BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF014E19

Length=715
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011099673.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    327   1e-101   Sesamum indicum [beniseed]
ref|XP_009609691.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    316   1e-97    Nicotiana tomentosiformis
ref|XP_009784325.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    315   4e-97    Nicotiana sylvestris
ref|XP_008227517.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    314   8e-97    Prunus mume [ume]
ref|XP_007213671.1|  hypothetical protein PRUPE_ppa001032mg             313   2e-96    Prunus persica
gb|EYU20592.1|  hypothetical protein MIMGU_mgv1a001027mg                311   5e-96    Erythranthe guttata [common monkey flower]
gb|EYU31239.1|  hypothetical protein MIMGU_mgv1a0018152mg               291   1e-95    Erythranthe guttata [common monkey flower]
ref|XP_004163388.1|  PREDICTED: neutral alpha-glucosidase C-like        296   2e-95    
emb|CDP05480.1|  unnamed protein product                                310   2e-95    Coffea canephora [robusta coffee]
ref|XP_011468292.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    306   8e-94    Fragaria vesca subsp. vesca
ref|XP_008394183.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    303   2e-92    
ref|XP_009355853.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    303   2e-92    Pyrus x bretschneideri [bai li]
ref|XP_008394182.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    303   2e-92    
ref|XP_002270200.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    300   2e-91    Vitis vinifera
gb|KHN31186.1|  Neutral alpha-glucosidase AB                            299   2e-91    Glycine soja [wild soybean]
ref|XP_010674404.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    300   3e-91    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002529411.1|  neutral alpha-glucosidase ab precursor, puta...    298   6e-91    Ricinus communis
ref|XP_004502983.1|  PREDICTED: neutral alpha-glucosidase AB-like       297   1e-90    Cicer arietinum [garbanzo]
ref|XP_002268690.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    297   2e-90    Vitis vinifera
ref|XP_009364181.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    297   2e-90    Pyrus x bretschneideri [bai li]
ref|XP_003523210.1|  PREDICTED: neutral alpha-glucosidase AB-like       296   2e-90    Glycine max [soybeans]
gb|KDP24259.1|  hypothetical protein JCGZ_26689                         296   3e-90    Jatropha curcas
ref|XP_010027570.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    296   6e-90    Eucalyptus grandis [rose gum]
gb|KDO57535.1|  hypothetical protein CISIN_1g0024422mg                  291   1e-89    Citrus sinensis [apfelsine]
ref|XP_007137757.1|  hypothetical protein PHAVU_009G153400g             295   1e-89    Phaseolus vulgaris [French bean]
ref|XP_004147325.1|  PREDICTED: neutral alpha-glucosidase AB-like       295   1e-89    Cucumis sativus [cucumbers]
ref|XP_006464915.1|  PREDICTED: neutral alpha-glucosidase AB-like       293   8e-89    Citrus sinensis [apfelsine]
gb|KJB40495.1|  hypothetical protein B456_007G066900                    292   1e-88    Gossypium raimondii
ref|XP_003602674.1|  Neutral alpha-glucosidase AB                       291   4e-88    Medicago truncatula
ref|XP_011022868.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    290   8e-88    Populus euphratica
ref|XP_007048509.1|  Glycosyl hydrolases family 31 protein isoform 1    290   8e-88    
ref|XP_002310537.1|  hypothetical protein POPTR_0007s04720g             290   9e-88    Populus trichocarpa [western balsam poplar]
gb|AFW89190.1|  hypothetical protein ZEAMMB73_762165                    281   1e-87    
ref|XP_008460826.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    289   1e-87    Cucumis melo [Oriental melon]
ref|XP_008801944.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    289   2e-87    Phoenix dactylifera
ref|XP_010270270.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    288   4e-87    Nelumbo nucifera [Indian lotus]
ref|XP_002468270.1|  hypothetical protein SORBIDRAFT_01g042750          286   2e-86    Sorghum bicolor [broomcorn]
gb|ABF94648.1|  Neutral alpha-glucosidase AB precursor, putative,...    281   2e-86    Oryza sativa Japonica Group [Japonica rice]
emb|CDX81200.1|  BnaC09g06110D                                          280   4e-86    
ref|XP_004985180.1|  PREDICTED: neutral alpha-glucosidase AB-like       285   4e-86    Setaria italica
gb|ACN26464.1|  unknown                                                 281   7e-86    Zea mays [maize]
ref|XP_010906080.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    284   2e-85    Elaeis guineensis
emb|CDY60045.1|  BnaA09g52360D                                          277   4e-85    Brassica napus [oilseed rape]
emb|CDX84449.1|  BnaC03g50510D                                          276   7e-85    
ref|XP_009407664.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    282   8e-85    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006394238.1|  hypothetical protein EUTSA_v10003620mg             281   1e-84    Eutrema salsugineum [saltwater cress]
ref|NP_001049385.1|  Os03g0216600                                       281   1e-84    
ref|XP_010908477.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    281   1e-84    Elaeis guineensis
gb|AFW89188.1|  hypothetical protein ZEAMMB73_762165                    281   1e-84    
gb|EEC74768.1|  hypothetical protein OsI_10536                          281   1e-84    Oryza sativa Indica Group [Indian rice]
sp|B9F676.1|GLU2A_ORYSJ  RecName: Full=Probable glucan 1,3-alpha-...    281   2e-84    Oryza sativa Japonica Group [Japonica rice]
emb|CDY43760.1|  BnaA06g22960D                                          273   2e-83    Brassica napus [oilseed rape]
ref|XP_010521236.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    278   2e-83    Tarenaya hassleriana [spider flower]
gb|KFK28077.1|  hypothetical protein AALP_AA8G469200                    278   2e-83    Arabis alpina [alpine rockcress]
ref|XP_010546305.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    278   3e-83    Tarenaya hassleriana [spider flower]
ref|XP_010461069.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    278   3e-83    Camelina sativa [gold-of-pleasure]
ref|XP_009112107.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    277   4e-83    Brassica rapa
ref|NP_201189.1|  alpha 1,3-glucosidase                                 277   5e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010444304.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    276   8e-83    Camelina sativa [gold-of-pleasure]
ref|XP_010444305.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    276   8e-83    
ref|XP_006649640.1|  PREDICTED: neutral alpha-glucosidase AB-like       276   1e-82    Oryza brachyantha
ref|NP_001169712.1|  hypothetical protein precursor                     275   2e-82    Zea mays [maize]
ref|XP_002864871.1|  hypothetical protein ARALYDRAFT_919683             275   2e-82    Arabidopsis lyrata subsp. lyrata
ref|XP_008645249.1|  PREDICTED: hypothetical protein isoform X1         275   3e-82    Zea mays [maize]
ref|XP_010484144.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    274   5e-82    
gb|EMS52413.1|  Neutral alpha-glucosidase AB                            270   7e-82    Triticum urartu
ref|XP_002307054.1|  hypothetical protein POPTR_0005s07000g             274   8e-82    Populus trichocarpa [western balsam poplar]
ref|XP_009150447.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    274   9e-82    Brassica rapa
ref|XP_003558486.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    271   6e-81    Brachypodium distachyon [annual false brome]
ref|NP_001275405.1|  neutral alpha-glucosidase AB-like precursor        271   9e-81    
gb|EMT11799.1|  Neutral alpha-glucosidase AB                            269   2e-80    
ref|XP_010088025.1|  Neutral alpha-glucosidase AB                       270   4e-80    
ref|XP_006279958.1|  hypothetical protein CARUB_v10025824mg             269   7e-80    
ref|XP_011031112.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    268   1e-79    Populus euphratica
dbj|BAG72145.1|  alpha-glucosidase like protein                         266   4e-79    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ91260.1|  predicted protein                                      266   5e-79    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001234030.1|  alpha glucosidase II precursor                     254   9e-75    
gb|EPS71756.1|  alpha-glucosidase                                       252   8e-74    Genlisea aurea
emb|CDP05478.1|  unnamed protein product                                243   3e-73    Coffea canephora [robusta coffee]
ref|XP_006857187.1|  hypothetical protein AMTR_s00065p00185540          248   2e-72    Amborella trichopoda
emb|CBI17232.3|  unnamed protein product                                237   5e-69    Vitis vinifera
ref|XP_010088026.1|  Neutral alpha-glucosidase AB                       229   9e-66    
gb|KJB40498.1|  hypothetical protein B456_007G066900                    213   3e-60    Gossypium raimondii
ref|XP_007048510.1|  Glycosyl hydrolases family 31 protein isoform 2    210   4e-59    
emb|CCW28783.1|  glycoside hydrolase                                    209   1e-58    Arachis duranensis
emb|CBI26440.3|  unnamed protein product                                206   7e-58    Vitis vinifera
ref|XP_001769049.1|  predicted protein                                  205   3e-57    
ref|XP_002964300.1|  hypothetical protein SELMODRAFT_142083             202   2e-56    
ref|XP_002967735.1|  hypothetical protein SELMODRAFT_169507             202   2e-56    Selaginella moellendorffii
ref|XP_006432099.1|  hypothetical protein CICLE_v100002001mg            163   6e-47    
emb|CAN82775.1|  hypothetical protein VITISV_000481                     172   4e-46    Vitis vinifera
gb|ACG25781.1|  hypothetical protein                                    159   2e-45    Zea mays [maize]
ref|XP_005814922.1|  PREDICTED: neutral alpha-glucosidase AB-like       159   1e-40    
ref|XP_010747970.1|  PREDICTED: neutral alpha-glucosidase AB isof...    159   2e-40    
ref|XP_010747972.1|  PREDICTED: neutral alpha-glucosidase AB isof...    159   2e-40    
ref|XP_008325072.1|  PREDICTED: neutral alpha-glucosidase AB isof...    158   4e-40    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008325071.1|  PREDICTED: neutral alpha-glucosidase AB isof...    158   4e-40    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008325070.1|  PREDICTED: neutral alpha-glucosidase AB isof...    158   4e-40    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_007550406.1|  PREDICTED: neutral alpha-glucosidase AB isof...    157   5e-40    Poecilia formosa
ref|XP_007550408.1|  PREDICTED: neutral alpha-glucosidase AB isof...    157   5e-40    Poecilia formosa
ref|XP_007550407.1|  PREDICTED: neutral alpha-glucosidase AB isof...    157   5e-40    Poecilia formosa
ref|XP_007550409.1|  PREDICTED: neutral alpha-glucosidase AB isof...    157   6e-40    Poecilia formosa
ref|XP_008418637.1|  PREDICTED: neutral alpha-glucosidase AB isof...    156   2e-39    Poecilia reticulata
ref|XP_008418638.1|  PREDICTED: neutral alpha-glucosidase AB isof...    156   2e-39    Poecilia reticulata
ref|XP_008418641.1|  PREDICTED: neutral alpha-glucosidase AB isof...    156   2e-39    Poecilia reticulata
ref|XP_008418640.1|  PREDICTED: neutral alpha-glucosidase AB isof...    156   2e-39    Poecilia reticulata
ref|XP_009289535.1|  PREDICTED: neutral alpha-glucosidase AB            156   2e-39    Danio rerio [leopard danio]
ref|XP_006782031.1|  PREDICTED: neutral alpha-glucosidase AB-like       155   2e-39    Neolamprologus brichardi [lyretail cichlid]
ref|XP_789535.3|  PREDICTED: neutral alpha-glucosidase AB-like          155   3e-39    
ref|XP_005467601.1|  PREDICTED: neutral alpha-glucosidase AB-like...    155   4e-39    Oreochromis niloticus
ref|XP_005467600.1|  PREDICTED: neutral alpha-glucosidase AB-like...    155   4e-39    Oreochromis niloticus
ref|XP_005467602.1|  PREDICTED: neutral alpha-glucosidase AB-like...    154   5e-39    Oreochromis niloticus
ref|XP_008302455.1|  PREDICTED: neutral alpha-glucosidase AB isof...    154   1e-38    Stegastes partitus
ref|XP_008302458.1|  PREDICTED: neutral alpha-glucosidase AB isof...    154   1e-38    Stegastes partitus
ref|XP_008302456.1|  PREDICTED: neutral alpha-glucosidase AB isof...    154   1e-38    Stegastes partitus
ref|XP_004545613.1|  PREDICTED: neutral alpha-glucosidase AB-like...    153   1e-38    
ref|XP_004545615.1|  PREDICTED: neutral alpha-glucosidase AB-like...    153   2e-38    
ref|XP_004545614.1|  PREDICTED: neutral alpha-glucosidase AB-like...    153   2e-38    
ref|XP_005913414.1|  PREDICTED: neutral alpha-glucosidase AB-like...    152   3e-38    Haplochromis burtoni
ref|XP_005913415.1|  PREDICTED: neutral alpha-glucosidase AB-like...    152   3e-38    Haplochromis burtoni
ref|XP_005913417.1|  PREDICTED: neutral alpha-glucosidase AB-like...    152   3e-38    Haplochromis burtoni
ref|NP_001099169.1|  uncharacterized protein LOC100126019               148   4e-38    
ref|XP_009300300.1|  PREDICTED: uncharacterized protein LOC100126...    150   2e-37    
emb|CAG09753.1|  unnamed protein product                                150   2e-37    Tetraodon nigroviridis
ref|XP_009300299.1|  PREDICTED: uncharacterized protein LOC100126...    150   2e-37    Danio rerio [leopard danio]
ref|XP_011478335.1|  PREDICTED: neutral alpha-glucosidase AB isof...    149   3e-37    Oryzias latipes [Japanese rice fish]
ref|XP_011478336.1|  PREDICTED: neutral alpha-glucosidase AB isof...    149   4e-37    Oryzias latipes [Japanese rice fish]
emb|CDQ84489.1|  unnamed protein product                                149   4e-37    Oncorhynchus mykiss
ref|XP_010896653.1|  PREDICTED: neutral alpha-glucosidase AB            149   7e-37    Esox lucius
ref|XP_010766252.1|  PREDICTED: neutral alpha-glucosidase AB isof...    147   2e-36    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_010766249.1|  PREDICTED: neutral alpha-glucosidase AB isof...    147   2e-36    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_010766251.1|  PREDICTED: neutral alpha-glucosidase AB isof...    147   2e-36    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_010766248.1|  PREDICTED: neutral alpha-glucosidase AB isof...    147   2e-36    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_007254102.1|  PREDICTED: neutral alpha-glucosidase AB-like       144   3e-36    
ref|XP_004919758.1|  PREDICTED: neutral alpha-glucosidase AB isof...    147   3e-36    Xenopus tropicalis [western clawed frog]
ref|XP_006432098.1|  hypothetical protein CICLE_v100002003mg            136   3e-36    
ref|XP_002943023.2|  PREDICTED: neutral alpha-glucosidase AB isof...    147   3e-36    Xenopus tropicalis [western clawed frog]
ref|XP_006642846.1|  PREDICTED: neutral alpha-glucosidase AB-like       143   5e-36    
ref|XP_003970285.1|  PREDICTED: LOW QUALITY PROTEIN: neutral alph...    145   9e-36    
ref|XP_007246439.1|  PREDICTED: neutral alpha-glucosidase AB-like       145   1e-35    
emb|CDQ83631.1|  unnamed protein product                                143   7e-35    Oncorhynchus mykiss
gb|KFZ12570.1|  hypothetical protein V501_04149                         142   8e-35    Pseudogymnoascus sp. VKM F-4519 (FW-2642)
ref|XP_005988915.1|  PREDICTED: neutral alpha-glucosidase AB            141   9e-35    
ref|NP_001091232.1|  glucosidase, alpha; neutral AB precursor           142   9e-35    Xenopus laevis [clawed frog]
ref|XP_003290372.1|  hypothetical protein DICPUDRAFT_49160              142   1e-34    Dictyostelium purpureum
gb|KFY75656.1|  hypothetical protein V499_04375                         142   1e-34    Pseudogymnoascus sp. VKM F-103
ref|XP_005723270.1|  PREDICTED: neutral alpha-glucosidase AB-like       141   2e-34    Pundamilia nyererei
ref|XP_005289309.1|  PREDICTED: neutral alpha-glucosidase AB isof...    141   2e-34    Chrysemys picta bellii
ref|XP_008172330.1|  PREDICTED: neutral alpha-glucosidase AB isof...    141   2e-34    
ref|XP_008172331.1|  PREDICTED: neutral alpha-glucosidase AB isof...    141   3e-34    
gb|KFX98691.1|  hypothetical protein V490_02174                         140   5e-34    Pseudogymnoascus sp. VKM F-3557
gb|KFY88420.1|  hypothetical protein V500_06348                         140   5e-34    Pseudogymnoascus sp. VKM F-4518 (FW-2643)
ref|XP_001362209.1|  PREDICTED: neutral alpha-glucosidase AB isof...    140   6e-34    Monodelphis domestica
ref|XP_001362291.1|  PREDICTED: neutral alpha-glucosidase AB isof...    140   6e-34    Monodelphis domestica
gb|KFY22792.1|  hypothetical protein V491_02727                         140   6e-34    Pseudogymnoascus sp. VKM F-3775
gb|KJB40499.1|  hypothetical protein B456_007G066900                    139   7e-34    Gossypium raimondii
ref|XP_009057287.1|  hypothetical protein LOTGIDRAFT_217135             140   7e-34    Lottia gigantea
ref|XP_003230179.2|  PREDICTED: neutral alpha-glucosidase AB            140   8e-34    Anolis carolinensis [Carolina anole]
gb|KJB40500.1|  hypothetical protein B456_007G066900                    139   9e-34    Gossypium raimondii
ref|XP_004366911.1|  alpha-glucosidase II                               139   1e-33    Cavenderia fasciculata
gb|KIW18151.1|  hypothetical protein PV08_02439                         139   1e-33    Exophiala spinifera
gb|KFY22883.1|  hypothetical protein V493_06260                         139   1e-33    Pseudogymnoascus sp. VKM F-4281 (FW-2241)
gb|KFX89887.1|  hypothetical protein O988_08442                         139   2e-33    Pseudogymnoascus sp. VKM F-3808
gb|KFY37784.1|  hypothetical protein V495_06955                         139   2e-33    Pseudogymnoascus sp. VKM F-4514 (FW-929)
ref|XP_005533287.1|  PREDICTED: neutral alpha-glucosidase AB            139   2e-33    
gb|KFY63167.1|  hypothetical protein V496_04145                         139   2e-33    Pseudogymnoascus sp. VKM F-4515 (FW-2607)
gb|KFY85257.1|  hypothetical protein V498_07745                         139   2e-33    Pseudogymnoascus sp. VKM F-4517 (FW-2822)
gb|KFY05579.1|  hypothetical protein V492_08435                         138   3e-33    Pseudogymnoascus sp. VKM F-4246
gb|KIN01586.1|  glycoside hydrolase family 31 protein                   137   5e-33    Oidiodendron maius Zn
gb|EFA77026.1|  alpha-glucosidase II                                    137   5e-33    Heterostelium album PN500
ref|XP_008360969.1|  PREDICTED: probable glucan 1,3-alpha-glucosi...    127   5e-33    
gb|KIW01512.1|  hypothetical protein PV09_06990                         137   5e-33    Verruconis gallopava
ref|XP_004365179.2|  neutral alpha-glucosidase AB                       137   5e-33    Capsaspora owczarzaki ATCC 30864
ref|XP_002590875.1|  hypothetical protein BRAFLDRAFT_115975             137   5e-33    Branchiostoma floridae
gb|EZF35783.1|  hypothetical protein H101_00686                         137   8e-33    Trichophyton interdigitale H6
gb|EGD93017.1|  glucosidase II alpha subunit                            137   8e-33    Trichophyton tonsurans CBS 112818
gb|KFZ10715.1|  hypothetical protein V502_07965                         136   2e-32    Pseudogymnoascus sp. VKM F-4520 (FW-2644)
gb|KDO57536.1|  hypothetical protein CISIN_1g0024422mg                  134   2e-32    Citrus sinensis [apfelsine]
ref|XP_007442138.1|  PREDICTED: neutral alpha-glucosidase AB isof...    135   2e-32    Python bivittatus
ref|XP_007442139.1|  PREDICTED: neutral alpha-glucosidase AB isof...    135   3e-32    Python bivittatus
ref|XP_006118290.1|  PREDICTED: LOW QUALITY PROTEIN: neutral alph...    135   3e-32    
gb|EGV97236.1|  Neutral alpha-glucosidase C                             127   3e-32    Cricetulus griseus [Chinese hamsters]
ref|XP_007056961.1|  PREDICTED: neutral alpha-glucosidase AB            135   4e-32    
gb|EMP38490.1|  Neutral alpha-glucosidase AB                            135   4e-32    Chelonia mydas [green seaturtle]
emb|CDQ63546.1|  unnamed protein product                                128   4e-32    Oncorhynchus mykiss
ref|XP_001640695.1|  predicted protein                                  135   4e-32    Nematostella vectensis
ref|XP_008870578.1|  hypothetical protein H310_07069                    134   5e-32    Aphanomyces invadans
ref|XP_010868916.1|  PREDICTED: LOW QUALITY PROTEIN: neutral alph...    134   8e-32    
ref|XP_002848904.1|  neutral alpha-glucosidase AB                       134   9e-32    Microsporum canis CBS 113480
gb|KFH70851.1|  hypothetical protein MVEG_03698                         134   1e-31    Mortierella verticillata NRRL 6337
gb|KFY42965.1|  hypothetical protein V494_02146                         134   1e-31    Pseudogymnoascus sp. VKM F-4513 (FW-928)
ref|XP_001242667.1|  hypothetical protein CIMG_06563                    133   1e-31    Coccidioides immitis RS
gb|EFW16067.1|  glucosidase II alpha subunit                            133   2e-31    Coccidioides posadasii str. Silveira
ref|XP_003069841.1|  glucosidase II alpha subunit, putative             133   2e-31    Coccidioides posadasii C735 delta SOWgp
ref|XP_002836987.1|  hypothetical protein                               133   2e-31    Tuber melanosporum Mel28
ref|XP_006011429.1|  PREDICTED: neutral alpha-glucosidase C-like        132   2e-31    
ref|XP_006271041.1|  PREDICTED: neutral alpha-glucosidase AB            132   3e-31    
gb|KFM71080.1|  Neutral alpha-glucosidase AB                            130   4e-31    Stegodyphus mimosarum
dbj|BAK62929.1|  neutral alpha-glucosidase AB precursor                 125   4e-31    Pan troglodytes
ref|XP_002109035.1|  hypothetical protein TRIADDRAFT_37096              131   6e-31    Trichoplax adhaerens
ref|XP_007721023.1|  alpha 1,3-glucosidase                              131   7e-31    Capronia coronata CBS 617.96
gb|KIW45991.1|  hypothetical protein PV06_01686                         131   9e-31    Exophiala oligosperma
ref|XP_007081758.1|  PREDICTED: neutral alpha-glucosidase C isofo...    131   9e-31    
ref|XP_003174057.1|  neutral alpha-glucosidase AB                       131   9e-31    Nannizzia gypsea CBS 118893
ref|XP_001657347.1|  AAEL015337-PA                                      130   1e-30    
gb|ELU04203.1|  hypothetical protein CAPTEDRAFT_178821                  130   1e-30    Capitella teleta
ref|XP_008080131.1|  (Trans)glycosidase                                 130   1e-30    Glarea lozoyensis ATCC 20868
ref|XP_006033277.1|  PREDICTED: neutral alpha-glucosidase AB            131   1e-30    
ref|XP_011404505.1|  PREDICTED: neutral alpha-glucosidase AB            130   1e-30    
dbj|BAE90752.1|  unnamed protein product                                127   2e-30    Macaca fascicularis [crab eating macaque]
gb|EZF22344.1|  hypothetical protein H100_04804                         129   2e-30    Trichophyton rubrum MR850
ref|XP_008845039.1|  PREDICTED: neutral alpha-glucosidase C             130   2e-30    Nannospalax galili
ref|XP_001660931.1|  AAEL010599-PA                                      130   2e-30    
ref|XP_008713093.1|  hypothetical protein HMPREF1541_10200              129   3e-30    Cyphellophora europaea CBS 101466
gb|AAH05405.1|  GANAB protein                                           125   3e-30    Homo sapiens [man]
ref|XP_011053092.1|  PREDICTED: neutral alpha-glucosidase AB isof...    129   4e-30    Acromyrmex echinatior
ref|XP_011053085.1|  PREDICTED: neutral alpha-glucosidase AB isof...    129   4e-30    Acromyrmex echinatior
ref|XP_007993639.1|  PREDICTED: LOW QUALITY PROTEIN: neutral alph...    129   4e-30    Chlorocebus sabaeus
ref|XP_005718347.1|  Neutral alpha-glucosidase AB                       129   4e-30    Chondrus crispus [carageen]
ref|XP_002544360.1|  hypothetical protein UREG_03877                    129   4e-30    Uncinocarpus reesii 1704
gb|EGI70745.1|  Neutral alpha-glucosidase AB                            129   4e-30    Acromyrmex echinatior
ref|XP_003235505.1|  glucosidase II alpha subunit                       129   5e-30    Trichophyton rubrum CBS 118892
ref|XP_011427688.1|  PREDICTED: neutral alpha-glucosidase AB-like...    129   5e-30    Crassostrea gigas
ref|XP_011427687.1|  PREDICTED: neutral alpha-glucosidase AB-like...    129   5e-30    Crassostrea gigas
ref|XP_011427686.1|  PREDICTED: neutral alpha-glucosidase AB-like...    129   5e-30    Crassostrea gigas
emb|CCC94599.1|  unnamed protein product                                128   6e-30    Trypanosoma congolense IL3000
ref|XP_004621567.1|  PREDICTED: neutral alpha-glucosidase AB isof...    128   7e-30    Sorex araneus [Eurasian shrew]
gb|EDL79939.1|  rCG26875                                                127   7e-30    Rattus norvegicus [brown rat]
ref|XP_002799568.1|  PREDICTED: neutral alpha-glucosidase AB-like       128   7e-30    
ref|XP_004621565.1|  PREDICTED: neutral alpha-glucosidase AB isof...    128   7e-30    Sorex araneus [Eurasian shrew]
ref|XP_004621566.1|  PREDICTED: neutral alpha-glucosidase AB isof...    128   8e-30    Sorex araneus [Eurasian shrew]
ref|XP_002799567.1|  PREDICTED: neutral alpha-glucosidase AB-like       128   8e-30    
ref|XP_001116364.1|  PREDICTED: neutral alpha-glucosidase AB-like...    128   9e-30    
ref|XP_004621564.1|  PREDICTED: neutral alpha-glucosidase AB isof...    128   9e-30    Sorex araneus [Eurasian shrew]
ref|XP_004621563.1|  PREDICTED: neutral alpha-glucosidase AB isof...    128   9e-30    Sorex araneus [Eurasian shrew]
ref|XP_005771424.1|  hypothetical protein EMIHUDRAFT_419333             127   9e-30    Emiliania huxleyi CCMP1516
ref|XP_001116402.1|  PREDICTED: neutral alpha-glucosidase AB-like...    128   1e-29    Macaca mulatta [rhesus macaque]
ref|NP_001181640.1|  neutral alpha-glucosidase AB precursor             128   1e-29    Macaca mulatta [rhesus macaque]
gb|KEF54650.1|  alpha 1,3-glucosidase                                   128   1e-29    Exophiala aquamarina CBS 119918
dbj|GAM21733.1|  hypothetical protein SAMD00019534_049080               127   1e-29    Acytostelium subglobosum LB1
ref|XP_006214918.1|  PREDICTED: neutral alpha-glucosidase AB isof...    127   1e-29    
ref|NP_999069.1|  neutral alpha-glucosidase AB precursor                127   1e-29    Sus scrofa [pigs]
ref|XP_007728474.1|  alpha 1,3-glucosidase                              127   1e-29    Capronia epimyces CBS 606.96
ref|XP_005660830.1|  PREDICTED: neutral alpha-glucosidase AB isof...    127   1e-29    
ref|XP_006214919.1|  PREDICTED: neutral alpha-glucosidase AB isof...    127   1e-29    
ref|XP_010954731.1|  PREDICTED: neutral alpha-glucosidase AB isof...    127   1e-29    Camelus bactrianus [camel]
ref|XP_006181827.1|  PREDICTED: neutral alpha-glucosidase AB isof...    127   1e-29    
ref|XP_005660829.1|  PREDICTED: neutral alpha-glucosidase AB isof...    127   1e-29    Sus scrofa [pigs]
ref|XP_006156645.1|  PREDICTED: neutral alpha-glucosidase AB isof...    127   1e-29    Tupaia chinensis
ref|XP_006911268.1|  PREDICTED: neutral alpha-glucosidase AB isof...    127   1e-29    Pteropus alecto
emb|CCD48419.1|  glycoside hydrolase family 31 protein                  127   1e-29    Botrytis cinerea T4
ref|XP_005660831.1|  PREDICTED: neutral alpha-glucosidase AB isof...    127   1e-29    
ref|XP_006181828.1|  PREDICTED: neutral alpha-glucosidase AB isof...    127   1e-29    
ref|XP_006156644.1|  PREDICTED: neutral alpha-glucosidase AB isof...    127   2e-29    Tupaia chinensis
gb|ELK13445.1|  Neutral alpha-glucosidase AB                            127   2e-29    Pteropus alecto
ref|XP_968811.2|  PREDICTED: neutral alpha-glucosidase AB-like          126   2e-29    
ref|XP_646169.1|  alpha-glucosidase II                                  127   2e-29    Dictyostelium discoideum AX4
ref|XP_006911267.1|  PREDICTED: neutral alpha-glucosidase AB isof...    127   2e-29    Pteropus alecto
ref|XP_006214916.1|  PREDICTED: neutral alpha-glucosidase AB isof...    127   2e-29    Vicugna pacos
ref|XP_011163209.1|  PREDICTED: neutral alpha-glucosidase AB isof...    127   2e-29    Solenopsis invicta [imported red fire ant]
ref|XP_004656609.1|  PREDICTED: neutral alpha-glucosidase AB isof...    127   2e-29    Jaculus jaculus
ref|XP_011163210.1|  PREDICTED: neutral alpha-glucosidase AB isof...    127   2e-29    Solenopsis invicta [imported red fire ant]
ref|XP_006214917.1|  PREDICTED: neutral alpha-glucosidase AB isof...    127   2e-29    Vicugna pacos
ref|XP_006181826.1|  PREDICTED: neutral alpha-glucosidase AB isof...    127   2e-29    Camelus ferus
ref|XP_006181825.1|  PREDICTED: neutral alpha-glucosidase AB isof...    127   2e-29    Camelus ferus
gb|EPY83405.1|  neutral alpha-glucosidase AB isoform 1                  127   2e-29    Camelus ferus
ref|NP_001139312.1|  neutral alpha-glucosidase C                        127   2e-29    Rattus norvegicus [brown rat]
gb|EFZ15875.1|  hypothetical protein SINV_06608                         127   2e-29    
ref|XP_004656607.1|  PREDICTED: neutral alpha-glucosidase AB isof...    127   2e-29    Jaculus jaculus
gb|AAH17433.2|  GANAB protein                                           124   2e-29    Homo sapiens [man]
ref|XP_004656608.1|  PREDICTED: neutral alpha-glucosidase AB isof...    127   2e-29    Jaculus jaculus
gb|EHH62760.1|  hypothetical protein EGM_21219                          127   2e-29    Macaca fascicularis [crab eating macaque]
ref|XP_005577635.1|  PREDICTED: neutral alpha-glucosidase AB isof...    127   2e-29    Macaca fascicularis [crab eating macaque]
ref|XP_004656606.1|  PREDICTED: neutral alpha-glucosidase AB isof...    127   2e-29    Jaculus jaculus
ref|XP_005414845.1|  PREDICTED: neutral alpha-glucosidase AB isof...    127   2e-29    
ref|NP_001272004.1|  neutral alpha-glucosidase AB precursor             127   2e-29    Macaca fascicularis [crab eating macaque]
ref|XP_005414846.1|  PREDICTED: neutral alpha-glucosidase AB isof...    126   2e-29    
ref|XP_005414844.1|  PREDICTED: neutral alpha-glucosidase AB isof...    127   3e-29    Chinchilla lanigera
ref|XP_004656605.1|  PREDICTED: neutral alpha-glucosidase AB isof...    127   3e-29    Jaculus jaculus
ref|XP_003987296.1|  PREDICTED: neutral alpha-glucosidase C isofo...    126   3e-29    
ref|XP_003393119.1|  PREDICTED: neutral alpha-glucosidase AB-like       126   3e-29    
ref|NP_001099804.1|  neutral alpha-glucosidase AB                       126   3e-29    
ref|XP_005414843.1|  PREDICTED: neutral alpha-glucosidase AB isof...    127   3e-29    
gb|ERE70820.1|  neutral alpha-glucosidase C                             126   3e-29    
ref|XP_007526406.1|  PREDICTED: neutral alpha-glucosidase AB isof...    126   3e-29    
ref|XP_006043266.1|  PREDICTED: neutral alpha-glucosidase AB isof...    126   3e-29    
ref|XP_003498132.1|  PREDICTED: neutral alpha-glucosidase C isofo...    126   3e-29    
ref|XP_006043267.1|  PREDICTED: neutral alpha-glucosidase AB isof...    126   3e-29    
gb|ERE70817.1|  neutral alpha-glucosidase C                             126   3e-29    
gb|ERE70819.1|  neutral alpha-glucosidase C                             126   3e-29    
ref|XP_003492162.1|  PREDICTED: neutral alpha-glucosidase AB-like       126   4e-29    
ref|XP_005904899.1|  PREDICTED: neutral alpha-glucosidase AB isof...    126   4e-29    
ref|XP_007290587.1|  glucosidase II alpha subunit                       126   4e-29    
ref|XP_005904898.1|  PREDICTED: neutral alpha-glucosidase AB isof...    126   4e-29    
ref|XP_007526407.1|  PREDICTED: neutral alpha-glucosidase AB isof...    126   4e-29    
ref|XP_007621649.1|  PREDICTED: neutral alpha-glucosidase C isofo...    126   4e-29    
ref|XP_005904897.1|  PREDICTED: neutral alpha-glucosidase AB isof...    126   4e-29    
ref|XP_005226989.1|  PREDICTED: neutral alpha-glucosidase AB isof...    126   4e-29    
gb|ELR49696.1|  Neutral alpha-glucosidase AB                            126   4e-29    
ref|XP_005904896.1|  PREDICTED: neutral alpha-glucosidase AB isof...    126   4e-29    
ref|XP_006043264.1|  PREDICTED: neutral alpha-glucosidase AB isof...    126   4e-29    
ref|NP_001192706.1|  neutral alpha-glucosidase AB                       126   4e-29    
gb|AAI48866.1|  GANAB protein                                           126   4e-29    
ref|XP_006231039.1|  PREDICTED: neutral alpha-glucosidase AB isof...    126   4e-29    
ref|XP_006043265.1|  PREDICTED: neutral alpha-glucosidase AB isof...    126   4e-29    
gb|KIW57882.1|  hypothetical protein PV05_02438                         126   4e-29    
ref|XP_003909740.1|  PREDICTED: neutral alpha-glucosidase AB isof...    126   4e-29    
ref|XP_010383187.1|  PREDICTED: neutral alpha-glucosidase AB isof...    126   5e-29    
ref|XP_003920281.1|  PREDICTED: neutral alpha-glucosidase AB isof...    126   5e-29    
ref|XP_001851053.1|  neutral alpha-glucosidase AB                       126   5e-29    
ref|XP_001888761.1|  glycoside hydrolase family 31 protein              126   5e-29    
ref|XP_009184099.1|  PREDICTED: neutral alpha-glucosidase AB isof...    126   5e-29    
ref|XP_003920282.1|  PREDICTED: neutral alpha-glucosidase AB isof...    126   5e-29    
ref|XP_010383186.1|  PREDICTED: neutral alpha-glucosidase AB isof...    126   5e-29    
dbj|BAB30982.1|  unnamed protein product                                123   5e-29    
ref|XP_006231038.1|  PREDICTED: neutral alpha-glucosidase AB isof...    126   5e-29    
emb|CDM29671.1|  Glucosidase 2 subunit alpha                            126   5e-29    
ref|XP_005966839.1|  PREDICTED: neutral alpha-glucosidase AB isof...    125   6e-29    
ref|XP_005598297.1|  PREDICTED: neutral alpha-glucosidase AB isof...    125   6e-29    
ref|XP_006875077.1|  PREDICTED: neutral alpha-glucosidase AB isof...    125   6e-29    
ref|XP_008571708.1|  PREDICTED: neutral alpha-glucosidase AB            125   6e-29    
gb|ESZ92791.1|  glucosidase II alpha subunit                            125   6e-29    
ref|NP_001268822.1|  neutral alpha-glucosidase AB-like precursor        125   7e-29    
gb|ELR03619.1|  hypothetical protein GMDG_06269                         125   7e-29    
ref|XP_006875076.1|  PREDICTED: neutral alpha-glucosidase AB isof...    125   7e-29    
ref|XP_005699838.1|  PREDICTED: neutral alpha-glucosidase AB isof...    125   7e-29    
dbj|GAD93532.1|  alpha glucosidase II, alpha subunit, putative          125   7e-29    
gb|EDL27993.1|  mCG132433, isoform CRA_a                                124   7e-29    
ref|XP_005699837.1|  PREDICTED: neutral alpha-glucosidase AB isof...    125   7e-29    
ref|XP_004019910.1|  PREDICTED: neutral alpha-glucosidase AB            125   7e-29    
ref|XP_005966838.1|  PREDICTED: neutral alpha-glucosidase AB isof...    125   7e-29    
ref|XP_001502746.2|  PREDICTED: neutral alpha-glucosidase AB isof...    125   8e-29    
gb|KDR15365.1|  Neutral alpha-glucosidase AB                            125   8e-29    
ref|XP_008530392.1|  PREDICTED: neutral alpha-glucosidase AB isof...    125   8e-29    
ref|XP_005966837.1|  PREDICTED: neutral alpha-glucosidase AB isof...    125   8e-29    
ref|XP_007110009.1|  PREDICTED: neutral alpha-glucosidase AB isof...    125   8e-29    
ref|XP_005699835.1|  PREDICTED: neutral alpha-glucosidase AB isof...    125   8e-29    
ref|XP_005598296.1|  PREDICTED: neutral alpha-glucosidase AB isof...    125   8e-29    
ref|XP_007110010.1|  PREDICTED: neutral alpha-glucosidase AB isof...    125   8e-29    
ref|XP_002721052.1|  PREDICTED: neutral alpha-glucosidase AB isof...    125   8e-29    
ref|XP_008530391.1|  PREDICTED: neutral alpha-glucosidase AB isof...    125   8e-29    
ref|XP_002721053.1|  PREDICTED: neutral alpha-glucosidase AB isof...    125   8e-29    
ref|XP_005699836.1|  PREDICTED: neutral alpha-glucosidase AB isof...    125   9e-29    
ref|XP_005966836.1|  PREDICTED: neutral alpha-glucosidase AB isof...    125   9e-29    
ref|XP_006875075.1|  PREDICTED: neutral alpha-glucosidase AB isof...    125   9e-29    
ref|XP_003362719.1|  PREDICTED: neutral alpha-glucosidase AB isof...    125   9e-29    
ref|XP_006875074.1|  PREDICTED: neutral alpha-glucosidase AB isof...    125   1e-28    
gb|EEH05397.1|  glucosidase II alpha subunit                            125   1e-28    
ref|XP_004437540.1|  PREDICTED: neutral alpha-glucosidase AB isof...    125   1e-28    
dbj|BAC36303.1|  unnamed protein product                                124   1e-28    
ref|XP_010631289.1|  PREDICTED: neutral alpha-glucosidase AB isof...    125   1e-28    
gb|KFO29441.1|  Neutral alpha-glucosidase AB                            125   1e-28    
ref|XP_010631290.1|  PREDICTED: neutral alpha-glucosidase AB isof...    125   1e-28    
ref|XP_002950309.1|  hypothetical protein VOLCADRAFT_60238              125   1e-28    
gb|EHB02089.1|  Neutral alpha-glucosidase AB                            125   1e-28    
ref|XP_004437541.1|  PREDICTED: neutral alpha-glucosidase AB isof...    125   1e-28    
ref|XP_002821696.1|  PREDICTED: neutral alpha-glucosidase AB isof...    125   1e-28    
ref|XP_009006587.1|  PREDICTED: neutral alpha-glucosidase AB            124   1e-28    
ref|XP_007104918.1|  PREDICTED: neutral alpha-glucosidase C             124   1e-28    
gb|EDL27994.1|  mCG132433, isoform CRA_b                                124   1e-28    
emb|CAH92411.1|  hypothetical protein                                   125   1e-28    
ref|XP_001543499.1|  hypothetical protein HCAG_00545                    124   1e-28    
ref|XP_011366942.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   1e-28    
ref|XP_003777781.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   1e-28    
ref|NP_001265122.1|  neutral alpha-glucosidase AB isoform 5             124   1e-28    
gb|KIV86341.1|  hypothetical protein PV11_01956                         124   1e-28    
ref|XP_004883318.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   1e-28    
ref|XP_002413171.1|  glucosidase II, putative                           124   1e-28    
ref|XP_011366941.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
ref|XP_004051401.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
ref|XP_006997032.1|  PREDICTED: neutral alpha-glucosidase C             124   2e-28    
ref|XP_004874443.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
ref|XP_004883319.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
ref|XP_004874442.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
dbj|BAG58624.1|  unnamed protein product                                124   2e-28    
ref|XP_004896213.1|  PREDICTED: neutral alpha-glucosidase C             124   2e-28    
ref|XP_001216686.1|  hypothetical protein ATEG_08065                    124   2e-28    
ref|XP_008555049.1|  PREDICTED: neutral alpha-glucosidase AB            124   2e-28    
ref|XP_009155762.1|  alpha 1,3-glucosidase                              124   2e-28    
ref|XP_011366940.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
gb|EAW74045.1|  glucosidase, alpha; neutral AB, isoform CRA_a           124   2e-28    
gb|EAW74046.1|  glucosidase, alpha; neutral AB, isoform CRA_b           124   2e-28    
ref|XP_001154003.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
ref|NP_001265123.1|  neutral alpha-glucosidase AB isoform 6             124   2e-28    
ref|NP_001265121.1|  neutral alpha-glucosidase AB isoform 4             124   2e-28    
ref|XP_004874441.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
ref|XP_004383903.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
ref|XP_004051400.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
ref|XP_011268828.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
dbj|BAG63965.1|  unnamed protein product                                124   2e-28    
gb|EFN72883.1|  Neutral alpha-glucosidase AB                            124   2e-28    
ref|XP_004883317.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
ref|XP_006899889.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
ref|XP_004051402.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
ref|XP_004883315.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
ref|XP_006899890.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
dbj|BAG61688.1|  unnamed protein product                                124   2e-28    
gb|AAH65266.1|  GANAB protein                                           124   2e-28    
ref|XP_009309615.1|  glucosidase                                        124   2e-28    
ref|XP_006899888.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
ref|XP_006899887.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
ref|XP_004383901.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
ref|NP_938148.1|  neutral alpha-glucosidase AB isoform 2 precursor      124   2e-28    
ref|XP_004383902.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
ref|XP_004874439.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
gb|EEH21853.1|  hypothetical protein PABG_04069                         124   2e-28    
ref|XP_011502214.1|  PREDICTED: neutral alpha-glucosidase AB            124   2e-28    
ref|XP_004051398.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
ref|XP_003828530.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
gb|EAW74050.1|  glucosidase, alpha; neutral AB, isoform CRA_e           124   2e-28    
ref|NP_766260.2|  neutral alpha-glucosidase C                           124   2e-28    
ref|XP_004883316.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
ref|XP_004051399.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
dbj|BAG58692.1|  unnamed protein product                                124   2e-28    
sp|Q8BVW0.2|GANC_MOUSE  RecName: Full=Neutral alpha-glucosidase C       124   2e-28    
ref|XP_004874440.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
ref|XP_003828531.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
gb|EAW74047.1|  glucosidase, alpha; neutral AB, isoform CRA_c           124   2e-28    
ref|XP_011268827.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
ref|NP_938149.2|  neutral alpha-glucosidase AB isoform 3 precursor      124   2e-28    
ref|XP_508494.2|  PREDICTED: neutral alpha-glucosidase AB isoform X1    124   2e-28    
ref|XP_004383900.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
ref|XP_009826556.1|  hypothetical protein H257_03932                    124   2e-28    
emb|CCC52278.1|  putative glucosidase                                   124   2e-28    
ref|XP_002628452.1|  alpha glucosidase II                               124   2e-28    
ref|XP_006899885.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
ref|XP_007943069.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
ref|XP_004383899.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
ref|XP_007943071.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
ref|XP_006899886.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
ref|XP_006899884.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   2e-28    
ref|XP_007472477.1|  PREDICTED: neutral alpha-glucosidase C isofo...    124   3e-28    
ref|XP_001822711.1|  alpha glucosidase II, alpha subunit                124   3e-28    
gb|EER41163.1|  glucosidase II alpha subunit                            123   3e-28    
dbj|BAM78680.1|  glucosidase II alpha-subunit                           124   3e-28    
ref|XP_001362744.1|  PREDICTED: neutral alpha-glucosidase C isofo...    124   3e-28    
gb|KIX08989.1|  hypothetical protein Z518_00067                         124   3e-28    
ref|XP_006201749.1|  PREDICTED: neutral alpha-glucosidase C             124   3e-28    
ref|XP_006899883.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   3e-28    
ref|XP_010762887.1|  hypothetical protein PADG_07523                    124   3e-28    
ref|XP_006772816.1|  PREDICTED: neutral alpha-glucosidase AB isof...    124   3e-28    
ref|XP_002794018.1|  neutral alpha-glucosidase AB                       124   3e-28    
dbj|BAG09600.1|  neutral alpha-glucosidase AB precursor                 123   3e-28    
gb|KGO43354.1|  Glycoside hydrolase, family 31                          124   3e-28    
ref|XP_006772817.1|  PREDICTED: neutral alpha-glucosidase AB isof...    123   3e-28    
ref|XP_005842635.1|  hypothetical protein CHLNCDRAFT_59508              117   3e-28    
emb|CAA04006.1|  Glucosidase II                                         123   3e-28    
ref|XP_003707910.1|  PREDICTED: neutral alpha-glucosidase AB-like       123   3e-28    
ref|XP_004623565.1|  PREDICTED: neutral alpha-glucosidase C             123   3e-28    
ref|XP_006730398.1|  PREDICTED: neutral alpha-glucosidase AB isof...    123   4e-28    
ref|XP_623603.1|  PREDICTED: neutral alpha-glucosidase AB-like is...    123   4e-28    
gb|ELK23451.1|  Neutral alpha-glucosidase AB                            124   4e-28    
ref|XP_006730397.1|  PREDICTED: neutral alpha-glucosidase AB isof...    123   4e-28    
dbj|BAA07642.1|  KIAA0088                                               123   4e-28    
ref|XP_006730399.1|  PREDICTED: neutral alpha-glucosidase AB isof...    123   4e-28    
ref|XP_006995257.1|  PREDICTED: neutral alpha-glucosidase AB isof...    123   4e-28    
ref|XP_006730400.1|  PREDICTED: neutral alpha-glucosidase AB isof...    123   4e-28    
ref|XP_002568596.1|  Pc21g15870                                         123   4e-28    
ref|XP_006995256.1|  PREDICTED: neutral alpha-glucosidase AB isof...    123   4e-28    
ref|XP_005645495.1|  glycoside-hydrolase-like protein                   123   4e-28    
ref|XP_005860355.1|  PREDICTED: neutral alpha-glucosidase C isofo...    123   4e-28    
ref|XP_003274133.1|  PREDICTED: neutral alpha-glucosidase AB isof...    123   4e-28    
ref|XP_006158712.1|  PREDICTED: neutral alpha-glucosidase C isofo...    123   4e-28    
dbj|BAC65483.1|  mKIAA0088 protein                                      122   5e-28    
ref|XP_004596827.1|  PREDICTED: neutral alpha-glucosidase AB isof...    123   5e-28    
ref|XP_008705727.1|  PREDICTED: neutral alpha-glucosidase AB isof...    123   5e-28    
ref|XP_005860354.1|  PREDICTED: neutral alpha-glucosidase C isofo...    123   5e-28    
ref|XP_002925412.1|  PREDICTED: neutral alpha-glucosidase AB isof...    123   5e-28    
ref|XP_003274131.1|  PREDICTED: neutral alpha-glucosidase AB isof...    123   5e-28    
ref|XP_005860357.1|  PREDICTED: neutral alpha-glucosidase C isofo...    123   5e-28    
ref|XP_005860359.1|  PREDICTED: neutral alpha-glucosidase C isofo...    123   5e-28    
ref|XP_867560.2|  PREDICTED: neutral alpha-glucosidase AB isoformX2     123   5e-28    
ref|XP_005631674.1|  PREDICTED: neutral alpha-glucosidase AB isof...    123   5e-28    
ref|XP_004596828.1|  PREDICTED: neutral alpha-glucosidase AB isof...    122   5e-28    
ref|XP_004596824.1|  PREDICTED: neutral alpha-glucosidase AB isof...    123   5e-28    
ref|XP_006526741.1|  PREDICTED: neutral alpha-glucosidase AB isof...    122   5e-28    
gb|ELW52032.1|  Neutral alpha-glucosidase AB                            123   5e-28    
ref|XP_005631675.1|  PREDICTED: neutral alpha-glucosidase AB isof...    122   5e-28    
ref|XP_005002927.1|  PREDICTED: neutral alpha-glucosidase AB isof...    122   5e-28    
ref|XP_004596825.1|  PREDICTED: neutral alpha-glucosidase AB isof...    123   5e-28    
ref|XP_004596826.1|  PREDICTED: neutral alpha-glucosidase AB isof...    122   5e-28    
ref|XP_003274132.1|  PREDICTED: neutral alpha-glucosidase AB isof...    122   5e-28    
ref|NP_001280550.1|  neutral alpha-glucosidase AB isoform 2 precu...    123   5e-28    
ref|XP_006730396.1|  PREDICTED: neutral alpha-glucosidase AB isof...    123   6e-28    
ref|XP_008705726.1|  PREDICTED: neutral alpha-glucosidase AB isof...    122   6e-28    
ref|XP_003274129.1|  PREDICTED: neutral alpha-glucosidase AB isof...    123   6e-28    
ref|XP_002925411.1|  PREDICTED: neutral alpha-glucosidase AB isof...    123   6e-28    
ref|XP_007462210.1|  PREDICTED: neutral alpha-glucosidase AB isof...    122   6e-28    
ref|XP_004321717.1|  PREDICTED: neutral alpha-glucosidase C             120   6e-28    
ref|XP_006526740.1|  PREDICTED: neutral alpha-glucosidase AB isof...    122   6e-28    
ref|XP_009248023.1|  PREDICTED: neutral alpha-glucosidase C-like        116   6e-28    
ref|XP_540905.2|  PREDICTED: neutral alpha-glucosidase AB isoformX1     123   6e-28    
ref|XP_005002926.1|  PREDICTED: neutral alpha-glucosidase AB isof...    122   6e-28    
gb|EFB28162.1|  hypothetical protein PANDA_014926                       123   6e-28    
ref|XP_008267355.1|  PREDICTED: neutral alpha-glucosidase C isofo...    122   6e-28    
gb|EDL33398.1|  alpha glucosidase 2 alpha neutral subunit, isofor...    123   6e-28    
gb|EGC47052.1|  glucosidase II alpha subunit                            123   6e-28    
gb|EPQ04006.1|  Neutral alpha-glucosidase C                             123   6e-28    
ref|XP_004660805.1|  PREDICTED: neutral alpha-glucosidase C             122   6e-28    
dbj|BAD90228.1|  mFLJ00088 protein                                      122   6e-28    



