                                         424   3e-144   Camellia sinensis [black tea]
gb|ACH68563.1|  alpha-tubulin                                           424   4e-144   Solanum tuberosum [potatoes]
gb|EYU34660.1|  hypothetical protein MIMGU_mgv1a006269mg                424   4e-144   Erythranthe guttata [common monkey flower]
ref|NP_001291325.1|  tubulin alpha chain-like                           423   5e-144   Sesamum indicum [beniseed]
gb|EYU34085.1|  hypothetical protein MIMGU_mgv1a0196712mg               414   5e-144   Erythranthe guttata [common monkey flower]
emb|CDP02221.1|  unnamed protein product                                423   5e-144   Coffea canephora [robusta coffee]
gb|KGN48654.1|  hypothetical protein Csa_6G497050                       422   5e-144   Cucumis sativus [cucumbers]
ref|NP_001275271.1|  alpha-tubulin-like protein                         423   6e-144   Solanum tuberosum [potatoes]
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     423   6e-144   Sesamum indicum [beniseed]
ref|XP_004232226.1|  PREDICTED: tubulin alpha chain-like                423   8e-144   Solanum lycopersicum
gb|KJB58756.1|  hypothetical protein B456_009G224800                    421   1e-143   Gossypium raimondii
ref|XP_009626810.1|  PREDICTED: tubulin alpha chain-like                422   1e-143   Nicotiana tomentosiformis
gb|KDO81349.1|  hypothetical protein CISIN_1g013037mg                   419   1e-143   Citrus sinensis [apfelsine]
emb|CAB76917.1|  alpha-tubulin 4                                        416   1e-143   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAH19954.1|  AT1G50010                                              415   1e-143   Arabidopsis thaliana [mouse-ear cress]
gb|AAW57306.1|  alpha-tubulin                                           414   3e-143   Ceratopteris richardii
gb|ADW83724.1|  alpha-tubulin                                           420   3e-143   Musa acuminata AAA Group [Cavendish banana]
gb|AFW67749.1|  alpha tubulin4                                          416   3e-143   
gb|AAX96763.1|  Tubulin/FtsZ family, GTPase domain, putative            417   4e-143   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004150268.1|  PREDICTED: tubulin alpha chain-like                421   7e-143   Cucumis sativus [cucumbers]
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        421   7e-143   Cucumis melo [Oriental melon]
gb|KDO49533.1|  hypothetical protein CISIN_1g013062mg                   420   7e-143   Citrus sinensis [apfelsine]
ref|XP_003608582.1|  Tubulin alpha-5 chain                              420   8e-143   Medicago truncatula
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                420   8e-143   Cucumis sativus [cucumbers]
gb|AFW67748.1|  alpha tubulin4                                          417   8e-143   
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              420   9e-143   Cucumis sativus [cucumbers]
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     420   1e-142   Cucumis melo [Oriental melon]
gb|KHG18997.1|  Tubulin alpha chain                                     420   1e-142   Gossypium arboreum [tree cotton]
gb|ABO47740.1|  alpha-tubulin                                           420   1e-142   Gossypium hirsutum [American cotton]
gb|ABO47736.1|  alpha-tubulin                                           420   1e-142   Gossypium hirsutum [American cotton]
ref|XP_007032501.1|  Tubulin alpha-2 chain                              420   1e-142   
gb|AIX10966.1|  tubulin                                                 420   1e-142   Ornithogalum longebracteatum [sea-onion]
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         420   1e-142   Jatropha curcas
gb|ACJ60905.1|  alpha tubulin                                           420   1e-142   Betula pendula [white birch]
gb|ABO47739.1|  alpha-tubulin                                           420   1e-142   Gossypium hirsutum [American cotton]
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     420   1e-142   Fragaria vesca subsp. vesca
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     420   1e-142   Pyrus x bretschneideri [bai li]
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             420   1e-142   Prunus persica
emb|CAN62392.1|  hypothetical protein VITISV_016172                     419   1e-142   Vitis vinifera
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             420   1e-142   Citrus clementina [clementine]
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                420   1e-142   Elaeis guineensis
ref|XP_002510010.1|  tubulin alpha chain, putative                      420   1e-142   Ricinus communis
gb|KIY91712.1|  Tubulin alpha chain                                     412   1e-142   Monoraphidium neglectum
gb|ABX57816.1|  alpha tubulin                                           420   1e-142   Picea wilsonii
ref|XP_006433708.1|  hypothetical protein CICLE_v100015522mg            411   1e-142   
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                420   1e-142   Phoenix dactylifera
gb|ACN40181.1|  unknown                                                 420   1e-142   Picea sitchensis
ref|XP_002522104.1|  tubulin alpha chain, putative                      420   1e-142   Ricinus communis
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     420   1e-142   Vitis vinifera
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                420   1e-142   Vitis vinifera
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    420   1e-142   Citrus sinensis [apfelsine]
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             420   1e-142   Selaginella moellendorffii
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             420   1e-142   Citrus clementina [clementine]
ref|XP_007018369.1|  Tubulin alpha-2 chain                              420   1e-142   Theobroma cacao [chocolate]
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         420   1e-142   Jatropha curcas
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    420   1e-142   Gossypium hirsutum [American cotton]
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                420   1e-142   Nelumbo nucifera [Indian lotus]
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     420   1e-142   Nelumbo nucifera [Indian lotus]
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     420   1e-142   Phoenix dactylifera
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          420   1e-142   Malus domestica [apple tree]
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     420   1e-142   Eucalyptus grandis [rose gum]
ref|XP_001764722.1|  predicted protein                                  420   1e-142   
ref|NP_001289660.1|  tubulin alpha chain-like                           420   1e-142   Eucalyptus grandis [rose gum]
gb|AID52921.1|  tubulin alpha chain                                     420   1e-142   Carthamus tinctorius
ref|XP_010093625.1|  Tubulin alpha chain                                420   1e-142   Morus notabilis
gb|AAV92352.1|  alpha tubulin 1                                         420   1e-142   Pseudotsuga menziesii var. menziesii
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          420   1e-142   Tarenaya hassleriana [spider flower]
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   420   1e-142   Fragaria vesca subsp. vesca
ref|XP_010099392.1|  Tubulin alpha chain                                420   1e-142   
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                420   1e-142   Prunus dulcis [sweet almond]
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                420   1e-142   Cicer arietinum [garbanzo]
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                420   1e-142   Pyrus x bretschneideri [bai li]
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                   420   1e-142   Nelumbo nucifera [Indian lotus]
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   420   1e-142   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     420   1e-142   Vitis vinifera
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             420   1e-142   Phaseolus vulgaris [French bean]
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                420   1e-142   Elaeis guineensis
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         420   1e-142   Jatropha curcas
ref|XP_003603670.1|  Tubulin alpha-7 chain                              420   2e-142   Medicago truncatula
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                419   2e-142   Tarenaya hassleriana [spider flower]
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                419   2e-142   Tarenaya hassleriana [spider flower]
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                419   2e-142   Elaeis guineensis
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                419   2e-142   Nelumbo nucifera [Indian lotus]
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             419   2e-142   Populus trichocarpa [western balsam poplar]
gb|AGG37283.1|  alpha-tubulin 1                                         419   2e-142   Salix arbutifolia
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             419   2e-142   Prunus persica
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               419   2e-142   Pisum sativum [garden pea]
sp|P33623.1|TBA1_ANEPH  RecName: Full=Tubulin alpha-1 chain             419   2e-142   Anemia phyllitidis
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        419   2e-142   Glycine max [soybeans]
gb|AHJ80823.1|  Tua1                                                    419   2e-142   Eragrostis tef [tef]
ref|XP_007042689.1|  Tubulin alpha-2 chain                              419   2e-142   Theobroma cacao [chocolate]
gb|AGG37285.1|  alpha-tubulin 3                                         419   2e-142   Salix arbutifolia
gb|AEQ75493.1|  alpha-tubulin                                           419   2e-142   Rosa multiflora [Japanese rose]
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   419   2e-142   Populus euphratica
ref|XP_004981922.1|  PREDICTED: tubulin alpha-1 chain-like              419   2e-142   Setaria italica
gb|AGG37289.1|  alpha-tubulin 7                                         419   2e-142   Salix arbutifolia
ref|XP_002517492.1|  tubulin alpha chain, putative                      419   2e-142   Ricinus communis
dbj|BAJ06362.1|  alpha-tubulin                                          419   2e-142   Alopecurus aequalis
ref|XP_003560377.1|  PREDICTED: tubulin alpha-1 chain                   419   2e-142   Brachypodium distachyon [annual false brome]
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     419   2e-142   Populus euphratica
gb|ABK92520.1|  unknown                                                 419   3e-142   Populus trichocarpa [western balsam poplar]
gb|KHN08201.1|  Tubulin alpha chain                                     419   3e-142   Glycine soja [wild soybean]
sp|O22347.1|TBA1_ELEIN  RecName: Full=Tubulin alpha-1 chain; AltN...    419   3e-142   Eleusine indica [crabgrass]
gb|AFC88832.1|  putative tubulin alpha-3 chain                          419   3e-142   Miscanthus sinensis
ref|XP_008621874.1|  tubulin alpha                                      412   3e-142   Saprolegnia diclina VS20
gb|ABO47742.1|  alpha-tubulin                                           419   3e-142   Gossypium hirsutum [American cotton]
gb|ABQ59633.1|  alpha-tubulin 3                                         419   3e-142   Populus tremuloides
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              419   3e-142   Populus euphratica
gb|AIX10773.1|  alpha tubulin                                           419   3e-142   Panax notoginseng [san-qi]
ref|NP_001167663.1|  tubulin alpha-3 chain                              419   3e-142   Zea mays [maize]
ref|XP_008665337.1|  PREDICTED: tubulin alpha-1 chain-like              419   3e-142   
ref|XP_008665339.1|  PREDICTED: tubulin alpha-2 chain                   419   3e-142   Zea mays [maize]
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                419   3e-142   Phoenix dactylifera
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             419   3e-142   Prunus persica
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain             419   3e-142   Hordeum vulgare [barley]
ref|XP_002466535.1|  hypothetical protein SORBIDRAFT_01g009570          419   3e-142   
tpg|DAA51109.1|  TPA: alpha tubulin                                     419   3e-142   
ref|XP_002324047.2|  hypothetical protein POPTR_0017s11740g             419   3e-142   
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        419   3e-142   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                419   3e-142   Fragaria vesca subsp. vesca
ref|XP_007223365.1|  hypothetical protein PRUPE_ppa005617mg             419   3e-142   Prunus persica
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like              419   4e-142   Oryza brachyantha
ref|XP_009409992.1|  PREDICTED: tubulin alpha chain-like                419   4e-142   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              419   4e-142   Fragaria vesca subsp. vesca
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    419   4e-142   Glycine max [soybeans]
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   419   4e-142   Malus domestica [apple tree]
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     419   4e-142   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAB36609.1|  alpha-tubulin                                           416   4e-142   Eucalyptus globulus subsp. bicostata
gb|KDO81348.1|  hypothetical protein CISIN_1g013037mg                   418   4e-142   Citrus sinensis [apfelsine]
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 419   4e-142   Populus trichocarpa [western balsam poplar]
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     418   4e-142   Glycine max [soybeans]
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    419   4e-142   
dbj|BAG99724.1|  unnamed protein product                                417   4e-142   Oryza sativa Japonica Group [Japonica rice]
gb|ABF98641.1|  Tubulin alpha-1 chain, putative, expressed              417   4e-142   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like              418   5e-142   Oryza brachyantha
ref|XP_002959708.1|  alpha tubulin                                      411   5e-142   Volvox carteri f. nagariensis
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   418   5e-142   Citrus sinensis [apfelsine]
gb|KEH43997.1|  tubulin beta-1 chain                                    418   5e-142   Medicago truncatula
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                418   5e-142   Cicer arietinum [garbanzo]
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g             418   5e-142   Phaseolus vulgaris [French bean]
ref|XP_006650524.1|  PREDICTED: tubulin alpha-1 chain-like              418   5e-142   Oryza brachyantha
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    418   5e-142   Gossypium hirsutum [American cotton]
ref|XP_007143142.1|  hypothetical protein PHAVU_007G047300g             418   6e-142   Phaseolus vulgaris [French bean]
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          418   6e-142   Citrus sinensis [apfelsine]
gb|KHN42598.1|  Tubulin alpha-2 chain                                   418   6e-142   Glycine soja [wild soybean]
gb|AAB08791.1|  alpha tubulin                                           418   6e-142   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like              418   7e-142   Glycine max [soybeans]