>ref|XP_011099673.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Sesamum indicum]
Length=928

 Score =   327 bits (838),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 178/198 (90%), Gaps = 1/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYT+RAKHVSVYLPGDQSWYD+++GTAYKGG THKLE  ++SIPAFQRAGTIIPRKD
Sbjct  731  VQGIYTQRAKHVSVYLPGDQSWYDMKTGTAYKGGATHKLEVSDDSIPAFQRAGTIIPRKD  790

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQMENDPYTLVIALNSS+AAEGELY+DDG+SF F++GAYIHRRF FS G LTS 
Sbjct  791  RFRRSSTQMENDPYTLVIALNSSKAAEGELYVDDGKSFQFQKGAYIHRRFTFSNGKLTSS  850

Query  355  NLKPSSGS-KKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            NL P++ +  KF+SDCTVERIILLGLS  PK+A VEPGN KV++E GPL+LRE +G SVL
Sbjct  851  NLAPATAALSKFTSDCTVERIILLGLSPEPKTASVEPGNEKVDIELGPLVLREGKGQSVL  910

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIRKPNVR+ DDW+IK+L
Sbjct  911  TIRKPNVRISDDWTIKVL  928



>ref|XP_009609691.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Nicotiana tomentosiformis]
Length=921

 Score =   316 bits (810),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 174/198 (88%), Gaps = 2/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYTERAKHVSVYLPGD+SWYDLRSG AYKGG THK E  E+S+P+FQRAGTIIPRKD
Sbjct  725  VQGIYTERAKHVSVYLPGDESWYDLRSGFAYKGGQTHKYEVSEDSVPSFQRAGTIIPRKD  784

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            R RRSSTQMENDPYTLVIALNSSQAAEGELYIDDG+SF+FKQGA+IHRRF FS G LTS 
Sbjct  785  RLRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGKSFEFKQGAFIHRRFTFSKGKLTSS  844

Query  355  NLKPSSG-SKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            N  PSS  + +FSS+CTVERIILLGLS G K+ALVEPGN KVE+E GPL ++ ++G SVL
Sbjct  845  NAAPSSAENDRFSSECTVERIILLGLSPGAKTALVEPGNRKVEIELGPLFIQGNRG-SVL  903

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIRKPNVR+  DWSI+IL
Sbjct  904  TIRKPNVRIAGDWSIQIL  921



>ref|XP_009784325.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Nicotiana sylvestris]
Length=923

 Score =   315 bits (807),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 174/198 (88%), Gaps = 2/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYTERAKHVSVYLPGD+SWYDLRSG AYKGG THK E  E+S+P+FQRAGTIIPRKD
Sbjct  727  VQGIYTERAKHVSVYLPGDESWYDLRSGFAYKGGQTHKYEVSEDSVPSFQRAGTIIPRKD  786

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            R RRSSTQMENDPYTLVI+LNSSQAAEGELYIDDG+SF+FKQGA+IHR F FS G LTS 
Sbjct  787  RLRRSSTQMENDPYTLVISLNSSQAAEGELYIDDGKSFEFKQGAFIHRFFTFSNGKLTSS  846

Query  355  NLKPSS-GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            N  PSS G+ +FSS+CTVERIILLGLS G  +ALVEPGN KVE+E GPL ++ ++G SVL
Sbjct  847  NAAPSSAGNDRFSSECTVERIILLGLSPGATTALVEPGNRKVEIELGPLFIQGNRG-SVL  905

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIRKPNVR+ DDWSI+IL
Sbjct  906  TIRKPNVRIADDWSIQIL  923



>ref|XP_008227517.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Prunus mume]
Length=928

 Score =   314 bits (805),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 170/198 (86%), Gaps = 1/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYTE A+H SVYLPG +SWY++++G AYKGG THKL+  EES+PAFQRAGTIIPRKD
Sbjct  731  VQGIYTEHARHASVYLPGKESWYEVKTGVAYKGGRTHKLDVNEESVPAFQRAGTIIPRKD  790

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALNSSQAAEGELY+DDGRSF+F QGAYIHRRF+FS G LTSL
Sbjct  791  RFRRSSTQMVNDPYTLVIALNSSQAAEGELYVDDGRSFEFHQGAYIHRRFVFSDGKLTSL  850

Query  355  NLKPS-SGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            NL P+  G  +FSS+C +ERIIL GLS G KSAL+EP N K E+EKGPLLL   QGP+V+
Sbjct  851  NLAPTPPGQAQFSSECVIERIILQGLSTGQKSALIEPENQKAEIEKGPLLLHSRQGPTVV  910

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIRKPNVR+ DDW IK+L
Sbjct  911  TIRKPNVRIVDDWVIKLL  928



>ref|XP_007213671.1| hypothetical protein PRUPE_ppa001032mg [Prunus persica]
 gb|EMJ14870.1| hypothetical protein PRUPE_ppa001032mg [Prunus persica]
Length=928

 Score =   313 bits (802),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 170/198 (86%), Gaps = 1/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYTE A+H SVYLPG +SWY++++G AYKGG THKL+  EES+PAFQRAGTIIPRKD
Sbjct  731  VQGIYTEHARHASVYLPGKESWYEVKTGVAYKGGRTHKLDVNEESVPAFQRAGTIIPRKD  790

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALNSSQAAEGELY+DDGRSF+F+QGAYIHRRF+FS G LTSL
Sbjct  791  RFRRSSTQMVNDPYTLVIALNSSQAAEGELYVDDGRSFEFQQGAYIHRRFVFSDGKLTSL  850

Query  355  NLKPS-SGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            NL P+  G  +FSS+C +ERIIL GLS G KSAL+EP N K E+EKGPLLL   QGP+ +
Sbjct  851  NLAPTPPGQAQFSSECVIERIILQGLSTGQKSALIEPENQKAEIEKGPLLLHSRQGPTAI  910

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIRKPNVR+ DDW IK+L
Sbjct  911  TIRKPNVRIVDDWVIKLL  928



>gb|EYU20592.1| hypothetical protein MIMGU_mgv1a001027mg [Erythranthe guttata]
Length=909

 Score =   311 bits (798),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 174/198 (88%), Gaps = 1/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYT+RAKHVSVYLPGD+SWYD++SG+AYKG   HKLEALE+SIP+FQRAGTIIPRKD
Sbjct  712  VQGIYTQRAKHVSVYLPGDESWYDMKSGSAYKGRAIHKLEALEDSIPSFQRAGTIIPRKD  771

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQME DPYTLVIALNSS++AEGELY+DDG++F+F+QG+YIHRRF FS G LTS 
Sbjct  772  RFRRSSTQMEYDPYTLVIALNSSKSAEGELYVDDGKTFEFQQGSYIHRRFTFSNGRLTSS  831

Query  355  NLKP-SSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            N  P ++G  K+ S+CTVERIILLGLS  PK+AL+EP N KV++  GPLLLR   GPSVL
Sbjct  832  NAGPATAGDHKYVSECTVERIILLGLSTQPKTALIEPENRKVDITWGPLLLRGGPGPSVL  891

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIRKPNVR+ DDW+I+IL
Sbjct  892  TIRKPNVRIADDWTIQIL  909



>gb|EYU31239.1| hypothetical protein MIMGU_mgv1a0018152mg, partial [Erythranthe 
guttata]
Length=236

 Score =   291 bits (746),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 167/200 (84%), Gaps = 3/200 (2%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYT+ AKH  VYLPG Q WYD ++G +YKGG T+KL+ LE+S+P+F R GTI+PRKD
Sbjct  37   VQGIYTQGAKHAEVYLPGYQPWYDFKNGNSYKGGETYKLDVLEDSVPSFIRGGTILPRKD  96

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALN S +AEGELYIDDG+SF+F++GAYIHRRF FS G LTS 
Sbjct  97   RFRRSSTQMANDPYTLVIALNQSMSAEGELYIDDGKSFEFQKGAYIHRRFTFSNGKLTSS  156

Query  355  NLKP---SSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPS  185
            N++P   ++G +KF ++ TVERIILLGLS  PK+A++EP N KVE+E GPLLLR  +G S
Sbjct  157  NMRPDDTTAGDRKFETESTVERIILLGLSNAPKNAVIEPANQKVEIEMGPLLLRGGRGLS  216

Query  184  VLTIRKPNVRVGDDWSIKIL  125
            V TIRKP+VR+GDDW+IK+L
Sbjct  217  VPTIRKPDVRIGDDWTIKLL  236



>ref|XP_004163388.1| PREDICTED: neutral alpha-glucosidase C-like [Cucumis sativus]
Length=395

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 167/198 (84%), Gaps = 2/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYT+ AK VSVYLPG QSWYD R+GT YKGG+TH+LE  EESIP FQ+AGTIIPRKD
Sbjct  199  VQGIYTKEAKKVSVYLPGKQSWYDFRTGTIYKGGITHQLEVFEESIPTFQKAGTIIPRKD  258

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            R RRSSTQM NDPYTLV+ALNSSQAAEGELYIDDG+SF+FKQGA+IHRRF+FS G LTSL
Sbjct  259  RSRRSSTQMVNDPYTLVVALNSSQAAEGELYIDDGKSFEFKQGAFIHRRFVFSDGKLTSL  318

Query  355  NLKP-SSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            N+ P +S S KFSS+C +ERIILLG S G KSALVEP N KV++E GPL     +G SVL
Sbjct  319  NVGPIASSSTKFSSNCVIERIILLGHS-GAKSALVEPENRKVDIELGPLHFLRGRGSSVL  377

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIRKPN+ + DDW++K++
Sbjct  378  TIRKPNLLISDDWTVKVV  395



>emb|CDP05480.1| unnamed protein product [Coffea canephora]
Length=913

 Score =   310 bits (794),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 166/198 (84%), Gaps = 1/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQG+YTERAKHVSVYLPGDQSWYDLR+G  YKGG  HK EALE+S+PAFQRAGTIIPRKD
Sbjct  716  VQGVYTERAKHVSVYLPGDQSWYDLRNGATYKGGKRHKFEALEDSVPAFQRAGTIIPRKD  775

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM+ DPYTLVIALNSS+ AEGELYIDDG+SF+F+ GAYIHR F FS G LTS 
Sbjct  776  RFRRSSTQMDKDPYTLVIALNSSKEAEGELYIDDGKSFNFENGAYIHRHFKFSNGKLTSS  835

Query  355  NLKPS-SGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            N  PS +G  KFS+DCTVERIILLGLS  PKSA +EP N KV +E GPL +R  + PS  
Sbjct  836  NAAPSGAGGNKFSTDCTVERIILLGLSPAPKSAFIEPSNQKVGIEMGPLTIRPGKNPSFA  895

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIRKPNVR+ D+W+IKIL
Sbjct  896  TIRKPNVRIADNWTIKIL  913



>ref|XP_011468292.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Fragaria vesca 
subsp. vesca]
Length=917

 Score =   306 bits (783),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 165/197 (84%), Gaps = 2/197 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYTE AKH SVYLPG + WYDL++G A+KGG THKL+  EE +PAFQRAGTIIPRKD
Sbjct  723  VQGIYTEHAKHASVYLPGKELWYDLKTGAAFKGGKTHKLDVNEEGVPAFQRAGTIIPRKD  782

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALNSSQAAEGELY+DDG+SF+F+QG+YIHRRF+F+ G LTSL
Sbjct  783  RFRRSSTQMVNDPYTLVIALNSSQAAEGELYVDDGKSFEFQQGSYIHRRFVFADGKLTSL  842

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLT  176
            NL  + G  +FSS+C +ERIILLGLS G KSA +EP N   E+E+GPLLL   QGP+ LT
Sbjct  843  NL--ALGQTQFSSECVIERIILLGLSTGQKSATIEPANQNAEIERGPLLLHSRQGPTALT  900

Query  175  IRKPNVRVGDDWSIKIL  125
            IRKPNVR+ DDW IKI 
Sbjct  901  IRKPNVRIADDWVIKIF  917



>ref|XP_008394183.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Malus domestica]
Length=934

 Score =   303 bits (775),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 164/198 (83%), Gaps = 1/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYTERA+H SVYLPG + WYD ++G  YKGG T+KL+  EESIPAFQRAGTIIPRKD
Sbjct  737  VQGIYTERARHASVYLPGKELWYDTKTGVTYKGGKTYKLDVNEESIPAFQRAGTIIPRKD  796

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALNSSQAAEGELY+DDGRSF F++GAYIHRRF+FS G LTSL
Sbjct  797  RFRRSSTQMVNDPYTLVIALNSSQAAEGELYVDDGRSFGFQEGAYIHRRFVFSDGKLTSL  856

Query  355  NLKP-SSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            N+ P + G  +FSS+C +ERIIL GLS G K AL+EP N K E+E GPLLL   +GP+ +
Sbjct  857  NMAPVAPGQXQFSSECVIERIILQGLSTGHKGALIEPANQKAEIELGPLLLHSKKGPTAI  916

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIRKPNVRV DDW IK+ 
Sbjct  917  TIRKPNVRVADDWVIKLF  934



>ref|XP_009355853.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Pyrus x bretschneideri]
Length=935

 Score =   303 bits (775),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 165/198 (83%), Gaps = 1/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYTE A+H SVYLPG + WYD ++G AYKGG T+KL+  EESIPAFQRAGTIIPRKD
Sbjct  738  VQGIYTEHARHASVYLPGKELWYDTKTGVAYKGGKTYKLDVNEESIPAFQRAGTIIPRKD  797

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALNSSQAAEGELY+DDGRSF F++GAYIHRRF+FS G LTS+
Sbjct  798  RFRRSSTQMVNDPYTLVIALNSSQAAEGELYVDDGRSFGFQEGAYIHRRFVFSDGKLTSV  857

Query  355  NLKPSS-GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            N+ P++ G  +FSS+C +ERIIL GLS G KSAL+EP N K E+E GPLLL   +GP+  
Sbjct  858  NMAPAAPGQNQFSSECVIERIILQGLSSGQKSALIEPANQKAEIELGPLLLHSKKGPTAT  917