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    418   7e-142   Glycine max [soybeans]
gb|AAO73546.1|  alpha-tubulin                                           418   8e-142   Ceratopteris richardii
emb|CDO97305.1|  unnamed protein product                                418   8e-142   Coffea canephora [robusta coffee]
ref|XP_007515802.1|  alpha-tubulin                                      416   8e-142   Bathycoccus prasinos
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             418   8e-142   Selaginella moellendorffii
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                418   8e-142   Eucalyptus grandis [rose gum]
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain                418   8e-142   Triticum aestivum [Canadian hard winter wheat]
gb|ABD92930.1|  alpha tubulin-2A                                        418   9e-142   Triticum aestivum [Canadian hard winter wheat]
sp|Q96460.1|TBA2_HORVU  RecName: Full=Tubulin alpha-2 chain             417   9e-142   Hordeum vulgare [barley]
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     417   1e-141   Sesamum indicum [beniseed]
gb|ABQ59634.1|  alpha-tubulin 5                                         417   1e-141   Populus tremuloides
ref|XP_010557535.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    417   1e-141   Tarenaya hassleriana [spider flower]
emb|CAB66336.1|  alpha-tubulin                                          417   1e-141   Betula pendula [white birch]
dbj|BAC24800.1|  alpha tubulin                                          417   1e-141   Physcomitrella patens
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             417   2e-141   Eutrema salsugineum [saltwater cress]
gb|AGG37287.1|  alpha-tubulin 5                                         417   2e-141   Salix arbutifolia
gb|AHJ80817.1|  Tua1                                                    417   2e-141   Eragrostis tef [tef]
emb|CAA06619.1|  alpha-tubulin 1                                        417   2e-141   Eleusine indica [crabgrass]
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             417   2e-141   Capsella rubella
dbj|BAP59012.1|  alpha tubulin                                          417   2e-141   Taxus cuspidata [ichii]
gb|ABL61201.1|  alpha-tubulin                                           411   2e-141   Oxymonadida environmental sample
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g             417   2e-141   Populus trichocarpa [western balsam poplar]
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   417   2e-141   Vitis vinifera
ref|XP_007047652.1|  Tubulin alpha-2 chain                              419   2e-141   
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                417   2e-141   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like                417   2e-141   Populus euphratica
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    417   2e-141   Gossypium hirsutum [American cotton]
gb|ACU20294.1|  unknown                                                 412   2e-141   Glycine max [soybeans]
gb|AHJ80815.1|  Tua1                                                    417   2e-141   Eragrostis tef [tef]
emb|CDY29334.1|  BnaA05g16010D                                          416   2e-141   Brassica napus [oilseed rape]
gb|KHG20487.1|  Tubulin alpha chain                                     416   3e-141   Gossypium arboreum [tree cotton]
emb|CAA62916.1|  alpha-tubulin                                          416   3e-141   Oryza sativa Japonica Group [Japonica rice]
gb|ACK76232.1|  alpha-tubulin                                           416   3e-141   Dimocarpus longan [longan]
gb|AEW46684.1|  beta-tubulin                                            416   3e-141   Ulva linza
emb|CDY66630.1|  BnaCnng51680D                                          416   3e-141   Brassica napus [oilseed rape]
ref|NP_001051132.1|  Os03g0726100                                       416   3e-141   
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    416   3e-141   Arabis alpina [alpine rockcress]
gb|ABV55999.1|  alpha-tubulin 7                                         416   4e-141   Populus tremuloides
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             416   4e-141   Arabidopsis thaliana [mouse-ear cress]
emb|CAD20821.1|  alpha tubulin                                          409   4e-141   Zea mays [maize]
ref|NP_171974.1|  tubulin alpha-4 chain                                 416   5e-141   Arabidopsis thaliana [mouse-ear cress]
gb|AAO46127.1|  alpha-tubulin                                           408   5e-141   Streblomastix strix
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        416   5e-141   Camelina sativa [gold-of-pleasure]
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          416   5e-141   Arabidopsis thaliana [mouse-ear cress]
gb|ACU19580.1|  unknown                                                 416   5e-141   Glycine max [soybeans]
ref|XP_011398411.1|  Tubulin alpha chain                                414   5e-141   Auxenochlorella protothecoides
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              416   6e-141   
ref|NP_193232.1|  tubulin alpha-6 chain                                 416   6e-141   Arabidopsis thaliana [mouse-ear cress]
gb|AFK33477.1|  unknown                                                 412   6e-141   Lotus japonicus
gb|ABL61216.1|  alpha-tubulin                                           410   7e-141   Oxymonadida environmental sample
dbj|BAJ06364.1|  alpha-tubulin                                          415   7e-141   Alopecurus aequalis
gb|ABL61215.1|  alpha-tubulin                                           410   7e-141   Oxymonadida environmental sample
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    415   8e-141   Brassica rapa
gb|ABL61212.1|  alpha-tubulin                                           410   8e-141   Oxymonadida environmental sample
gb|ABR25510.1|  tubulin alpha-1 chain                                   408   8e-141   Oryza sativa Indica Group [Indian rice]
ref|XP_003558668.1|  PREDICTED: tubulin alpha-2 chain-like              415   8e-141   Brachypodium distachyon [annual false brome]
gb|KJB29387.1|  hypothetical protein B456_005G097800                    415   9e-141   Gossypium raimondii
gb|ABD92936.1|  alpha tubulin-4D                                        415   9e-141   Triticum aestivum [Canadian hard winter wheat]
gb|ABD92937.1|  alpha tubulin-4A                                        415   9e-141   Triticum aestivum [Canadian hard winter wheat]
gb|ABK92552.1|  unknown                                                 415   1e-140   Populus trichocarpa [western balsam poplar]
gb|EYU37544.1|  hypothetical protein MIMGU_mgv1a007145mg                413   1e-140   Erythranthe guttata [common monkey flower]
ref|XP_005851144.1|  alpha-tubulin                                      415   1e-140   Chlorella variabilis
gb|ETM52928.1|  tubulin alpha chain                                     413   1e-140   Phytophthora parasitica
ref|XP_001777110.1|  predicted protein                                  410   2e-140   
gb|KIZ01406.1|  Tubulin alpha-1 chain                                   414   2e-140   Monoraphidium neglectum
gb|ABL61224.1|  alpha-tubulin                                           409   2e-140   Oxymonadida environmental sample
ref|NP_001067613.1|  Os11g0247300                                       414   2e-140   
gb|ABL61219.1|  alpha-tubulin                                           409   2e-140   Oxymonadida environmental sample
gb|ABG78593.1|  alpha-tubulin                                           414   2e-140   Oryza sativa Japonica Group [Japonica rice]
gb|KDD76276.1|  tubulin/FtsZ GTPase                                     414   3e-140   Helicosporidium sp. ATCC 50920
emb|CAL35827.1|  alpha-2 tubulin                                        406   3e-140   Plantago major [cart-track plant]
ref|XP_005643073.1|  tubulin alpha chain                                414   3e-140   Coccomyxa subellipsoidea C-169
gb|ABL61202.1|  alpha-tubulin                                           408   3e-140   Oxymonadida environmental sample
gb|KIZ03400.1|  Tubulin alpha chain                                     414   3e-140   Monoraphidium neglectum
gb|ABL61217.1|  alpha-tubulin                                           409   3e-140   Oxymonadida environmental sample
gb|ABL61213.1|  alpha-tubulin                                           409   3e-140   Oxymonadida environmental sample
ref|XP_005651460.1|  tubulin alpha chain                                414   3e-140   Coccomyxa subellipsoidea C-169
gb|KHN01709.1|  Tubulin alpha chain                                     414   4e-140   Glycine soja [wild soybean]
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                   414   4e-140   Brassica rapa
gb|AAO46130.1|  alpha-tubulin                                           406   4e-140   Streblomastix strix
gb|ABL61203.1|  alpha-tubulin                                           408   4e-140   Oxymonadida environmental sample
ref|XP_002508010.1|  alpha tubulin 2                                    413   4e-140   Micromonas commoda
ref|XP_003524707.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    413   4e-140   Glycine max [soybeans]
gb|AAT09063.1|  alpha tubulin 1                                         413   4e-140   Bigelowiella natans
ref|XP_007155784.1|  hypothetical protein PHAVU_003G231500g             413   4e-140   Phaseolus vulgaris [French bean]
ref|XP_003080933.1|  TBA_CHLVU Tubulin alpha chain (ISS)                414   4e-140   
gb|ADJ00012.1|  tubulin alpha chain                                     405   5e-140   Chromera velia
emb|CDP12358.1|  unnamed protein product                                413   5e-140   Coffea canephora [robusta coffee]
ref|XP_010461854.1|  PREDICTED: tubulin alpha-6 chain-like              413   5e-140   Camelina sativa [gold-of-pleasure]
emb|CEG01594.1|  Tubulin/FtsZ, 2-layer sandwich domain                  413   5e-140   Ostreococcus tauri
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              413   5e-140   Camelina sativa [gold-of-pleasure]
gb|ABL61227.1|  alpha-tubulin                                           408   5e-140   Oxymonadida environmental sample
sp|P28287.1|TBA_OXYGR  RecName: Full=Tubulin alpha chain                413   6e-140   Oxytricha granulifera
ref|XP_001770881.1|  predicted protein                                  413   6e-140   
gb|AAO46128.1|  alpha-tubulin                                           405   6e-140   Streblomastix strix
emb|CDW82295.1|  alpha tubulin                                          413   6e-140   Stylonychia lemnae
gb|EJY81124.1|  Alpha tubulin,putative                                  413   6e-140   Oxytricha trifallax
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             413   6e-140   
ref|XP_001419217.1|  predicted protein                                  413   7e-140   Ostreococcus lucimarinus CCE9901
ref|XP_008384431.1|  PREDICTED: tubulin alpha-3 chain-like              406   7e-140   
gb|AAQ81585.1|  putative tubulin alpha-2/alpha-4 chain                  413   7e-140   Brassica napus [oilseed rape]
gb|ABL61214.1|  alpha-tubulin                                           407   8e-140   Oxymonadida environmental sample
gb|AHJ80816.1|  Tua1                                                    412   8e-140   Eragrostis tef [tef]
emb|CAA62917.1|  alfa-tubulin                                           412   8e-140   Oryza sativa Japonica Group [Japonica rice]
gb|ETW27380.1|  tubulin alpha chain                                     407   8e-140   Plasmodium falciparum FCH/4
ref|XP_003058621.1|  alpha tubulin                                      412   1e-139   Micromonas pusilla CCMP1545
gb|AIA82435.1|  alpha-tubulin-like protein 03                           412   1e-139   Stentor coeruleus
gb|ABL61226.1|  alpha-tubulin                                           407   1e-139   Oxymonadida environmental sample
gb|AIA82433.1|  alpha-tubulin-like protein 01                           412   1e-139   
emb|CDJ60085.1|  tubulin alpha chain, putative                          411   1e-139   
gb|ABO47737.1|  alpha-tubulin                                           412   1e-139   
ref|XP_006431130.1|  hypothetical protein CICLE_v10011709mg             412   1e-139   
emb|CAE52514.1|  alpha tubulin                                          412   1e-139   
sp|Q9FT36.1|TBA_DAUCA  RecName: Full=Tubulin alpha chain                412   1e-139   
ref|XP_004981594.1|  PREDICTED: tubulin alpha-3 chain-like              412   2e-139   
gb|ABL61204.1|  alpha-tubulin                                           406   2e-139   
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             412   2e-139   
gb|ABL61218.1|  alpha-tubulin                                           407   2e-139   
ref|XP_002951007.1|  alpha tubulin                                      412   2e-139   
gb|EPR58771.1|  alpha tubulin TUBA1                                     411   2e-139   
ref|XP_002980240.1|  hypothetical protein SELMODRAFT_419896             410   2e-139   
ref|XP_010104543.1|  Tubulin alpha chain                                412   2e-139   
gb|EWC76931.1|  tubulin alpha chain                                     406   3e-139   
sp|Q25563.1|TBA13_NAEGR  RecName: Full=Tubulin alpha-13 chain           411   3e-139   
gb|ETM30643.1|  tubulin alpha chain                                     411   3e-139   
tpg|DAA63280.1|  TPA: alpha tubulin6                                    406   3e-139   
gb|ABL61205.1|  alpha-tubulin                                           410   3e-139   
gb|AAT09064.1|  alpha tubulin 2                                         411   3e-139   
ref|XP_002675196.1|  alpha-tubulin                                      411   3e-139   
tpg|DAA41189.1|  TPA: alpha tubulin5                                    406   3e-139   
gb|KJB34154.1|  hypothetical protein B456_006G050600                    403   4e-139   
gb|AAO46126.1|  alpha-tubulin                                           404   4e-139   
gb|ABL61086.1|  alpha-tubulin                                           406   4e-139   
gb|ABU93324.1|  tubulin alpha subunit                                   411   4e-139   
gb|ABL61209.1|  alpha-tubulin                                           410   4e-139   
gb|ABL61208.1|  alpha-tubulin                                           410   4e-139   
ref|XP_007512064.1|  alpha-tubulin                                      411   4e-139   
gb|ABL61206.1|  alpha-tubulin                                           410   4e-139   
gb|ABP65323.1|  alpha tubulin                                           411   4e-139   
ref|XP_002904194.1|  alpha-tubulin                                      411   4e-139   
ref|XP_008872990.1|  tubulin alpha chain                                411   5e-139   
emb|CDJ53173.1|  tubulin alpha chain, putative                          411   5e-139   
gb|AHJ80821.1|  Tua3                                                    409   5e-139   
gb|ETM52951.1|  tubulin alpha chain                                     410   5e-139   
gb|AIA82436.1|  alpha-tubulin-like protein 04                           412   5e-139   
emb|CCI41153.1|  unnamed protein product                                411   5e-139   
ref|XP_008900864.1|  tubulin alpha chain                                411   5e-139   
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             410   5e-139   
gb|AFR42020.1|  alpha-tubulin                                           401   5e-139   
ref|XP_002904195.1|  alpha-tubulin, putative                            410   5e-139   
gb|ABL61210.1|  alpha-tubulin                                           410   5e-139   
gb|AFR42026.1|  alpha-tubulin                                           401   5e-139   
gb|ABU93323.1|  tubulin alpha subunit                                   410   6e-139   
dbj|BAH20267.1|  AT5G19780                                              404   6e-139   
emb|CDI81818.1|  tubulin alpha chain, putative                          410   6e-139   
ref|XP_002782100.1|  Tubulin alpha chain, putative                      405   6e-139   
ref|XP_009842456.1|  tubulin alpha chain                                410   6e-139   
gb|ADP08782.1|  alpha tubulin                                           410   7e-139   
gb|AAK37831.1|AF182309_1  alpha-tubulin                                 410   7e-139   
gb|KJB83378.1|  hypothetical protein B456_013G244600                    409   7e-139   
gb|AEF79970.1|  alpha-tubulin protein                                   410   7e-139   
ref|XP_010096739.1|  Tubulin alpha chain                                410   7e-139   
ref|XP_002364807.1|  tubulin alpha chain                                410   8e-139   
sp|P33625.1|TBA_EUGGR  RecName: Full=Tubulin alpha chain                410   8e-139   
gb|AAZ23863.1|  alpha-tubulin                                           410   8e-139   
gb|ABL61228.1|  alpha-tubulin                                           405   8e-139   
emb|CDJ42547.1|  tubulin alpha chain, putative                          410   8e-139   
gb|KHG14074.1|  Tubulin alpha-2 chain                                   408   8e-139   
emb|CDP00974.1|  unnamed protein product                                410   9e-139   
ref|XP_002963093.1|  hypothetical protein SELMODRAFT_404672             410   1e-138   
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058             410   1e-138   
ref|XP_001691876.1|  alpha tubulin 1                                    410   1e-138   
gb|KCW87067.1|  hypothetical protein EUGRSUZ_B03604                     407   1e-138   
gb|AEG74028.1|  alpha-tubulin                                           410   1e-138   
ref|XP_001777081.1|  predicted protein                                  410   1e-138   
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             410   1e-138   
gb|ACN40824.1|  unknown                                                 410   1e-138   
ref|XP_001782790.1|  predicted protein                                  410   1e-138   
emb|CCD11782.1|  unnamed protein product                                402   1e-138   
gb|AHJ80820.1|  Tua3                                                    407   1e-138   
gb|ETO82054.1|  tubulin alpha chain                                     409   1e-138   
ref|XP_009400845.1|  PREDICTED: tubulin alpha-3 chain                   409   1e-138   
ref|XP_008804327.1|  PREDICTED: tubulin alpha-1 chain-like              409   1e-138   
emb|CBH08958.1|  alpha tubulin, (fragment)                              404   2e-138   
ref|XP_009406530.1|  PREDICTED: tubulin alpha-3 chain-like              409   2e-138   
gb|ETM53018.1|  tubulin alpha chain                                     402   2e-138   
ref|XP_006858944.1|  hypothetical protein AMTR_s00068p00090790          409   2e-138   
ref|XP_009413318.1|  PREDICTED: tubulin alpha-3 chain-like              409   2e-138   
gb|AFR42035.1|  alpha-tubulin                                           399   2e-138   
ref|XP_010673470.1|  PREDICTED: tubulin alpha-3 chain                   409   2e-138   
gb|AAL73386.1|AF408404_1  alpha-tubulin                                 409   2e-138   
ref|XP_009537046.1|  hypothetical protein PHYSODRAFT_340566             404   2e-138   
gb|EYU23006.1|  hypothetical protein MIMGU_mgv1a006283mg                409   2e-138   
gb|EKF28172.1|  epsilon tubulin, putative                               401   2e-138   
gb|AAD11425.1|  alpha tubulin                                           406   3e-138   
ref|XP_002963092.1|  hypothetical protein SELMODRAFT_78469              409   3e-138   
ref|XP_006445597.1|  hypothetical protein CICLE_v10015224mg             409   3e-138   
ref|XP_002285721.1|  PREDICTED: tubulin alpha-3 chain                   409   3e-138   
ref|XP_009408459.1|  PREDICTED: tubulin alpha-3 chain-like              409   3e-138   
gb|ABU93321.1|  tubulin alpha subunit                                   409   3e-138   
gb|EKF29047.1|  epsilon tubulin, putative                               401   3e-138   
emb|CDP17586.1|  unnamed protein product                                409   3e-138   
gb|ETW61813.1|  tubulin alpha chain                                     406   3e-138   
gb|AAX63396.1|  alpha-tubulin                                           408   3e-138   
emb|CAL80740.1|  alpha-tubulin                                          409   3e-138   
emb|CAA61255.1|  alpha tubulin                                          409   3e-138   
gb|AHJ80822.1|  Tua1                                                    409   3e-138   
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             409   4e-138   
ref|XP_010695478.1|  PREDICTED: tubulin alpha-2 chain-like              408   4e-138   
gb|AAB86648.1|  alpha-tubulin                                           408   4e-138   
gb|AGY80453.1|  tubulin                                                 408   4e-138   
ref|XP_004958110.1|  PREDICTED: tubulin alpha-3 chain-like              408   4e-138   
emb|CAD26891.1|  alpha-tubulin                                          408   4e-138   
gb|ABD92942.1|  alpha tubulin-1D                                        408   5e-138   
gb|AAB86649.1|  alpha-tubulin                                           408   5e-138   
dbj|BAJ06363.1|  alpha-tubulin                                          408   5e-138   
sp|Q43473.1|TBA1_HORVU  RecName: Full=Tubulin alpha-1 chain             408   5e-138   
ref|XP_003562846.1|  PREDICTED: tubulin alpha-1 chain                   408   5e-138   
ref|XP_008223650.1|  PREDICTED: tubulin alpha-3 chain-like              408   5e-138   
gb|KHG06160.1|  Tubulin alpha-3/alpha-5 chain -like protein             408   5e-138   
gb|EPY33355.1|  tubulin alpha                                           403   5e-138   
ref|XP_008813089.1|  PREDICTED: tubulin alpha-3 chain                   408   5e-138   
gb|ETP23198.1|  tubulin alpha chain                                     405   5e-138   
ref|XP_008877307.1|  tubulin alpha chain                                405   5e-138   
ref|XP_010934670.1|  PREDICTED: tubulin alpha-3 chain-like              408   5e-138   
ref|XP_006657877.1|  PREDICTED: tubulin alpha-3 chain-like              408   6e-138   
gb|EUT86396.1|  tubulin alpha chain                                     406   6e-138   
ref|NP_001105588.1|  tubulin alpha-6 chain                              408   6e-138   
gb|ABB16994.1|  unknown                                                 409   6e-138   
gb|ETW45898.1|  tubulin alpha chain                                     407   6e-138   
ref|XP_007205189.1|  hypothetical protein PRUPE_ppa005642mg             408   6e-138   
ref|NP_001105324.1|  tubulin alpha-5 chain                              408   6e-138   
gb|AGD80034.1|  alpha-tubulin 1                                         408   6e-138   
gb|ETW20218.1|  tubulin alpha chain                                     406   6e-138   
dbj|BAJ98211.1|  predicted protein                                      408   6e-138   
emb|CAD24765.1|  alpha-tubulin                                          408   7e-138   
ref|XP_010257632.1|  PREDICTED: tubulin alpha-3 chain                   408   7e-138   
gb|EUR72656.1|  hypothetical protein PFBG_02365                         406   7e-138   
gb|AAU10519.1|  alpha tubulin                                           400   7e-138   
sp|O22349.1|TBA3_ELEIN  RecName: Full=Tubulin alpha-3 chain; AltN...    408   7e-138   
ref|NP_001060075.1|  Os07g0574800                                       408   7e-138   
ref|XP_010044940.1|  PREDICTED: tubulin alpha-3 chain                   408   7e-138   
gb|ABC97356.1|  alpha tubulin                                           407   7e-138   
ref|XP_001427643.1|  hypothetical protein                               400   7e-138   
ref|XP_002303998.1|  alpha-tubulin 2 family protein                     407   7e-138   
gb|AAO23139.1|  alpha tubulin                                           408   7e-138   
gb|KJB83375.1|  hypothetical protein B456_013G244600                    407   8e-138   
ref|XP_011025144.1|  PREDICTED: tubulin alpha-3 chain                   407   8e-138   
sp|Q08114.1|TBA_EUPOC  RecName: Full=Tubulin alpha chain                407   8e-138   
ref|XP_010923361.1|  PREDICTED: tubulin alpha-3 chain                   407   9e-138   
ref|XP_002532068.1|  tubulin alpha chain, putative                      407   9e-138   
ref|XP_006650667.1|  PREDICTED: tubulin alpha-2 chain-like              407   1e-137   
ref|XP_002980239.1|  hypothetical protein SELMODRAFT_233509             407   1e-137   
ref|XP_010112637.1|  Tubulin alpha-3 chain                              407   1e-137   
gb|AFR42036.1|  alpha-tubulin                                           397   1e-137   
gb|ETW56906.1|  tubulin alpha chain                                     406   1e-137   
gb|ABO47741.1|  alpha-tubulin                                           407   1e-137   
ref|XP_002904167.1|  cleavage induced tubulin alpha chain               402   1e-137   
gb|KCW87065.1|  hypothetical protein EUGRSUZ_B03604                     407   1e-137   
gb|AGG37284.1|  alpha-tubulin 2                                         407   1e-137   
ref|XP_009389058.1|  PREDICTED: tubulin alpha-3 chain-like              407   1e-137   
emb|CAD24768.1|  alpha-tubulin                                          407   1e-137   
gb|ABO47735.1|  alpha-tubulin                                           407   1e-137   
gb|ABL61230.1|  alpha-tubulin                                           406   1e-137   
ref|XP_002973792.1|  hypothetical protein SELMODRAFT_100162             407   2e-137   
ref|XP_009622332.1|  PREDICTED: tubulin alpha-3 chain                   407   2e-137   
gb|AFR42049.1|  alpha-tubulin                                           397   2e-137   
gb|KHG06861.1|  Tubulin alpha-6 chain                                   407   2e-137   
gb|ETW57405.1|  tubulin alpha chain                                     405   2e-137   
ref|XP_001420620.1|  predicted protein                                  406   2e-137   
sp|P33624.1|TBA2_ANEPH  RecName: Full=Tubulin alpha-2 chain             403   2e-137   
ref|XP_011089722.1|  PREDICTED: tubulin alpha-3 chain                   406   2e-137   
ref|XP_002779172.1|  Tubulin alpha chain, putative                      405   3e-137   
ref|XP_004149645.1|  PREDICTED: tubulin alpha-3 chain-like              406   3e-137   
gb|ETW30983.1|  tubulin alpha chain                                     408   3e-137   
ref|XP_008818311.1|  tubulin alpha chain                                406   3e-137   
ref|XP_010276368.1|  PREDICTED: tubulin alpha-3 chain-like              406   3e-137   
ref|XP_008464962.1|  PREDICTED: tubulin alpha-3 chain-like              406   3e-137   
ref|XP_004141134.1|  PREDICTED: tubulin alpha-3 chain-like              406   3e-137   
emb|CAA65330.1|  alpha-tubulin                                          406   3e-137   
gb|EUD70907.1|  tubulin alpha chain                                     406   3e-137   
emb|CCI45804.1|  unnamed protein product                                406   3e-137   
ref|XP_008449885.1|  PREDICTED: tubulin alpha-3 chain isoform X1        406   3e-137   
emb|CCA20146.1|  alpha tubulin 1 putative                               406   4e-137   
gb|KJB48791.1|  hypothetical protein B456_008G087400                    404   4e-137   
ref|XP_008349406.1|  PREDICTED: tubulin alpha-3 chain                   406   4e-137   
ref|XP_003082284.1|  TBA_CHLVU Tubulin alpha chain (ISS)                406   4e-137   
ref|XP_009375870.1|  PREDICTED: tubulin alpha-3 chain                   405   4e-137   
emb|CEF99848.1|  Tubulin/FtsZ, 2-layer sandwich domain                  405   4e-137   
gb|AFR42042.1|  alpha-tubulin                                           396   4e-137   
emb|CAD26887.1|  alpha-tubulin                                          405   4e-137   
ref|XP_008351479.1|  PREDICTED: tubulin alpha-3 chain                   405   4e-137   
gb|ABR67425.1|  alpha-tubulin 4                                         405   4e-137   
gb|ETW38327.1|  tubulin alpha chain                                     405   5e-137   
ref|XP_001351526.1|  alpha-tubulin ii                                   405   5e-137   
ref|XP_724313.1|  hypothetical protein                                  405   5e-137   
ref|XP_008625823.1|  tubulin alpha chain                                405   5e-137   
ref|XP_004295008.1|  PREDICTED: tubulin alpha-3 chain isoform X1        405   5e-137   
ref|XP_004221286.1|  tubulin alpha chain                                405   6e-137   
ref|XP_001615123.1|  tubulin alpha chain                                405   6e-137   
gb|AFR42054.1|  alpha-tubulin                                           395   6e-137   
ref|XP_001351911.1|  alpha tubulin                                      405   7e-137   
ref|XP_002297631.1|  alpha-tubulin 2 family protein                     405   7e-137   
gb|AGG37286.1|  alpha-tubulin 4                                         405   7e-137   
ref|XP_006286664.1|  hypothetical protein CARUB_v10002583mg             405   7e-137   
emb|CCW60849.1|  unnamed protein product                                403   7e-137   
gb|EYU31677.1|  hypothetical protein MIMGU_mgv1a006281mg                405   7e-137   
ref|XP_011048194.1|  PREDICTED: tubulin alpha-6 chain-like              405   7e-137   
gb|KHN06388.1|  Tubulin alpha-3 chain                                   404   8e-137   
emb|CAA65329.1|  alpha-tubulin                                          405   8e-137   
ref|XP_002258308.1|  alpha tubulin                                      405   9e-137   
ref|XP_001614576.1|  tubulin alpha chain                                405   9e-137   
emb|CAD26886.1|  alpha-tubulin                                          405   9e-137   
gb|EWM25815.1|  alpha tubulin 1                                         405   1e-136   
emb|CDR11405.1|  alpha tubulin 1, putative                              405   1e-136   
ref|XP_010531152.1|  PREDICTED: tubulin alpha-3 chain                   404   1e-136   
ref|XP_728879.1|  tubulin subunit alpha                                 405   1e-136   
gb|AAO63773.2|  alpha-tubulin 2                                         404   1e-136   
ref|XP_007014666.1|  Tubulin alpha-5                                    404   1e-136   
gb|AIC33057.1|  tubulin alpha-1 chain                                   404   2e-136   
emb|CAD24766.1|  alpha-tubulin                                          404   2e-136   
ref|XP_011075054.1|  PREDICTED: tubulin alpha-3 chain-like              404   2e-136   
ref|XP_009353129.1|  PREDICTED: tubulin alpha-3 chain-like              404   2e-136   
gb|ACJ04933.1|  alpha tubulin                                           396   2e-136   
emb|CAD24767.1|  alpha-tubulin                                          404   2e-136   
gb|ABL61207.1|  alpha-tubulin                                           403   2e-136   
ref|XP_010535933.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    404   2e-136   
ref|XP_002788269.1|  Tubulin alpha chain, putative                      404   2e-136   
emb|CDY42294.1|  BnaC02g09000D                                          404   2e-136   