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIRKPNVR+ DDW IK+ 
Sbjct  918  TIRKPNVRIADDWVIKLF  935



>ref|XP_008394182.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Malus domestica]
Length=934

 Score =   303 bits (775),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 164/198 (83%), Gaps = 1/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYTERA+H SVYLPG + WYD ++G  YKGG T+KL+  EESIPAFQRAGTIIPRKD
Sbjct  737  VQGIYTERARHASVYLPGKELWYDTKTGVTYKGGKTYKLDVNEESIPAFQRAGTIIPRKD  796

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALNSSQAAEGELY+DDGRSF F++GAYIHRRF+FS G LTSL
Sbjct  797  RFRRSSTQMVNDPYTLVIALNSSQAAEGELYVDDGRSFGFQEGAYIHRRFVFSDGKLTSL  856

Query  355  NLKP-SSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            N+ P + G  +FSS+C +ERIIL GLS G K AL+EP N K E+E GPLLL   +GP+ +
Sbjct  857  NMAPVAPGQXQFSSECVIERIILQGLSTGHKGALIEPANQKAEIELGPLLLHSKKGPTAI  916

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIRKPNVRV DDW IK+ 
Sbjct  917  TIRKPNVRVADDWVIKLF  934



>ref|XP_002270200.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Vitis vinifera]
Length=926

 Score =   300 bits (768),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 161/197 (82%), Gaps = 0/197 (0%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYTE+ KH SVYLPG QSWYDLR+G  YKGG  HKLE  EE+IPAFQRAGTIIPRKD
Sbjct  730  VQGIYTEQVKHASVYLPGGQSWYDLRTGIIYKGGTAHKLEVSEETIPAFQRAGTIIPRKD  789

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            R+RRSSTQM NDPYTLVIALN S AAEGELYIDDG+SF+FKQGAYIHR F+FS G LTS 
Sbjct  790  RYRRSSTQMANDPYTLVIALNGSHAAEGELYIDDGKSFEFKQGAYIHRHFVFSDGKLTSS  849

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLT  176
            +L P++G   FSS C +ERII+LG S GPK+AL+EP N K E+E GPL LR  +   VLT
Sbjct  850  SLVPNAGRTLFSSACVIERIIVLGHSSGPKNALIEPSNRKAEIELGPLWLRRGKSAPVLT  909

Query  175  IRKPNVRVGDDWSIKIL  125
            IR+PNV V DDW+IKIL
Sbjct  910  IRRPNVPVADDWTIKIL  926



>gb|KHN31186.1| Neutral alpha-glucosidase AB [Glycine soja]
Length=889

 Score =   299 bits (765),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 166/198 (84%), Gaps = 1/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYTERAKH SVYLPG QSWYDLR+G  YKGG+THKLE  EESIPAFQRAGTII RKD
Sbjct  692  VQGIYTERAKHASVYLPGKQSWYDLRTGAVYKGGVTHKLEVTEESIPAFQRAGTIIARKD  751

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLV+ALNSSQAAEGELYIDDG SF+F QG YIHRRFIFS G LTS+
Sbjct  752  RFRRSSTQMANDPYTLVVALNSSQAAEGELYIDDGSSFNFLQGGYIHRRFIFSNGKLTSI  811

Query  355  NLKPSSGSK-KFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +L P+SGSK ++ SD  +ERIILLG +   K+AL+EP N KV++E GPL +  ++ P+V 
Sbjct  812  DLAPASGSKGRYPSDAFIERIILLGHAPSSKNALIEPSNQKVDIELGPLWVLRARAPAVT  871

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIR+PNVRV +DW+I ++
Sbjct  872  TIRRPNVRVAEDWTITVI  889



>ref|XP_010674404.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Beta vulgaris 
subsp. vulgaris]
Length=943

 Score =   300 bits (767),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 171/198 (86%), Gaps = 1/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQG+Y+E+AKH SVYLPG+Q WYD+R+G+ YKGG+THKLE  +ES+PAFQRAGTIIPRKD
Sbjct  746  VQGVYSEQAKHASVYLPGEQYWYDMRTGSPYKGGVTHKLELSDESVPAFQRAGTIIPRKD  805

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            R+RRSSTQM NDPYTLVIALNSSQ+AEGELY+DDG+SF+F++GAYIHRRFIFS G LTSL
Sbjct  806  RYRRSSTQMVNDPYTLVIALNSSQSAEGELYVDDGKSFEFQRGAYIHRRFIFSDGKLTSL  865

Query  355  NLKPSSGSKK-FSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            N+ PS  + + FS++C VERIILLG    PKSAL+EP N + E+E GPL ++ S+  SVL
Sbjct  866  NMAPSGNNGRLFSTECVVERIILLGHPSRPKSALIEPSNKETEIEMGPLRVQRSRIASVL  925

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIRKPNVRV DDW+I+IL
Sbjct  926  TIRKPNVRVTDDWTIRIL  943



>ref|XP_002529411.1| neutral alpha-glucosidase ab precursor, putative [Ricinus communis]
 gb|EEF33007.1| neutral alpha-glucosidase ab precursor, putative [Ricinus communis]
Length=923

 Score =   298 bits (764),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 166/199 (83%), Gaps = 2/199 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYTERAKH +VYLPG +SWYD ++GTA+KGG THKLE  EES+PAFQRAGTI+PRKD
Sbjct  725  VQGIYTERAKHATVYLPGKESWYDFKTGTAFKGGKTHKLEVSEESVPAFQRAGTILPRKD  784

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            R+RRSSTQM NDPYTLVIALNSSQAAEGELY+DDG SF+F QGA+IHRRF+FS G LTS+
Sbjct  785  RYRRSSTQMVNDPYTLVIALNSSQAAEGELYVDDGESFEFLQGAFIHRRFVFSKGKLTSI  844

Query  355  NLKPSSGSK-KFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQ-GPSV  182
            NL PSS  K +FSS C +ERIILLG S G K AL+EP N+KVE+  GPL L  S  G +V
Sbjct  845  NLAPSSNVKSRFSSKCVIERIILLGYSPGAKDALIEPANHKVEIAPGPLRLHGSAGGAAV  904

Query  181  LTIRKPNVRVGDDWSIKIL  125
            +TIRKP V + DDW+IKIL
Sbjct  905  VTIRKPMVHIADDWTIKIL  923



>ref|XP_004502983.1| PREDICTED: neutral alpha-glucosidase AB-like [Cicer arietinum]
Length=913

 Score =   297 bits (761),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 165/198 (83%), Gaps = 1/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYTERAKH SVYLPG QSWYDLR+GT YKGG+THKLE  EESIPAFQR GTI+ RKD
Sbjct  716  VQGIYTERAKHASVYLPGKQSWYDLRTGTVYKGGVTHKLEVTEESIPAFQRGGTILTRKD  775

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDP+TLVIALNSSQAAEGELYIDDG SF F +GA+IHRRFIF+ G LTS+
Sbjct  776  RFRRSSTQMTNDPFTLVIALNSSQAAEGELYIDDGSSFGFLEGAFIHRRFIFANGKLTSV  835

Query  355  NLKPSSGSK-KFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            NL P+SG   + +SD  +ERIILLG + G K+AL+EP N  V++E GPL ++ +  P+ +
Sbjct  836  NLAPTSGGNVRHTSDVLIERIILLGHAPGSKNALIEPSNQNVDIELGPLWVQRAHSPAFM  895

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIRKPNVRV +DW+IKIL
Sbjct  896  TIRKPNVRVAEDWTIKIL  913



>ref|XP_002268690.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Vitis vinifera]
Length=926

 Score =   297 bits (761),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 161/197 (82%), Gaps = 0/197 (0%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYTERAK+ SVYLPG QSWYDLR+G  YKGG THKLE  EE+IPAF RAGTIIPRKD
Sbjct  730  VQGIYTERAKYASVYLPGGQSWYDLRTGIIYKGGTTHKLEVSEETIPAFHRAGTIIPRKD  789

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            R+RRSST M NDPYTLVIALNSS AAEGELYID+G+SF+FKQGAYIHR F+FS G LTS 
Sbjct  790  RYRRSSTLMANDPYTLVIALNSSHAAEGELYIDNGKSFEFKQGAYIHRHFVFSDGKLTSS  849

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLT  176
            +L P++    FSS C +ERII+LG S GPK+AL+EP N K E+E GPL LR  +   VLT
Sbjct  850  SLVPNASKTLFSSACVIERIIVLGHSSGPKNALIEPSNRKAEIELGPLWLRRGKSAPVLT  909

Query  175  IRKPNVRVGDDWSIKIL  125
            IRKPNV V DDW+IKIL
Sbjct  910  IRKPNVPVADDWTIKIL  926



>ref|XP_009364181.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Pyrus x bretschneideri]
Length=934

 Score =   297 bits (761),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 163/198 (82%), Gaps = 1/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIY ERA+H SV+LPG + WYD ++G AYKGG  +KLE  EES+PAFQRAGTIIPRKD
Sbjct  737  VQGIYAERARHASVFLPGKELWYDTKTGVAYKGGKIYKLEVNEESVPAFQRAGTIIPRKD  796

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALNSSQAAEGELY+DDGRSF+F++GAYIHRRFIFS G LTSL
Sbjct  797  RFRRSSTQMVNDPYTLVIALNSSQAAEGELYVDDGRSFEFQKGAYIHRRFIFSEGKLTSL  856

Query  355  NL-KPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            NL   +SG  +FS  C +ERIIL GLS G KSAL+EP + K E+E GPLL+    GP+ +
Sbjct  857  NLASAASGQNEFSCGCVIERIILQGLSTGQKSALIEPASQKAEIELGPLLMHSRHGPTAI  916

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIRKPNVR+ DDW IK+L
Sbjct  917  TIRKPNVRIADDWVIKML  934



>ref|XP_003523210.1| PREDICTED: neutral alpha-glucosidase AB-like [Glycine max]
Length=914

 Score =   296 bits (759),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 165/198 (83%), Gaps = 1/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYTERAKH SVYLPG QSWYDLR+G  YKGG+THKLE  EESIPAFQRAGTII RKD
Sbjct  717  VQGIYTERAKHASVYLPGKQSWYDLRTGAVYKGGVTHKLEVTEESIPAFQRAGTIIARKD  776

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLV+ALNSSQAAEGELYIDDG SF+F QG YIHRRFIFS G LTS+
Sbjct  777  RFRRSSTQMANDPYTLVVALNSSQAAEGELYIDDGSSFNFLQGGYIHRRFIFSNGKLTSI  836

Query  355  NLKPSSGSK-KFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +L P+S SK ++ SD  +ERIILLG +   K+AL+EP N KV++E GPL +  ++ P+V 
Sbjct  837  DLAPASSSKGRYPSDAFIERIILLGHAPSSKNALIEPSNQKVDIELGPLWVLRARAPAVT  896

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIR+PNVRV +DW+I ++
Sbjct  897  TIRRPNVRVAEDWTITVI  914



>gb|KDP24259.1| hypothetical protein JCGZ_26689 [Jatropha curcas]
Length=919

 Score =   296 bits (758),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 166/198 (84%), Gaps = 3/198 (2%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYTERAKH SVYLPG +SWYD R+GT +KGG THKLE  EESIPAFQRAGTIIPRKD
Sbjct  724  VQGIYTERAKHASVYLPGKESWYDFRTGTPFKGGKTHKLEVSEESIPAFQRAGTIIPRKD  783

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            R+RRSSTQM +DPYTLVIALNSSQ AEGELYIDDG+SF+F QGAY+HRRF+FS G LTS 
Sbjct  784  RYRRSSTQMVDDPYTLVIALNSSQEAEGELYIDDGKSFEFTQGAYMHRRFVFSDGALTSS  843

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLR-ESQGPSVL  179
            NL  ++G  + SS+C VERIILLG S GPKSAL+EP N KVE+E GPL  R  ++G S++
Sbjct  844  NL--NNGKSQSSSNCVVERIILLGCSPGPKSALIEPSNQKVEIELGPLSFRGGARGASIV  901

Query  178  TIRKPNVRVGDDWSIKIL  125
            T+RKP VR+ DDW+IKI 
Sbjct  902  TVRKPMVRIADDWTIKIF  919



>ref|XP_010027570.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Eucalyptus 
grandis]
 ref|XP_010027571.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Eucalyptus 
grandis]
 gb|KCW54130.1| hypothetical protein EUGRSUZ_I00112 [Eucalyptus grandis]
 gb|KCW54131.1| hypothetical protein EUGRSUZ_I00112 [Eucalyptus grandis]
 gb|KCW54132.1| hypothetical protein EUGRSUZ_I00112 [Eucalyptus grandis]
 gb|KCW54133.1| hypothetical protein EUGRSUZ_I00112 [Eucalyptus grandis]
 gb|KCW54134.1| hypothetical protein EUGRSUZ_I00112 [Eucalyptus grandis]
 gb|KCW54135.1| hypothetical protein EUGRSUZ_I00112 [Eucalyptus grandis]
Length=930

 Score =   296 bits (757),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 165/198 (83%), Gaps = 1/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGI+TERAKHVSVYLPG +SWYDLR+GT Y G  THKLEA E+ +PAFQRAGTIIPR+D
Sbjct  733  VQGIFTERAKHVSVYLPGKESWYDLRTGTTYLGSKTHKLEAPEDHVPAFQRAGTIIPRRD  792

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRS+TQ  NDPYTLVIALNSSQ AEGELYIDDG+SF+FK GAYIHRRF+F  G LTSL
Sbjct  793  RFRRSTTQTVNDPYTLVIALNSSQTAEGELYIDDGKSFEFKHGAYIHRRFVFKGGKLTSL  852

Query  355  NLKP-SSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            N+ P +SG+  F S+C +ERII+LG + GPK+AL+EPGN K +VE GPLLL+      VL
Sbjct  853  NMAPATSGNLPFKSECIIERIIILGHAGGPKNALIEPGNLKAQVEFGPLLLQGRSSSGVL  912

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIRKP +R+ DDW+IK+L
Sbjct  913  TIRKPGIRIADDWTIKVL  930



>gb|KDO57535.1| hypothetical protein CISIN_1g0024422mg, partial [Citrus sinensis]
Length=731

 Score =   291 bits (746),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQG+Y ERAKH+SVYLPG +SWYD+R+G   KGG+THKLE  EES+PAFQR GTIIPR+D
Sbjct  536  VQGVYEERAKHISVYLPGKESWYDIRTGARVKGGVTHKLEVSEESVPAFQRPGTIIPRRD  595

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLV+ALNSSQAAEG+LY+DDG+SFDF +GA+IHRRF+FS G L S+
Sbjct  596  RFRRSSTQMVNDPYTLVVALNSSQAAEGQLYVDDGKSFDFLEGAFIHRRFVFSNGQLKSI  655

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLT  176
            N+ P++G  +FSS+C +ERIILLG   G KSA++EP N K E+E GPL L+   G +VLT
Sbjct  656  NMAPAAGKSRFSSECIIERIILLGHG-GSKSAVIEPANQKAEIELGPLQLQGRHGRTVLT  714

Query  175  IRKPNVRVGDDWSIKIL  125
            +R P VR+ DDW+IKIL
Sbjct  715  VRNPGVRISDDWTIKIL  731



>ref|XP_007137757.1| hypothetical protein PHAVU_009G153400g [Phaseolus vulgaris]
 gb|ESW09751.1| hypothetical protein PHAVU_009G153400g [Phaseolus vulgaris]
Length=917

 Score =   295 bits (755),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 165/198 (83%), Gaps = 1/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYTERAKH SVYLPG +SWYDLR+GTAYKG + HKLE  EESIPAFQRAGTII RKD
Sbjct  719  VQGIYTERAKHASVYLPGKESWYDLRTGTAYKGRVKHKLEVTEESIPAFQRAGTIIARKD  778

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALNSSQ AEGELYIDDG SF+F QGAYIHRRFIFS G LTS+
Sbjct  779  RFRRSSTQMANDPYTLVIALNSSQEAEGELYIDDGSSFNFLQGAYIHRRFIFSNGKLTSI  838

Query  355  NLKPSSGS-KKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +L P+SGS +++ SD  +ERIILLG + G K+AL+EP N K+++E GPL    ++ P+V+
Sbjct  839  DLAPASGSNRRYPSDAFIERIILLGQAPGSKNALIEPSNQKIDIELGPLWFLRARAPAVV  898

Query  178  TIRKPNVRVGDDWSIKIL  125
            T+RKP VRV +DWSI  +
Sbjct  899  TVRKPYVRVAEDWSITFM  916



>ref|XP_004147325.1| PREDICTED: neutral alpha-glucosidase AB-like [Cucumis sativus]
 gb|KGN62240.1| hypothetical protein Csa_2G338840 [Cucumis sativus]
Length=917

 Score =   295 bits (755),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 167/198 (84%), Gaps = 2/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYT+ AK VSVYLPG QSWYD R+GT YKGG+TH+LE  EESIP FQ+AGTIIPRKD
Sbjct  721  VQGIYTKEAKKVSVYLPGKQSWYDFRTGTIYKGGITHQLEVFEESIPTFQKAGTIIPRKD  780

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            R RRSSTQM NDPYTLV+ALNSSQAAEGELYIDDG+SF+FKQGA+IHRRF+FS G LTSL
Sbjct  781  RSRRSSTQMVNDPYTLVVALNSSQAAEGELYIDDGKSFEFKQGAFIHRRFVFSDGKLTSL  840

Query  355  NLKP-SSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            N+ P +S S KFSS+C +ERIILLG S G KSALVEP N KV++E GPL     +G SVL
Sbjct  841  NVGPIASSSTKFSSNCVIERIILLGHS-GAKSALVEPENRKVDIELGPLHFLRGRGSSVL  899

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIRKPN+ + DDW++K++
Sbjct  900  TIRKPNLLISDDWTVKVV  917



>ref|XP_006464915.1| PREDICTED: neutral alpha-glucosidase AB-like [Citrus sinensis]
Length=924

 Score =   293 bits (749),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQG+Y ERAKH+SVYLPG +SWYD+R+G   KGG+THKLE  EES+PAFQRAGTIIPR+D
Sbjct  729  VQGVYEERAKHISVYLPGKESWYDIRTGARVKGGVTHKLEVSEESVPAFQRAGTIIPRRD  788

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLV+ALNSSQAAEG+LY+DDG+SFDF +GA+IHRRF+FS   L S+
Sbjct  789  RFRRSSTQMVNDPYTLVVALNSSQAAEGQLYVDDGKSFDFLEGAFIHRRFVFSNSHLKSI  848

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLT  176
            N+ P++G  +FSS+C +ERIILLG   G KSAL+EP N K E+E GPL L+   G +VLT
Sbjct  849  NMAPAAGKSRFSSECIIERIILLGHG-GSKSALIEPANQKAEIELGPLQLQGQHGRTVLT  907

Query  175  IRKPNVRVGDDWSIKIL  125
            +R P VR+ DDW+IKIL
Sbjct  908  VRNPGVRISDDWTIKIL  924



>gb|KJB40495.1| hypothetical protein B456_007G066900 [Gossypium raimondii]
Length=917

 Score =   292 bits (747),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 159/197 (81%), Gaps = 4/197 (2%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYT RAKHVSVYLPG +SWYDLR+GTAYKGG  HKLE  EESIPAFQRAGTI+PRKD
Sbjct  725  VQGIYTARAKHVSVYLPGKESWYDLRTGTAYKGGKVHKLEVSEESIPAFQRAGTIVPRKD  784

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            R RRSSTQM +DPYTLVIALNSSQAAEGELY+DDG+S+DFK GAYIHRRF+FS G LTS 
Sbjct  785  RLRRSSTQMVHDPYTLVIALNSSQAAEGELYVDDGKSYDFKHGAYIHRRFVFSNGHLTSS  844

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLT  176
             +    G+ +FSSDC +ER+ILLG + G K+ALVEPGN K E+E GPL          +T
Sbjct  845  PV----GNSRFSSDCIIERVILLGFTPGAKTALVEPGNQKAEIELGPLRFGGQHAAVAVT  900

Query  175  IRKPNVRVGDDWSIKIL  125
            IRKP VRV +DW IKIL
Sbjct  901  IRKPGVRVAEDWKIKIL  917



>ref|XP_003602674.1| Neutral alpha-glucosidase AB [Medicago truncatula]
 ref|XP_003638244.1| Neutral alpha-glucosidase AB [Medicago truncatula]
 gb|AES72925.1| neutral alpha-glucosidase [Medicago truncatula]
Length=912

 Score =   291 bits (744),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 166/198 (84%), Gaps = 1/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYTERAKH SVYLPG QSWYDLR+GT YKGG+THKL+  EESIPAFQRAGTI+ RKD
Sbjct  715  VQGIYTERAKHASVYLPGKQSWYDLRTGTVYKGGVTHKLDVTEESIPAFQRAGTILTRKD  774

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSS+QM NDP+TLV+ALNSSQAAEGELYIDDG SF F +GA+IHRRFIF+ G L+S+
Sbjct  775  RFRRSSSQMTNDPFTLVVALNSSQAAEGELYIDDGSSFGFLEGAFIHRRFIFANGKLSSV  834

Query  355  NLKPSSGSK-KFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +L P+SG   + +SD  +ERII+LG + G K+AL+E  N KV++E GPL ++ +  P+ +
Sbjct  835  DLAPTSGGNVRHTSDVVIERIIVLGHAHGSKNALIETSNQKVDIELGPLWVQRAHSPAFM  894

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIRKPNVRV +DW+IKIL
Sbjct  895  TIRKPNVRVAEDWTIKIL  912



>ref|XP_011022868.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Populus euphratica]
Length=932

 Score =   290 bits (743),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 168/198 (85%), Gaps = 1/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYTERAK+VSVYLPG + WYD+R+G AYKGG THKLEA EES+PAFQRAGTIIPRKD
Sbjct  735  VQGIYTERAKYVSVYLPGKELWYDIRTGAAYKGGKTHKLEAKEESVPAFQRAGTIIPRKD  794

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            R RRSSTQM NDPYTLVIALNSSQAAEGELYIDDG+S++F QGAYIHRRF+F+ G LTS 
Sbjct  795  RLRRSSTQMVNDPYTLVIALNSSQAAEGELYIDDGKSYEFLQGAYIHRRFVFANGKLTST  854

Query  355  NLKPSSGSKKFSSDCTV-ERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            NL PSS SK   S  ++ ERIILLG S GPK+AL+EP N +VEVE GPL+L   +G SV+
Sbjct  855  NLAPSSSSKSQFSSKSILERIILLGYSPGPKNALIEPANQEVEVELGPLMLEGGRGSSVV  914

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIRKP V+V DDW+IKIL
Sbjct  915  TIRKPAVQVSDDWTIKIL  932



>ref|XP_007048509.1| Glycosyl hydrolases family 31 protein isoform 1 [Theobroma cacao]
 gb|EOX92666.1| Glycosyl hydrolases family 31 protein isoform 1 [Theobroma cacao]
Length=923

 Score =   290 bits (742),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 161/198 (81%), Gaps = 2/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGI++ERAKH SVYLPG + WYD R+G+AYKGG  HKLE  EESIPAFQRAGTI+PRKD
Sbjct  727  VQGIFSERAKHASVYLPGKELWYDFRTGSAYKGGKIHKLEVSEESIPAFQRAGTILPRKD  786

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM +DPYTLVIALNSSQAAEGELY+DDG+SFDF  GAYIHRRF+FS G LTS 
Sbjct  787  RFRRSSTQMVHDPYTLVIALNSSQAAEGELYLDDGKSFDFMHGAYIHRRFVFSNGQLTSS  846

Query  355  NL-KPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            N+  PS G   FSSDC +ERIILL  + GPKSALVEPGN   E+E GPL L    G + +
Sbjct  847  NMASPSLGRSGFSSDCIIERIILLEHTPGPKSALVEPGNKYAEIELGPLRL-GGHGAAAV  905

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIRKP VRV +DW+IKIL
Sbjct  906  TIRKPGVRVAEDWTIKIL  923



>ref|XP_002310537.1| hypothetical protein POPTR_0007s04720g [Populus trichocarpa]
 gb|EEE90987.1| hypothetical protein POPTR_0007s04720g [Populus trichocarpa]
Length=932

 Score =   290 bits (742),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 168/198 (85%), Gaps = 1/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYTERAK+ SVYLPG + WYD+R+G AYKGG THKLEA EES+PAFQRAGTIIPRKD
Sbjct  735  VQGIYTERAKYTSVYLPGKELWYDIRTGAAYKGGKTHKLEAKEESVPAFQRAGTIIPRKD  794

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            R RRSSTQM NDPYTLVIALNSSQAAEGELYIDDG+S++F QGAYIHRRF+F+ G LTS+
Sbjct  795  RLRRSSTQMVNDPYTLVIALNSSQAAEGELYIDDGKSYEFLQGAYIHRRFVFANGKLTSI  854

Query  355  NLKPSSGSKKFSSDCTV-ERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            NL PSS SK   S  ++ ERIILLG S GPK+AL+EP N +VEVE GPL+L   +G SV+
Sbjct  855  NLAPSSSSKSQFSSKSILERIILLGYSPGPKNALIEPANQEVEVELGPLMLEGGRGSSVV  914

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIRKP V+V DDW+IKIL
Sbjct  915  TIRKPAVQVSDDWTIKIL  932



>gb|AFW89190.1| hypothetical protein ZEAMMB73_762165 [Zea mays]
Length=558

 Score =   281 bits (720),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 159/196 (81%), Gaps = 0/196 (0%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
             QGIY E  K VSVYLPG +SWYDLR+G+ YKG +THKL+ LE+SIP+FQRAGTI+PRKD
Sbjct  362  AQGIYEEGQKSVSVYLPGKESWYDLRNGSPYKGSVTHKLQVLEDSIPSFQRAGTIVPRKD  421

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALNSS AAEGELY+DDG+S+D++QGA+ HRRF+F+   LTS 
Sbjct  422  RFRRSSTQMVNDPYTLVIALNSSGAAEGELYMDDGKSYDYQQGAFSHRRFVFADNKLTSF  481

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLT  176
            N+ P + SKKF+S C +ERII+LGL  G K A++EPGN +VE+E GP+ LR    P V T
Sbjct  482  NIAPDNLSKKFTSGCVIERIIVLGLRSGVKKAIIEPGNQEVEIESGPISLRSGSSPVVPT  541

Query  175  IRKPNVRVGDDWSIKI  128
            IR+PNVR+ D W+I I
Sbjct  542  IRRPNVRIADSWTIWI  557



>ref|XP_008460826.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Cucumis melo]
 ref|XP_008460827.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Cucumis melo]
Length=917

 Score =   289 bits (740),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 165/198 (83%), Gaps = 2/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYT+ AK VSVY PG QSWYD R+GT YKGG+TH++E  EE IP FQ+AGTIIPRKD
Sbjct  721  VQGIYTKEAKKVSVYFPGKQSWYDFRTGTIYKGGVTHQIEVFEEGIPTFQKAGTIIPRKD  780

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLV+ALNSSQ AEGELYIDDG+SF+FKQGA+IHRRF+FS G LTSL
Sbjct  781  RFRRSSTQMVNDPYTLVVALNSSQTAEGELYIDDGKSFEFKQGAFIHRRFVFSDGKLTSL  840

Query  355  NLKP-SSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            N+ P +S S KFSS+C +ERIILLG S G KSALVEP N KV++E GPL   + +  SVL
Sbjct  841  NVGPIASSSTKFSSNCFIERIILLGHS-GAKSALVEPENRKVDIELGPLHFLKGRRTSVL  899

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIRKPN+ + DDW++KI+
Sbjct  900  TIRKPNLLIRDDWTVKIV  917



>ref|XP_008801944.1| PREDICTED: LOW QUALITY PROTEIN: probable glucan 1,3-alpha-glucosidase 
[Phoenix dactylifera]
Length=927

 Score =   289 bits (740),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 162/197 (82%), Gaps = 0/197 (0%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIY ER K VSVYLP  QSWY+LR+G +Y GG++HKLE  E+SIP FQRAGTIIPRKD
Sbjct  731  VQGIYEERQKSVSVYLPDGQSWYNLRNGVSYTGGVSHKLEVSEDSIPTFQRAGTIIPRKD  790

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLV+ALN S AAEGELY+DDG+S+DF+QGAYIHRRFIF+   LTS+
Sbjct  791  RFRRSSTQMVNDPYTLVVALNGSLAAEGELYVDDGKSYDFEQGAYIHRRFIFADRKLTSV  850

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLT  176
            N+ P++   KFSSDC +ERI+LLGL  G K A++EPGN++ +VE GPL LR    P  +T
Sbjct  851  NVHPANLGGKFSSDCVIERIVLLGLPSGAKKAVIEPGNHEADVELGPLTLRGGSSPDAIT  910

Query  175  IRKPNVRVGDDWSIKIL  125
            +RKPNVR+ DDW+++IL
Sbjct  911  VRKPNVRIADDWTLRIL  927



>ref|XP_010270270.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Nelumbo nucifera]
Length=945

 Score =   288 bits (738),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 165/198 (83%), Gaps = 1/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYTE A+H SVYLP  QSWYDLR+G AYKGG+THKLE  EESIPAFQ+AGTI+PRKD
Sbjct  748  VQGIYTEHARHASVYLPAGQSWYDLRTGVAYKGGVTHKLEVSEESIPAFQKAGTIVPRKD  807

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM  DPYTLVIALNSS+AAEGELYIDDG+SF+F++G YIHRRF+FS G L S 
Sbjct  808  RFRRSSTQMVKDPYTLVIALNSSKAAEGELYIDDGKSFEFEKGDYIHRRFLFSDGKLVSS  867

Query  355  NLKPSSGSKK-FSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            N  P + S   FSSDC +ERI+LLGLS G KSA++EP N++V++E GPL LR  Q PS  
Sbjct  868  NASPPASSNTPFSSDCFIERIVLLGLSLGAKSAIIEPANHRVDIELGPLNLRRGQMPSFP  927

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIRKPNVR+ DDW+IKIL
Sbjct  928  TIRKPNVRIADDWTIKIL  945



>ref|XP_002468270.1| hypothetical protein SORBIDRAFT_01g042750 [Sorghum bicolor]
 gb|EER95268.1| hypothetical protein SORBIDRAFT_01g042750 [Sorghum bicolor]
Length=917

 Score =   286 bits (733),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 160/196 (82%), Gaps = 0/196 (0%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
             QGIY E  K VSVYLPG +SWYDLR+G+ YKG +THKL+ LE+SIP+FQRAGTI+PRKD
Sbjct  721  AQGIYEEGQKSVSVYLPGKESWYDLRNGSPYKGSVTHKLQVLEDSIPSFQRAGTIVPRKD  780

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALNSS AAEGELY+DDG+S+D++QGA+IHRRF+F+   LTS 
Sbjct  781  RFRRSSTQMVNDPYTLVIALNSSGAAEGELYVDDGKSYDYQQGAFIHRRFVFADNKLTSF  840

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLT  176
            N+ P +  KKF+SDC +ERII+LGL  G K A++EPGN +VE+E GP+ LR    P   T
Sbjct  841  NIAPDNLGKKFASDCVIERIIVLGLRSGAKKAIIEPGNQEVEIESGPISLRSGSSPVAPT  900

Query  175  IRKPNVRVGDDWSIKI  128
            IR+PNVR+ D W+I+I
Sbjct  901  IRRPNVRIADSWTIRI  916



>gb|ABF94648.1| Neutral alpha-glucosidase AB precursor, putative, expressed [Oryza 
sativa Japonica Group]
Length=640

 Score =   281 bits (718),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
             QGIY E  K VSVYLPG++ WYDLR+G+ YKGG++HKLE  E+SIP+FQRAG I+PRKD
Sbjct  443  AQGIYEEGQKSVSVYLPGEELWYDLRNGSPYKGGVSHKLEVSEDSIPSFQRAGAIVPRKD  502

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALNSS AAEGELY+DDG+S+D++QGA+IHRRF+F+   LTS+
Sbjct  503  RFRRSSTQMVNDPYTLVIALNSSSAAEGELYVDDGKSYDYQQGAFIHRRFVFADNKLTSM  562

Query  355  NLKPSS-GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            N+ P + G+KKFS++C +ERII+LG+S G K A+VEPGN++V++E GP+ LR        
Sbjct  563  NIAPKNLGNKKFSTECVIERIIILGVSSGSKKAIVEPGNHEVDIELGPISLRSGSSSVAP  622