>emb|CAJ38386.1| alpha tubulin [Plantago major]
Length=270

 Score =   424 bits (1091),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 200/203 (99%), Positives = 202/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  50   LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  109

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  110  EITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  169

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  170  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  229

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  230  GEGMEEGEFSEAREDLAALEKDY  252



>gb|AHM93474.1| alpha-tubulin, partial [Camellia chekiangoleosa]
Length=327

 Score =   426 bits (1094),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 200/203 (99%), Positives = 202/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  107  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  166

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  167  EITNSAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  226

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  227  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  286

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  287  GEGMEEGEFSEAREDLAALEKDY  309



>ref|XP_004252814.1| PREDICTED: tubulin alpha-2 chain-like [Solanum lycopersicum]
Length=227

 Score =   421 bits (1083),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 199/203 (98%), Positives = 201/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L +QVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  6    LTTQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  65

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  66   EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  125

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQ+AVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  126  GFKCGINYQPPTVVPGGDLAKVQKAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  185

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  186  GEGMEEGEFSEAREDLAALEKDY  208



>gb|KJB58759.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=340

 Score =   423 bits (1088),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  120  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  179

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  180  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  239

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  240  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  299

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  300  GEGMEEGEFSEAREDLAALEKDY  322



>gb|EPS62716.1| alpha-tubulin, partial [Genlisea aurea]
Length=404

 Score =   425 bits (1093),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 200/203 (99%), Positives = 202/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  184  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  243

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  244  EITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  303

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  304  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  363

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  364  GEGMEEGEFSEAREDLAALEKDY  386



>gb|AHJ80819.1| Tua1, partial [Eragrostis tef]
Length=243

 Score =   418 bits (1074),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  22   LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  81

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  82   EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  141

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  142  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  201

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  202  GEGMEEGEFSEAREDLAALEKDY  224



>ref|XP_009790136.1| PREDICTED: tubulin alpha chain [Nicotiana sylvestris]
Length=450

 Score =   426 bits (1094),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 202/203 (99%), Positives = 202/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD13176.1| alpha-tubulin [Nicotiana tabacum]
Length=450

 Score =   426 bits (1094),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 202/203 (99%), Positives = 202/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009620798.1| PREDICTED: tubulin alpha chain [Nicotiana tomentosiformis]
Length=450

 Score =   426 bits (1094),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 202/203 (99%), Positives = 202/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABB02631.1| unknown [Solanum tuberosum]
Length=450

 Score =   426 bits (1094),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 202/203 (99%), Positives = 202/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004238046.1| PREDICTED: tubulin alpha chain [Solanum lycopersicum]
Length=450

 Score =   426 bits (1094),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 202/203 (99%), Positives = 202/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABP65320.1| alpha tubulin [Capsicum annuum]
Length=450

 Score =   426 bits (1094),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 202/203 (99%), Positives = 202/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009614122.1| PREDICTED: tubulin alpha-3 chain [Nicotiana tomentosiformis]
 ref|XP_009787472.1| PREDICTED: tubulin alpha-3 chain [Nicotiana sylvestris]
 emb|CAD13177.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   425 bits (1093),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 202/203 (99%), Positives = 202/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009605705.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana tomentosiformis]
 ref|XP_009761158.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana sylvestris]
 emb|CAD13178.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   425 bits (1093),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 202/203 (99%), Positives = 202/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KJB32211.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=361

 Score =   422 bits (1084),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  141  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  200

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  201  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  260

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  261  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  320

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  321  GEGMEEGEFSEAREDLAALEKDY  343



>ref|XP_006362511.1| PREDICTED: tubulin alpha-1 chain-like [Solanum tuberosum]
Length=450

 Score =   425 bits (1093),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 202/203 (99%), Positives = 202/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004244533.1| PREDICTED: tubulin alpha-3 chain-like [Solanum lycopersicum]
Length=451

 Score =   425 bits (1093),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 202/203 (99%), Positives = 202/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006356798.1| PREDICTED: tubulin alpha chain-like [Solanum tuberosum]
Length=450

 Score =   425 bits (1092),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 202/203 (99%), Positives = 202/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AAW57310.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57311.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57313.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=267

 Score =   418 bits (1074),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  46   LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  105

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  106  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  165

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID+KFDLMY KRAFVHWYV
Sbjct  166  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDYKFDLMYAKRAFVHWYV  225

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  226  GEGMEEGEFSEAREDLAALEKDY  248



>gb|AAW57309.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=266

 Score =   418 bits (1074),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  45   LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  104

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  105  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  164

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID+KFDLMY KRAFVHWYV
Sbjct  165  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDYKFDLMYAKRAFVHWYV  224

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  225  GEGMEEGEFSEAREDLAALEKDY  247



>gb|AAW57305.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=306

 Score =   419 bits (1078),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  86   LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  145

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  146  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  205

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRA+CMISNSTSVAEVFSRID KFDLMYCKRAFVHWYV
Sbjct  206  GFKCGINYQPPTVVPGGDLAKVQRAICMISNSTSVAEVFSRIDFKFDLMYCKRAFVHWYV  265

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  266  GEGMEEGEFSEAREDLAALEKDY  288



>dbj|BAB19779.1| alpha tubulin [Nicotiana tabacum]
Length=450

 Score =   424 bits (1090),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 201/203 (99%), Positives = 201/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRA VHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRALVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>emb|CAA52158.1| alpha tubulin [Zea mays]
Length=256

 Score =   417 bits (1071),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  35   LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  94

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  95   EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  154

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  155  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  214

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDL ALEKDY
Sbjct  215  GEGMEEGEFSEAREDLRALEKDY  237



>ref|WP_039310890.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91192.1| hypothetical protein QW71_36085, partial [Paenibacillus sp. IHB 
B 3415]
Length=453

 Score =   424 bits (1090),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 200/203 (99%), Positives = 202/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  234  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  293

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  294  EITNSAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  353

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  354  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  413

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  414  GEGMEEGEFSEAREDLAALEKDY  436



>gb|ABC59068.2| alpha tubulin 1 [Camellia sinensis]
Length=450

 Score =   424 bits (1089),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 200/203 (99%), Positives = 202/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ACH68563.1| alpha-tubulin [Solanum tuberosum]
Length=449

 Score =   424 bits (1089),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 201/203 (99%), Positives = 201/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
             ISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  229  FISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  288

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  289  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  348

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  349  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  408

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  409  GEGMEEGEFSEAREDLAALEKDY  431



>gb|EYU34660.1| hypothetical protein MIMGU_mgv1a006269mg [Erythranthe guttata]
Length=450

 Score =   424 bits (1089),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 200/203 (99%), Positives = 202/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001291325.1| tubulin alpha chain-like [Sesamum indicum]
 gb|AFJ42573.1| alpha-tubulin [Sesamum indicum]
Length=450

 Score =   423 bits (1088),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 200/203 (99%), Positives = 202/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|EYU34085.1| hypothetical protein MIMGU_mgv1a0196712mg, partial [Erythranthe 
guttata]
Length=217

 Score =   414 bits (1065),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 195/199 (98%), Positives = 198/199 (99%), Gaps = 0/199 (0%)
 Frame = -3