Query  178  TIRKPNVRVGDDWSIKI  128
            T+RKPNVRV DDW+I+I
Sbjct  623  TVRKPNVRVVDDWTIRI  639



>emb|CDX81200.1| BnaC09g06110D [Brassica napus]
Length=641

 Score =   280 bits (715),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 158/200 (79%), Gaps = 5/200 (3%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQG+YT+   H SVYLPG +SWYDLR+G  Y GG THK++A EESIPAFQRAGTIIPRKD
Sbjct  444  VQGVYTKGTTHASVYLPGKESWYDLRNGKTYVGGKTHKMDAPEESIPAFQRAGTIIPRKD  503

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSS QM+NDPYTLVIALNSSQ A+GELYIDDG+SF+FK+GAYIHRRF+FS G LTS 
Sbjct  504  RFRRSSFQMDNDPYTLVIALNSSQEADGELYIDDGKSFEFKRGAYIHRRFVFSNGVLTSK  563

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLL---LRESQGPS  185
            N+ P   S   SS C ++RIILLG S GP SALVEP N K E+E GPL    L  S G +
Sbjct  564  NVAPPEAS--LSSQCLIDRIILLGHSSGPNSALVEPLNQKAEIEMGPLRMGGLVASSGTN  621

Query  184  VLTIRKPNVRVGDDWSIKIL  125
            VLTIRKP VRV  DW+IKIL
Sbjct  622  VLTIRKPGVRVDQDWTIKIL  641



>ref|XP_004985180.1| PREDICTED: neutral alpha-glucosidase AB-like [Setaria italica]
Length=917

 Score =   285 bits (730),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 162/197 (82%), Gaps = 1/197 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
             QGIY E  K VSVYLPG +SWYDLR+G+ YKG ++HKL+ LE+SIP+FQR GTI+PRKD
Sbjct  720  AQGIYEEGQKSVSVYLPGKESWYDLRNGSPYKGSMSHKLQVLEDSIPSFQRGGTIVPRKD  779

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALNSS AAEGELY+DDG+S+D++ GA+IHRRF+F+   LTSL
Sbjct  780  RFRRSSTQMVNDPYTLVIALNSSNAAEGELYVDDGKSYDYQHGAFIHRRFVFADNKLTSL  839

Query  355  NLKPSS-GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            N+ P + G KKF+S+C +ERII+LGL  G K A++EPGN +VE+E GP+ LR    P+  
Sbjct  840  NIAPDNLGKKKFTSECVIERIIILGLRSGAKKAIIEPGNQEVEIESGPVSLRSGSSPAAP  899

Query  178  TIRKPNVRVGDDWSIKI  128
            TIR+PNVR+ DDW+I+I
Sbjct  900  TIRRPNVRIADDWTIRI  916



>gb|ACN26464.1| unknown [Zea mays]
Length=731

 Score =   281 bits (719),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 159/196 (81%), Gaps = 0/196 (0%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
             QGIY E  K VSVYLPG +SWYDLR+G+ YKG +THKL+ LE+SIP+FQRAGTI+PRKD
Sbjct  535  AQGIYEEGQKSVSVYLPGKESWYDLRNGSPYKGSVTHKLQVLEDSIPSFQRAGTIVPRKD  594

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALNSS AAEGELY+DDG+S+D++QGA+ HRRF+F+   LTS 
Sbjct  595  RFRRSSTQMVNDPYTLVIALNSSGAAEGELYMDDGKSYDYQQGAFSHRRFVFADNKLTSF  654

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLT  176
            N+ P + SKKF+S C +ERII+LGL  G K A++EPGN +VE+E GP+ LR    P V T
Sbjct  655  NIAPDNLSKKFTSGCVIERIIVLGLRSGVKKAIIEPGNQEVEIESGPISLRSGSSPVVPT  714

Query  175  IRKPNVRVGDDWSIKI  128
            IR+PNVR+ D W+I I
Sbjct  715  IRRPNVRIADSWTIWI  730



>ref|XP_010906080.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Elaeis guineensis]
Length=927

 Score =   284 bits (726),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 158/197 (80%), Gaps = 0/197 (0%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIY ER K VSVYLP  QSWY+LR+G +Y GG++HKLE  E+SIP FQRAGTIIPRKD
Sbjct  731  VQGIYEERQKSVSVYLPAGQSWYNLRNGVSYAGGVSHKLEVSEDSIPTFQRAGTIIPRKD  790

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALN S AAEGELY+DDG+++DF+QGAYIHRRFIF+   LTS+
Sbjct  791  RFRRSSTQMVNDPYTLVIALNGSFAAEGELYVDDGKTYDFEQGAYIHRRFIFADLKLTSV  850

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLT  176
            N+ P++   KF SDC +ERI+LLGL  G K A++EPGN +  VE GPL LR    P  +T
Sbjct  851  NIHPANLGGKFPSDCVIERIVLLGLPSGAKKAVIEPGNREANVELGPLTLRGGSSPDAIT  910

Query  175  IRKPNVRVGDDWSIKIL  125
            +RKPNV + DDW+++IL
Sbjct  911  VRKPNVHIADDWTLRIL  927



>emb|CDY60045.1| BnaA09g52360D [Brassica napus]
Length=641

 Score =   277 bits (709),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 157/200 (79%), Gaps = 5/200 (3%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQG+YT+   H SVYLPG++SWYDLR+G  Y GG  HK++A EESIPAFQRAGTIIPRKD
Sbjct  444  VQGVYTKGTTHASVYLPGEESWYDLRNGKRYVGGKIHKMDAPEESIPAFQRAGTIIPRKD  503

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSS QM+NDPYTLV+ALNSSQ A+GELYIDDG+SF+FK+GAYIHRRF+FS G LTS 
Sbjct  504  RFRRSSFQMDNDPYTLVVALNSSQEADGELYIDDGKSFEFKRGAYIHRRFVFSNGVLTST  563

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLL---LRESQGPS  185
            N+ P   S   SS C ++RIILLG S GP SALVEP N K E+E GPL    L  S G  
Sbjct  564  NIAPPEAS--LSSQCLIDRIILLGHSSGPNSALVEPLNQKAEIEMGPLRMGGLVASSGTR  621

Query  184  VLTIRKPNVRVGDDWSIKIL  125
            VLTIRKP VRV  DW+IKIL
Sbjct  622  VLTIRKPGVRVDQDWTIKIL  641



>emb|CDX84449.1| BnaC03g50510D [Brassica napus]
Length=645

 Score =   276 bits (707),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 159/200 (80%), Gaps = 5/200 (3%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQG+YT+   H +VYLPG  SWYDLR G  Y GG T+K++A EESIPAFQRAGTIIPRKD
Sbjct  448  VQGVYTKGTTHAAVYLPGKASWYDLRDGKTYVGGKTYKMDAPEESIPAFQRAGTIIPRKD  507

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSS+QM+NDPYTLV+ALNS+Q A+GELYIDDG+SF+FK+G+YIHRRF+FS G LTS 
Sbjct  508  RFRRSSSQMDNDPYTLVVALNSTQEADGELYIDDGKSFEFKRGSYIHRRFLFSNGVLTST  567

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLL---LRESQGPS  185
            NL PS    + SS C+++RIILLG + GPKSALVEP N K E+E GPL    L  S G  
Sbjct  568  NLAPSQA--RLSSQCSIDRIILLGHTSGPKSALVEPLNQKAEIEMGPLRMGGLVASSGTK  625

Query  184  VLTIRKPNVRVGDDWSIKIL  125
            VLTIRKP VRV  DW++K+L
Sbjct  626  VLTIRKPGVRVDQDWTVKVL  645



>ref|XP_009407664.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Musa acuminata 
subsp. malaccensis]
Length=932

 Score =   282 bits (721),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 161/198 (81%), Gaps = 1/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            V GIY +  K  SVYLP   SW++LR+G  + GG++HKL   E+SIP+FQRAGTIIPRKD
Sbjct  735  VHGIYEKDQKSASVYLPSGASWFNLRNGVKFDGGVSHKLAVSEDSIPSFQRAGTIIPRKD  794

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALN S AAEGELYIDDG+S+DF+QGAYIHRRFIF+   LTS+
Sbjct  795  RFRRSSTQMVNDPYTLVIALNGSLAAEGELYIDDGKSYDFEQGAYIHRRFIFADRKLTSI  854

Query  355  NLKPSS-GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +++PS+ G KKFS+DCTVERIILLGL  G K A+VEPGN++  +E GPL LR +  P  L
Sbjct  855  DIRPSNVGDKKFSTDCTVERIILLGLPSGAKKAVVEPGNHETNIELGPLTLRRASPPVAL  914

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIRKPNVRV DDWS++IL
Sbjct  915  TIRKPNVRVADDWSLRIL  932



>ref|XP_006394238.1| hypothetical protein EUTSA_v10003620mg [Eutrema salsugineum]
 gb|ESQ31524.1| hypothetical protein EUTSA_v10003620mg [Eutrema salsugineum]
Length=921

 Score =   281 bits (720),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 158/200 (79%), Gaps = 5/200 (3%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQG+YT+   HVSVYLPG  SWYDLR+G  Y GG THK++A EESIP FQRAGTIIPRKD
Sbjct  724  VQGVYTKGTTHVSVYLPGKDSWYDLRNGKTYVGGKTHKVDAPEESIPVFQRAGTIIPRKD  783

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM+NDPYTLV+ALNSSQ AEGELYIDDG+SF+FK+G+YIHRRF+FS G LTS 
Sbjct  784  RFRRSSTQMDNDPYTLVVALNSSQEAEGELYIDDGKSFEFKRGSYIHRRFVFSNGILTST  843

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLL---LRESQGPS  185
            NL P   S   SS C ++RIILLG + GPKSALVEP N K E+E GPL    L  S G  
Sbjct  844  NLAPPQAS--LSSQCLIDRIILLGHASGPKSALVEPLNQKAEIEMGPLRMGGLVASSGTK  901

Query  184  VLTIRKPNVRVGDDWSIKIL  125
            VLTIRKP VRV  DW++KIL
Sbjct  902  VLTIRKPGVRVDQDWTVKIL  921



>ref|NP_001049385.1| Os03g0216600 [Oryza sativa Japonica Group]
 dbj|BAF11299.1| Os03g0216600, partial [Oryza sativa Japonica Group]
Length=862

 Score =   281 bits (718),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
             QGIY E  K VSVYLPG++ WYDLR+G+ YKGG++HKLE  E+SIP+FQRAG I+PRKD
Sbjct  665  AQGIYEEGQKSVSVYLPGEELWYDLRNGSPYKGGVSHKLEVSEDSIPSFQRAGAIVPRKD  724

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALNSS AAEGELY+DDG+S+D++QGA+IHRRF+F+   LTS+
Sbjct  725  RFRRSSTQMVNDPYTLVIALNSSSAAEGELYVDDGKSYDYQQGAFIHRRFVFADNKLTSM  784

Query  355  NLKPSS-GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            N+ P + G+KKFS++C +ERII+LG+S G K A+VEPGN++V++E GP+ LR        
Sbjct  785  NIAPKNLGNKKFSTECVIERIIILGVSSGSKKAIVEPGNHEVDIELGPISLRSGSSSVAP  844

Query  178  TIRKPNVRVGDDWSIKI  128
            T+RKPNVRV DDW+I+I
Sbjct  845  TVRKPNVRVVDDWTIRI  861



>ref|XP_010908477.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Elaeis guineensis]
Length=927

 Score =   281 bits (720),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 161/197 (82%), Gaps = 0/197 (0%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIY +R K VSVYLP  QSWY++R+G AY GG++HKLE  E+SIP+FQ+AGTI+PRKD
Sbjct  731  VQGIYEKRQKSVSVYLPMGQSWYNMRNGAAYTGGISHKLEVSEDSIPSFQKAGTIVPRKD  790

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALN S AAEGELY+DDG+S+DF+QGAYIHRRFIF+   LTS+
Sbjct  791  RFRRSSTQMVNDPYTLVIALNGSLAAEGELYVDDGKSYDFEQGAYIHRRFIFADCKLTSI  850

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLT  176
            +++P+    KFSSDC +ERIILLGL  G K A++EPGN + +VE GPL LR       +T
Sbjct  851  DVRPAKIGGKFSSDCVIERIILLGLPSGAKKAVIEPGNREADVELGPLTLRGGSSLVAVT  910

Query  175  IRKPNVRVGDDWSIKIL  125
            +RKPNVR+ DDW+++IL
Sbjct  911  VRKPNVRIADDWTLRIL  927



>gb|AFW89188.1| hypothetical protein ZEAMMB73_762165 [Zea mays]
Length=915

 Score =   281 bits (719),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 159/196 (81%), Gaps = 0/196 (0%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
             QGIY E  K VSVYLPG +SWYDLR+G+ YKG +THKL+ LE+SIP+FQRAGTI+PRKD
Sbjct  719  AQGIYEEGQKSVSVYLPGKESWYDLRNGSPYKGSVTHKLQVLEDSIPSFQRAGTIVPRKD  778

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALNSS AAEGELY+DDG+S+D++QGA+ HRRF+F+   LTS 
Sbjct  779  RFRRSSTQMVNDPYTLVIALNSSGAAEGELYMDDGKSYDYQQGAFSHRRFVFADNKLTSF  838

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLT  176
            N+ P + SKKF+S C +ERII+LGL  G K A++EPGN +VE+E GP+ LR    P V T
Sbjct  839  NIAPDNLSKKFTSGCVIERIIVLGLRSGVKKAIIEPGNQEVEIESGPISLRSGSSPVVPT  898

Query  175  IRKPNVRVGDDWSIKI  128
            IR+PNVR+ D W+I I
Sbjct  899  IRRPNVRIADSWTIWI  914



>gb|EEC74768.1| hypothetical protein OsI_10536 [Oryza sativa Indica Group]
Length=879

 Score =   281 bits (718),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
             QGIY E  K VSVYLPG++ WYDLR+G+ YKGG++HKLE  E+SIP+FQRAG I+PRKD
Sbjct  682  AQGIYEEGQKSVSVYLPGEELWYDLRNGSPYKGGVSHKLEVSEDSIPSFQRAGAIVPRKD  741

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALNSS AAEGELY+DDG+S+D++QGA+IHRRF+F+   LTS+
Sbjct  742  RFRRSSTQMVNDPYTLVIALNSSSAAEGELYVDDGKSYDYQQGAFIHRRFVFADNKLTSM  801

Query  355  NLKPSS-GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            N+ P + G+KKFS++C +ERII+LG+S G K A+VEPGN++V++E GP+ LR        
Sbjct  802  NIAPKNLGNKKFSTECVIERIIILGVSSGSKKAIVEPGNHEVDIELGPISLRSGSSSVAP  861

Query  178  TIRKPNVRVGDDWSIKI  128
            T+RKPNVRV DDW+I+I
Sbjct  862  TVRKPNVRVVDDWTIRI  878



>sp|B9F676.1|GLU2A_ORYSJ RecName: Full=Probable glucan 1,3-alpha-glucosidase; AltName: 
Full=Glucosidase II subunit alpha; Flags: Precursor [Oryza 
sativa Japonica Group]
 gb|EEE58592.1| hypothetical protein OsJ_09923 [Oryza sativa Japonica Group]
Length=919

 Score =   281 bits (719),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
             QGIY E  K VSVYLPG++ WYDLR+G+ YKGG++HKLE  E+SIP+FQRAG I+PRKD
Sbjct  722  AQGIYEEGQKSVSVYLPGEELWYDLRNGSPYKGGVSHKLEVSEDSIPSFQRAGAIVPRKD  781

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALNSS AAEGELY+DDG+S+D++QGA+IHRRF+F+   LTS+
Sbjct  782  RFRRSSTQMVNDPYTLVIALNSSSAAEGELYVDDGKSYDYQQGAFIHRRFVFADNKLTSM  841

Query  355  NLKPSS-GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            N+ P + G+KKFS++C +ERII+LG+S G K A+VEPGN++V++E GP+ LR        
Sbjct  842  NIAPKNLGNKKFSTECVIERIIILGVSSGSKKAIVEPGNHEVDIELGPISLRSGSSSVAP  901

Query  178  TIRKPNVRVGDDWSIKI  128
            T+RKPNVRV DDW+I+I
Sbjct  902  TVRKPNVRVVDDWTIRI  918



>emb|CDY43760.1| BnaA06g22960D [Brassica napus]
Length=645

 Score =   273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 158/200 (79%), Gaps = 5/200 (3%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQG+YT+   H SVYLPG  SWYDLR+G  Y GG T+K++A EESIPAFQRAGTIIPRKD
Sbjct  448  VQGVYTKGTTHASVYLPGKASWYDLRNGKTYVGGKTYKMDAPEESIPAFQRAGTIIPRKD  507

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSS+QM+NDPYTLV+ALNS+Q A+GELYIDDG+S +F++G+YIHRRF+FS G LTS 
Sbjct  508  RFRRSSSQMDNDPYTLVVALNSTQEADGELYIDDGKSLEFRRGSYIHRRFVFSNGVLTST  567

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLL---LRESQGPS  185
            NL P     + SS C+++RIILLG + GPKSALVEP N K E+E GPL    L  S G  
Sbjct  568  NLAPPHA--RLSSQCSIDRIILLGHTSGPKSALVEPLNQKAEIEMGPLRMGGLVASSGTK  625

Query  184  VLTIRKPNVRVGDDWSIKIL  125
            VLTIRKP VRV  DW++K+L
Sbjct  626  VLTIRKPGVRVDQDWTVKVL  645



>ref|XP_010521236.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Tarenaya hassleriana]
Length=921

 Score =   278 bits (711),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 161/201 (80%), Gaps = 7/201 (3%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYT+ AK  SVYLPG +SWYD+RSG AY G   HK+E  EESIPAFQRAGTII RKD
Sbjct  724  VQGIYTKGAKQASVYLPGKESWYDMRSGKAYVGSKIHKVEVSEESIPAFQRAGTIISRKD  783

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSS+QM+NDPYTLV+ALNSSQAAEGELYIDDG+SF+FK+G+YIHRRF+FS G LTS 
Sbjct  784  RFRRSSSQMDNDPYTLVVALNSSQAAEGELYIDDGKSFEFKRGSYIHRRFVFSNGQLTSS  843

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPL----LLRESQGP  188
            NL P S   +FSS CT+ERIILLG ++GPKSALVEP N KV++E GP+    L     G 
Sbjct  844  NLAPES---RFSSHCTIERIILLGHAKGPKSALVEPSNQKVDIEMGPIRLGGLAGSGSGA  900

Query  187  SVLTIRKPNVRVGDDWSIKIL  125
              LTIR P VRV +DWSIKIL
Sbjct  901  KALTIRNPGVRVYEDWSIKIL  921



>gb|KFK28077.1| hypothetical protein AALP_AA8G469200 [Arabis alpina]
Length=917

 Score =   278 bits (711),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 157/200 (79%), Gaps = 5/200 (3%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQG+YT+   H SVYLPG + WYDLR+G  Y GG THK++A EESIPAFQ+AGTIIPRKD
Sbjct  720  VQGVYTKGTTHASVYLPGKELWYDLRNGKTYVGGKTHKMDAPEESIPAFQKAGTIIPRKD  779

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSS+QM NDPYTLV+ALNS+Q AEGELYIDDG+SF+FK+GAYIHRRFIFS G LTS 
Sbjct  780  RFRRSSSQMGNDPYTLVVALNSTQEAEGELYIDDGKSFEFKRGAYIHRRFIFSNGILTST  839

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLL---LRESQGPS  185
            NL P   S   SS C ++RIILLG + GPKSA+VEP N K E+E GPL    L  S G  
Sbjct  840  NLAPPQAS--LSSQCLIDRIILLGHASGPKSAMVEPSNQKAEIEMGPLRMGGLVASSGTK  897

Query  184  VLTIRKPNVRVGDDWSIKIL  125
            VLTIRKP VRV  DW++KIL
Sbjct  898  VLTIRKPGVRVDQDWTVKIL  917



>ref|XP_010546305.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Tarenaya hassleriana]
Length=917

 Score =   278 bits (710),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 160/198 (81%), Gaps = 4/198 (2%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            +QGIY++ AK  SVYLPG +SWY++RSG  Y G  THK+E  EESIPAFQRAGTIIPRKD
Sbjct  723  IQGIYSKGAKQASVYLPGKESWYEMRSGKIYAGSKTHKVEVSEESIPAFQRAGTIIPRKD  782

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSS+QM+NDPYTLV+ALNSSQAAEGELYIDDG+SF+FKQ +YIHR+F+FS G LTS 
Sbjct  783  RFRRSSSQMDNDPYTLVVALNSSQAAEGELYIDDGKSFEFKQESYIHRKFVFSNGRLTSS  842

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGP-SVL  179
            NL P +   +FSS C VERIIL+G + GPKSALVEP N K +VE GPL L  + G  S L
Sbjct  843  NLAPRA---RFSSGCMVERIILMGHASGPKSALVEPSNQKTDVEMGPLRLGGAAGSGSAL  899

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIR P VRV +DWSIKIL
Sbjct  900  TIRNPGVRVDEDWSIKIL  917



>ref|XP_010461069.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Camelina sativa]
Length=918

 Score =   278 bits (710),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 158/200 (79%), Gaps = 5/200 (3%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQG+YT+   H SVYLPG +SW+DLR+G  Y GG THK++A EESIPAFQ+AGTIIPRKD
Sbjct  721  VQGVYTKGTTHASVYLPGKESWFDLRNGKTYVGGKTHKMDAPEESIPAFQKAGTIIPRKD  780

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSS+QM+NDPYTLV+ALNSSQ A GELYIDDG+SF+F++GAYIHRRF+FS G LTS 
Sbjct  781  RFRRSSSQMDNDPYTLVVALNSSQEAAGELYIDDGKSFEFRRGAYIHRRFVFSNGVLTST  840

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLL---LRESQGPS  185
            NL P     + SS C ++RIILLG S GPKSALVEP N K E+E GPL    L  S G  
Sbjct  841  NLAPPQA--RLSSQCLIDRIILLGHSSGPKSALVEPLNQKAEIEMGPLRMGGLVASSGTK  898

Query  184  VLTIRKPNVRVGDDWSIKIL  125
            VLTIRKP VRV  DW++KIL
Sbjct  899  VLTIRKPGVRVDQDWTVKIL  918



>ref|XP_009112107.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Brassica rapa]
Length=910

 Score =   277 bits (709),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 157/200 (79%), Gaps = 5/200 (3%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQG+YT+   H SVYLPG++SWYDLR+G  Y GG  HK++A EESIPAFQRAGTIIPRKD
Sbjct  713  VQGVYTKGTTHASVYLPGEESWYDLRNGKRYVGGKIHKMDAPEESIPAFQRAGTIIPRKD  772

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSS QM+NDPYTLV+ALNSSQ A+GELYIDDG+SF+FK+GAYIHRRF+FS G LTS 
Sbjct  773  RFRRSSFQMDNDPYTLVVALNSSQEADGELYIDDGKSFEFKRGAYIHRRFVFSNGVLTST  832

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLL---LRESQGPS  185
            N+ P   S   SS C ++RIILLG S GP SALVEP N K E+E GPL    L  S G  
Sbjct  833  NIAPPEAS--LSSQCLIDRIILLGHSSGPNSALVEPLNQKAEIEMGPLRMGGLVASSGTR  890

Query  184  VLTIRKPNVRVGDDWSIKIL  125
            VLTIRKP VRV  DW+IKIL
Sbjct  891  VLTIRKPGVRVDQDWTIKIL  910



>ref|NP_201189.1| alpha 1,3-glucosidase [Arabidopsis thaliana]
 sp|Q9FN05.1|PSL5_ARATH RecName: Full=Probable glucan 1,3-alpha-glucosidase; AltName: 
Full=Glucosidase II subunit alpha; AltName: Full=Protein PRIORITY 
IN SWEET LIFE 5; AltName: Full=Protein RADIAL SWELLING 
3; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB11032.1| glucosidase II alpha subunit [Arabidopsis thaliana]
 gb|AED97803.1| alpha 1,3-glucosidase [Arabidopsis thaliana]
Length=921

 Score =   277 bits (708),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 158/200 (79%), Gaps = 5/200 (3%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQG+YT+     SVYLPG +SWYDLR+G  Y GG THK++A EESIPAFQ+AGTIIPRKD
Sbjct  724  VQGVYTKGTTQASVYLPGKESWYDLRNGKTYVGGKTHKMDAPEESIPAFQKAGTIIPRKD  783

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSS+QM+NDPYTLV+ALNSSQ AEGELYIDDG+SF+F++G+YIHRRF+FS G LTS 
Sbjct  784  RFRRSSSQMDNDPYTLVVALNSSQEAEGELYIDDGKSFEFRRGSYIHRRFVFSKGVLTST  843

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLL---LRESQGPS  185
            NL P     + SS C ++RIILLG S GPKSALVEP N K E+E GPL    L  S G  
Sbjct  844  NLAPPEA--RLSSQCLIDRIILLGHSSGPKSALVEPLNQKAEIEMGPLRMGGLVASSGTK  901

Query  184  VLTIRKPNVRVGDDWSIKIL  125
            VLTIRKP VRV  DW++KIL
Sbjct  902  VLTIRKPGVRVDQDWTVKIL  921



>ref|XP_010444304.1| PREDICTED: probable glucan 1,3-alpha-glucosidase isoform X1 [Camelina 
sativa]
Length=922

 Score =   276 bits (707),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 157/200 (79%), Gaps = 5/200 (3%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQG+YT+   H SVYLPG  SW+DLR+G  Y GG THK++A EESIPAFQ+AGTIIPRKD
Sbjct  725  VQGVYTKGTTHASVYLPGKVSWFDLRNGKTYVGGKTHKMDAPEESIPAFQKAGTIIPRKD  784

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSS+QM+NDPYTLV+ALNSSQ A GELYIDDG+SF+F++GAYIHRRF+FS G LTS 
Sbjct  785  RFRRSSSQMDNDPYTLVVALNSSQEAAGELYIDDGKSFEFRRGAYIHRRFVFSNGVLTST  844

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLL---LRESQGPS  185
            NL P     + SS C ++RIILLG S GPKSALVEP N K E+E GPL    L  S G  
Sbjct  845  NLAPPQA--RLSSQCVIDRIILLGHSSGPKSALVEPLNQKAEIEMGPLRMGGLVASSGTK  902

Query  184  VLTIRKPNVRVGDDWSIKIL  125
            VLTIRKP VRV  DW++KIL
Sbjct  903  VLTIRKPGVRVDQDWTVKIL  922



>ref|XP_010444305.1| PREDICTED: probable glucan 1,3-alpha-glucosidase isoform X2 [Camelina 
sativa]
Length=923

 Score =   276 bits (707),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 157/200 (79%), Gaps = 5/200 (3%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQG+YT+   H SVYLPG  SW+DLR+G  Y GG THK++A EESIPAFQ+AGTIIPRKD
Sbjct  726  VQGVYTKGTTHASVYLPGKVSWFDLRNGKTYVGGKTHKMDAPEESIPAFQKAGTIIPRKD  785

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSS+QM+NDPYTLV+ALNSSQ A GELYIDDG+SF+F++GAYIHRRF+FS G LTS 
Sbjct  786  RFRRSSSQMDNDPYTLVVALNSSQEAAGELYIDDGKSFEFRRGAYIHRRFVFSNGVLTST  845

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLL---LRESQGPS  185
            NL P     + SS C ++RIILLG S GPKSALVEP N K E+E GPL    L  S G  
Sbjct  846  NLAPPQA--RLSSQCVIDRIILLGHSSGPKSALVEPLNQKAEIEMGPLRMGGLVASSGTK  903

Query  184  VLTIRKPNVRVGDDWSIKIL  125
            VLTIRKP VRV  DW++KIL
Sbjct  904  VLTIRKPGVRVDQDWTVKIL  923



>ref|XP_006649640.1| PREDICTED: neutral alpha-glucosidase AB-like [Oryza brachyantha]
Length=921

 Score =   276 bits (705),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 160/197 (81%), Gaps = 1/197 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
             QGIY +  K VSVYLPG   WYDLR+G+ YKG ++HKLE  E+SIP+FQR GTI+PRKD
Sbjct  724  AQGIYEDGQKSVSVYLPGKVLWYDLRNGSPYKGSVSHKLEVSEDSIPSFQRTGTIVPRKD  783

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALNSS AAEGELY+DDG+S+D++QGA+IHRRF+F+   LTS+
Sbjct  784  RFRRSSTQMVNDPYTLVIALNSSSAAEGELYVDDGKSYDYQQGAFIHRRFVFADNKLTSM  843

Query  355  NLKP-SSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            N+ P + G+KKFS++C +ERII+LGL  G K A+VEPGN+KVE+E GP+ LR        
Sbjct  844  NIAPKNGGNKKFSTECVIERIIILGLPSGLKKAIVEPGNHKVEIELGPVSLRSGSASVAP  903

Query  178  TIRKPNVRVGDDWSIKI  128
            T+RKPNVRV DDW+I+I
Sbjct  904  TVRKPNVRVVDDWTIRI  920



>ref|NP_001169712.1| hypothetical protein precursor [Zea mays]
 gb|ACN34619.1| unknown [Zea mays]
 tpg|DAA44103.1| TPA: hypothetical protein ZEAMMB73_706096 [Zea mays]
Length=917

 Score =   275 bits (704),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 155/196 (79%), Gaps = 0/196 (0%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
             QGIY E  K VSVYLPG +SWYDLR+G+ YKG  THKL+ LE+SIP+FQRAGTI+PRKD
Sbjct  721  AQGIYEEGQKSVSVYLPGKESWYDLRNGSPYKGSATHKLQVLEDSIPSFQRAGTIVPRKD  780

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALNSS A EGELY+DDG+S++++QGA+IHRRF+F+   LTS 
Sbjct  781  RFRRSSTQMVNDPYTLVIALNSSGAGEGELYVDDGKSYEYQQGAFIHRRFVFADNKLTSF  840

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLT  176
            N+ P    KKF SDC +ERII+LGL  G K A++EPGN ++E+E GP+ LR    P   T
Sbjct  841  NIGPDDLGKKFRSDCVIERIIILGLRSGVKKAIIEPGNQELEIESGPISLRSGSSPVAPT  900

Query  175  IRKPNVRVGDDWSIKI  128
            IR+PNV + D W+I+I
Sbjct  901  IRRPNVCIADSWTIRI  916



>ref|XP_002864871.1| hypothetical protein ARALYDRAFT_919683 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41130.1| hypothetical protein ARALYDRAFT_919683 [Arabidopsis lyrata subsp. 
lyrata]
Length=921

 Score =   275 bits (704),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 158/200 (79%), Gaps = 5/200 (3%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQG+YT+     SVYLPG +SWYDLR+G  Y GG THK++A EESIPAFQ+AGTIIPRKD
Sbjct  724  VQGVYTKGTTQASVYLPGKESWYDLRNGKTYVGGKTHKMDAPEESIPAFQKAGTIIPRKD  783

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSS+QM+NDPYTLV+ALNSSQ AEGELYIDDG+SF+F++G+YIHRRF+FS G LTS 
Sbjct  784  RFRRSSSQMDNDPYTLVVALNSSQEAEGELYIDDGKSFEFRRGSYIHRRFVFSNGVLTST  843

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLL---LRESQGPS  185
            NL P     + SS C ++RIILLG S GPKSALVEP N K E+E GPL    L  S G  
Sbjct  844  NLAPPQA--RLSSQCLIDRIILLGHSSGPKSALVEPLNQKAEIEMGPLRMGGLVASSGTK  901

Query  184  VLTIRKPNVRVGDDWSIKIL  125
            VLTIRKP V+V  DW++KIL
Sbjct  902  VLTIRKPGVQVDQDWTVKIL  921



>ref|XP_008645249.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=946

 Score =   275 bits (704),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 155/196 (79%), Gaps = 0/196 (0%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
             QGIY E  K VSVYLPG +SWYDLR+G+ YKG  THKL+ LE+SIP+FQRAGTI+PRKD
Sbjct  750  AQGIYEEGQKSVSVYLPGKESWYDLRNGSPYKGSATHKLQVLEDSIPSFQRAGTIVPRKD  809

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALNSS A EGELY+DDG+S++++QGA+IHRRF+F+   LTS 
Sbjct  810  RFRRSSTQMVNDPYTLVIALNSSGAGEGELYVDDGKSYEYQQGAFIHRRFVFADNKLTSF  869

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLT  176
            N+ P    KKF SDC +ERII+LGL  G K A++EPGN ++E+E GP+ LR    P   T
Sbjct  870  NIGPDDLGKKFRSDCVIERIIILGLRSGVKKAIIEPGNQELEIESGPISLRSGSSPVAPT  929

Query  175  IRKPNVRVGDDWSIKI  128
            IR+PNV + D W+I+I
Sbjct  930  IRRPNVCIADSWTIRI  945



>ref|XP_010484144.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Camelina sativa]
Length=921