Query  753  VISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITN  574
            VISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV+EITN
Sbjct  1    VISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSEITN  60

Query  573  SAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKC  394
            +AFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKC
Sbjct  61   TAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKC  120

Query  393  GINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGM  214
            GINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGM
Sbjct  121  GINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGM  180

Query  213  EEGEFSEAREDLAALEKDY  157
            EEGEFSEAREDLAALEKDY
Sbjct  181  EEGEFSEAREDLAALEKDY  199



>emb|CDP02221.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   423 bits (1088),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 200/203 (99%), Positives = 202/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KGN48654.1| hypothetical protein Csa_6G497050 [Cucumis sativus]
Length=415

 Score =   422 bits (1085),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 199/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  195  LISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  254

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  255  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  314

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  315  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  374

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  375  GEGMEEGEFSEAREDLAALEKDY  397



>ref|NP_001275271.1| alpha-tubulin-like protein [Solanum tuberosum]
 gb|ABB72803.1| alpha-tubulin-like protein [Solanum tuberosum]
Length=452

 Score =   423 bits (1088),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 201/203 (99%), Positives = 201/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLT SLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  231  LISQVISSLTTSLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  290

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  291  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  350

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  351  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  410

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  411  GEGMEEGEFSEAREDLAALEKDY  433



>ref|XP_011098608.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   423 bits (1088),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 200/203 (99%), Positives = 202/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004232226.1| PREDICTED: tubulin alpha chain-like [Solanum lycopersicum]
 ref|XP_006338460.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Solanum tuberosum]
Length=450

 Score =   423 bits (1087),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 200/203 (99%), Positives = 202/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KJB58756.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=415

 Score =   421 bits (1083),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  195  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  254

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  255  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  314

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  315  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  374

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  375  GEGMEEGEFSEAREDLAALEKDY  397



>ref|XP_009626810.1| PREDICTED: tubulin alpha chain-like [Nicotiana tomentosiformis]
 ref|XP_009785294.1| PREDICTED: tubulin alpha chain-like [Nicotiana sylvestris]
Length=450

 Score =   422 bits (1086),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 200/203 (99%), Positives = 202/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KDO81349.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=355

 Score =   419 bits (1077),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVA
Sbjct  134  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVA  193

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  194  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  253

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  254  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  313

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  314  GEGMEEGEFSEAREDLAALEKDY  336



>emb|CAB76917.1| alpha-tubulin 4 [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   416 bits (1070),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLT SLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV+
Sbjct  68   LVSQVISSLTTSLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVS  127

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  128  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  187

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  188  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  247

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  248  GEGMEEGEFSEAREDLAALEKDY  270



>dbj|BAH19954.1| AT1G50010 [Arabidopsis thaliana]
Length=248

 Score =   415 bits (1066),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVA
Sbjct  28   LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVA  87

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  88   EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  147

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  148  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  207

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  208  GEGMEEGEFSEAREDLAALEKDY  230



>gb|AAW57306.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57308.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=257

 Score =   414 bits (1065),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  36   LISQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  95

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACC+M+RGDVVPKDVNA+VATIKTKRTIQFVDWCPT
Sbjct  96   EITNSAFEPASMMAKCDPRHGKYMACCMMYRGDVVPKDVNASVATIKTKRTIQFVDWCPT  155

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS+AEVFSR+DHKFDLMY KRAFVHWYV
Sbjct  156  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSIAEVFSRLDHKFDLMYAKRAFVHWYV  215

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKD+
Sbjct  216  GEGMEEGEFSEAREDLAALEKDF  238



>gb|ADW83724.1| alpha-tubulin [Musa acuminata AAA Group]
Length=423

 Score =   420 bits (1080),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  202  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  261

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  262  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  321

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  322  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  381

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  382  GEGMEEGEFSEAREDLAALEKDY  404



>gb|AFW67749.1| alpha tubulin4 [Zea mays]
Length=321

 Score =   416 bits (1070),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  100  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  159

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  160  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  219

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  220  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  279

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  280  GEGMEEGEFSEAREDLAALEKDY  302



>gb|AAX96763.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|ABA92354.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
Length=346

 Score =   417 bits (1072),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  125  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  184

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  185  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  244

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRID KFDLMY KRAFVHWYV
Sbjct  245  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDIKFDLMYSKRAFVHWYV  304

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  305  GEGMEEGEFSEAREDLAALEKDY  327



>ref|XP_004150268.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004156870.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_008454421.1| PREDICTED: tubulin alpha chain [Cucumis melo]
 gb|ADN33817.1| tubulin alpha chain [Cucumis melo subsp. melo]
 gb|KGN52737.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   421 bits (1081),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 201/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLA+VQRAVC ISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLARVQRAVCKISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008455054.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Cucumis melo]
Length=451

 Score =   421 bits (1081),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 199/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KDO49533.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=431

 Score =   420 bits (1079),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  211  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  270

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  271  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  330

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  331  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  390

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  391  GEGMEEGEFSEAREDLAALEKDY  413



>ref|XP_003608582.1| Tubulin alpha-5 chain [Medicago truncatula]
 gb|AES90779.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   420 bits (1080),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004143417.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004160931.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
Length=450

 Score =   420 bits (1080),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 199/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AFW67748.1| alpha tubulin4 [Zea mays]
Length=364

 Score =   417 bits (1072),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  143  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  202

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  203  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  262

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  263  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  322

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  323  GEGMEEGEFSEAREDLAALEKDY  345



>ref|XP_004136930.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 ref|XP_004155416.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 gb|KGN43837.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   420 bits (1080),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 199/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008440459.1| PREDICTED: tubulin alpha chain-like isoform X1 [Cucumis melo]
Length=450

 Score =   420 bits (1080),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 199/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KHG18997.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB32210.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=450

 Score =   420 bits (1080),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47740.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89777.1| alpha-tubulin 10 [Gossypium hirsutum]
 gb|KHG24734.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB58758.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=450

 Score =   420 bits (1080),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47736.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89778.1| alpha-tubulin 6 [Gossypium hirsutum]
Length=450

 Score =   420 bits (1080),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007032501.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY03427.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   420 bits (1080),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AIX10966.1| tubulin [Ornithogalum saundersiae]
Length=451

 Score =   420 bits (1080),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score =   420 bits (1080),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ACJ60905.1| alpha tubulin [Betula pendula]
Length=450

 Score =   420 bits (1080),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47739.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG18532.1| Tubulin alpha-2 chain [Gossypium arboreum]
Length=450

 Score =   420 bits (1080),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011457777.1| PREDICTED: tubulin alpha chain [Fragaria vesca subsp. vesca]
Length=450

 Score =   420 bits (1080),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009335354.1| PREDICTED: tubulin alpha chain [Pyrus x bretschneideri]
Length=450

 Score =   420 bits (1080),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007199840.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
 ref|XP_008236252.1| PREDICTED: tubulin alpha chain isoform X1 [Prunus mume]
 gb|EMJ01039.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
Length=450

 Score =   420 bits (1080),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>emb|CAN62392.1| hypothetical protein VITISV_016172 [Vitis vinifera]
Length=435

 Score =   419 bits (1078),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  215  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  274

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  275  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  334

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  335  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  394

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  395  GEGMEEGEFSEAREDLAALEKDY  417



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010943272.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   420 bits (1080),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score =   420 bits (1080),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KIY91712.1| Tubulin alpha chain [Monoraphidium neglectum]
Length=249

 Score =   412 bits (1060),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L++QVISSLT SLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  28   LVAQVISSLTTSLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  87

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNA+VATIKTKRTIQFVDWCPT
Sbjct  88   EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNASVATIKTKRTIQFVDWCPT  147

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST+VAEVFSR+DHKFDLMY KRAFVHWYV
Sbjct  148  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAVAEVFSRLDHKFDLMYAKRAFVHWYV  207

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  208  GEGMEEGEFSEAREDLAALEKDY  230



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score =   420 bits (1080),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006433708.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
 gb|ESR46948.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
Length=218

 Score =   411 bits (1057),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 194/199 (97%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = -3

Query  753  VISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITN  574
            VISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITN
Sbjct  1    VISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITN  60

Query  573  SAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKC  394
            SAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKC
Sbjct  61   SAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKC  120

Query  393  GINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGM  214
            GINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGM
Sbjct  121  GINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGM  180

Query  213  EEGEFSEAREDLAALEKDY  157
            EEGEFSEAREDLAALEKDY
Sbjct  181  EEGEFSEAREDLAALEKDY  199



>ref|XP_008804464.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=450

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ACN40181.1| unknown [Picea sitchensis]
 gb|ACN40840.1| unknown [Picea sitchensis]
Length=450

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002283198.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
 ref|XP_006827169.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
 ref|XP_010939541.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
 gb|ERM94406.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
Length=450

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003635553.2| PREDICTED: tubulin alpha chain-like [Vitis vinifera]
Length=451

 Score =   420 bits (1080),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002981542.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
 gb|EFJ17357.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
Length=449

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006426173.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
 gb|ESR39413.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
Length=451

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007018369.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY15594.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=451

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYTKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010245599.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=451

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010266793.1| PREDICTED: tubulin alpha chain [Nelumbo nucifera]
Length=451

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008787237.1| PREDICTED: tubulin alpha chain [Phoenix dactylifera]
 ref|XP_010941981.1| PREDICTED: tubulin alpha chain [Elaeis guineensis]
Length=451

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008372961.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
Length=450

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010065856.1| PREDICTED: tubulin alpha chain [Eucalyptus grandis]
 gb|KCW63554.1| hypothetical protein EUGRSUZ_G01186 [Eucalyptus grandis]
Length=450

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_001764722.1| predicted protein [Physcomitrella patens]
 gb|EDQ70421.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001289660.1| tubulin alpha chain-like [Eucalyptus grandis]
 gb|ABS50670.1| alpha-tubulin [Eucalyptus grandis]
Length=451

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AID52921.1| tubulin alpha chain [Carthamus tinctorius]
Length=450

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010093625.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB54386.1| Tubulin alpha chain [Morus notabilis]
Length=451

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010531321.1| PREDICTED: tubulin alpha chain isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004288297.1| PREDICTED: tubulin alpha-3 chain [Fragaria vesca subsp. vesca]
Length=451

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010099392.1| Tubulin alpha chain [Morus notabilis]
 ref|XP_010105098.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB78237.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC03883.1| Tubulin alpha chain [Morus notabilis]
Length=467

 Score =   420 bits (1080),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  246  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  305

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  306  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  365

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  366  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  425

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  426  GEGMEEGEFSEAREDLAALEKDY  448



>sp|P33629.1|TBA_PRUDU RecName: Full=Tubulin alpha chain [Prunus dulcis]
 emb|CAA47635.1| alpha-tubulin [Prunus dulcis]
Length=450

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004501073.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=451

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009335355.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
Length=450

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010242419.1| PREDICTED: tubulin alpha-1 chain [Nelumbo nucifera]
Length=451

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010680774.1| PREDICTED: tubulin alpha-2 chain [Beta vulgaris subsp. vulgaris]
Length=451

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EIT SAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITTSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002275973.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
Length=450

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007137281.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
 gb|ESW09275.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
Length=451

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010939312.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KDP41548.1| hypothetical protein JCGZ_15955 [Jatropha curcas]
Length=451

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003603670.1| Tubulin alpha-7 chain [Medicago truncatula]
 gb|AES73921.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   420 bits (1079),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010555432.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   419 bits (1078),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010526692.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   419 bits (1078),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010936237.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   419 bits (1078),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010256937.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=450

 Score =   419 bits (1078),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002301128.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
 ref|XP_011017025.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017026.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017027.1| PREDICTED: tubulin alpha chain-like isoform X2 [Populus euphratica]
 gb|AAO63781.1| alpha-tubulin 1 [Populus tremuloides]
 gb|ABK96001.1| unknown [Populus trichocarpa]
 gb|EEE80401.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
Length=451

 Score =   419 bits (1078),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37283.1| alpha-tubulin 1 [Salix arbutifolia]
Length=451

 Score =   419 bits (1078),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007205183.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
 ref|XP_008236958.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 gb|EMJ06382.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
Length=451

 Score =   419 bits (1078),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>sp|P46259.1|TBA1_PEA RecName: Full=Tubulin alpha-1 chain [Pisum sativum]
 gb|AAA79910.1| alpha-tubulin [Pisum sativum]
Length=452