 Score =   274 bits (701),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 157/200 (79%), Gaps = 5/200 (3%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQG+YT+   H SVYLPG +SW+DLR+G  Y GG THK++A EESIPAFQ+AGTIIPRKD
Sbjct  724  VQGVYTKGTTHASVYLPGKESWFDLRNGKTYVGGKTHKMDAPEESIPAFQKAGTIIPRKD  783

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSS+QM+N+PYTLV+ALNSSQ A GELYIDDG+SF+F++GAYIHRRF+FS G LTS 
Sbjct  784  RFRRSSSQMDNNPYTLVVALNSSQEAAGELYIDDGKSFEFRRGAYIHRRFVFSNGVLTST  843

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLL---LRESQGPS  185
            NL P     + SS C ++RIILLG S GPKSA VEP N K E+E GPL    L  S G  
Sbjct  844  NLAPPQA--RLSSQCLIDRIILLGHSSGPKSAFVEPLNQKAEIEMGPLRMGGLVASSGTK  901

Query  184  VLTIRKPNVRVGDDWSIKIL  125
            VLTIRKP VRV  DW++KIL
Sbjct  902  VLTIRKPGVRVDQDWTVKIL  921



>gb|EMS52413.1| Neutral alpha-glucosidase AB [Triticum urartu]
Length=682

 Score =   270 bits (689),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 160/197 (81%), Gaps = 1/197 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
             QGIY E  K VSVYLPG + WYDLR+G+ YKG ++HKL+  E+SIP+FQR+GTI+PRKD
Sbjct  485  AQGIYEEGQKSVSVYLPGTELWYDLRNGSPYKGSVSHKLQVSEDSIPSFQRSGTIVPRKD  544

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALNSS +AEGELY+DDG+S+D++QGA+IHRRF+F+   LTS+
Sbjct  545  RFRRSSTQMVNDPYTLVIALNSSGSAEGELYVDDGKSYDYQQGAFIHRRFVFADNKLTSI  604

Query  355  NLKPSS-GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            N+ P S G K +S++C +ERII+LGLS G K A++EPGN +VE++ GP+ LR        
Sbjct  605  NIAPDSLGKKVYSTECVIERIIVLGLSSGAKKAIIEPGNQEVEIDLGPISLRSGSKSVAP  664

Query  178  TIRKPNVRVGDDWSIKI  128
            T+R+PNVRV DDW+I+I
Sbjct  665  TVRRPNVRVVDDWTIRI  681



>ref|XP_002307054.1| hypothetical protein POPTR_0005s07000g [Populus trichocarpa]
 gb|EEE94050.1| hypothetical protein POPTR_0005s07000g [Populus trichocarpa]
Length=925

 Score =   274 bits (700),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 164/198 (83%), Gaps = 2/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYTE AK+ SVYLPG + WYD+R+G AYKGG THKLEA  ES+PAFQRAGTIIPRKD
Sbjct  729  VQGIYTEGAKYASVYLPGKELWYDIRTGDAYKGGKTHKLEA-AESVPAFQRAGTIIPRKD  787

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            R RRSSTQM NDPYTLVIA+NSSQAAEGELY+DDG+SF+F QGAYIHRRF+F+ G LTS+
Sbjct  788  RLRRSSTQMVNDPYTLVIAVNSSQAAEGELYMDDGKSFEFLQGAYIHRRFVFANGKLTSI  847

Query  355  NLKP-SSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            NL P SS   +FSS   +ERIILLG + GPK+A +EPGN KVEVE G L+L    G SV+
Sbjct  848  NLAPSSSSKSQFSSKSMIERIILLGYAPGPKNAQIEPGNQKVEVELGQLMLEGRHGSSVV  907

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIRKP V+V DDW+I++L
Sbjct  908  TIRKPAVQVSDDWTIRLL  925



>ref|XP_009150447.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Brassica rapa]
Length=921

 Score =   274 bits (700),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 133/200 (67%), Positives = 158/200 (79%), Gaps = 5/200 (3%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQG+YT+   H SVYLPG  SWYDLR+G  Y GG T+K++A EESIPAFQRAGTIIPRKD
Sbjct  724  VQGVYTKGTTHASVYLPGKGSWYDLRNGKTYVGGKTYKMDAPEESIPAFQRAGTIIPRKD  783

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSS+QM+NDPYTLV+ALNS+Q A+GELYIDDG+SF+FK+G+YIHRRF+FS G LTS 
Sbjct  784  RFRRSSSQMDNDPYTLVVALNSTQEADGELYIDDGKSFEFKRGSYIHRRFVFSNGVLTST  843

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLL---LRESQGPS  185
            NL P     + SS C+++RIILLG + GP SALVEP N K E+E GPL    L  S G  
Sbjct  844  NLAPPQA--RLSSQCSIDRIILLGHTSGPTSALVEPLNQKAEIEMGPLRMGGLVASSGTK  901

Query  184  VLTIRKPNVRVGDDWSIKIL  125
            VLTIRKP VRV  DW++K+L
Sbjct  902  VLTIRKPGVRVDQDWTVKVL  921



>ref|XP_003558486.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Brachypodium 
distachyon]
Length=914

 Score =   271 bits (694),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 159/197 (81%), Gaps = 1/197 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
             QGIY E  K VSVYLPG +SWYDLR+G+ YKG ++HKLE  E+SIP+F RAGTI+PRKD
Sbjct  717  AQGIYEEGQKSVSVYLPGKESWYDLRNGSPYKGSVSHKLEVSEDSIPSFLRAGTIVPRKD  776

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALNSS AAEGELY+DDG+S+D++QGA+IHRRF+F+   LTS 
Sbjct  777  RFRRSSTQMVNDPYTLVIALNSSGAAEGELYVDDGKSYDYQQGAFIHRRFVFADNKLTST  836

Query  355  NLKPSS-GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            N+ P+  G K+FS++C +ERII+LGLS   K A++EPGN +VE+E GP+ LR        
Sbjct  837  NIAPNHPGKKEFSTECVIERIIVLGLSSRAKKAVIEPGNQEVEIELGPISLRSGSSSVAP  896

Query  178  TIRKPNVRVGDDWSIKI  128
            T+R+PNVRV DDWS++I
Sbjct  897  TVRRPNVRVVDDWSVRI  913



>ref|NP_001275405.1| neutral alpha-glucosidase AB-like precursor [Solanum tuberosum]
 emb|CAA04707.1| alpha-glucosidase [Solanum tuberosum]
Length=919

 Score =   271 bits (693),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 161/199 (81%), Gaps = 9/199 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQG+YTE+ KHVSVYLPG++SWYDLRS +AY GG THK E  E+SIP+FQRAGTIIPRKD
Sbjct  728  VQGVYTEKPKHVSVYLPGEESWYDLRSASAYNGGHTHKYEVSEDSIPSFQRAGTIIPRKD  787

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHR--RFIFSAGTLT  362
            R RRSSTQMENDPYTLVIALNSS+AAEGELYIDDG+S++FKQGA+I +   +IF      
Sbjct  788  RLRRSSTQMENDPYTLVIALNSSKAAEGELYIDDGKSYEFKQGAFILKWEAYIFQMQPRL  847

Query  361  SLNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSV  182
             L +        F S+CTVERIILLGLS G K+AL+EPGN KVE+E GPL ++ ++G SV
Sbjct  848  QLAV------THFPSECTVERIILLGLSPGAKTALIEPGNKKVEIELGPLFIQGNRG-SV  900

Query  181  LTIRKPNVRVGDDWSIKIL  125
             TIRKPNVR+ DDWSI+IL
Sbjct  901  PTIRKPNVRITDDWSIQIL  919



>gb|EMT11799.1| Neutral alpha-glucosidase AB [Aegilops tauschii]
Length=867

 Score =   269 bits (687),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 160/196 (82%), Gaps = 1/196 (1%)
 Frame = -1

Query  712  QGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDR  533
            QGIY E  K VSVYLPG + WYDLR+G+ YKG ++HKL+  E+SIP+FQR+GTI+PRKDR
Sbjct  671  QGIYEEGQKSVSVYLPGTELWYDLRNGSPYKGSVSHKLQVSEDSIPSFQRSGTIVPRKDR  730

Query  532  FRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSLN  353
            FRRSSTQM NDPYTLVIALNSS +AEGELY+DDG+++D++QGA+IHRRF+F+   LTS+N
Sbjct  731  FRRSSTQMVNDPYTLVIALNSSGSAEGELYVDDGKTYDYQQGAFIHRRFVFADNKLTSIN  790

Query  352  LKPSS-GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLT  176
            + P S G K +S++C +ERII+LGLS G K A++EPGN +VE++ GP+ LR        T
Sbjct  791  IAPDSLGKKVYSTECVIERIIVLGLSSGAKKAIIEPGNQEVEIDLGPISLRSGSKSVAPT  850

Query  175  IRKPNVRVGDDWSIKI  128
            +R+PNVRV DDW+I+I
Sbjct  851  VRRPNVRVVDDWTIRI  866



>ref|XP_010088025.1| Neutral alpha-glucosidase AB [Morus notabilis]
 gb|EXB31244.1| Neutral alpha-glucosidase AB [Morus notabilis]
Length=1024

 Score =   270 bits (691),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 154/191 (81%), Gaps = 1/191 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYTERAK+VSVY+PG +SWYD R+G  YKG  T++LEA EE++PAFQRAGTIIPRKD
Sbjct  806  VQGIYTERAKYVSVYMPGKESWYDFRTGAVYKGSTTNELEATEETVPAFQRAGTIIPRKD  865

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALNSSQ AEGELYIDDG+SF F QGAYIHRRF+F+ G LTSL
Sbjct  866  RFRRSSTQMVNDPYTLVIALNSSQKAEGELYIDDGKSFAFTQGAYIHRRFVFADGKLTSL  925

Query  355  NLKPSS-GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            N+ P++ G  +FSS C +ERI++LG S  PK AL+EP     E+E GPL L+  +G   +
Sbjct  926  NVAPAALGGAQFSSKCVIERIVVLGHSGVPKRALIEPEEKTAEIELGPLDLKSRRGSDFI  985

Query  178  TIRKPNVRVGD  146
            TIRKPN+ V +
Sbjct  986  TIRKPNLPVAE  996



>ref|XP_006279958.1| hypothetical protein CARUB_v10025824mg, partial [Capsella rubella]
 gb|EOA12856.1| hypothetical protein CARUB_v10025824mg, partial [Capsella rubella]
Length=957

 Score =   269 bits (687),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 157/200 (79%), Gaps = 5/200 (3%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQG+YT+   H SVYLPG +SW+DLR+G  Y GG T+K++A EESIPAFQ+AGTIIPRKD
Sbjct  760  VQGVYTKGTTHASVYLPGKESWFDLRNGKTYVGGKTYKMDAPEESIPAFQKAGTIIPRKD  819

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSS+QM+NDPYTLV+ALNSSQ A GELY+DDG+SF+F++G+YIHRRF+FS G LTS 
Sbjct  820  RFRRSSSQMDNDPYTLVVALNSSQEAAGELYMDDGKSFEFRRGSYIHRRFVFSNGVLTST  879

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLL---RESQGPS  185
            NL P     + SS C ++RIILLG S GPKSALVEP N K E+E GPL +     S    
Sbjct  880  NLAPPQA--RLSSQCLIDRIILLGHSSGPKSALVEPLNQKAEIEMGPLRMGGTVASSSTK  937

Query  184  VLTIRKPNVRVGDDWSIKIL  125
            VLTIRKP VRV  DW++KI+
Sbjct  938  VLTIRKPGVRVDQDWTVKIM  957



>ref|XP_011031112.1| PREDICTED: LOW QUALITY PROTEIN: probable glucan 1,3-alpha-glucosidase 
[Populus euphratica]
Length=923

 Score =   268 bits (685),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 162/198 (82%), Gaps = 2/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYTE AK+ SVYLPG + WYD+R+G AY+GG THKLEA  ES+PAFQRAGTIIPRKD
Sbjct  727  VQGIYTEGAKYASVYLPGKELWYDIRTGDAYRGGKTHKLEA-AESVPAFQRAGTIIPRKD  785

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            R RRSSTQM NDPYTLVIA+NSSQAAEGELY+DDG+SF+F QGAYIHRRF+F+ G LTS+
Sbjct  786  RLRRSSTQMVNDPYTLVIAVNSSQAAEGELYMDDGKSFEFLQGAYIHRRFVFANGKLTSI  845

Query  355  NLKP-SSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            NL P SS   +FSS   +ERIILLG + GPK+A +EP N KVEVE G L+     G SV+
Sbjct  846  NLAPSSSSKSQFSSKSMIERIILLGYAPGPKNAQIEPANQKVEVELGQLMPEGRHGSSVV  905

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIRKP V+V DDW+I++L
Sbjct  906  TIRKPAVQVSDDWTIRLL  923



>dbj|BAG72145.1| alpha-glucosidase like protein [Hordeum vulgare subsp. vulgare]
Length=916

 Score =   266 bits (681),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 159/197 (81%), Gaps = 1/197 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
             QGIY E  K VSVYLPG + WYDLR+G+ YKG ++HKL+  E+SIP+FQR+GTI+PRKD
Sbjct  719  AQGIYEEGQKSVSVYLPGTELWYDLRNGSPYKGSVSHKLQVSEDSIPSFQRSGTIVPRKD  778

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALNSS  AEGELY+DDG+S+D++QGA+IHRRF+F+   LTS+
Sbjct  779  RFRRSSTQMVNDPYTLVIALNSSGYAEGELYVDDGKSYDYQQGAFIHRRFVFADNKLTSI  838

Query  355  NLKPSSGSKK-FSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            N+ P S +KK +S++C +ERII+LGL  G K A++EPGN +VE++ GP+ LR        
Sbjct  839  NIAPDSLTKKVYSTECVIERIIVLGLPSGAKKAIIEPGNQEVEIDLGPISLRSGSKSVAP  898

Query  178  TIRKPNVRVGDDWSIKI  128
            T+R+PNVRV DDW+I+I
Sbjct  899  TVRRPNVRVVDDWTIRI  915



>dbj|BAJ91260.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=915

 Score =   266 bits (680),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 159/197 (81%), Gaps = 1/197 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
             QGIY E  K VSVYLPG + WYDLR+G+ YKG ++HKL+  E+SIP+FQR+GTI+PRKD
Sbjct  718  AQGIYEEGQKSVSVYLPGTELWYDLRNGSPYKGSVSHKLQVSEDSIPSFQRSGTIVPRKD  777

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALNSS  AEGELY+DDG+S+D++QGA+IHRRF+F+   LTS+
Sbjct  778  RFRRSSTQMVNDPYTLVIALNSSGYAEGELYVDDGKSYDYQQGAFIHRRFVFADNKLTSI  837

Query  355  NLKPSSGSKK-FSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            N+ P S +KK +S++C +ERII+LGL  G K A++EPGN +VE++ GP+ LR        
Sbjct  838  NIAPDSLTKKVYSTECVIERIIVLGLPSGAKKAIIEPGNQEVEIDLGPISLRSGSKSVAP  897

Query  178  TIRKPNVRVGDDWSIKI  128
            T+R+PNVRV DDW+I+I
Sbjct  898  TVRRPNVRVVDDWTIRI  914



>ref|NP_001234030.1| alpha glucosidase II precursor [Solanum lycopersicum]
 emb|CAE54480.1| alpha glucosidase II [Solanum lycopersicum]
Length=921

 Score =   254 bits (650),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 158/202 (78%), Gaps = 10/202 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQG+YTE+AK+VSVYLPG++SWYDLRS + YK G THK E  ++SIP+FQRAGTIIPRKD
Sbjct  725  VQGVYTEKAKYVSVYLPGEESWYDLRSASVYKAGHTHKYEVSQDSIPSFQRAGTIIPRKD  784

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFI-FSAGTLTS  359
            R RRSSTQMENDPYTLVIALNSS+AAEGELYIDDG+S++F +       FI  S   + S
Sbjct  785  RLRRSSTQMENDPYTLVIALNSSKAAEGELYIDDGKSYEFNKVP----SFIGVSHSQMGS  840

Query  358  LNLKPSS----GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQG  191
            L L+           F S+CTVERIILLGLS G K+A++EPGN KVE+E GPL ++ ++G
Sbjct  841  LYLQMQPRLQLAVTHFPSECTVERIILLGLSPGAKAAIIEPGNKKVEIELGPLFIQGNRG  900

Query  190  PSVLTIRKPNVRVGDDWSIKIL  125
             SV TIRKPNVR+ DDWSI+IL
Sbjct  901  -SVPTIRKPNVRIADDWSIQIL  921



>gb|EPS71756.1| alpha-glucosidase, partial [Genlisea aurea]
Length=930

 Score =   252 bits (643),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 157/200 (79%), Gaps = 4/200 (2%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLE-ALEESIPAFQRAGTIIPRK  539
            VQGIY+E AK   VYLPG+  W+D R+G AY+GG THK E   E+++PAFQRAGTIIPRK
Sbjct  732  VQGIYSEGAKEAKVYLPGNDLWFDTRTGRAYEGGETHKFENPAEDAVPAFQRAGTIIPRK  791

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSA-GTLT  362
            DRFRRSSTQMENDPYTLV+A+N S +AEGELYIDDG+SFDF +G+Y+H RF F A GTL+
Sbjct  792  DRFRRSSTQMENDPYTLVVAVNGSNSAEGELYIDDGKSFDFVKGSYLHLRFEFGADGTLS  851

Query  361  SLNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPL-LLRESQGPS  185
            S N+  SSGS+KFSS CTVERIILLGL   PK A+VE  N +V VE GP+ L+ +S    
Sbjct  852  STNMG-SSGSRKFSSGCTVERIILLGLGFDPKGAVVEGENREVGVETGPVSLIGKSSSSG  910

Query  184  VLTIRKPNVRVGDDWSIKIL  125
            V TIRKP +R+ D+W IK++
Sbjct  911  VPTIRKPGLRISDNWKIKLV  930



>emb|CDP05478.1| unnamed protein product [Coffea canephora]
Length=527

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 137/197 (70%), Gaps = 36/197 (18%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQG+YT+RAKHVSVYLPG+QSWYDLRSG AYKGG  HK EALE+S+PAFQRAGTIIPRKD
Sbjct  367  VQGVYTQRAKHVSVYLPGEQSWYDLRSGAAYKGGKRHKFEALEDSVPAFQRAGTIIPRKD  426

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM  DPYTLVIALNSS+ AEGELYIDDG+SF+F+ GAYIHR F FS G LTS 
Sbjct  427  RFRRSSTQMGTDPYTLVIALNSSKEAEGELYIDDGKSFEFENGAYIHRHFKFSNGKLTSS  486

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLT  176
            N  PS                                     V+ GPL +R    PS LT
Sbjct  487  NAAPSG------------------------------------VQLGPLTIRHGNSPSFLT  510

Query  175  IRKPNVRVGDDWSIKIL  125
            IR+PNVR+ DDW+IKIL
Sbjct  511  IRRPNVRIEDDWTIKIL  527



>ref|XP_006857187.1| hypothetical protein AMTR_s00065p00185540 [Amborella trichopoda]
 gb|ERN18654.1| hypothetical protein AMTR_s00065p00185540 [Amborella trichopoda]
Length=919

 Score =   248 bits (634),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYTE A+   VYLP  Q+WYD+RSG AY GG  + LE   ESIP+FQ+ GT+IPRKD
Sbjct  722  VQGIYTEGARSTIVYLPRGQTWYDMRSGDAYSGGKNYTLEVSMESIPSFQKGGTVIPRKD  781

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQ  +DP++LVIALNSS  AEGELY+DDG+S+D++QGAYIHR F+FS G LTS 
Sbjct  782  RFRRSSTQTMDDPFSLVIALNSSMEAEGELYMDDGKSYDYEQGAYIHRHFVFSKGILTSS  841

Query  355  NLKPSSGSKK-FSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +++ +  SKK  SS+  +ER+I+LGLS   KSAL+EP  +  EVE GPL LR+      +
Sbjct  842  SMRSTKTSKKTLSSNSVIERVIVLGLSSSAKSALIEPAKHTTEVEPGPLTLRKGSSAVGV  901

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIRKPNVR+ +DW+IK++
Sbjct  902  TIRKPNVRIDEDWAIKLV  919



>emb|CBI17232.3| unnamed protein product [Vitis vinifera]
Length=762

 Score =   237 bits (604),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 133/197 (68%), Gaps = 38/197 (19%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYTE+ KH SVYLPG QSWYDLR+G  YKGG  HKLE  EE+IPAFQRAGTIIPRKD
Sbjct  604  VQGIYTEQVKHASVYLPGGQSWYDLRTGIIYKGGTAHKLEVSEETIPAFQRAGTIIPRKD  663

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            R+RRSSTQM NDPYTLVIALN S AAEGELYIDDG+SF+FKQGAYIHR F+FS G LTS 
Sbjct  664  RYRRSSTQMANDPYTLVIALNGSHAAEGELYIDDGKSFEFKQGAYIHRHFVFSDGKLTSS  723

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLT  176
            +L                                       E+E GPL LR  +   VLT
Sbjct  724  SL--------------------------------------AEIELGPLWLRRGKSAPVLT  745

Query  175  IRKPNVRVGDDWSIKIL  125
            IR+PNV V DDW+IKIL
Sbjct  746  IRRPNVPVADDWTIKIL  762



>ref|XP_010088026.1| Neutral alpha-glucosidase AB [Morus notabilis]
 gb|EXB31245.1| Neutral alpha-glucosidase AB [Morus notabilis]
Length=870

 Score =   229 bits (584),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 135/174 (78%), Gaps = 1/174 (1%)
 Frame = -1

Query  643  LRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSSTQMENDPYTLVIALNSSQ  464
            L  G   +G  THKLEA EE++PAFQR+GTIIPRKDRFRRSSTQM NDPYTLVIALNSSQ
Sbjct  697  LVQGIYTEGSTTHKLEATEETVPAFQRSGTIIPRKDRFRRSSTQMVNDPYTLVIALNSSQ  756

Query  463  AAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSLNLKPSS-GSKKFSSDCTVERIILL  287
             AEGE+YIDDG+SF F QGAYIHRRF+++ G LTSLN+ P++ G  +FSS+C +ERII+L
Sbjct  757  KAEGEVYIDDGKSFAFTQGAYIHRRFVYADGKLTSLNVAPAALGGAQFSSECVIERIIVL  816

Query  286  GLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNVRVGDDWSIKIL  125
            G S  PK AL+EP     E+E GPL L+   G   +TIRKPN+ V  DW+IKI+
Sbjct  817  GHSGVPKRALIEPEEKTAEIELGPLDLKLGLGSDFITIRKPNLPVAGDWTIKIV  870



>gb|KJB40498.1| hypothetical protein B456_007G066900 [Gossypium raimondii]
Length=854

 Score =   213 bits (543),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 112/130 (86%), Gaps = 3/130 (2%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYT RAKHVSVYLPG +SWYDLR+GTAYKGG  HKLE  EESIPAFQRAGTI+PRKD
Sbjct  725  VQGIYTARAKHVSVYLPGKESWYDLRTGTAYKGGKVHKLEVSEESIPAFQRAGTIVPRKD  784

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            R RRSSTQM +DPYTLVIALNSSQAAEGELY+DDG+S+DFK GAYIHRRF+FS G LTS 
Sbjct  785  RLRRSSTQMVHDPYTLVIALNSSQAAEGELYVDDGKSYDFKHGAYIHRRFVFSNGHLTS-  843

Query  355  NLKPSSGSKK  326
               P   S+K
Sbjct  844  --SPVGNSRK  851



>ref|XP_007048510.1| Glycosyl hydrolases family 31 protein isoform 2 [Theobroma cacao]
 gb|EOX92667.1| Glycosyl hydrolases family 31 protein isoform 2 [Theobroma cacao]
Length=856

 Score =   210 bits (535),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 112/130 (86%), Gaps = 1/130 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGI++ERAKH SVYLPG + WYD R+G+AYKGG  HKLE  EESIPAFQRAGTI+PRKD
Sbjct  727  VQGIFSERAKHASVYLPGKELWYDFRTGSAYKGGKIHKLEVSEESIPAFQRAGTILPRKD  786

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM +DPYTLVIALNSSQAAEGELY+DDG+SFDF  GAYIHRRF+FS G LTS 
Sbjct  787  RFRRSSTQMVHDPYTLVIALNSSQAAEGELYLDDGKSFDFMHGAYIHRRFVFSNGQLTSS  846

Query  355  NL-KPSSGSK  329
            N+  PS G K
Sbjct  847  NMASPSLGRK  856



>emb|CCW28783.1| glycoside hydrolase [Arachis duranensis]
Length=907

 Score =   209 bits (532),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 113/141 (80%), Gaps = 1/141 (1%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYTERAK  SVYLPG +SWYD R+G  YKG  THKL   EESIP F RAGTII RKD
Sbjct  766  VQGIYTERAKQTSVYLPGKESWYDFRTGNVYKGEATHKLAVTEESIPVFMRAGTIITRKD  825

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSSTQM NDPYTLVIALNSSQAAEGELY+DDG SF+F QGAYIHRRFIF  G LTSL
Sbjct  826  RFRRSSTQMTNDPYTLVIALNSSQAAEGELYLDDGSSFNFLQGAYIHRRFIFKDGKLTSL  885

Query  355  NLKPSS-GSKKFSSDCTVERI  296
            +L P+S G+ ++  +  +E +
Sbjct  886  DLAPASNGNARYPVNTVIESL  906



>emb|CBI26440.3| unnamed protein product [Vitis vinifera]
Length=752

 Score =   206 bits (525),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYTERAK+ SVYLPG QSWYDLR+G  YKGG THKLE  EE+IPAF RAGTIIPRKD
Sbjct  604  VQGIYTERAKYASVYLPGGQSWYDLRTGIIYKGGTTHKLEVSEETIPAFHRAGTIIPRKD  663

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            R+RRSST M NDPYTLVIALNSS AAEGELYID+G+SF+FKQGAYIHR F+FS G LTS 
Sbjct  664  RYRRSSTLMANDPYTLVIALNSSHAAEGELYIDNGKSFEFKQGAYIHRHFVFSDGKLTSS  723

Query  355  NLKPSSGSKKF  323
            +L   +  K +
Sbjct  724  SLDVVTNLKNY  734



>ref|XP_001769049.1| predicted protein [Physcomitrella patens]
 gb|EDQ66127.1| predicted protein [Physcomitrella patens]
Length=929

 Score =   205 bits (522),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 142/202 (70%), Gaps = 7/202 (3%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLE-ALEESIPAFQRAGTIIPRK  539
            V G+Y+E AK   VY PG+++WYD++SGT + GG   ++  +L+  IP +QRAGTIIP+K
Sbjct  728  VHGVYSEGAKSEMVYFPGNETWYDVKSGTTFPGGKEMEIPVSLQSGIPVYQRAGTIIPKK  787

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSSTQM NDPYTLV+AL+S+  AEGELYIDDG++++F++GA+IHRRF F  G LTS
Sbjct  788  LRHRRSSTQMLNDPYTLVVALDSNYEAEGELYIDDGKTYEFEKGAFIHRRFKFVKGKLTS  847

Query  358  LNLKPS-SGSKKFSSDCTVERIILLGLSE----GPKSALVEPGNNKVEVEKGPLLLRESQ  194
             NL PS S  KKF+S C VERI+++G+        K A+VE G   ++ + G   L    
Sbjct  848  TNLAPSKSNPKKFTSPCLVERIVIMGVRARDLVTGKGAVVE-GERWIQTDIGAPSLIPGA  906

Query  193  GPSVLTIRKPNVRVGDDWSIKI  128
              S L +R PNVR+ DDWSIK+
Sbjct  907  HSSALILRLPNVRIADDWSIKL  928



>ref|XP_002964300.1| hypothetical protein SELMODRAFT_142083 [Selaginella moellendorffii]
 gb|EFJ34633.1| hypothetical protein SELMODRAFT_142083 [Selaginella moellendorffii]
Length=823

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 145/203 (71%), Gaps = 8/203 (4%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            V+ +YTE +   +VYLPG + W+D+++G ++ GG T+KL   ++SIPAFQR GTIIPRKD
Sbjct  623  VRSVYTEGSNLETVYLPGSEPWFDIKTGQSFNGGKTYKLAVSQDSIPAFQRGGTIIPRKD  682

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSS+QM +DPYTLVIALNS+Q A+GELYIDDG+S++F++GA+IHRRF FS G L+S 
Sbjct  683  RFRRSSSQMVDDPYTLVIALNSTQEAQGELYIDDGKSYEFEKGAFIHRRFSFSGGKLSSS  742

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSE----GPKSALVEPG--NNKVEVEKGPLLLRESQ  194
            +   S  SK + +  TVERII+LGL          ALVE G  + + ++E  P +LR   
Sbjct  743  SA--SPASKSYKTLSTVERIIILGLDAKKVPAAHRALVEEGGQDRQADIEAAPPVLRAKL  800

Query  193  GPSVLTIRKPNVRVGDDWSIKIL  125
              + + +R PNV +  DWSIK+L
Sbjct  801  KSNAVAVRLPNVSIDKDWSIKVL  823



>ref|XP_002967735.1| hypothetical protein SELMODRAFT_169507 [Selaginella moellendorffii]
 gb|EFJ31082.1| hypothetical protein SELMODRAFT_169507 [Selaginella moellendorffii]
Length=905

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 146/203 (72%), Gaps = 8/203 (4%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            V+ +YTE +   +VYLPG + W+D+++G ++ GG T+KL   ++SIPAFQR GTIIPRKD
Sbjct  705  VRSVYTEGSNLETVYLPGSEPWFDIKTGQSFNGGKTYKLAVSQDSIPAFQRGGTIIPRKD  764

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSS+QM +DPYTLVIALNS+Q A+GELYIDDG+S++F++GA+IHRRF FS G L+S 
Sbjct  765  RFRRSSSQMVDDPYTLVIALNSTQEAQGELYIDDGKSYEFEKGAFIHRRFSFSGGKLSSS  824

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSE----GPKSALVEPG--NNKVEVEKGPLLLRESQ  194
            +  P+S S K  S  TVERII+LGL          ALVE G  + + ++E  P +LR   
Sbjct  825  SASPASKSYKTLS--TVERIIILGLDAKKVPAAHRALVEEGGQDRQADIEAAPPVLRAKL  882

Query  193  GPSVLTIRKPNVRVGDDWSIKIL  125
              + + +R PNV +  DWSIK+L
Sbjct  883  KSNAVAVRLPNVSIDKDWSIKVL  905



>ref|XP_006432099.1| hypothetical protein CICLE_v100002001mg, partial [Citrus clementina]
 gb|ESR45339.1| hypothetical protein CICLE_v100002001mg, partial [Citrus clementina]
Length=119

 Score =   163 bits (412),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 95/120 (79%), Gaps = 1/120 (1%)
 Frame = -1

Query  484  IALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSLNLKPSSGSKKFSSDCTV  305
            +ALNSSQAAEG+LY+DDG+SFDF +GA+IHRRF+FS   L S+N+ P++G  +FSS+C +
Sbjct  1    VALNSSQAAEGQLYVDDGKSFDFLEGAFIHRRFVFSNSHLKSINMAPAAGKSRFSSECII  60

Query  304  ERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNVRVGDDWSIKIL  125
            ERIILLG   G KSAL+EP N K E+E GPL L+   G +VLT+R P VR+ DDW+IKIL
Sbjct  61   ERIILLG-HGGSKSALIEPANQKAEIELGPLQLQGQHGRTVLTVRNPGVRISDDWTIKIL  119



>emb|CAN82775.1| hypothetical protein VITISV_000481 [Vitis vinifera]
Length=594

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 103/144 (72%), Gaps = 6/144 (4%)
 Frame = -1

Query  538  DRFRRSSTQMENDPYTL------VIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFS  377
            DR ++   Q+ N  +        VIALN S AAEGELYIDDG+SF+FKQGAYIHR F+FS
Sbjct  451  DRLQKRGWQLPNRCFLCGCEKENVIALNGSHAAEGELYIDDGKSFEFKQGAYIHRHFVFS  510

Query  376  AGTLTSLNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRES  197
             G LTS +L P++G   FSS C +ERII+LG S GPK+AL+EP N K E+E GPL LR  
Sbjct  511  DGKLTSSSLVPNAGRTLFSSACVIERIIVLGHSSGPKNALIEPSNRKAEIELGPLWLRRG  570

Query  196  QGPSVLTIRKPNVRVGDDWSIKIL  125
            +   VLTIR+PNV V DDW+IKIL
Sbjct  571  KSAPVLTIRRPNVPVADDWTIKIL  594



>gb|ACG25781.1| hypothetical protein [Zea mays]
 gb|AFW89187.1| hypothetical protein ZEAMMB73_762165 [Zea mays]
Length=128