 Score =   419 bits (1078),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>sp|P33623.1|TBA1_ANEPH RecName: Full=Tubulin alpha-1 chain [Anemia phyllitidis]
 emb|CAA48927.1| alpha tubulin [Anemia phyllitidis]
Length=451

 Score =   419 bits (1078),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003522731.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Glycine max]
Length=452

 Score =   419 bits (1078),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AHJ80823.1| Tua1 [Eragrostis tef]
Length=451

 Score =   419 bits (1078),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007042689.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX98520.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   419 bits (1078),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score =   419 bits (1078),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AEQ75493.1| alpha-tubulin [Rosa multiflora]
Length=440

 Score =   419 bits (1077),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  219  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  278

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  279  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  338

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  339  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  398

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  399  GEGMEEGEFSEAREDLAALEKDY  421



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score =   419 bits (1078),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004981922.1| PREDICTED: tubulin alpha-1 chain-like [Setaria italica]
 emb|CAE52515.1| alpha tubulin [Setaria viridis]
Length=451

 Score =   419 bits (1078),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37289.1| alpha-tubulin 7 [Salix arbutifolia]
Length=450

 Score =   419 bits (1077),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            E+TNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EVTNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002517492.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF45034.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   419 bits (1077),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV+
Sbjct  230  LISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVS  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAJ06362.1| alpha-tubulin [Alopecurus aequalis]
Length=451

 Score =   419 bits (1077),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003560377.1| PREDICTED: tubulin alpha-1 chain [Brachypodium distachyon]
Length=451

 Score =   419 bits (1077),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011008936.1| PREDICTED: tubulin alpha chain [Populus euphratica]
Length=451

 Score =   419 bits (1077),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            E+TNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EVTNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABK92520.1| unknown [Populus trichocarpa]
Length=451

 Score =   419 bits (1077),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KHN08201.1| Tubulin alpha chain [Glycine soja]
Length=457

 Score =   419 bits (1078),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  235  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  294

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  295  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  354

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  355  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  414

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  415  GEGMEEGEFSEAREDLAALEKDY  437



>sp|O22347.1|TBA1_ELEIN RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Eleusine indica]
 gb|AAC05717.1| alpha tubulin 1 [Eleusine indica]
 emb|CAA06618.1| alpha-tubulin 1 [Eleusine indica]
 gb|AFC88823.1| putative tubulin alpha-1 chain [Miscanthus sinensis]
 gb|AFC88833.1| tubulin alpha-1 chain [Miscanthus sinensis]
Length=451

 Score =   419 bits (1077),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AFC88832.1| putative tubulin alpha-3 chain [Miscanthus sinensis]
Length=451

 Score =   419 bits (1077),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008621874.1| tubulin alpha, partial [Saprolegnia diclina VS20]
 gb|EQC24696.1| tubulin alpha, partial [Saprolegnia diclina VS20]
Length=273

 Score =   412 bits (1060),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LI+QVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  50   LIAQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  109

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMA CLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  110  EITNSAFEPASMMAKCDPRHGKYMAACLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  169

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLA+VQRAVCMISN++++AEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  170  GFKCGINYQPPTVVPGGDLARVQRAVCMISNTSAIAEVFSRIDHKFDLMYAKRAFVHWYV  229

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  230  GEGMEEGEFSEAREDLAALEKDY  252



>gb|ABO47742.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG08879.1| Tubulin alpha-1 chain [Gossypium arboreum]
 gb|KJB11380.1| hypothetical protein B456_001G255600 [Gossypium raimondii]
Length=450

 Score =   419 bits (1077),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 201/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EIT+SAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITSSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABQ59633.1| alpha-tubulin 3 [Populus tremuloides]
Length=451

 Score =   419 bits (1077),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011014531.1| PREDICTED: tubulin alpha-4 chain-like [Populus euphratica]
Length=451

 Score =   419 bits (1077),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AIX10773.1| alpha tubulin [Panax notoginseng]
Length=451

 Score =   419 bits (1077),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001167663.1| tubulin alpha-3 chain [Zea mays]
 gb|ACG26907.1| tubulin alpha-3 chain [Zea mays]
 gb|AFW67746.1| alpha tubulin4 isoform 1 [Zea mays]
 gb|AFW67747.1| alpha tubulin4 isoform 2 [Zea mays]
Length=451

 Score =   419 bits (1077),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008665337.1| PREDICTED: tubulin alpha-1 chain-like [Zea mays]
 sp|P14640.1|TBA1_MAIZE RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Zea mays]
 emb|CAA33734.1| alpha1-tubulin [Zea mays]
 tpg|DAA51112.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51113.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51114.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51117.1| TPA: tubulin alpha-1 chain [Zea mays]
Length=451

 Score =   419 bits (1077),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008665339.1| PREDICTED: tubulin alpha-2 chain [Zea mays]
 sp|P14641.1|TBA2_MAIZE RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Zea mays]
 emb|CAA33733.1| alpha2-tubulin [Zea mays]
 tpg|DAA51111.1| TPA: tubulin alpha-2 chain [Zea mays]
Length=451

 Score =   419 bits (1077),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008787760.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=451

 Score =   419 bits (1076),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV+
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVS  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007215369.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
 ref|XP_008230754.1| PREDICTED: tubulin alpha chain-like [Prunus mume]
 gb|EMJ16568.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
Length=450

 Score =   419 bits (1076),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>sp|Q9ZRR5.1|TBA3_HORVU RecName: Full=Tubulin alpha-3 chain [Hordeum vulgare]
 emb|CAA10663.1| alpha-tubulin 3 [Hordeum vulgare subsp. vulgare]
 gb|ABD92933.1| alpha tubulin-3B [Triticum aestivum]
 gb|ABD92934.1| alpha tubulin-3A [Triticum aestivum]
 gb|ABD92935.1| alpha tubulin-3D [Triticum aestivum]
 dbj|BAJ87680.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS48260.1| Tubulin alpha-3 chain [Triticum urartu]
 gb|EMT18537.1| Tubulin alpha-3 chain [Aegilops tauschii]
Length=451

 Score =   419 bits (1076),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002466535.1| hypothetical protein SORBIDRAFT_01g009570 [Sorghum bicolor]
 gb|EER93533.1| hypothetical protein SORBIDRAFT_01g009570 [Sorghum bicolor]
 gb|ACX70682.1| tubulin alpha-2-like protein [Sorghum bicolor]
Length=452

 Score =   419 bits (1076),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  231  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  290

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  291  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  350

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  351  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  410

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  411  GEGMEEGEFSEAREDLAALEKDY  433



>tpg|DAA51109.1| TPA: alpha tubulin [Zea mays]
Length=452

 Score =   419 bits (1076),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  231  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  290

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  291  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  350

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  351  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  410

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  411  GEGMEEGEFSEAREDLAALEKDY  433



>ref|XP_002324047.2| hypothetical protein POPTR_0017s11740g [Populus trichocarpa]
 gb|EEF04180.2| hypothetical protein POPTR_0017s11740g [Populus trichocarpa]
Length=454

 Score =   419 bits (1076),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  233  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  292

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            E+TNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  293  EVTNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  352

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  353  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  412

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  413  GEGMEEGEFSEAREDLAALEKDY  435



>ref|XP_009388502.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=451

 Score =   419 bits (1076),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004299843.1| PREDICTED: tubulin alpha chain-like [Fragaria vesca subsp. vesca]
 gb|AAK81858.1|AF394915_1 alpha tubulin subunit [Rosa hybrid cultivar]
Length=451

 Score =   419 bits (1076),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007223365.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
 ref|XP_008219156.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 ref|XP_008347836.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_008352750.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_009357230.1| PREDICTED: tubulin alpha chain-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009335481.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
 gb|EMJ24564.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
Length=451

 Score =   419 bits (1076),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006650518.1| PREDICTED: tubulin alpha-1 chain-like [Oryza brachyantha]
Length=451

 Score =   419 bits (1076),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP++VPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSIVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009409992.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=451

 Score =   419 bits (1076),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVA+VFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVADVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004304311.1| PREDICTED: tubulin alpha-2 chain-like [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   419 bits (1076),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003556001.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
 gb|KHN01573.1| Tubulin alpha-4 chain [Glycine soja]
Length=449

 Score =   419 bits (1076),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008379344.1| PREDICTED: tubulin alpha-2 chain [Malus domestica]
Length=450

 Score =   419 bits (1076),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009402887.1| PREDICTED: tubulin alpha chain [Musa acuminata subsp. malaccensis]
Length=451

 Score =   419 bits (1076),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AAB36609.1| alpha-tubulin, partial [Eucalyptus globulus subsp. bicostata]
Length=380

 Score =   416 bits (1069),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  160  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  219

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            E TNSAFEPSS+M KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  220  ETTNSAFEPSSLMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  279

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST +AEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  280  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTRLAEVFSRIDHKFDLMYAKRAFVHWYV  339

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  340  GEGMEEGEFSEAREDLAALEKDY  362



>gb|KDO81348.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=447

 Score =   418 bits (1075),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVA
Sbjct  226  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVA  285

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  286  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  345

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  346  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  405

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  406  GEGMEEGEFSEAREDLAALEKDY  428



>ref|XP_002298794.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
 gb|EEE83599.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
Length=451

 Score =   419 bits (1076),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003536570.1| PREDICTED: tubulin alpha chain-like isoform X1 [Glycine max]
 gb|KHN23177.1| Tubulin alpha chain [Glycine soja]
Length=449

 Score =   418 bits (1075),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006581474.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
Length=452

 Score =   419 bits (1076),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLA+VQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLARVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAG99724.1| unnamed protein product [Oryza sativa Japonica Group]
Length=417

 Score =   417 bits (1072),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  195  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  254

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  255  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  314

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVP GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  315  GFKCGINYQPPSVVPSGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYSKRAFVHWYV  374

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  375  GEGMEEGEFSEAREDLAALEKDY  397



>gb|ABF98641.1| Tubulin alpha-1 chain, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG95437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99628.1| unnamed protein product [Oryza sativa Japonica Group]
Length=416

 Score =   417 bits (1072),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  195  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  254

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  255  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  314

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVP GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  315  GFKCGINYQPPSVVPSGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYSKRAFVHWYV  374

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  375  GEGMEEGEFSEAREDLAALEKDY  397



>ref|XP_006662856.1| PREDICTED: tubulin alpha-3 chain-like [Oryza brachyantha]
Length=451

 Score =   418 bits (1075),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002959708.1| alpha tubulin [Volvox carteri f. nagariensis]
 gb|EFJ39226.1| alpha tubulin [Volvox carteri f. nagariensis]
Length=255

 Score =   411 bits (1056),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 190/203 (94%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LI+QVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAP+ISAEKAYHEQLSVA
Sbjct  34   LIAQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPIISAEKAYHEQLSVA  93

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITN+AFEP+SMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  94   EITNAAFEPASMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  153

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST++ E+FSR+DHKFDLMY KRAFVHWYV
Sbjct  154  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIGEIFSRLDHKFDLMYAKRAFVHWYV  213

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKD+
Sbjct  214  GEGMEEGEFSEAREDLAALEKDF  236



>gb|KDO81347.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=451

 Score =   418 bits (1075),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KEH43997.1| tubulin beta-1 chain [Medicago truncatula]
Length=450

 Score =   418 bits (1075),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004496862.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=450

 Score =   418 bits (1075),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007156677.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
 gb|ESW28671.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
Length=451

 Score =   418 bits (1075),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFV+WCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVEWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006650524.1| PREDICTED: tubulin alpha-1 chain-like [Oryza brachyantha]
Length=451

 Score =   418 bits (1075),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP++VPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSIVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>sp|Q6VAG0.1|TBA2_GOSHI RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Gossypium hirsutum]
 gb|AAQ92662.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|ACM89776.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|KJB77616.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
 gb|KJB77617.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
Length=450

 Score =   418 bits (1075),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVA+IKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVASIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAF+HWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFIHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007143142.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
 gb|ESW15136.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
Length=449

 Score =   418 bits (1075),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006472372.1| PREDICTED: tubulin alpha chain isoform X1 [Citrus sinensis]
Length=451