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = -1

Query  487  VIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSLNLKPSSGSKKFSSDCT  308
            VIALNSS AAEGELY+DDG+S+D++QGA+ HRRF+F+   LTS N+ P + SKKF+S C 
Sbjct  8    VIALNSSGAAEGELYMDDGKSYDYQQGAFSHRRFVFADNKLTSFNIAPDNLSKKFTSGCV  67

Query  307  VERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNVRVGDDWSIKI  128
            +ERII+LGL  G K A++EPGN +VE+E GP+ LR    P V TIR+PNVR+ D W+I I
Sbjct  68   IERIIVLGLRSGVKKAIIEPGNQEVEIESGPISLRSGSSPVVPTIRRPNVRIADSWTIWI  127



>ref|XP_005814922.1| PREDICTED: neutral alpha-glucosidase AB-like [Xiphophorus maculatus]
Length=883

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 125/198 (63%), Gaps = 12/198 (6%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQS-WYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG    W+D+ +   + GG    +     SIP FQR G+IIPRK
Sbjct  695  VHPVTEEGARGVTAYLPGKHEVWFDIHTFQKHNGGQNLYIPVTMSSIPVFQRGGSIIPRK  754

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +AL++ + AEGELYIDDG +F++++   IHR+F F+ G L+S
Sbjct  755  LRVRRSSTCMEHDPYTLYVALDNQRTAEGELYIDDGHTFNYEKKELIHRKFSFANGVLSS  814

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSAL-VEPGNNKVEVEKGPLLLRESQGPSV  182
            ++L+P++   +F++   VERII+LG S+     L    G N++E +    +       SV
Sbjct  815  VDLEPNA---QFTTKSWVERIIILGASKPSMVTLKTADGENQLEFDFDASM-------SV  864

Query  181  LTIRKPNVRVGDDWSIKI  128
            LTIRKP + VG DW++ +
Sbjct  865  LTIRKPGMNVGADWTVTL  882



>ref|XP_010747970.1| PREDICTED: neutral alpha-glucosidase AB isoform X1 [Larimichthys 
crocea]
Length=950

 Score =   159 bits (402),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 120/197 (61%), Gaps = 10/197 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG D+ W+D+ S   + G     +     SIP FQR G+IIPRK
Sbjct  762  VHPVTEEGARGVTAYLPGKDEVWFDVNSFQKHNGAQNLYIPVTMSSIPVFQRGGSIIPRK  821

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +ALN  + AEGELY+DDG +F++++  +IHRR  F+   L+S
Sbjct  822  LRVRRSSTCMEHDPYTLYVALNPKRTAEGELYVDDGHTFNYEKKEFIHRRLSFANNVLSS  881

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +NL P +    FS+   +ERII+LG S+ P    +  G  + ++E            SVL
Sbjct  882  VNLAPDA---HFSTRSWIERIIILGASK-PGKVTLTAGAQESQLE-----FEFDASMSVL  932

Query  178  TIRKPNVRVGDDWSIKI  128
            TIRKP +  G DW++K+
Sbjct  933  TIRKPGMNAGVDWTVKL  949



>ref|XP_010747972.1| PREDICTED: neutral alpha-glucosidase AB isoform X2 [Larimichthys 
crocea]
Length=928

 Score =   159 bits (401),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 120/197 (61%), Gaps = 10/197 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG D+ W+D+ S   + G     +     SIP FQR G+IIPRK
Sbjct  740  VHPVTEEGARGVTAYLPGKDEVWFDVNSFQKHNGAQNLYIPVTMSSIPVFQRGGSIIPRK  799

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +ALN  + AEGELY+DDG +F++++  +IHRR  F+   L+S
Sbjct  800  LRVRRSSTCMEHDPYTLYVALNPKRTAEGELYVDDGHTFNYEKKEFIHRRLSFANNVLSS  859

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +NL P +    FS+   +ERII+LG S+ P    +  G  + ++E            SVL
Sbjct  860  VNLAPDA---HFSTRSWIERIIILGASK-PGKVTLTAGAQESQLE-----FEFDASMSVL  910

Query  178  TIRKPNVRVGDDWSIKI  128
            TIRKP +  G DW++K+
Sbjct  911  TIRKPGMNAGVDWTVKL  927



>ref|XP_008325072.1| PREDICTED: neutral alpha-glucosidase AB isoform X3 [Cynoglossus 
semilaevis]
Length=927

 Score =   158 bits (399),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 119/197 (60%), Gaps = 9/197 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG ++ W+D+ +   + G     +     SIP FQR G+IIPRK
Sbjct  738  VHPVTEEGARGVTAYLPGKNEVWFDVNTFQKHNGAQNLYIPVTMSSIPVFQRGGSIIPRK  797

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +ALN  + AEGELYIDDG +F++++  +IHR+  F+   L+S
Sbjct  798  LRVRRSSTCMEHDPYTLFVALNPQRTAEGELYIDDGHTFNYEKKEFIHRKLFFANNILSS  857

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +NL P +   KFS+   +ER+I+LG S+  K  L      + ++E            SVL
Sbjct  858  INLAPDA---KFSTQSWIERVIILGASKPSKVTLQTADGQESQLE-----FEFDSSMSVL  909

Query  178  TIRKPNVRVGDDWSIKI  128
            T+RKP +  G+DW + +
Sbjct  910  TLRKPGMNAGEDWKVML  926



>ref|XP_008325071.1| PREDICTED: neutral alpha-glucosidase AB isoform X2 [Cynoglossus 
semilaevis]
Length=950

 Score =   158 bits (399),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 119/197 (60%), Gaps = 9/197 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG ++ W+D+ +   + G     +     SIP FQR G+IIPRK
Sbjct  761  VHPVTEEGARGVTAYLPGKNEVWFDVNTFQKHNGAQNLYIPVTMSSIPVFQRGGSIIPRK  820

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +ALN  + AEGELYIDDG +F++++  +IHR+  F+   L+S
Sbjct  821  LRVRRSSTCMEHDPYTLFVALNPQRTAEGELYIDDGHTFNYEKKEFIHRKLFFANNILSS  880

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +NL P +   KFS+   +ER+I+LG S+  K  L      + ++E            SVL
Sbjct  881  INLAPDA---KFSTQSWIERVIILGASKPSKVTLQTADGQESQLE-----FEFDSSMSVL  932

Query  178  TIRKPNVRVGDDWSIKI  128
            T+RKP +  G+DW + +
Sbjct  933  TLRKPGMNAGEDWKVML  949



>ref|XP_008325070.1| PREDICTED: neutral alpha-glucosidase AB isoform X1 [Cynoglossus 
semilaevis]
Length=951

 Score =   158 bits (399),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 119/197 (60%), Gaps = 9/197 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG ++ W+D+ +   + G     +     SIP FQR G+IIPRK
Sbjct  762  VHPVTEEGARGVTAYLPGKNEVWFDVNTFQKHNGAQNLYIPVTMSSIPVFQRGGSIIPRK  821

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +ALN  + AEGELYIDDG +F++++  +IHR+  F+   L+S
Sbjct  822  LRVRRSSTCMEHDPYTLFVALNPQRTAEGELYIDDGHTFNYEKKEFIHRKLFFANNILSS  881

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +NL P +   KFS+   +ER+I+LG S+  K  L      + ++E            SVL
Sbjct  882  INLAPDA---KFSTQSWIERVIILGASKPSKVTLQTADGQESQLE-----FEFDSSMSVL  933

Query  178  TIRKPNVRVGDDWSIKI  128
            T+RKP +  G+DW + +
Sbjct  934  TLRKPGMNAGEDWKVML  950



>ref|XP_007550406.1| PREDICTED: neutral alpha-glucosidase AB isoform X1 [Poecilia 
formosa]
Length=950

 Score =   157 bits (398),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 124/198 (63%), Gaps = 12/198 (6%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQS-WYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG    W+D+ +   + GG    +     SIP FQR G+IIPRK
Sbjct  762  VHPVTEEGARGVTAYLPGKHEVWFDIHTFQKHNGGQNLYIPVTMSSIPVFQRGGSIIPRK  821

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +AL++ + AEGELYIDDG +F++++   IHR+F F+ G L+S
Sbjct  822  LRVRRSSTCMEHDPYTLYVALDNQRTAEGELYIDDGHTFNYEKKELIHRKFSFANGVLSS  881

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSAL-VEPGNNKVEVEKGPLLLRESQGPSV  182
            ++L+P++   +F++   VERII+LG S+     L    G N++E +    +       SV
Sbjct  882  VDLEPNA---QFTTKSWVERIIILGASKPSMVTLKTADGENQLEFDFDASM-------SV  931

Query  181  LTIRKPNVRVGDDWSIKI  128
            LTIRKP +  G DW++ +
Sbjct  932  LTIRKPGMNAGADWTVTL  949



>ref|XP_007550408.1| PREDICTED: neutral alpha-glucosidase AB isoform X3 [Poecilia 
formosa]
Length=943

 Score =   157 bits (398),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 124/198 (63%), Gaps = 12/198 (6%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQS-WYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG    W+D+ +   + GG    +     SIP FQR G+IIPRK
Sbjct  755  VHPVTEEGARGVTAYLPGKHEVWFDIHTFQKHNGGQNLYIPVTMSSIPVFQRGGSIIPRK  814

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +AL++ + AEGELYIDDG +F++++   IHR+F F+ G L+S
Sbjct  815  LRVRRSSTCMEHDPYTLYVALDNQRTAEGELYIDDGHTFNYEKKELIHRKFSFANGVLSS  874

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSAL-VEPGNNKVEVEKGPLLLRESQGPSV  182
            ++L+P++   +F++   VERII+LG S+     L    G N++E +    +       SV
Sbjct  875  VDLEPNA---QFTTKSWVERIIILGASKPSMVTLKTADGENQLEFDFDASM-------SV  924

Query  181  LTIRKPNVRVGDDWSIKI  128
            LTIRKP +  G DW++ +
Sbjct  925  LTIRKPGMNAGADWTVTL  942



>ref|XP_007550407.1| PREDICTED: neutral alpha-glucosidase AB isoform X2 [Poecilia 
formosa]
Length=947

 Score =   157 bits (398),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 124/198 (63%), Gaps = 12/198 (6%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQS-WYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG    W+D+ +   + GG    +     SIP FQR G+IIPRK
Sbjct  759  VHPVTEEGARGVTAYLPGKHEVWFDIHTFQKHNGGQNLYIPVTMSSIPVFQRGGSIIPRK  818

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +AL++ + AEGELYIDDG +F++++   IHR+F F+ G L+S
Sbjct  819  LRVRRSSTCMEHDPYTLYVALDNQRTAEGELYIDDGHTFNYEKKELIHRKFSFANGVLSS  878

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSAL-VEPGNNKVEVEKGPLLLRESQGPSV  182
            ++L+P++   +F++   VERII+LG S+     L    G N++E +    +       SV
Sbjct  879  VDLEPNA---QFTTKSWVERIIILGASKPSMVTLKTADGENQLEFDFDASM-------SV  928

Query  181  LTIRKPNVRVGDDWSIKI  128
            LTIRKP +  G DW++ +
Sbjct  929  LTIRKPGMNAGADWTVTL  946



>ref|XP_007550409.1| PREDICTED: neutral alpha-glucosidase AB isoform X4 [Poecilia 
formosa]
Length=928

 Score =   157 bits (397),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 124/198 (63%), Gaps = 12/198 (6%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQS-WYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG    W+D+ +   + GG    +     SIP FQR G+IIPRK
Sbjct  740  VHPVTEEGARGVTAYLPGKHEVWFDIHTFQKHNGGQNLYIPVTMSSIPVFQRGGSIIPRK  799

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +AL++ + AEGELYIDDG +F++++   IHR+F F+ G L+S
Sbjct  800  LRVRRSSTCMEHDPYTLYVALDNQRTAEGELYIDDGHTFNYEKKELIHRKFSFANGVLSS  859

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSAL-VEPGNNKVEVEKGPLLLRESQGPSV  182
            ++L+P++   +F++   VERII+LG S+     L    G N++E +    +       SV
Sbjct  860  VDLEPNA---QFTTKSWVERIIILGASKPSMVTLKTADGENQLEFDFDASM-------SV  909

Query  181  LTIRKPNVRVGDDWSIKI  128
            LTIRKP +  G DW++ +
Sbjct  910  LTIRKPGMNAGADWTVTL  927



>ref|XP_008418637.1| PREDICTED: neutral alpha-glucosidase AB isoform X1 [Poecilia 
reticulata]
Length=950

 Score =   156 bits (394),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 124/198 (63%), Gaps = 12/198 (6%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQS-WYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG    W+D+ +   + GG    +     SIP FQR G+IIPRK
Sbjct  762  VHPVTEEGARGVTAYLPGKHEVWFDIHTFQKHNGGQNLYIPVTMSSIPVFQRGGSIIPRK  821

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +AL++ + AEGELYIDDG +F++++   +HR+F F+ G L+S
Sbjct  822  LRVRRSSTCMEHDPYTLYVALDNRRTAEGELYIDDGHTFNYEKKELMHRKFSFANGVLSS  881

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSAL-VEPGNNKVEVEKGPLLLRESQGPSV  182
            ++L+P++   +F++   VERII+LG S+     L    G N++E +    +       SV
Sbjct  882  VDLEPNA---QFTTKSWVERIIILGASKPSMVTLKTADGENQLEFDFDASM-------SV  931

Query  181  LTIRKPNVRVGDDWSIKI  128
            LTIRKP +  G DW++ +
Sbjct  932  LTIRKPGMNAGADWTVTL  949



>ref|XP_008418638.1| PREDICTED: neutral alpha-glucosidase AB isoform X2 [Poecilia 
reticulata]
Length=947

 Score =   156 bits (394),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 124/198 (63%), Gaps = 12/198 (6%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQS-WYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG    W+D+ +   + GG    +     SIP FQR G+IIPRK
Sbjct  759  VHPVTEEGARGVTAYLPGKHEVWFDIHTFQKHNGGQNLYIPVTMSSIPVFQRGGSIIPRK  818

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +AL++ + AEGELYIDDG +F++++   +HR+F F+ G L+S
Sbjct  819  LRVRRSSTCMEHDPYTLYVALDNRRTAEGELYIDDGHTFNYEKKELMHRKFSFANGVLSS  878

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSAL-VEPGNNKVEVEKGPLLLRESQGPSV  182
            ++L+P++   +F++   VERII+LG S+     L    G N++E +    +       SV
Sbjct  879  VDLEPNA---QFTTKSWVERIIILGASKPSMVTLKTADGENQLEFDFDASM-------SV  928

Query  181  LTIRKPNVRVGDDWSIKI  128
            LTIRKP +  G DW++ +
Sbjct  929  LTIRKPGMNAGADWTVTL  946



>ref|XP_008418641.1| PREDICTED: neutral alpha-glucosidase AB isoform X4 [Poecilia 
reticulata]
Length=928

 Score =   156 bits (394),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 124/198 (63%), Gaps = 12/198 (6%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQS-WYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG    W+D+ +   + GG    +     SIP FQR G+IIPRK
Sbjct  740  VHPVTEEGARGVTAYLPGKHEVWFDIHTFQKHNGGQNLYIPVTMSSIPVFQRGGSIIPRK  799

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +AL++ + AEGELYIDDG +F++++   +HR+F F+ G L+S
Sbjct  800  LRVRRSSTCMEHDPYTLYVALDNRRTAEGELYIDDGHTFNYEKKELMHRKFSFANGVLSS  859

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSAL-VEPGNNKVEVEKGPLLLRESQGPSV  182
            ++L+P++   +F++   VERII+LG S+     L    G N++E +    +       SV
Sbjct  860  VDLEPNA---QFTTKSWVERIIILGASKPSMVTLKTADGENQLEFDFDASM-------SV  909

Query  181  LTIRKPNVRVGDDWSIKI  128
            LTIRKP +  G DW++ +
Sbjct  910  LTIRKPGMNAGADWTVTL  927



>ref|XP_008418640.1| PREDICTED: neutral alpha-glucosidase AB isoform X3 [Poecilia 
reticulata]
Length=943

 Score =   156 bits (394),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 124/198 (63%), Gaps = 12/198 (6%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQS-WYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG    W+D+ +   + GG    +     SIP FQR G+IIPRK
Sbjct  755  VHPVTEEGARGVTAYLPGKHEVWFDIHTFQKHNGGQNLYIPVTMSSIPVFQRGGSIIPRK  814

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +AL++ + AEGELYIDDG +F++++   +HR+F F+ G L+S
Sbjct  815  LRVRRSSTCMEHDPYTLYVALDNRRTAEGELYIDDGHTFNYEKKELMHRKFSFANGVLSS  874

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSAL-VEPGNNKVEVEKGPLLLRESQGPSV  182
            ++L+P++   +F++   VERII+LG S+     L    G N++E +    +       SV
Sbjct  875  VDLEPNA---QFTTKSWVERIIILGASKPSMVTLKTADGENQLEFDFDASM-------SV  924

Query  181  LTIRKPNVRVGDDWSIKI  128
            LTIRKP +  G DW++ +
Sbjct  925  LTIRKPGMNAGADWTVTL  942



>ref|XP_009289535.1| PREDICTED: neutral alpha-glucosidase AB [Danio rerio]
Length=941

 Score =   156 bits (394),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 124/205 (60%), Gaps = 11/205 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E ++ V+ YLPG  + WYD+ +   + G     +     SIP FQR G+IIPRK
Sbjct  746  VHPVTEEGSRGVTAYLPGAGEVWYDVHTFQKHNGAQNLYIPVTLSSIPVFQRGGSIIPRK  805

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLT  362
            DR RRSS  MENDPYTL +AL+  + AEGELYIDDG SF++  +  +IHR+  F+  +LT
Sbjct  806  DRIRRSSACMENDPYTLYVALSPKKFAEGELYIDDGHSFNYDTKSEFIHRKLTFANNSLT  865

Query  361  SLNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSV  182
            S NL P     KFS+   VE++++LG S+ P+  L+     KV+ ++ P+        SV
Sbjct  866  SRNLCPDC---KFSTSSWVEKVVILGASK-PRKVLL-----KVDGKETPVEFEFDASMSV  916

Query  181  LTIRKPNVRVGDDWSIKIL*ELADL  107
            LT+RKP +  G DW+I +  +  DL
Sbjct  917  LTLRKPGINAGMDWTILLQSQRNDL  941



>ref|XP_006782031.1| PREDICTED: neutral alpha-glucosidase AB-like [Neolamprologus 
brichardi]
Length=932

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 120/195 (62%), Gaps = 9/195 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG D+ W+D+ +   + G     +     SIP FQR G+IIPRK
Sbjct  743  VHPVVEEGARGVTAYLPGKDEVWFDVHTFQKHNGAQNLYIPVTMSSIPVFQRGGSIIPRK  802

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +ALN  + A+GELYIDDG +F++++  +I+R+  F+   L+S
Sbjct  803  LRVRRSSTCMEHDPYTLYVALNLQRTADGELYIDDGHTFNYEKKEFIYRKLTFANKVLSS  862

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +NL P +   KF++D  +ERII+LG S+  K  L      + ++E        +   SVL
Sbjct  863  VNLAPDA---KFTTDSWIERIIVLGASKPSKVTLKTADGQEKQLE-----FDFNASMSVL  914

Query  178  TIRKPNVRVGDDWSI  134
            T+RKP +  G DW++
Sbjct  915  TVRKPGMNAGADWTV  929



>ref|XP_789535.3| PREDICTED: neutral alpha-glucosidase AB-like [Strongylocentrotus 
purpuratus]
Length=880

 Score =   155 bits (392),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 120/199 (60%), Gaps = 16/199 (8%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            V  I  + ++  SVY PG+  W+D+ +  AY+G  TH + A  + IP FQ  G+I+PRK+
Sbjct  694  VSPISDQGSRATSVYFPGNDPWFDVDTFFAYQGPATHNVNADLDKIPVFQHGGSIVPRKE  753

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            R RR S+   +DPYTL +ALN++  A G+LYIDDG SFD+KQ  +I+R+F FSA  L S 
Sbjct  754  RVRRCSSLTVDDPYTLTVALNNAGTANGDLYIDDGHSFDYKQQKFIYRQFTFSANKLESR  813

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEV---EKGPLLLRESQGPS  185
             L   SG+  F ++  +ER++++GL   PK         KVE+       L    S    
Sbjct  814  AL---SGA-GFETNSWLERVVIIGLKSVPK---------KVELISQTITQLSFSTSHNRQ  860

Query  184  VLTIRKPNVRVGDDWSIKI  128
            VLTIRKP V +G DW+I++
Sbjct  861  VLTIRKPGVNIGQDWTIRL  879



>ref|XP_005467601.1| PREDICTED: neutral alpha-glucosidase AB-like isoform X2 [Oreochromis 
niloticus]
Length=944

 Score =   155 bits (391),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 119/195 (61%), Gaps = 9/195 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG D+ W+D+ +   + G     +     SIP FQR G+IIPRK
Sbjct  755  VHPVVEEGARGVTAYLPGKDEVWFDVHTFQKHNGAQNLYIPVTMSSIPVFQRGGSIIPRK  814

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +ALN  + A+GELYIDDG +F++++  +I+R+  F+   L+S
Sbjct  815  LRVRRSSTCMEHDPYTLYVALNLQRTADGELYIDDGHTFNYEKKEFIYRKLTFANKVLSS  874

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +NL P +   KF++D  +ERII+LG S+  K  L      + ++E            SVL
Sbjct  875  VNLAPDA---KFTTDSWIERIIVLGASKPSKVTLKTADGQEKQLE-----FDFDASMSVL  926

Query  178  TIRKPNVRVGDDWSI  134
            T+RKP +  G DW++
Sbjct  927  TVRKPGMNAGADWTM  941



>ref|XP_005467600.1| PREDICTED: neutral alpha-glucosidase AB-like isoform X1 [Oreochromis 
niloticus]
Length=951

 Score =   155 bits (391),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 119/195 (61%), Gaps = 9/195 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG D+ W+D+ +   + G     +     SIP FQR G+IIPRK
Sbjct  762  VHPVVEEGARGVTAYLPGKDEVWFDVHTFQKHNGAQNLYIPVTMSSIPVFQRGGSIIPRK  821

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +ALN  + A+GELYIDDG +F++++  +I+R+  F+   L+S
Sbjct  822  LRVRRSSTCMEHDPYTLYVALNLQRTADGELYIDDGHTFNYEKKEFIYRKLTFANKVLSS  881

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +NL P +   KF++D  +ERII+LG S+  K  L      + ++E            SVL
Sbjct  882  VNLAPDA---KFTTDSWIERIIVLGASKPSKVTLKTADGQEKQLE-----FDFDASMSVL  933

Query  178  TIRKPNVRVGDDWSI  134
            T+RKP +  G DW++
Sbjct  934  TVRKPGMNAGADWTM  948



>ref|XP_005467602.1| PREDICTED: neutral alpha-glucosidase AB-like isoform X3 [Oreochromis 
niloticus]
Length=929

 Score =   154 bits (390),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 119/195 (61%), Gaps = 9/195 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG D+ W+D+ +   + G     +     SIP FQR G+IIPRK
Sbjct  740  VHPVVEEGARGVTAYLPGKDEVWFDVHTFQKHNGAQNLYIPVTMSSIPVFQRGGSIIPRK  799

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +ALN  + A+GELYIDDG +F++++  +I+R+  F+   L+S
Sbjct  800  LRVRRSSTCMEHDPYTLYVALNLQRTADGELYIDDGHTFNYEKKEFIYRKLTFANKVLSS  859

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +NL P +   KF++D  +ERII+LG S+  K  L      + ++E            SVL
Sbjct  860  VNLAPDA---KFTTDSWIERIIVLGASKPSKVTLKTADGQEKQLE-----FDFDASMSVL  911

Query  178  TIRKPNVRVGDDWSI  134
            T+RKP +  G DW++
Sbjct  912  TVRKPGMNAGADWTM  926



>ref|XP_008302455.1| PREDICTED: neutral alpha-glucosidase AB isoform X1 [Stegastes 
partitus]
Length=951

 Score =   154 bits (388),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 118/197 (60%), Gaps = 9/197 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG D+ W+D+ +   + G     +     SIP FQR G+IIPRK
Sbjct  762  VHPVTEEGARGVTAYLPGKDEVWFDVHTFQKHNGAQNLYIPVTMSSIPVFQRGGSIIPRK  821

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +ALN  + AEGE+YIDDG +F++++  +IHRR  F+   L+S
Sbjct  822  LRVRRSSTCMEHDPYTLFVALNPQRTAEGEIYIDDGHTFNYEKKEFIHRRLSFANNLLSS  881

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +NL P +   +F++   +ER+++LG S+  K  L        +VE            SVL
Sbjct  882  VNLAPDA---QFTTRSWIERVVILGASKPSKVTLKTTDGQVSQVE-----FDFDASMSVL  933

Query  178  TIRKPNVRVGDDWSIKI  128
            T+RKP +  G DW++ +
Sbjct  934  TLRKPGMNAGADWTVML  950



>ref|XP_008302458.1| PREDICTED: neutral alpha-glucosidase AB isoform X3 [Stegastes 
partitus]
Length=929

 Score =   154 bits (388),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 118/197 (60%), Gaps = 9/197 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG D+ W+D+ +   + G     +     SIP FQR G+IIPRK
Sbjct  740  VHPVTEEGARGVTAYLPGKDEVWFDVHTFQKHNGAQNLYIPVTMSSIPVFQRGGSIIPRK  799

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +ALN  + AEGE+YIDDG +F++++  +IHRR  F+   L+S
Sbjct  800  LRVRRSSTCMEHDPYTLFVALNPQRTAEGEIYIDDGHTFNYEKKEFIHRRLSFANNLLSS  859

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +NL P +   +F++   +ER+++LG S+  K  L        +VE            SVL
Sbjct  860  VNLAPDA---QFTTRSWIERVVILGASKPSKVTLKTTDGQVSQVE-----FDFDASMSVL  911

Query  178  TIRKPNVRVGDDWSIKI  128
            T+RKP +  G DW++ +
Sbjct  912  TLRKPGMNAGADWTVML  928



>ref|XP_008302456.1| PREDICTED: neutral alpha-glucosidase AB isoform X2 [Stegastes 
partitus]
Length=944

 Score =   154 bits (388),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 118/197 (60%), Gaps = 9/197 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG D+ W+D+ +   + G     +     SIP FQR G+IIPRK
Sbjct  755  VHPVTEEGARGVTAYLPGKDEVWFDVHTFQKHNGAQNLYIPVTMSSIPVFQRGGSIIPRK  814

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +ALN  + AEGE+YIDDG +F++++  +IHRR  F+   L+S
Sbjct  815  LRVRRSSTCMEHDPYTLFVALNPQRTAEGEIYIDDGHTFNYEKKEFIHRRLSFANNLLSS  874

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +NL P +   +F++   +ER+++LG S+  K  L        +VE            SVL
Sbjct  875  VNLAPDA---QFTTRSWIERVVILGASKPSKVTLKTTDGQVSQVE-----FDFDASMSVL  926

Query  178  TIRKPNVRVGDDWSIKI  128
            T+RKP +  G DW++ +
Sbjct  927  TLRKPGMNAGADWTVML  943



>ref|XP_004545613.1| PREDICTED: neutral alpha-glucosidase AB-like isoform X1 [Maylandia 
zebra]
Length=951

 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 118/195 (61%), Gaps = 9/195 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG D+ W+D+ +   + G     +     SIP FQ  G+IIPRK
Sbjct  762  VHPVVEEGARGVTAYLPGKDEVWFDVHTFQKHNGAQNLYIPVTMSSIPVFQHGGSIIPRK  821

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +ALN  + A+GELYIDDG +F++++  +I+R+  F+   L+S
Sbjct  822  LRVRRSSTCMEHDPYTLYVALNLQRTADGELYIDDGHTFNYEKKEFIYRKLTFANKVLSS  881

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +NL P +   KF++D  +ERII+LG S+  K  L      + ++E            SVL
Sbjct  882  VNLAPDA---KFTTDSWIERIIVLGASKPSKVTLKTADGQEKQLE-----FDFDASMSVL  933

Query  178  TIRKPNVRVGDDWSI  134
            T+RKP +  G DW++
Sbjct  934  TVRKPGMNAGADWTV  948



>ref|XP_004545615.1| PREDICTED: neutral alpha-glucosidase AB-like isoform X3 [Maylandia 
zebra]
Length=929

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 118/195 (61%), Gaps = 9/195 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG D+ W+D+ +   + G     +     SIP FQ  G+IIPRK
Sbjct  740  VHPVVEEGARGVTAYLPGKDEVWFDVHTFQKHNGAQNLYIPVTMSSIPVFQHGGSIIPRK  799

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +ALN  + A+GELYIDDG +F++++  +I+R+  F+   L+S
Sbjct  800  LRVRRSSTCMEHDPYTLYVALNLQRTADGELYIDDGHTFNYEKKEFIYRKLTFANKVLSS  859

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +NL P +   KF++D  +ERII+LG S+  K  L      + ++E            SVL
Sbjct  860  VNLAPDA---KFTTDSWIERIIVLGASKPSKVTLKTADGQEKQLE-----FDFDASMSVL  911

Query  178  TIRKPNVRVGDDWSI  134
            T+RKP +  G DW++
Sbjct  912  TVRKPGMNAGADWTV  926



>ref|XP_004545614.1| PREDICTED: neutral alpha-glucosidase AB-like isoform X2 [Maylandia 
zebra]
Length=944

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 118/195 (61%), Gaps = 9/195 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG D+ W+D+ +   + G     +     SIP FQ  G+IIPRK
Sbjct  755  VHPVVEEGARGVTAYLPGKDEVWFDVHTFQKHNGAQNLYIPVTMSSIPVFQHGGSIIPRK  814

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +ALN  + A+GELYIDDG +F++++  +I+R+  F+   L+S
Sbjct  815  LRVRRSSTCMEHDPYTLYVALNLQRTADGELYIDDGHTFNYEKKEFIYRKLTFANKVLSS  874

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +NL P +   KF++D  +ERII+LG S+  K  L      + ++E            SVL
Sbjct  875  VNLAPDA---KFTTDSWIERIIVLGASKPSKVTLKTADGQEKQLE-----FDFDASMSVL  926

Query  178  TIRKPNVRVGDDWSI  134
            T+RKP +  G DW++
Sbjct  927  TVRKPGMNAGADWTV  941



>ref|XP_005913414.1| PREDICTED: neutral alpha-glucosidase AB-like isoform X1 [Haplochromis 
burtoni]
Length=951

 Score =   152 bits (385),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 118/195 (61%), Gaps = 9/195 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG D+ W+D+ +   + G     +     SIP FQR G+IIPRK
Sbjct  762  VHPVVEEGARGVTAYLPGKDEVWFDVHTFQKHNGAQNLYIPVTMSSIPVFQRGGSIIPRK  821

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +ALN  + A+GELYIDDG +F++++  +I+R+  F+   L+S
Sbjct  822  LRVRRSSTCMEHDPYTLYVALNLQRTADGELYIDDGHTFNYEKKEFIYRKLTFANKVLSS  881

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +N  P +   KF++D  +ERII+LG S+  K  L      + ++E            SVL
Sbjct  882  VNHAPDA---KFTTDSWIERIIVLGASKPSKVTLKTADGQEKQLE-----FDFDASMSVL  933

Query  178  TIRKPNVRVGDDWSI  134
            T+RKP +  G DW++
Sbjct  934  TVRKPGMNAGADWTV  948



>ref|XP_005913415.1| PREDICTED: neutral alpha-glucosidase AB-like isoform X2 [Haplochromis 
burtoni]
 ref|XP_005913416.1| PREDICTED: neutral alpha-glucosidase AB-like isoform X3 [Haplochromis 
burtoni]
 ref|XP_005913418.1| PREDICTED: neutral alpha-glucosidase AB-like isoform X5 [Haplochromis 
burtoni]
Length=944

 Score =   152 bits (385),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 118/195 (61%), Gaps = 9/195 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG D+ W+D+ +   + G     +     SIP FQR G+IIPRK
Sbjct  755  VHPVVEEGARGVTAYLPGKDEVWFDVHTFQKHNGAQNLYIPVTMSSIPVFQRGGSIIPRK  814

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +ALN  + A+GELYIDDG +F++++  +I+R+  F+   L+S
Sbjct  815  LRVRRSSTCMEHDPYTLYVALNLQRTADGELYIDDGHTFNYEKKEFIYRKLTFANKVLSS  874

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +N  P +   KF++D  +ERII+LG S+  K  L      + ++E            SVL
Sbjct  875  VNHAPDA---KFTTDSWIERIIVLGASKPSKVTLKTADGQEKQLE-----FDFDASMSVL  926

Query  178  TIRKPNVRVGDDWSI  134
            T+RKP +  G DW++
Sbjct  927  TVRKPGMNAGADWTV  941



>ref|XP_005913417.1| PREDICTED: neutral alpha-glucosidase AB-like isoform X4 [Haplochromis 
burtoni]
Length=929

 Score =   152 bits (385),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 118/195 (61%), Gaps = 9/195 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG D+ W+D+ +   + G     +     SIP FQR G+IIPRK
Sbjct  740  VHPVVEEGARGVTAYLPGKDEVWFDVHTFQKHNGAQNLYIPVTMSSIPVFQRGGSIIPRK  799

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +ALN  + A+GELYIDDG +F++++  +I+R+  F+   L+S
Sbjct  800  LRVRRSSTCMEHDPYTLYVALNLQRTADGELYIDDGHTFNYEKKEFIYRKLTFANKVLSS  859

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +N  P +   KF++D  +ERII+LG S+  K  L      + ++E            SVL
Sbjct  860  VNHAPDA---KFTTDSWIERIIVLGASKPSKVTLKTADGQEKQLE-----FDFDASMSVL  911

Query  178  TIRKPNVRVGDDWSI  134
            T+RKP +  G DW++
Sbjct  912  TVRKPGMNAGADWTV  926



>ref|NP_001099169.1| uncharacterized protein LOC100126019 [Danio rerio]
 gb|AAI52015.1| Zgc:171967 protein [Danio rerio]
Length=433

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 119/198 (60%), Gaps = 10/198 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A  V+ YLPG  + WYD+ S   + G  +  +     SIP FQR G+II RK
Sbjct  198  VHPVTDEGATGVTAYLPGKGEVWYDVHSLQKHDGDQSLYIPVTMSSIPVFQRGGSIICRK  257

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDF-KQGAYIHRRFIFSAGTLT  362
            +R RRSS+ MENDPYTL +ALNS   AEGELYIDD  +F++ K   +IHRR  FS  +LT
Sbjct  258  ERVRRSSSCMENDPYTLYVALNSQGFAEGELYIDDFHTFNYQKSKQFIHRRLSFSNNSLT  317

Query  361  SLNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSV  182
            S +L P +   +FS++  +ERI+++G S+    +L+     +  +E        S  P+V
Sbjct  318  SRSLAPDA---QFSTESWIERIVVIGGSQPSSVSLISADGVESALE-----FEFSSNPAV  369

Query  181  LTIRKPNVRVGDDWSIKI  128
            LTIRKP+V    DW++ +
Sbjct  370  LTIRKPSVSAAADWTVVL  387



>ref|XP_009300300.1| PREDICTED: uncharacterized protein LOC100126019 isoform X2 [Danio 
rerio]
 gb|AAI63301.1| Zgc:171967 protein [Danio rerio]
Length=917

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 118/196 (60%), Gaps = 10/196 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A  V+ YLPG  + WYD+ S   + G  +  +     SIP FQR G+II RK
Sbjct  727  VHPVTDEGATGVTAYLPGKGEVWYDVHSLQKHDGDQSLYIPVTMSSIPVFQRGGSIICRK  786

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDF-KQGAYIHRRFIFSAGTLT  362
            +R RRSS+ MENDPYTL +ALNS   AEGELYIDD  +F++ K   +IHRR  FS  +LT
Sbjct  787  ERVRRSSSCMENDPYTLYVALNSQGFAEGELYIDDFHTFNYQKSKQFIHRRLSFSNNSLT  846

Query  361  SLNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSV  182
            S NL P +   +FS++  +ERI+++G S     +L+    N   VE   L    S  P+V
Sbjct  847  SRNLAPDA---QFSTESWIERIVVIGGSRPSSVSLI----NADGVESA-LEFEFSSNPAV  898

Query  181  LTIRKPNVRVGDDWSI  134
            LT+RKP+V    DW++
Sbjct  899  LTVRKPSVSAAADWTV  914



>emb|CAG09753.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=928

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/199 (39%), Positives = 123/199 (62%), Gaps = 13/199 (7%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A  V+ YLPG D+ W+D+ +   + GG +  +     SIP FQR G+IIP+K
Sbjct  739  VHPVTDEGATSVTAYLPGKDEVWFDIHTFKKHNGGQSLYIPVTISSIPVFQRGGSIIPKK  798

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSS  ME+DPYTL +AL++ + AEGE+YIDDG +F++++  +IHRR   +   ++S
Sbjct  799  LRVRRSSACMEHDPYTLYVALSNQKTAEGEIYIDDGYTFNYEKKEFIHRRISLANNVISS  858

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPG--NNKVEVEKGPLLLRESQGPS  185
            +NL P +    F++   +ERI+++G ++  K  L   G   ++++ E  P +       S
Sbjct  859  INLAPDA---HFTTPSWIERIVIIGATKPSKVTLKAAGGLESQLDFEFDPSV-------S  908

Query  184  VLTIRKPNVRVGDDWSIKI  128
            VLT+RKP V  G+DW+I +
Sbjct  909  VLTLRKPGVNAGEDWTITL  927



>ref|XP_009300299.1| PREDICTED: uncharacterized protein LOC100126019 isoform X1 [Danio 
rerio]
Length=984

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 118/196 (60%), Gaps = 10/196 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A  V+ YLPG  + WYD+ S   + G  +  +     SIP FQR G+II RK
Sbjct  749  VHPVTDEGATGVTAYLPGKGEVWYDVHSLQKHDGDQSLYIPVTMSSIPVFQRGGSIICRK  808

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDF-KQGAYIHRRFIFSAGTLT  362
            +R RRSS+ MENDPYTL +ALNS   AEGELYIDD  +F++ K   +IHRR  FS  +LT
Sbjct  809  ERVRRSSSCMENDPYTLYVALNSQGFAEGELYIDDFHTFNYQKSKQFIHRRLSFSNNSLT  868

Query  361  SLNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSV  182
            S NL P +   +FS++  +ERI+++G S     +L+    N   VE   L    S  P+V
Sbjct  869  SRNLAPDA---QFSTESWIERIVVIGGSRPSSVSLI----NADGVESA-LEFEFSSNPAV  920

Query  181  LTIRKPNVRVGDDWSI  134
            LT+RKP+V    DW++
Sbjct  921  LTVRKPSVSAAADWTV  936



>ref|XP_011478335.1| PREDICTED: neutral alpha-glucosidase AB isoform X1 [Oryzias latipes]
Length=951

 Score =   149 bits (377),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 118/197 (60%), Gaps = 9/197 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG ++ W+D+ +   + G     +     SIP FQR G+IIPRK
Sbjct  762  VHPVTEEGARGVTAYLPGKEEVWFDIHTFQKHNGAQNLYIPVTMSSIPVFQRGGSIIPRK  821

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSS+ ME+DPYTL  ALN+   AEGELY+DDG +F++++  +IHRR  FS   L+S
Sbjct  822  MRVRRSSSCMEHDPYTLYAALNARGVAEGELYMDDGHTFNYEKKEFIHRRLSFSNNVLSS  881

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +NL P S    F+++  +ERI+L+G S+  K  L      + ++E            SV+
Sbjct  882  VNLVPDS---HFTTNSWIERIVLIGSSKPAKVTLKTADGIESQLE-----FDFDASMSVV  933

Query  178  TIRKPNVRVGDDWSIKI  128
            T+RKP +  G DW++ +
Sbjct  934  TVRKPGMNAGADWTVTL  950



>ref|XP_011478336.1| PREDICTED: neutral alpha-glucosidase AB isoform X2 [Oryzias latipes]
Length=929

 Score =   149 bits (376),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 118/197 (60%), Gaps = 9/197 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG ++ W+D+ +   + G     +     SIP FQR G+IIPRK
Sbjct  740  VHPVTEEGARGVTAYLPGKEEVWFDIHTFQKHNGAQNLYIPVTMSSIPVFQRGGSIIPRK  799

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSS+ ME+DPYTL  ALN+   AEGELY+DDG +F++++  +IHRR  FS   L+S
Sbjct  800  MRVRRSSSCMEHDPYTLYAALNARGVAEGELYMDDGHTFNYEKKEFIHRRLSFSNNVLSS  859

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +NL P S    F+++  +ERI+L+G S+  K  L      + ++E            SV+
Sbjct  860  VNLVPDS---HFTTNSWIERIVLIGSSKPAKVTLKTADGIESQLE-----FDFDASMSVV  911

Query  178  TIRKPNVRVGDDWSIKI  128
            T+RKP +  G DW++ +
Sbjct  912  TVRKPGMNAGADWTVTL  928



>emb|CDQ84489.1| unnamed protein product [Oncorhynchus mykiss]
Length=935

 Score =   149 bits (376),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 119/198 (60%), Gaps = 10/198 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG  + W+D+ +   + G     +     SIP FQR G+II RK
Sbjct  745  VHPVTEEGARGVTAYLPGKGEVWFDVHTFQKHNGAQNLYIPVTISSIPVFQRGGSIISRK  804

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDF-KQGAYIHRRFIFSAGTLT  362
             R RRSS+ ME+DPYTL +AL+  + A+GELYIDDG +F+F KQ  +IHRRF F+   L+
Sbjct  805  ARVRRSSSCMEHDPYTLFVALSPKRFAQGELYIDDGHTFNFDKQKQFIHRRFSFANNALS  864

Query  361  SLNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSV  182
            S NL P S   +F++   VE+I++LG S+  K+ L  P   + ++E            SV
Sbjct  865  SRNLAPGS---QFTTFSWVEKIVILGASKPSKATLKTPDGKESQLE-----FEFDASMSV  916

Query  181  LTIRKPNVRVGDDWSIKI  128
            LT+RKP V  G DW++ +
Sbjct  917  LTLRKPGVNAGLDWTVVL  934



>ref|XP_010896653.1| PREDICTED: neutral alpha-glucosidase AB [Esox lucius]
Length=934

 Score =   149 bits (375),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 120/198 (61%), Gaps = 10/198 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG+ + W+D+ +   + GG    +     SIP FQR G+IIPRK
Sbjct  744  VHPVTEEGARGVTAYLPGNGEVWFDVHTFQKHNGGQNLYIPVTMSSIPVFQRGGSIIPRK  803

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDF-KQGAYIHRRFIFSAGTLT  362
             R RRSS+ ME+DPYTL +AL+  + A+GELYIDDG +F + KQ  +I+RR  F+  TL+
Sbjct  804  VRVRRSSSCMEHDPYTLYVALSPKRFAQGELYIDDGHTFSYEKQKEFIYRRLAFANNTLS  863

Query  361  SLNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSV  182
            S NL P S   +F++   +E+I++LG S+  K  L  P   + ++E            SV
Sbjct  864  SRNLAPGS---QFTTLSWIEKIVILGASKPSKVTLKMPDGKESQLE-----FDFDASMSV  915

Query  181  LTIRKPNVRVGDDWSIKI  128
            LT+RKP V  G DW++ +
Sbjct  916  LTLRKPGVNAGVDWTVVL  933



>ref|XP_010766252.1| PREDICTED: neutral alpha-glucosidase AB isoform X4 [Notothenia 
coriiceps]
Length=927

 Score =   147 bits (371),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 116/197 (59%), Gaps = 10/197 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG DQ W+D+ +   + G     +     SIP FQR G+IIPRK
Sbjct  739  VHPVTEEGARGVTAYLPGKDQVWFDVHTFQKHNGAQNLYIPVTMSSIPVFQRGGSIIPRK  798

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSS+ M  DPYTL +ALN  + AEGELYIDDG +F++++  +IHRR  F+   L+S
Sbjct  799  IRVRRSSSCMMQDPYTLYVALNLQRTAEGELYIDDGHTFNYEK-EFIHRRLSFANNVLSS  857

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +NL P +   +F +   +ERI++LG S+  K  L      + +VE            SVL
Sbjct  858  VNLAPEA---QFLTGSWIERIVILGASKPSKVLLKTDDGQESQVE-----FDFDASMSVL  909

Query  178  TIRKPNVRVGDDWSIKI  128
            T+RKP +  G DW++ +
Sbjct  910  TLRKPGMNAGADWNVML  926



>ref|XP_010766249.1| PREDICTED: neutral alpha-glucosidase AB isoform X2 [Notothenia 
coriiceps]
 ref|XP_010766250.1| PREDICTED: neutral alpha-glucosidase AB isoform X2 [Notothenia 
coriiceps]
Length=943

 Score =   147 bits (371),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 116/197 (59%), Gaps = 10/197 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG DQ W+D+ +   + G     +     SIP FQR G+IIPRK
Sbjct  755  VHPVTEEGARGVTAYLPGKDQVWFDVHTFQKHNGAQNLYIPVTMSSIPVFQRGGSIIPRK  814

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSS+ M  DPYTL +ALN  + AEGELYIDDG +F++++  +IHRR  F+   L+S
Sbjct  815  IRVRRSSSCMMQDPYTLYVALNLQRTAEGELYIDDGHTFNYEK-EFIHRRLSFANNVLSS  873

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +NL P +   +F +   +ERI++LG S+  K  L      + +VE            SVL
Sbjct  874  VNLAPEA---QFLTGSWIERIVILGASKPSKVLLKTDDGQESQVE-----FDFDASMSVL  925

Query  178  TIRKPNVRVGDDWSIKI  128
            T+RKP +  G DW++ +
Sbjct  926  TLRKPGMNAGADWNVML  942



>ref|XP_010766251.1| PREDICTED: neutral alpha-glucosidase AB isoform X3 [Notothenia 
coriiceps]
Length=928

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 116/197 (59%), Gaps = 10/197 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG DQ W+D+ +   + G     +     SIP FQR G+IIPRK
Sbjct  740  VHPVTEEGARGVTAYLPGKDQVWFDVHTFQKHNGAQNLYIPVTMSSIPVFQRGGSIIPRK  799

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSS+ M  DPYTL +ALN  + AEGELYIDDG +F++++  +IHRR  F+   L+S
Sbjct  800  IRVRRSSSCMMQDPYTLYVALNLQRTAEGELYIDDGHTFNYEK-EFIHRRLSFANNVLSS  858

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +NL P +   +F +   +ERI++LG S+  K  L      + +VE            SVL
Sbjct  859  VNLAPEA---QFLTGSWIERIVILGASKPSKVLLKTDDGQESQVE-----FDFDASMSVL  910

Query  178  TIRKPNVRVGDDWSIKI  128
            T+RKP +  G DW++ +
Sbjct  911  TLRKPGMNAGADWNVML  927



>ref|XP_010766248.1| PREDICTED: neutral alpha-glucosidase AB isoform X1 [Notothenia 
coriiceps]
Length=950

 Score =   147 bits (371),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 116/197 (59%), Gaps = 10/197 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG DQ W+D+ +   + G     +     SIP FQR G+IIPRK
Sbjct  762  VHPVTEEGARGVTAYLPGKDQVWFDVHTFQKHNGAQNLYIPVTMSSIPVFQRGGSIIPRK  821

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSS+ M  DPYTL +ALN  + AEGELYIDDG +F++++  +IHRR  F+   L+S
Sbjct  822  IRVRRSSSCMMQDPYTLYVALNLQRTAEGELYIDDGHTFNYEK-EFIHRRLSFANNVLSS  880

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +NL P +   +F +   +ERI++LG S+  K  L      + +VE            SVL
Sbjct  881  VNLAPEA---QFLTGSWIERIVILGASKPSKVLLKTDDGQESQVE-----FDFDASMSVL  932

Query  178  TIRKPNVRVGDDWSIKI  128
            T+RKP +  G DW++ +
Sbjct  933  TLRKPGMNAGADWNVML  949



>ref|XP_007254102.1| PREDICTED: neutral alpha-glucosidase AB-like [Astyanax mexicanus]
Length=546

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 112/199 (56%), Gaps = 10/199 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E AK V+ +LPG  + WYD+ +   +KG     +     SIP FQR G+II RK
Sbjct  356  VHPVTEEGAKGVTAFLPGKGEVWYDVHTFQKHKGAQNLYIPVTMSSIPVFQRGGSIISRK  415

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQG-AYIHRRFIFSAGTLT  362
            DR RRSS  MENDPYTL +AL+    AEGE+YIDD  +F F+    +IHRR  FS   L+
Sbjct  416  DRVRRSSACMENDPYTLYVALSPQGTAEGEIYIDDFHTFKFETDKQFIHRRLHFSDNALS  475

Query  361  SLNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSV  182
            S NL P S   +F++   +E+++++G S     +L      K  +E            SV
Sbjct  476  SSNLAPDS---QFTTASWIEKVVIMGASRPTSVSLTTADGTKTALE-----FEFDSAASV  527

Query  181  LTIRKPNVRVGDDWSIKIL  125
            LT+RKP V  G DW++ ++
Sbjct  528  LTLRKPGVNAGADWTVFLV  546



>ref|XP_004919758.1| PREDICTED: neutral alpha-glucosidase AB isoform X2 [Xenopus (Silurana) 
tropicalis]
Length=979

 Score =   147 bits (370),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/197 (40%), Positives = 118/197 (60%), Gaps = 9/197 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V+ +   +A+ V +YLPGD + WYD+ S   Y+   T  L     SIP +QR G+IIPRK
Sbjct  790  VRPVTEAKARGVQIYLPGDGEVWYDVHSYQRYEAPQTFYLPITMNSIPVYQRGGSIIPRK  849

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
            DR RRSS  M++DP+TL +ALN    A GEL++DDG SF+++Q  +++R F +S G LT+
Sbjct  850  DRPRRSSDCMKDDPFTLYVALNVQGEARGELFLDDGHSFNYEQNEFLYREFNYSQGKLTA  909

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
             +L PS     F +   +ERII++G ++     L  PG ++  +E         Q  SV 
Sbjct  910  SSLDPSG---VFKTASWIERIIIIGATKPASVMLTLPGGSESALE-----FEYDQTTSVT  961

Query  178  TIRKPNVRVGDDWSIKI  128
            T+RKP V +  D+++ +
Sbjct  962  TVRKPGVNIASDFTVSL  978



>ref|XP_006432098.1| hypothetical protein CICLE_v100002003mg, partial [Citrus clementina]
 gb|ESR45338.1| hypothetical protein CICLE_v100002003mg, partial [Citrus clementina]
Length=139

 Score =   136 bits (342),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQG+Y ERAKH+SVYLPG +SWYD+R+G   KGG+THKLE  EES+PAFQRAGTIIPR+D
Sbjct  64   VQGVYEERAKHISVYLPGKESWYDIRTGARVKGGVTHKLEVSEESVPAFQRAGTIIPRRD  123

Query  535  RFRRSSTQMENDPYTL  488
            RFRRSSTQM NDPYTL
Sbjct  124  RFRRSSTQMVNDPYTL  139



>ref|XP_002943023.2| PREDICTED: neutral alpha-glucosidase AB isoform X1 [Xenopus (Silurana) 
tropicalis]
Length=957

 Score =   147 bits (370),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/197 (40%), Positives = 118/197 (60%), Gaps = 9/197 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V+ +   +A+ V +YLPGD + WYD+ S   Y+   T  L     SIP +QR G+IIPRK
Sbjct  768  VRPVTEAKARGVQIYLPGDGEVWYDVHSYQRYEAPQTFYLPITMNSIPVYQRGGSIIPRK  827

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
            DR RRSS  M++DP+TL +ALN    A GEL++DDG SF+++Q  +++R F +S G LT+
Sbjct  828  DRPRRSSDCMKDDPFTLYVALNVQGEARGELFLDDGHSFNYEQNEFLYREFNYSQGKLTA  887

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
             +L PS     F +   +ERII++G ++     L  PG ++  +E         Q  SV 
Sbjct  888  SSLDPSG---VFKTASWIERIIIIGATKPASVMLTLPGGSESALE-----FEYDQTTSVT  939

Query  178  TIRKPNVRVGDDWSIKI  128
            T+RKP V +  D+++ +
Sbjct  940  TVRKPGVNIASDFTVSL  956



>ref|XP_006642846.1| PREDICTED: neutral alpha-glucosidase AB-like [Lepisosteus oculatus]
Length=471

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 108/176 (61%), Gaps = 9/176 (5%)
 Frame = -1

Query  658  QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSSTQMENDPYTLVIA  479
            + WYD+ +   + GG    +     SIP FQR G+I+PRK+R RRSS+ M +DPYTL +A
Sbjct  301  EVWYDVHTFQKHSGGQHLYIPVTLSSIPVFQRGGSIVPRKNRVRRSSSCMTSDPYTLYVA  360

Query  478  LNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLTSLNLKPSSGSKKFSSDCTVE  302
            L+    AEGEL++DD  +F F+ +  +IHRRF+F+ GTL+S N  PS     FSSD  VE
Sbjct  361  LSPEGEAEGELFVDDEHTFRFESEHQFIHRRFVFARGTLSSHNADPSG---HFSSDSWVE  417

Query  301  RIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNVRVGDDWSI  134
            R+++LG S    + L+ P  +     + PL     +  SVLT+RKP V V  DW+I
Sbjct  418  RVVILGASRPSVALLLIPDGS-----QSPLEFDFEERASVLTLRKPAVNVAADWTI  468



>ref|XP_003970285.1| PREDICTED: LOW QUALITY PROTEIN: neutral alpha-glucosidase AB-like 
[Takifugu rubripes]
Length=941

 Score =   145 bits (366),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 74/197 (38%), Positives = 116/197 (59%), Gaps = 9/197 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E    V+ YLPG D+ WYD+ +   + GG    +     SIP FQR G+IIP+K
Sbjct  752  VHPVTEEGVTSVTAYLPGKDEVWYDIHTFKKHNGGQNLYIPVTISSIPVFQRGGSIIPKK  811

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +AL +   AEGE+YIDDG +F++++  +IHR+   +   ++S
Sbjct  812  LRVRRSSTCMEHDPYTLYVALGNQNTAEGEIYIDDGYTFNYEKKEFIHRKISMANNIISS  871

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            +NL   +    F++   +ER++++G ++  K  L   G  + +++            S+L
Sbjct  872  INL---AHDAHFTTQSWIERVVIIGATKPSKVTLKAAGGQESKLD-----FEFDASVSLL  923

Query  178  TIRKPNVRVGDDWSIKI  128
            TIRKP V  G+DW+I +
Sbjct  924  TIRKPGVNAGEDWTITL  940



>ref|XP_007246439.1| PREDICTED: neutral alpha-glucosidase AB-like [Astyanax mexicanus]
Length=935

 Score =   145 bits (365),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 116/199 (58%), Gaps = 11/199 (6%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG  + WYD+ +   + G     +     SIP FQR G+IIPRK
Sbjct  746  VHTVTEEGARGVTAYLPGLGEVWYDVHTFQKHNGAQNLYIPVTMSSIPVFQRGGSIIPRK  805

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLT  362
             R RRSS  MENDPYTL +AL+  + AEGELYIDDG +F+F+ +  +IHR   F    LT
Sbjct  806  VRVRRSSECMENDPYTLFVALSPQRVAEGELYIDDGHTFNFQTKKEFIHRGLSFVNNVLT  865

Query  361  SLNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSV  182
            S NL P S    FS+   +E++++LG S+  K  L      K++ ++  +        SV
Sbjct  866  SKNLCPES---NFSTKSWIEKVLILGASKPSKVTL------KMDGKETSVDFEFDASMSV  916

Query  181  LTIRKPNVRVGDDWSIKIL  125
            LT+RKP +  G DW++ +L
Sbjct  917  LTLRKPGMNAGADWAVVLL  935



>emb|CDQ83631.1| unnamed protein product [Oncorhynchus mykiss]
Length=963

 Score =   143 bits (360),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 116/207 (56%), Gaps = 19/207 (9%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGD----------QSWYDLRSGTAYKGGLTHKLEALEESIPAFQ  566
            V  +  E  + V+ YLPG           Q W+D+ +   + G     +     SIP FQ
Sbjct  764  VHPVTEEGGRGVTAYLPGKGEATALFCVLQVWFDVHTFQKHNGAQNLYIPVTISSIPVFQ  823

Query  565  RAGTIIPRKDRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDF-KQGAYIHRR  389
            R G+IIPRK R RRSS+ ME+DPYTL +AL+  + A+GELYIDDG +F+F KQ  +IHRR
Sbjct  824  RGGSIIPRKARVRRSSSCMEHDPYTLFVALSPKRFAQGELYIDDGHTFNFDKQKQFIHRR  883

Query  388  FIFSAGTLTSLNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLL  209
              F+   L+S NL P S   +F +   +E+I++LG S+  K+ L  P   +  +E     
Sbjct  884  LSFANKALSSRNLAPGS---QFITPSWIEKIVILGASKPSKATLKTPDGKENLLE-----  935

Query  208  LRESQGPSVLTIRKPNVRVGDDWSIKI  128
                   SVLT+RKP V  G DW++ +
Sbjct  936  FEFDASMSVLTLRKPGVNAGVDWTVVL  962



>gb|KFZ12570.1| hypothetical protein V501_04149 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=981

 Score =   142 bits (359),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 89/212 (42%), Positives = 126/212 (59%), Gaps = 24/212 (11%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            V  + TE A  V  YLP DQ +YD  +   Y+G  TH + A  ++IP   +AG IIPRKD
Sbjct  771  VHPVVTEGATSVEAYLPDDQVYYDYFTYKTYQGHGTHTVNAPLDTIPVLMQAGHIIPRKD  830

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIF--SAGTLT  362
            R RRSS  M  DPYTLV+ L+S+  A+GELY+DDG++F+F+QGAYIHR F    + GTL+
Sbjct  831  RPRRSSDLMRYDPYTLVVTLDSAGNAQGELYVDDGQTFEFQQGAYIHRSFNLDGTTGTLS  890

Query  361  SLNL---KPSSGSKKFS-----SDCTVERIILLGLSEGPKSALVEPGNNKVEV-EKG---  218
            S +    K   G +K +     ++ TVER+I++G  +  K      G  +VEV E+G   
Sbjct  891  STDFEEKKTRGGKEKMAFVKKMAEVTVERVIVVGAPKAWK------GVERVEVREEGKER  944

Query  217  --PLLLRE-SQG-PSVLTIRKPNVRVGDDWSI  134
              PL+    ++G  S   ++ P V +G DWS+
Sbjct  945  SVPLVWHAGAKGTASWAEVKNPKVGIGRDWSV  976



>ref|XP_005988915.1| PREDICTED: neutral alpha-glucosidase AB [Latimeria chalumnae]
Length=720

 Score =   141 bits (356),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 115/198 (58%), Gaps = 10/198 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  + A+ V VYLPG  + WY++ +   +   L+  +     +IP FQR GTI+PRK
Sbjct  530  VHPVTEQGARGVQVYLPGKGEVWYEVHTRQKHTAPLSLYMPVTMSTIPVFQRGGTIVPRK  589

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDF-KQGAYIHRRFIFSAGTLT  362
            DR RRSS+ M +DP+TL +ALN+   AEG+L++DDG +F+F K+  Y+HR+F F+  +L 
Sbjct  590  DRVRRSSSCMHSDPFTLYVALNAQNFAEGDLFVDDGHTFNFEKKKEYLHRKFTFAENSLM  649

Query  361  SLNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSV  182
            S    P     +F +   +ER+++LG ++     +  P  N+  ++        +   SV
Sbjct  650  SRCADPQG---RFETQSWIERVVILGAAKPASVHIKLPDGNESSLD-----FEHNAETSV  701

Query  181  LTIRKPNVRVGDDWSIKI  128
            LTIRKP V V  DW I +
Sbjct  702  LTIRKPAVNVASDWIIYL  719



>ref|NP_001091232.1| glucosidase, alpha; neutral AB precursor [Xenopus laevis]
 gb|AAI30138.1| LOC100037025 protein [Xenopus laevis]
Length=933

 Score =   142 bits (359),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 117/197 (59%), Gaps = 9/197 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V+ +   +A+ V VYLPGD + WYD+ S   Y+   T  L     SIP +QR G+IIPRK
Sbjct  744  VRPVTEAKARGVQVYLPGDGEVWYDVHSYQRYEAPQTFYLPVTMNSIPVYQRGGSIIPRK  803

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
            DR RR+S  M++DP+TL +ALN    A GEL++DDG SF+++Q  ++ R F +S G LT+
Sbjct  804  DRPRRTSDCMQDDPFTLYVALNLQGEARGELFLDDGHSFNYEQNEFLFREFNYSQGKLTA  863

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
             +L PS     F +   +ERI+++G ++     L   G ++  +E         Q  SV+
Sbjct  864  SSLDPSG---VFKTPSWIERIVIIGATKPSSITLSLQGGSESSLE-----FEYDQSTSVI  915

Query  178  TIRKPNVRVGDDWSIKI  128
            T+RKP V +  D+++ +
Sbjct  916  TVRKPGVNIASDFTVSL  932



>ref|XP_003290372.1| hypothetical protein DICPUDRAFT_49160 [Dictyostelium purpureum]
 gb|EGC33095.1| hypothetical protein DICPUDRAFT_49160 [Dictyostelium purpureum]
Length=932

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 121/200 (61%), Gaps = 14/200 (7%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG---DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIP  545
            V+ +  + AK + V LPG   ++ WYD+ +    + G T++++   E IP +QR G+IIP
Sbjct  742  VKPVTKQGAKSMKVILPGKSVNEIWYDVDTEKPIEAG-TYEIDTPLEKIPVYQRGGSIIP  800

Query  544  RKDRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTL  365
            +K+R RRSS QM++DP+T+ IAL+ +Q A+G+LYIDD  SFD+K+G Y++++F F   TL
Sbjct  801  KKERVRRSSAQMKDDPFTIRIALDKNQFAQGQLYIDDEHSFDYKKGNYLYKQFTFKDNTL  860

Query  364  TSLNLKPSSGSK-KFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGP  188
               N  P S    KF+S  T+E+II+LG  + P S + E G          L     Q  
Sbjct  861  I-FNTHPESKQNGKFTSPSTIEKIIILGYKQKPTSIVSEDGKQ--------LSFDYDQSL  911

Query  187  SVLTIRKPNVRVGDDWSIKI  128
            S LTIRKP+  V  ++ +K 
Sbjct  912  SKLTIRKPDFSVNSNFILKF  931



>gb|KFY75656.1| hypothetical protein V499_04375 [Pseudogymnoascus pannorum VKM 
F-103]
Length=981

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/212 (42%), Positives = 127/212 (60%), Gaps = 24/212 (11%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            V  + TE A  V  YLP DQ +YD  +   Y+G  TH ++A  ++IP   +AG IIPRKD
Sbjct  771  VHPVVTEGATSVEAYLPDDQVYYDYFAYKTYQGHGTHTVQAPLDTIPVLMQAGHIIPRKD  830

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIF--SAGTLT  362
            R RRSS  M  DPYTLV+ L+S+  A+GELY+DDG++F+F+QGAYIHR F    + GTL+
Sbjct  831  RPRRSSDLMRYDPYTLVVTLDSAGNAQGELYVDDGQTFEFEQGAYIHRSFSLNGATGTLS  890

Query  361  SLNL---KPSSGSKKFS-----SDCTVERIILLGLSEGPKSALVEPGNNKVEV-EKG---  218
            S +    K   G +K +     ++ TVER+I++G  +  K      G  +V+V E+G   
Sbjct  891  STDFEEKKTRGGKEKMAFVKKMAEVTVERVIVVGAPKAWK------GVERVQVREEGKER  944

Query  217  --PLLLRE-SQG-PSVLTIRKPNVRVGDDWSI  134
              PL+    ++G  S   ++ P V +G DWS+
Sbjct  945  SVPLVWHAGAKGTASWAEVKNPKVGIGRDWSV  976



>ref|XP_005723270.1| PREDICTED: neutral alpha-glucosidase AB-like [Pundamilia nyererei]
Length=920

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 102/158 (65%), Gaps = 4/158 (3%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E A+ V+ YLPG D+ W+D+ +   + G     +     SIP FQR G+IIPRK
Sbjct  762  VHPVVEEGARGVTAYLPGKDEVWFDVHTFQKHNGAQNLYIPVTMSSIPVFQRGGSIIPRK  821

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSST ME+DPYTL +ALN  + A+GELYIDDG +F++++  +I+R+  F+   L+S
Sbjct  822  LRVRRSSTCMEHDPYTLYVALNLQRTADGELYIDDGHTFNYEKKEFIYRKLTFANKVLSS  881

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPG  245
            +NL P +   KF++D  +ERII+LG S+  K  L   G
Sbjct  882  VNLAPDA---KFTTDSWIERIIVLGASKPSKVTLKTAG  916



>ref|XP_005289309.1| PREDICTED: neutral alpha-glucosidase AB isoform X3 [Chrysemys 
picta bellii]
Length=969

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/194 (40%), Positives = 114/194 (59%), Gaps = 11/194 (6%)
 Frame = -1