 Score =   418 bits (1075),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KHN42598.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   418 bits (1075),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVA IKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVAIIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AAB08791.1| alpha tubulin [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   418 bits (1075),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPGVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003539228.1| PREDICTED: tubulin alpha-2 chain-like [Glycine max]
 gb|KHN13032.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   418 bits (1074),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVA IKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVAIIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003517369.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Glycine max]
Length=451

 Score =   418 bits (1074),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVA IKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVAIIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AAO73546.1| alpha-tubulin [Ceratopteris richardii]
 gb|AAW57307.1| alpha-tubulin [Ceratopteris richardii]
Length=450

 Score =   418 bits (1074),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRA+CMISNSTSVAEVFSRID KFDLMYCKRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAICMISNSTSVAEVFSRIDFKFDLMYCKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>emb|CDO97305.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   418 bits (1074),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDG+LNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGSLNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDL+ VQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLSGVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007515802.1| alpha-tubulin [Bathycoccus prasinos]
 emb|CCO14681.1| alpha-tubulin [Bathycoccus prasinos]
Length=415

 Score =   416 bits (1070),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LI+QVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  195  LIAQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  254

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVA+IKTKRTIQFVDWCPT
Sbjct  255  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVASIKTKRTIQFVDWCPT  314

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYV
Sbjct  315  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYV  374

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  375  GEGMEEGEFSEAREDLAALEKDY  397



>ref|XP_002964078.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
 ref|XP_002975442.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ23643.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ34411.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
Length=451

 Score =   418 bits (1074),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITN+AFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNTAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010060142.1| PREDICTED: tubulin alpha chain-like [Eucalyptus grandis]
 gb|KCW66706.1| hypothetical protein EUGRSUZ_F00470 [Eucalyptus grandis]
Length=451

 Score =   418 bits (1074),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAHHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>sp|Q9ZRB7.1|TBA_WHEAT RecName: Full=Tubulin alpha chain [Triticum aestivum]
 gb|AAD10486.1| alpha-tubulin [Triticum aestivum]
Length=451

 Score =   418 bits (1074),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPGVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABD92930.1| alpha tubulin-2A [Triticum aestivum]
 gb|ABD92931.1| alpha tubulin-2D [Triticum aestivum]
 gb|ABD92932.1| alpha tubulin-2B [Triticum aestivum]
 gb|EMS59370.1| Tubulin alpha chain [Triticum urartu]
 gb|EMT25007.1| Tubulin alpha chain [Aegilops tauschii]
Length=451

 Score =   418 bits (1074),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPGVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>sp|Q96460.1|TBA2_HORVU RecName: Full=Tubulin alpha-2 chain [Hordeum vulgare]
 emb|CAA69724.1| alpha-tubulin 2 [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   417 bits (1073),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPGVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011088040.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   417 bits (1073),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAP ISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPAISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLA+VQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLARVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABQ59634.1| alpha-tubulin 5 [Populus tremuloides]
Length=451

 Score =   417 bits (1073),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDSKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010557535.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   417 bits (1073),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 201/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV+TIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVSTIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID+KFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDYKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>emb|CAB66336.1| alpha-tubulin [Betula pendula]
 gb|AJA29683.1| tubulin alpha chain [Betula luminifera]
Length=451

 Score =   417 bits (1072),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID+KFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDNKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAC24800.1| alpha tubulin [Physcomitrella patens]
Length=451

 Score =   417 bits (1072),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKF LMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFGLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006404742.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
 gb|ESQ46195.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
Length=451

 Score =   417 bits (1072),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLT SLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTTSLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITN+AFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNTAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37287.1| alpha-tubulin 5 [Salix arbutifolia]
Length=451

 Score =   417 bits (1072),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDTKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AHJ80817.1| Tua1 [Eragrostis tef]
Length=451

 Score =   417 bits (1072),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQ NLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVNEFQANLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>emb|CAA06619.1| alpha-tubulin 1 [Eleusine indica]
Length=451

 Score =   417 bits (1072),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSL ASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLIASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006307493.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
 ref|XP_010418156.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 ref|XP_010430201.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Camelina sativa]
 ref|XP_010430202.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
 ref|XP_010473400.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 gb|EOA40391.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
Length=450

 Score =   417 bits (1071),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAP59012.1| alpha tubulin [Taxus cuspidata]
Length=451

 Score =   417 bits (1071),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDRKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61201.1| alpha-tubulin [Oxymonadida environmental sample]
Length=299

 Score =   411 bits (1057),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 190/203 (94%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LI+QVISSLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  78   LIAQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  137

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNS+FEP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  138  EITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  197

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYV
Sbjct  198  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYV  257

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  258  GEGMEEGEFSEAREDLAALEKDY  280



>ref|XP_002313194.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
 gb|EEE87149.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
Length=451

 Score =   417 bits (1071),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDSKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010664458.1| PREDICTED: tubulin alpha-4 chain [Vitis vinifera]
 emb|CAN77412.1| hypothetical protein VITISV_000470 [Vitis vinifera]
Length=451

 Score =   417 bits (1071),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID+KFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDNKFDLMYSKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007047652.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX91809.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=501

 Score =   419 bits (1076),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  280  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  339

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNS FEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  340  EITNSTFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  399

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  400  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  459

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  460  GEGMEEGEFSEAREDLAALEKDY  482



>ref|XP_009407690.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=452

 Score =   417 bits (1071),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFE SSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFETSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011002356.1| PREDICTED: tubulin alpha chain-like [Populus euphratica]
Length=451

 Score =   417 bits (1071),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 198/203 (98%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDTKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>sp|Q6VAG1.1|TBA1_GOSHI RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Gossypium hirsutum]
 gb|AAQ92661.1| alpha-tubulin 1 [Gossypium hirsutum]
Length=451

 Score =   417 bits (1071),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EF+TNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFRTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQF DWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFADWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ACU20294.1| unknown [Glycine max]
Length=339

 Score =   412 bits (1060),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSV 
Sbjct  119  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAHHEQLSVG  178

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV  IKTKRTIQFVDWCPT
Sbjct  179  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGIIKTKRTIQFVDWCPT  238

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  239  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  298

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEG+FSEAREDLAALEKDY
Sbjct  299  GEGMEEGKFSEAREDLAALEKDY  321



>gb|AHJ80815.1| Tua1 [Eragrostis tef]
Length=451

 Score =   417 bits (1071),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+S VISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSXVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>emb|CDY29334.1| BnaA05g16010D [Brassica napus]
Length=431

 Score =   416 bits (1069),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVA
Sbjct  211  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVA  270

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  271  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  330

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  331  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  390

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  391  GEGMEEGEFSEAREDLAALEKDY  413



>gb|KHG20487.1| Tubulin alpha chain [Gossypium arboreum]
Length=451

 Score =   416 bits (1070),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISA KAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITN+AFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNTAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>emb|CAA62916.1| alpha-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   416 bits (1070),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVP GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPSGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYSKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ACK76232.1| alpha-tubulin [Dimocarpus longan]
Length=450

 Score =   416 bits (1070),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGA NVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGAPNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AEW46684.1| beta-tubulin [Ulva linza]
Length=452

 Score =   416 bits (1070),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LI+QVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LIAQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>emb|CDY66630.1| BnaCnng51680D [Brassica napus]
Length=435

 Score =   416 bits (1068),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001051132.1| Os03g0726100 [Oryza sativa Japonica Group]
 gb|AAG16905.1|AF182523_1 alpha-tubulin [Oryza sativa]
 gb|AAS07163.1| alpha tubulin [Oryza sativa Japonica Group]
 gb|AAT77077.1| alpha tubulin [Oryza sativa Japonica Group]
 gb|ABF98642.1| Tubulin alpha-1 chain, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG78592.1| alpha-tubulin [Oryza sativa Japonica Group]
 dbj|BAF13046.1| Os03g0726100 [Oryza sativa Japonica Group]
 gb|EAY91719.1| hypothetical protein OsI_13361 [Oryza sativa Indica Group]
 gb|EAZ28437.1| hypothetical protein OsJ_12419 [Oryza sativa Japonica Group]
 gb|AFI71265.1| alpha tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   416 bits (1070),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVP GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPSGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYSKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KFK32793.1| hypothetical protein AALP_AA6G289100 [Arabis alpina]
Length=450

 Score =   416 bits (1069),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITN+AFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  290  EITNTAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABV55999.1| alpha-tubulin 7 [Populus tremuloides]
Length=451

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            E+TNSAFEPSSMM KCDPR GKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EVTNSAFEPSSMMAKCDPRRGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AAL16174.1|AF428406_1 AT4g14960/dl3520c [Arabidopsis thaliana]
Length=450

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD20821.1| alpha tubulin [Zea mays]
Length=274

 Score =   409 bits (1052),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 189/203 (93%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQ+ISSLT SLRFDGA+NVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV 
Sbjct  54   LISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVP  113

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITN+ FEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRT+QFVDWCPT
Sbjct  114  EITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPT  173

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  174  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYV  233

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  234  GEGMEEGEFSEAREDLAALEKDY  256



>ref|NP_171974.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 ref|NP_175423.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 ref|XP_002863595.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002891551.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006279139.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 ref|XP_006393188.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 ref|XP_006406473.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 ref|XP_009107244.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Brassica rapa]
 sp|B9DGT7.2|TBA2_ARATH RecName: Full=Tubulin alpha-2 chain [Arabidopsis thaliana]
 sp|Q0WV25.2|TBA4_ARATH RecName: Full=Tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AAF40454.1|AC004809_12 Identical to the alpha-4 tubulin (TUA4) gene from A. thaliana 
gb|M84697. ESTs gb|T46564. gb|T04381, gb|T76028, gb|T21602, 
gb|H37154 gb|H37663 and gb|T21719 come from this gene [Arabidopsis 
thaliana]
 gb|AAF76449.1|AC015445_16 Identical to Tubulin Alpha-6 Chain from Arabidopsis thaliana 
gi|267070 and contains a Tubulin PF|00091 domain. ESTs gb|N37387, 
gb|N37805, gb|R90497, gb|T44684, gb|H36144, gb|N38686, 
gb|AI994844, gb|R90689, gb|T04725, gb|H36928, gb|N96479, gb|H36922, 
gb|R90670, gb|Z17980, gb|T4428, gb|H36248, gb|N65408, 
gb|T46222 come from this gene [Arabidopsis thaliana]
 gb|AAK95316.1|AF410330_1 At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|AAA32889.1| apha-2 tubulin [Arabidopsis thaliana]
 gb|AAA32890.1| alpha-4 tubulin [Arabidopsis thaliana]
 gb|AAL25612.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAL38293.1| Tubulin Alpha-6 Chain [Arabidopsis thaliana]
 gb|AAM98269.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAN31076.1| At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|ABQ01730.1| TUA2 [Eutrema halophilum]
 gb|ABQ01731.1| TUA2-2 [Eutrema halophilum]
 gb|EFH39854.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67810.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|AEE27747.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AEE32507.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 gb|EOA12037.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 gb|ESQ30474.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 gb|ESQ47926.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 gb|KFK35954.1| hypothetical protein AALP_AA4G059800 [Arabis alpina]
 gb|KFK39296.1| alpha tubulin 1 [Arabis alpina]
 emb|CDY45043.1| BnaA08g02320D [Brassica napus]
 emb|CDY03583.1| BnaC03g68420D [Brassica napus]
Length=450

 Score =   416 bits (1069),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AAO46127.1| alpha-tubulin [Streblomastix strix]
 gb|AAO46129.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   408 bits (1049),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 190/203 (94%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LI QVISSLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  29   LIGQVISSLTASLRFDGALNVDMTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  88

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNS+FEP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  89   EITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  148

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFK GINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  149  GFKVGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDHKFDLMYAKRAFVHWYV  208

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  209  GEGMEEGEFSEAREDLAALEKDY  231



>ref|XP_010500555.1| PREDICTED: tubulin alpha-6 chain isoform X1 [Camelina sativa]
 ref|XP_010479400.1| PREDICTED: tubulin alpha-6 chain [Camelina sativa]
Length=450

 Score =   416 bits (1068),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAE99023.1| tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=450

 Score =   416 bits (1068),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ACU19580.1| unknown [Glycine max]
Length=449

 Score =   416 bits (1068),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEF EAREDLAALEKDY
Sbjct  410  GEGMEEGEFFEAREDLAALEKDY  432



>ref|XP_011398411.1| Tubulin alpha chain [Auxenochlorella protothecoides]
 gb|KFM25515.1| Tubulin alpha chain [Auxenochlorella protothecoides]
Length=394

 Score =   414 bits (1063),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LI+QVISSLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  174  LIAQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  233

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVAT+KTKRTIQFVDWCPT
Sbjct  234  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATVKTKRTIQFVDWCPT  293

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYV
Sbjct  294  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYV  353

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  354  GEGMEEGEFSEAREDLAALEKDY  376



>ref|XP_008341563.1| PREDICTED: tubulin alpha-2 chain-like [Malus domestica]
Length=450

 Score =   416 bits (1068),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPR GKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRXGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_193232.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 sp|P29511.1|TBA6_ARATH RecName: Full=Tubulin alpha-6 chain [Arabidopsis thaliana]
 gb|AAA32892.1| TUA6 [Arabidopsis thaliana]
 emb|CAB10275.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 emb|CAB78538.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 gb|AAL24246.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAL38788.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|AAL79586.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAM51249.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|ABD75335.1| tubulin alpha-1 chain [Brassica rapa subsp. oleifera]
 gb|AEE83530.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 emb|CDY50974.1| BnaA06g37700D [Brassica napus]
 emb|CDY28123.1| BnaC06g03040D [Brassica napus]
Length=450

 Score =   416 bits (1068),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AFK33477.1| unknown [Lotus japonicus]
Length=352

 Score =   412 bits (1058),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  132  LISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  191

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV +IKTKRTIQFVDWCPT
Sbjct  192  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGSIKTKRTIQFVDWCPT  251

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYV
Sbjct  252  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDVKFDLMYSKRAFVHWYV  311

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  312  GEGMEEGEFSEAREDLAALEKDY  334



>gb|ABL61216.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   410 bits (1054),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 190/203 (94%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LI+QVISSLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  93   LIAQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  152

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNS+FEP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  153  EITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  212

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYV
Sbjct  213  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYV  272

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  273  GEGMEEGEFSEAREDLAALEKDY  295



>dbj|BAJ06364.1| alpha-tubulin [Alopecurus aequalis]
Length=451

 Score =   415 bits (1067),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLT SLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV+
Sbjct  230  LVSQVISSLTTSLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVS  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61215.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   410 bits (1054),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 190/203 (94%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LI+QVISSLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  93   LIAQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  152

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNS+FEP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  153  EITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  212

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYV
Sbjct  213  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYV  272

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  273  GEGMEEGEFSEAREDLAALEKDY  295



>ref|XP_009124556.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Brassica rapa]
Length=450

 Score =   415 bits (1067),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61212.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61220.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61221.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61222.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61223.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61225.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61229.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   410 bits (1054),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 190/203 (94%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LI+QVISSLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  93   LIAQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  152

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNS+FEP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  153  EITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  212

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYV
Sbjct  213  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYV  272

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  273  GEGMEEGEFSEAREDLAALEKDY  295



>gb|ABR25510.1| tubulin alpha-1 chain [Oryza sativa Indica Group]
Length=255

 Score =   408 bits (1048),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 189/203 (93%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQ+ISSLT SLRFDGA+NVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV 
Sbjct  35   LISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVP  94

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITN+ FEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRT+QFVDWCPT
Sbjct  95   EITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPT  154

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  155  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYV  214

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  215  GEGMEEGEFSEAREDLAALEKDY  237



>ref|XP_003558668.1| PREDICTED: tubulin alpha-2 chain-like [Brachypodium distachyon]
 emb|CAM58977.1| alpha-tubulin 4 [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   415 bits (1067),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLT SLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV+
Sbjct  230  LVSQVISSLTTSLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVS  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KJB29387.1| hypothetical protein B456_005G097800 [Gossypium raimondii]
Length=451

 Score =   415 bits (1067),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISA KAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITN+AFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNTAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLA+VQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAEVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABD92936.1| alpha tubulin-4D [Triticum aestivum]
Length=451

 Score =   415 bits (1067),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLT SLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV+
Sbjct  230  LVSQVISSLTTSLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVS  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABD92937.1| alpha tubulin-4A [Triticum aestivum]
 gb|ABD92938.1| alpha tubulin-4B [Triticum aestivum]
 gb|EMS53764.1| Tubulin alpha chain [Triticum urartu]
Length=451

 Score =   415 bits (1067),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 195/203 (96%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLT SLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV+
Sbjct  230  LVSQVISSLTTSLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVS  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABK92552.1| unknown [Populus trichocarpa]
Length=451

 Score =   415 bits (1067),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 197/203 (97%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRA CMISNSTSVAEVFSRID KFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAFCMISNSTSVAEVFSRIDSKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|EYU37544.1| hypothetical protein MIMGU_mgv1a007145mg [Erythranthe guttata]
Length=417

 Score =   413 bits (1062),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/201 (97%), Positives = 197/201 (98%), Gaps = 0/201 (0%)
 Frame = -3

Query  759  SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEI  580
            + VISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEI
Sbjct  198  TDVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEI  257

Query  579  TNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF  400
            TNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF
Sbjct  258  TNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGF  317

Query  399  KCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGE  220
            KCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGE
Sbjct  318  KCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGE  377

Query  219  GMEEGEFSEAREDLAALEKDY  157
            GMEEGEFSEAREDLAALEKDY
Sbjct  378  GMEEGEFSEAREDLAALEKDY  398



>ref|XP_005851144.1| alpha-tubulin [Chlorella variabilis]
 gb|EFN59042.1| alpha-tubulin [Chlorella variabilis]
Length=450

 Score =   415 bits (1066),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LI+QVISSLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LIAQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNA+VATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNASVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ETM52928.1| tubulin alpha chain, partial [Phytophthora parasitica]
 gb|ETM52931.1| tubulin alpha chain, partial [Phytophthora parasitica]
Length=398

 Score =   413 bits (1061),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LI+QVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  175  LIAQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  234

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMA CLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  235  EITNSAFEPASMMAKCDPRHGKYMAACLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  294

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLA+VQRAVCMISN++++AEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  295  GFKCGINYQPPTVVPGGDLARVQRAVCMISNTSAIAEVFSRIDHKFDLMYAKRAFVHWYV  354

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  355  GEGMEEGEFSEAREDLAALEKDY  377



>ref|XP_001777110.1| predicted protein [Physcomitrella patens]
 gb|EDQ58103.1| predicted protein [Physcomitrella patens]
Length=344

 Score =   410 bits (1055),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 190/203 (94%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQ+ISSLT SLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV 
Sbjct  125  LISQIISSLTTSLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVP  184

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITN+ FEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRT+QFVDWCPT
Sbjct  185  EITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPT  244

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  245  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYV  304

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  305  GEGMEEGEFSEAREDLAALEKDY  327



>gb|KIZ01406.1| Tubulin alpha-1 chain [Monoraphidium neglectum]
Length=451

 Score =   414 bits (1065),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L++QVISSLT SLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVAQVISSLTTSLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNA+VATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNASVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61224.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   409 bits (1051),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 189/203 (93%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LI+QVISS+TASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  93   LIAQVISSMTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  152

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNS+FEP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  153  EITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  212

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYV
Sbjct  213  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYV  272

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  273  GEGMEEGEFSEAREDLAALEKDY  295



>ref|NP_001067613.1| Os11g0247300 [Oryza sativa Japonica Group]
 sp|Q53M52.1|TBA2_ORYSJ RecName: Full=Tubulin alpha-2 chain [Oryza sativa Japonica Group]
 gb|AAX96762.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|AAX96764.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|ABA92352.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA92353.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27976.1| Os11g0247300 [Oryza sativa Japonica Group]
 gb|EAY80511.1| hypothetical protein OsI_35689 [Oryza sativa Indica Group]
 gb|EAZ17981.1| hypothetical protein OsJ_33527 [Oryza sativa Japonica Group]
 dbj|BAG95614.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH85357.1| alpha-tubulin [Oryza sativa Japonica Group]
 gb|ADM86870.1| alpha-tubulin [Oryza sativa Japonica Group]
 gb|AFI71279.1| alpha-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   414 bits (1065),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRID KFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDIKFDLMYSKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61219.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   409 bits (1051),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 190/203 (94%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LI+QVISSLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  93   LIAQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  152

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNS+FEP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  153  EITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  212

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST+VAEVFSRID KFDLMY KRAF HWYV
Sbjct  213  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAVAEVFSRIDRKFDLMYAKRAFAHWYV  272

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  273  GEGMEEGEFSEAREDLAALEKDY  295



>gb|ABG78593.1| alpha-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   414 bits (1064),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 196/203 (97%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRID KFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDIKFDLMYSKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KDD76276.1| tubulin/FtsZ GTPase [Helicosporidium sp. ATCC 50920]
Length=450

 Score =   414 bits (1064),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LI+QVISSLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LIAQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVAT+KTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATVKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>emb|CAL35827.1| alpha-2 tubulin [Plantago major]
Length=249

 Score =   406 bits (1044),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 187/203 (92%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LISQ+ISSLT SLRFDGA+NVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLS+ 
Sbjct  29   LISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSIP  88

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITN+ FEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRT+QFVDWCPT
Sbjct  89   EITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPT  148

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  149  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYV  208

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  209  GEGMEEGEFSEAREDLAALEKDY  231



>ref|XP_005643073.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
 sp|Q9ZRJ4.1|TBA_CHLVU RecName: Full=Tubulin alpha chain [Chlorella vulgaris]
 dbj|BAA03955.1| alpha-tubulin [Chlorella vulgaris]
 gb|EIE18529.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
Length=451

 Score =   414 bits (1063),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LI+QVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSY+PVISAEKAYHEQLSVA
Sbjct  230  LIAQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYSPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61202.1| alpha-tubulin [Oxymonadida environmental sample]
Length=299

 Score =   408 bits (1049),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 189/203 (93%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LI+QVISSLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  78   LIAQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  137

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNS+FEP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  138  EITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  197

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRID KF+LMY KRAFVHWYV
Sbjct  198  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFELMYAKRAFVHWYV  257

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  258  GEGMEEGEFSEAREDLAALEKDY  280



>gb|KIZ03400.1| Tubulin alpha chain [Monoraphidium neglectum]
Length=451

 Score =   414 bits (1063),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 192/203 (95%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L++QVISSLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  230  LVAQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNA+VATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNASVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST+VAEVFSR+DHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAVAEVFSRLDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61217.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   409 bits (1050),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 189/203 (93%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LI+QVISSLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  93   LIAQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  152

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNS+FEP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQ VDWCPT
Sbjct  153  EITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQLVDWCPT  212

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYV
Sbjct  213  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYV  272

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  273  GEGMEEGEFSEAREDLAALEKDY  295



>gb|ABL61213.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   409 bits (1050),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 189/203 (93%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LI+QVISSLTASLRFDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA
Sbjct  93   LIAQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  152

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNS+FEP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIK KRTIQFVDWCPT
Sbjct  153  EITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKAKRTIQFVDWCPT  212

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYV
Sbjct  213  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYV  272

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  273  GEGMEEGEFSEAREDLAALEKDY  295



>ref|XP_005651460.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
 gb|EIE26916.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
Length=451

 Score =   414 bits (1063),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            LI+QVISSLTASLRFDGALNVDV EFQTNLVPYPRIHFMLSSY+PVISAEKAYHEQLSVA
Sbjct  230  LIAQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYSPVISAEKAYHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KHN01709.1| Tubulin alpha chain [Glycine soja]
Length=450

 Score =   414 bits (1063),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSV 
Sbjct  230  LVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAHHEQLSVG  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV  IKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGIIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009147859.1| PREDICTED: tubulin alpha-6 chain [Brassica rapa]
Length=450

 Score =   414 bits (1063),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -3

Query  765  LISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVA  586
            L+SQVISSLTASLRFDGALNVDV EFQTNL PYPRIHFMLSSYAPVISAEKA+HEQLSVA
Sbjct  230  LVSQVISSLTASLRFDGALNVDVTEFQTNLAPYPRIHFMLSSYAPVISAEKAFHEQLSVA  289

Query  585  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  406
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  349

Query  405  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  226
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  225  GEGMEEGEFSEAREDLAALEKDY  157
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1454382771890