Query  700  TERAKH-VSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFR  527
            TE+  H V VYLPG  + WYD+ S   +    T  +  +  SIPA+QR G+I+PRK+R R
Sbjct  783  TEQGAHGVQVYLPGKGEVWYDVHSHQKHHAPQTLYVPVIMSSIPAYQRGGSIVPRKERVR  842

Query  526  RSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGA-YIHRRFIFSAGTLTSLNL  350
            RSS  M  DPYTL +AL+    AEG+L+IDDG +++F+  A Y+HR F F++ TLT+   
Sbjct  843  RSSDCMYRDPYTLYVALSPQGTAEGDLFIDDGHTYNFESKAQYLHRHFSFASNTLTA---  899

Query  349  KPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIR  170
            + +     F S   +ER+++LG  +     L +PG     ++      +     SVLT+R
Sbjct  900  RSADSKGVFESPAWIERVVILGAGKPAAVFLRQPGMADTRLD-----FQHEPETSVLTLR  954

Query  169  KPNVRVGDDWSIKI  128
            KP + +G DWSI +
Sbjct  955  KPGINIGADWSISL  968



>ref|XP_008172330.1| PREDICTED: neutral alpha-glucosidase AB isoform X1 [Chrysemys 
picta bellii]
Length=1009

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/194 (40%), Positives = 114/194 (59%), Gaps = 11/194 (6%)
 Frame = -1

Query  700   TERAKH-VSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFR  527
             TE+  H V VYLPG  + WYD+ S   +    T  +  +  SIPA+QR G+I+PRK+R R
Sbjct  823   TEQGAHGVQVYLPGKGEVWYDVHSHQKHHAPQTLYVPVIMSSIPAYQRGGSIVPRKERVR  882

Query  526   RSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGA-YIHRRFIFSAGTLTSLNL  350
             RSS  M  DPYTL +AL+    AEG+L+IDDG +++F+  A Y+HR F F++ TLT+   
Sbjct  883   RSSDCMYRDPYTLYVALSPQGTAEGDLFIDDGHTYNFESKAQYLHRHFSFASNTLTA---  939

Query  349   KPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIR  170
             + +     F S   +ER+++LG  +     L +PG     ++      +     SVLT+R
Sbjct  940   RSADSKGVFESPAWIERVVILGAGKPAAVFLRQPGMADTRLD-----FQHEPETSVLTLR  994

Query  169   KPNVRVGDDWSIKI  128
             KP + +G DWSI +
Sbjct  995   KPGINIGADWSISL  1008



>ref|XP_008172331.1| PREDICTED: neutral alpha-glucosidase AB isoform X2 [Chrysemys 
picta bellii]
Length=987

 Score =   141 bits (356),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/194 (40%), Positives = 114/194 (59%), Gaps = 11/194 (6%)
 Frame = -1

Query  700  TERAKH-VSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFR  527
            TE+  H V VYLPG  + WYD+ S   +    T  +  +  SIPA+QR G+I+PRK+R R
Sbjct  801  TEQGAHGVQVYLPGKGEVWYDVHSHQKHHAPQTLYVPVIMSSIPAYQRGGSIVPRKERVR  860

Query  526  RSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGA-YIHRRFIFSAGTLTSLNL  350
            RSS  M  DPYTL +AL+    AEG+L+IDDG +++F+  A Y+HR F F++ TLT+   
Sbjct  861  RSSDCMYRDPYTLYVALSPQGTAEGDLFIDDGHTYNFESKAQYLHRHFSFASNTLTA---  917

Query  349  KPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIR  170
            + +     F S   +ER+++LG  +     L +PG     ++      +     SVLT+R
Sbjct  918  RSADSKGVFESPAWIERVVILGAGKPAAVFLRQPGMADTRLD-----FQHEPETSVLTLR  972

Query  169  KPNVRVGDDWSIKI  128
            KP + +G DWSI +
Sbjct  973  KPGINIGADWSISL  986



>gb|KFX98691.1| hypothetical protein V490_02174 [Pseudogymnoascus pannorum VKM 
F-3557]
Length=975

 Score =   140 bits (354),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 89/208 (43%), Positives = 122/208 (59%), Gaps = 22/208 (11%)
 Frame = -1

Query  706  IYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFR  527
            + TE A  V +YLP DQ +YD  +   Y+G  TH ++A  ++IP   + G IIPRKDR R
Sbjct  768  VVTEGATSVQMYLPDDQIYYDYFTYKTYQGHGTHTIDAPLDTIPLLMQGGHIIPRKDRPR  827

Query  526  RSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAG--TLTSLN  353
            RSS  M  DPYTLV+AL+S+  A GELY+DDG +F+F+QGAYIHR F   A   TL+S++
Sbjct  828  RSSDLMRYDPYTLVVALDSAGNASGELYVDDGTTFEFEQGAYIHRSFALDAATHTLSSVD  887

Query  352  L--KPSSGSK------KFSSDCTVERIILLGLS---EGPKSALV-EPGNN---KVEVEKG  218
               K + G K      K  ++ TVER+I++G     +G +SALV E G     ++E   G
Sbjct  888  FEDKKTRGGKEKKAFVKKMAEVTVERVIVVGAPKTWKGVESALVKEEGKERSVRMEWHAG  947

Query  217  PLLLRESQGPSVLTIRKPNVRVGDDWSI  134
                      S   ++ P V VG DWS+
Sbjct  948  -----AKGAASWAEVKNPKVGVGRDWSV  970



>gb|KFY88420.1| hypothetical protein V500_06348 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=980

 Score =   140 bits (353),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 121/208 (58%), Gaps = 16/208 (8%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            V  + TE A  V  YLP DQ +YD  +   Y+G  TH + A  ++IP   +AG IIPRKD
Sbjct  770  VHPVVTEGATSVEAYLPDDQVYYDYFTYKTYQGHGTHTINAPLDTIPVLMQAGHIIPRKD  829

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAG--TLT  362
            R RRSS  M  DPYTLV+ L+S+  A GELY+DDG++F+F+QGAYIHR F   A   TL+
Sbjct  830  RPRRSSDLMRYDPYTLVVVLDSAGNASGELYVDDGQTFEFEQGAYIHRSFALDAATRTLS  889

Query  361  SLNL---KPSSGSKKFS-----SDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLL  206
            S++    K   G +K +     ++ TVER+I++G  +  K   VE    + + ++  + L
Sbjct  890  SVDFEDKKTRGGKEKMAFVKKMAEVTVERVIVVGAPKAWKG--VESVEVREDGKERSVRL  947

Query  205  RESQG----PSVLTIRKPNVRVGDDWSI  134
               +G     S   ++ P V +G DWS+
Sbjct  948  EWHEGAKGAASWAEVKNPKVGIGRDWSV  975



>ref|XP_001362209.1| PREDICTED: neutral alpha-glucosidase AB isoform 1 [Monodelphis 
domestica]
Length=963

 Score =   140 bits (353),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 112/190 (59%), Gaps = 10/190 (5%)
 Frame = -1

Query  691  AKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSST  515
            A+ V VYLPG+ + WYD +S   + G  T  L     SIP FQR GTIIPR +R RRSS 
Sbjct  781  ARGVQVYLPGEGEVWYDTQSHQKHHGPQTLYLPVTFSSIPVFQRGGTIIPRWERVRRSSD  840

Query  514  QMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLTSLNLKPSS  338
             M++DP TL +AL+    AEGELY+DDG +F+++ Q  ++ R+F FS  TLTS +  P  
Sbjct  841  CMKDDPITLYVALSPQGTAEGELYLDDGHTFNYETQNEFLFRKFTFSGNTLTSSSADPRG  900

Query  337  GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNV  158
                F +   +ER+++LG  + P S L+E       + +  L    +   SVLT+RKP V
Sbjct  901  ---HFETPIWIERVVILGAGK-PASVLLETEG----IPETILTFHHNAETSVLTLRKPEV  952

Query  157  RVGDDWSIKI  128
             V  DWSI +
Sbjct  953  HVSTDWSIHL  962



>ref|XP_001362291.1| PREDICTED: neutral alpha-glucosidase AB isoform 2 [Monodelphis 
domestica]
Length=941

 Score =   140 bits (352),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 112/190 (59%), Gaps = 10/190 (5%)
 Frame = -1

Query  691  AKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSST  515
            A+ V VYLPG+ + WYD +S   + G  T  L     SIP FQR GTIIPR +R RRSS 
Sbjct  759  ARGVQVYLPGEGEVWYDTQSHQKHHGPQTLYLPVTFSSIPVFQRGGTIIPRWERVRRSSD  818

Query  514  QMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLTSLNLKPSS  338
             M++DP TL +AL+    AEGELY+DDG +F+++ Q  ++ R+F FS  TLTS +  P  
Sbjct  819  CMKDDPITLYVALSPQGTAEGELYLDDGHTFNYETQNEFLFRKFTFSGNTLTSSSADPRG  878

Query  337  GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNV  158
                F +   +ER+++LG  + P S L+E       + +  L    +   SVLT+RKP V
Sbjct  879  ---HFETPIWIERVVILGAGK-PASVLLETEG----IPETILTFHHNAETSVLTLRKPEV  930

Query  157  RVGDDWSIKI  128
             V  DWSI +
Sbjct  931  HVSTDWSIHL  940



>gb|KFY22792.1| hypothetical protein V491_02727 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=978

 Score =   140 bits (353),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 87/209 (42%), Positives = 121/209 (58%), Gaps = 18/209 (9%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            V  + TE A  V  YLP DQ +YD  +   Y+G  TH + A  ++IP   +AG IIPRKD
Sbjct  768  VHPVVTEDATSVEAYLPDDQIYYDYFTYKTYQGHGTHTINAPLDTIPILMQAGHIIPRKD  827

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAG--TLT  362
            R RRSS  M  DPYTLV+ L+S+  A GELY+DDG++F+F+QGAYIHR F   A   TL+
Sbjct  828  RPRRSSDLMRYDPYTLVVVLDSAGNASGELYVDDGKTFEFEQGAYIHRSFALDAATHTLS  887

Query  361  SLNL---KPSSGSKKFS-----SDCTVERIILLGLS---EGPKSALVEPGNNKVEVEKGP  215
            S++    K   G +K +     +  TVER+I++G     +G +S LV     +  V   P
Sbjct  888  SVDFEEKKTRGGKEKMAFVKKMATVTVERVIIVGAPKAWKGVESVLVSEEGKERSV---P  944

Query  214  LLLRE-SQG-PSVLTIRKPNVRVGDDWSI  134
            L     ++G  S   ++ P V +G DWS+
Sbjct  945  LAWHAGAKGTASWAEVKNPKVGIGRDWSV  973



>gb|KJB40499.1| hypothetical protein B456_007G066900 [Gossypium raimondii]
Length=803

 Score =   139 bits (351),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYT RAKHVSVYLPG +SWYDLR+GTAYKGG  HKLE  EESIPAFQRAGTI+PRKD
Sbjct  725  VQGIYTARAKHVSVYLPGKESWYDLRTGTAYKGGKVHKLEVSEESIPAFQRAGTIVPRKD  784

Query  535  RFRRSSTQMENDPYTLVIA  479
            R RRSSTQM +DPYTLV  
Sbjct  785  RLRRSSTQMVHDPYTLVFV  803



>ref|XP_009057287.1| hypothetical protein LOTGIDRAFT_217135 [Lottia gigantea]
 gb|ESO91975.1| hypothetical protein LOTGIDRAFT_217135 [Lottia gigantea]
Length=946

 Score =   140 bits (352),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 117/198 (59%), Gaps = 7/198 (4%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V+ +  +   +V+VY PG D  WYD+ +   Y G +T  + A  + IP +Q+ G+II RK
Sbjct  755  VKPVTDQGQTNVNVYFPGKDNVWYDIDTYQTYDGSMTINVPAPLDKIPVYQKGGSIIARK  814

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSS+ M  DP+TL++ L+    AEGELY+DD  SF +K G YIHR+FIF+  TL+S
Sbjct  815  LRPRRSSSLMYQDPFTLIVCLDKQGKAEGELYVDDYHSFQYKNGDYIHRQFIFNKNTLSS  874

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
             N+ P     +F++   +E+II++G    PK   +   N+  E  +  L  + ++    L
Sbjct  875  KNIDPKG---QFNTREWIEKIIIVGFPNEPKKITI--ANSSGENSRI-LGFQYNENNKSL  928

Query  178  TIRKPNVRVGDDWSIKIL  125
            TIRKP   + D W++ I+
Sbjct  929  TIRKPGDNIADIWTLVIV  946



>ref|XP_003230179.2| PREDICTED: neutral alpha-glucosidase AB [Anolis carolinensis]
Length=946

 Score =   140 bits (352),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 114/198 (58%), Gaps = 9/198 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  + A+ V VYLPG  + WYD+ +        TH L     SIP +QR G+I+ RK
Sbjct  755  VHPVTAQGARGVQVYLPGKGEVWYDVHTHQKLHAPQTHYLAVTMSSIPVYQRGGSIVARK  814

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLT  362
            +R RRSS  M +DPYTL +AL     A+G+L++DDG +F+FK +  Y+H++F FS  TLT
Sbjct  815  ERVRRSSDCMHSDPYTLYVALGPQGTAQGDLFLDDGHTFNFKTKREYLHQQFNFSGNTLT  874

Query  361  SLNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSV  182
            + +  P      F +   +ER+++LG  + P +  ++  N   E     +   E+   SV
Sbjct  875  ASSADPKG---SFETPAWIERVVILGAGK-PAAVFLKEDNGAAETRLDFIHQAET---SV  927

Query  181  LTIRKPNVRVGDDWSIKI  128
            LTIRKP V +G DWSI +
Sbjct  928  LTIRKPGVNIGADWSISL  945



>gb|KJB40500.1| hypothetical protein B456_007G066900 [Gossypium raimondii]
Length=809

 Score =   139 bits (350),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIYT RAKHVSVYLPG +SWYDLR+GTAYKGG  HKLE  EESIPAFQRAGTI+PRKD
Sbjct  725  VQGIYTARAKHVSVYLPGKESWYDLRTGTAYKGGKVHKLEVSEESIPAFQRAGTIVPRKD  784

Query  535  RFRRSSTQMENDPYTLVI  482
            R RRSSTQM +DPYTLV 
Sbjct  785  RLRRSSTQMVHDPYTLVC  802



>ref|XP_004366911.1| alpha-glucosidase II [Dictyostelium fasciculatum]
 gb|EGG19928.1| alpha-glucosidase II [Dictyostelium fasciculatum]
Length=926

 Score =   139 bits (350),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/191 (41%), Positives = 118/191 (62%), Gaps = 20/191 (10%)
 Frame = -1

Query  682  VSVYLPG---DQSWYDLRSGTAY---KGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRS  521
            V V LPG    Q+W+D+ S   Y   + G+  +++   + +P +Q+ G+I+PRK+R RRS
Sbjct  749  VKVVLPGTENKQTWFDIDSDKKYFASEAGV--QVDTPLDKMPVYQKGGSIVPRKERQRRS  806

Query  520  STQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSLNLKPS  341
            S QM+ DPYTL IAL+  Q A G LY DD  SF++++G Y +R+F F+A  LT+ NL P 
Sbjct  807  SPQMKADPYTLRIALSDDQKASGTLYTDDESSFNYQKGDYSYRQFEFAANQLTNTNLAPR  866

Query  340  SGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPN  161
            S    +  + T+ERI+++GL + P S  V   NN+      PL     +    LTIRKP+
Sbjct  867  S---TYQPNNTIERIVIVGLKQKPSSITV---NNQ------PLTFEYEKDLERLTIRKPD  914

Query  160  VRVGDDWSIKI  128
            +++ +DWSIK+
Sbjct  915  LQIKNDWSIKL  925



>gb|KIW18151.1| hypothetical protein PV08_02439 [Exophiala spinifera]
Length=962

 Score =   139 bits (350),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/203 (40%), Positives = 116/203 (57%), Gaps = 11/203 (5%)
 Frame = -1

Query  706  IYTERAKHVSVYLPGDQSWYDLRSGTAYKGG-LTHKLEALEESIPAFQRAGTIIPRKDRF  530
            + TE A+ V +YL   +++YD    T Y GG  THK++A  + IP   + G IIPRKDR 
Sbjct  751  VTTEGAESVEIYLADSENYYDYFDYTIYSGGSKTHKIQAPLDKIPLLMQGGNIIPRKDRP  810

Query  529  RRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSLNL  350
            R+SS  M+ DPYTLV+ L+S+  A G LY+DDG +FD++QGA+IHRRF F+ G LTS N+
Sbjct  811  RKSSGLMKWDPYTLVVVLDSNTQAAGTLYVDDGETFDYEQGAFIHRRFTFAGGELTSTNI  870

Query  349  KPSSGSK-----KFSSDCTVERIILL----GLSEGPKSALVEPGNNKVEVEKGPLLLRES  197
              + G+K     K   D TVE+II++      SE  + ++   G       +        
Sbjct  871  G-TKGAKTAQYLKAMKDVTVEKIIVVNAPAAWSEMKEVSITGEGIKGTASAELMYYAAAG  929

Query  196  QGPSVLTIRKPNVRVGDDWSIKI  128
               +   IR P V +G DW+I +
Sbjct  930  GKAAWAVIRSPGVSIGADWAISL  952



>gb|KFY22883.1| hypothetical protein V493_06260 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=948

 Score =   139 bits (350),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 119/206 (58%), Gaps = 12/206 (6%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            V  + TE A  V  YLP +Q +YD  +   Y+G  TH ++A  ++IP   +AG IIPRKD
Sbjct  738  VHPVVTEGATSVEAYLPDNQIYYDYFTYKTYQGHGTHTIDAPLDTIPVLMQAGHIIPRKD  797

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAG--TLT  362
            R RRSS  M  DPYTLV+ L+++  A GELY+DDG++F+F+QGAYIHR F   A   TL+
Sbjct  798  RPRRSSDLMRYDPYTLVVVLDTAGNASGELYVDDGQTFEFEQGAYIHRSFALDAATQTLS  857

Query  361  SLNL---KPSSGSKKFS-----SDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLL  206
            S++    K   G +K +     +  TVER+I++G  +  +       N + + +  P+  
Sbjct  858  SVDFEEKKTRGGKEKMAFVKKMAGVTVERVIVVGAPKAWREVKSVVVNEEGKEKSVPMAW  917

Query  205  RESQ--GPSVLTIRKPNVRVGDDWSI  134
             E +    S   ++ P V +G DWS+
Sbjct  918  YEGEKGTASWAEVKNPKVGIGRDWSV  943



>gb|KFX89887.1| hypothetical protein O988_08442 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=975

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 122/208 (59%), Gaps = 22/208 (11%)
 Frame = -1

Query  706  IYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFR  527
            + TE A  V +YLP DQ +YD  +   Y+G  TH ++A  ++IP   + G IIPRKDR R
Sbjct  768  VVTEGATSVQMYLPDDQIYYDYFTYKTYQGHGTHTIDAPLDTIPLLMQGGHIIPRKDRPR  827

Query  526  RSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAG--TLTSLN  353
            RSS  M  DPYTLV+AL+S+  A GELY+DDG +F+F+QGAYIHR F  +A   TL+S++
Sbjct  828  RSSDLMRYDPYTLVVALDSAGNASGELYVDDGTTFEFEQGAYIHRSFALNASTQTLSSVD  887

Query  352  L--KPSSGSK------KFSSDCTVERIILLGLS---EGPKSALV-EPGNN---KVEVEKG  218
               K + G K      K  ++ TVER+I++G     +G +S LV E G     ++E   G
Sbjct  888  FEDKKTRGGKEKKAFVKKMAEVTVERVIVVGAPKAWKGVESVLVKEEGKERSVRMEWHAG  947

Query  217  PLLLRESQGPSVLTIRKPNVRVGDDWSI  134
                      S   ++ P V VG DWS+
Sbjct  948  -----AKGAASWAEVKNPKVGVGRDWSV  970



>gb|KFY37784.1| hypothetical protein V495_06955 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY51890.1| hypothetical protein V497_08778 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=946

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 121/208 (58%), Gaps = 22/208 (11%)
 Frame = -1

Query  706  IYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFR  527
            + TE A  V +YLP DQ +YD  +   Y+G  TH ++A  ++IP   + G IIPRKDR R
Sbjct  739  VVTEGATSVQMYLPDDQIYYDYFTYKTYQGHGTHTIDAPLDTIPLLMQGGHIIPRKDRPR  798

Query  526  RSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAG--TLTSLN  353
            RSS  M  DPYTLV+AL+S+  A GELY+DDG +F+F+QGAYIHR F   A   TL+S++
Sbjct  799  RSSDLMRYDPYTLVVALDSAGNASGELYVDDGTTFEFEQGAYIHRSFALDAATHTLSSVD  858

Query  352  L--KPSSGSK------KFSSDCTVERIILLGLS---EGPKSALV-EPGNN---KVEVEKG  218
               K + G K      K  ++ TVER+I++G     +G +S LV E G     ++E   G
Sbjct  859  FEDKKTRGGKEKKAFVKKMAEVTVERVIVVGAPKTWKGVESVLVKEEGKERSVRMEWHAG  918

Query  217  PLLLRESQGPSVLTIRKPNVRVGDDWSI  134
                      S   ++ P V VG DWS+
Sbjct  919  -----AKGAASWAEVKNPKVGVGRDWSV  941



>ref|XP_005533287.1| PREDICTED: neutral alpha-glucosidase AB [Pseudopodoces humilis]
Length=935

 Score =   139 bits (349),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 77/190 (41%), Positives = 115/190 (61%), Gaps = 10/190 (5%)
 Frame = -1

Query  691  AKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSST  515
            A+ V VYLPG+ + WYD  +   ++   T  +     +IP FQR GT+IPR+DR RRS+ 
Sbjct  753  ARGVHVYLPGEGEVWYDDETHEQHRAPQTLYVPVTLSTIPVFQRGGTVIPRQDRPRRSTE  812

Query  514  QMENDPYTLVIALNSSQAAEGELYIDDGRSFDF-KQGAYIHRRFIFSAGTLTSLNLKPSS  338
             M  DP+TL +AL+    A+GELY+DDG SFD+  +  ++HR+F F+ GTLTS +  P  
Sbjct  813  AMRGDPFTLYVALSPQGTAQGELYLDDGISFDYATKNEFLHRQFRFANGTLTSSSADPRG  872

Query  337  GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNV  158
                 S+   +ER+++LG+   P+SAL+   +      + PL  +     SVLT+R+P V
Sbjct  873  ---SMSNPAWLERVVILGVGR-PESALLTAHDG----SQTPLQFQHDPERSVLTLRRPGV  924

Query  157  RVGDDWSIKI  128
             +G DWSI +
Sbjct  925  PIGADWSISL  934



>gb|KFY63167.1| hypothetical protein V496_04145 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
Length=978

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 120/211 (57%), Gaps = 22/211 (10%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            V  + TE A  V  YLP DQ +YD  +   Y+G  TH + A  ++IP   +AG IIPRKD
Sbjct  768  VHPVVTEGATSVEAYLPDDQVYYDYFTYKTYQGHGTHTINAPLDTIPVLMQAGHIIPRKD  827

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAG--TLT  362
            R RRSS  M  DPYTLV+ L+++  A+GELY+DDG +F+F+QGAYIHR F   A   TL+
Sbjct  828  RPRRSSDLMRYDPYTLVVVLDAAGNAKGELYVDDGHTFEFEQGAYIHRSFSLDASTQTLS  887

Query  361  SLNL---KPSSGSKKFS-----SDCTVERIILLGLSEGPKS----ALVEPG---NNKVEV  227
            S++    K   G +K +     ++ +VER+I++G  +G K      + E G   N + E 
Sbjct  888  SVDFEDKKTRGGKEKMAFVKKMAEVSVERVIVVGAPKGWKGLESVQVKEEGKERNVRAEW  947

Query  226  EKGPLLLRESQGPSVLTIRKPNVRVGDDWSI  134
             +G          S   ++ P V +G DWS+
Sbjct  948  HEG-----AKGAASWAEVKNPKVGIGRDWSV  973



>gb|KFY85257.1| hypothetical protein V498_07745 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=964

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 120/211 (57%), Gaps = 22/211 (10%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            V  + TE A  V  YLP DQ +YD  +   Y+G  TH + A  ++IP   +AG IIPRKD
Sbjct  754  VHPVVTEGATSVEAYLPDDQVYYDYFTYKTYQGHGTHTINAPLDTIPVLMQAGHIIPRKD  813

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAG--TLT  362
            R RRSS  M  DPYTLV+ L+++  A+GELY+DDG +F+F+QGAYIHR F   A   TL+
Sbjct  814  RPRRSSDLMRYDPYTLVVVLDAAGNAKGELYVDDGHTFEFEQGAYIHRSFSLDASTQTLS  873

Query  361  SLNL---KPSSGSKKFS-----SDCTVERIILLGLSEGPKS----ALVEPG---NNKVEV  227
            S++    K   G +K +     ++ +VER+I++G  +G K      + E G   N + E 
Sbjct  874  SVDFEDKKTRGGKEKMAFVKKMAEVSVERVIVVGAPKGWKGLESVQVKEEGKERNVRAEW  933

Query  226  EKGPLLLRESQGPSVLTIRKPNVRVGDDWSI  134
             +G          S   ++ P V +G DWS+
Sbjct  934  HEG-----AKGAASWAEVKNPKVGIGRDWSV  959



>gb|KFY05579.1| hypothetical protein V492_08435 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=949

 Score =   138 bits (347),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 84/210 (40%), Positives = 122/210 (58%), Gaps = 20/210 (10%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            V  + TE A  V  YLP D+++YD  +   Y+G  TH ++A  ++IP   + G IIPRKD
Sbjct  739  VHPVVTEGATSVEAYLPDDETYYDYFTYKTYQGHGTHTVDAPLDTIPVLMQGGHIIPRKD  798

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAG--TLT  362
            R RRSS  M  DPYTLV+ L+S+  A GELY+DDG++F+F+QGAYIHR F   A   TL+
Sbjct  799  RPRRSSDLMRYDPYTLVVVLDSAGNASGELYVDDGQTFEFEQGAYIHRSFALDAATQTLS  858

Query  361  SLNL---KPSSGSKKFS-----SDCTVERIILLGLS---EGPKSALVEPGNNKVEVEKGP  215
            S++    K   G +K +     +  TVER+I++G     +G +S LV    N+   E+  
Sbjct  859  SVDFEEKKTRGGKEKMAFVKKMAAVTVERVIVVGAPKKWKGVESVLV----NEEGKERSV  914

Query  214  LLLRESQG---PSVLTIRKPNVRVGDDWSI  134
             L   + G    S   ++ P V +G DW++
Sbjct  915  PLTWHAGGKGTASWAEVKNPKVGIGRDWNV  944



>gb|KIN01586.1| glycoside hydrolase family 31 protein [Oidiodendron maius Zn]
Length=971

 Score =   137 bits (346),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 112/199 (56%), Gaps = 17/199 (9%)
 Frame = -1

Query  706  IYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFR  527
            + TE A+ V +YLP D+ ++D    T Y G   H + A  + IP   + G I PRKDR R
Sbjct  770  VVTEGAESVEMYLPDDELYFDYFDYTLYSGKGKHTISAPLDKIPLLMQGGHIFPRKDRPR  829

Query  526  RSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSLNL-  350
            RSS  M  DPYTLVI L     A+GELY+DDG SF+++QGAYIHR F FS   L S N+ 
Sbjct  830  RSSGLMRFDPYTLVIVLGKVGMAKGELYVDDGDSFEYEQGAYIHRTFEFSNNVLESKNIA  889

Query  349  ---KPSSGSKKFSSDCTVERIILLGL--SEGPKSALVEPGNNKVEVEKGPLLLRESQGPS  185
               K +    K   D  VERIIL+G+  S   KS L       VE+E        ++GP+
Sbjct  890  TKGKLTDKFLKTMKDVAVERIILVGIPASWTGKSTL----KGGVEIE-----CHAAEGPT  940

Query  184  V--LTIRKPNVRVGDDWSI  134
                T++KP V+V +DW I
Sbjct  941  AAWATVKKPGVKVVEDWRI  959



>gb|EFA77026.1| alpha-glucosidase II [Polysphondylium pallidum PN500]
Length=899

 Score =   137 bits (346),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 75/199 (38%), Positives = 115/199 (58%), Gaps = 16/199 (8%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGD---QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIP  545
            V  +  +  K V V LPGD   Q W+D+ +   YK G  + ++   + IP +QR G+I+ 
Sbjct  712  VHPVVEQGQKQVKVILPGDAAKQQWFDIDTNKMYKPG-QYDVDTPLQKIPVYQRGGSIVA  770

Query  544  RKDRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTL  365
            +K+R RRSS QM +DPYTL +ALN+ Q A GEL++DD  SF++K+G Y +R+F +  G L
Sbjct  771  KKERLRRSSYQMRDDPYTLKVALNTDQVATGELFMDDEHSFNYKKGQYQYRQFRYENGQL  830

Query  364  TSLNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPS  185
            TS +L  + G+  F    TVERI++LG++  P +         +     PL     +  S
Sbjct  831  TSKSLD-TKGT--FKPVNTVERIVVLGINNKPSA---------ISYADKPLQFEYDKSLS  878

Query  184  VLTIRKPNVRVGDDWSIKI  128
             + IRKP++ +  DW+I  
Sbjct  879  SVVIRKPDLPISSDWTINF  897



>ref|XP_008360969.1| PREDICTED: probable glucan 1,3-alpha-glucosidase [Malus domestica]
Length=136

 Score =   127 bits (320),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQGIY ERA+H S++LPG + WYD ++G AYKGG  +KL+  EES+PAFQRAGTIIPRKD
Sbjct  49   VQGIYAERARHASLFLPGKELWYDTKTGVAYKGGKIYKLDVNEESVPAFQRAGTIIPRKD  108

Query  535  RFRRSSTQMENDPYTLVIALN  473
            RFR+SSTQM NDPYTLV  L 
Sbjct  109  RFRQSSTQMVNDPYTLVCLLT  129



>gb|KIW01512.1| hypothetical protein PV09_06990 [Verruconis gallopava]
Length=976

 Score =   137 bits (346),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 81/203 (40%), Positives = 111/203 (55%), Gaps = 9/203 (4%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            V+ + TE A  V +YL  D  +YD    +  KG   H L+A  + IP   RAG I PR+D
Sbjct  771  VKPVVTEGADSVDIYLGDDTQYYDYFDYSPVKGKGRHTLKAPLDKIPVLMRAGHIFPRRD  830

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            RFRRSS  M+ DPYTLV+ L + Q AEGELY+DDG SF+F+QGAY+H RF+F  G L S 
Sbjct  831  RFRRSSGLMKMDPYTLVVVLGADQKAEGELYVDDGESFEFQQGAYLHLRFVFENGALRSE  890

Query  355  NLKPSSG-SKKFSS---DCTVERIILLGLSEGPKS----ALVEPGNNKVEVEK-GPLLLR  203
            ++      S K++S      VER+I++G  +  K+    ++ E G           L   
Sbjct  891  DIGAKGKLSDKYASKMEKVRVERVIVVGAPKAWKNLSTVSVSEEGTKSSGASNTAKLEFL  950

Query  202  ESQGPSVLTIRKPNVRVGDDWSI  134
            E +G     +R P V +   W I
Sbjct  951  EDKGTDYAIVRDPGVSISRGWKI  973



>ref|XP_004365179.2| neutral alpha-glucosidase AB [Capsaspora owczarzaki ATCC 30864]
 gb|KJE88713.1| neutral alpha-glucosidase AB [Capsaspora owczarzaki ATCC 30864]
Length=920

 Score =   137 bits (346),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 112/201 (56%), Gaps = 11/201 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            V+ + +  A  V+VY PGDQ WY++ +GT +    T  + A  E +P FQR G+I+PRK 
Sbjct  725  VKPVTSAGATTVNVYFPGDQPWYNVETGTRHSAPATQTIPAPLERLPVFQRGGSIVPRKM  784

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS-  359
            R RRS+  M  DP+TL +AL+ S++A G LY+DDG SF + +GAY+ R+F F+   LTS 
Sbjct  785  RVRRSTALMTADPFTLYVALDQSKSASGTLYLDDGHSFSYTEGAYLFRQFTFANQVLTST  844

Query  358  --LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGP--LLLRESQG  191
              +    +S      +   VER+++ G    P S   + G      ++ P  L       
Sbjct  845  AGVTGGVASRPDLHKTSEWVERVVVYGYRSQPTSVTFQEG------KEAPRSLNFVFDAA  898

Query  190  PSVLTIRKPNVRVGDDWSIKI  128
             S LTI+KP V +  DW+I I
Sbjct  899  LSQLTIKKPGVNIAHDWTITI  919



>ref|XP_002590875.1| hypothetical protein BRAFLDRAFT_115975 [Branchiostoma floridae]
 gb|EEN46886.1| hypothetical protein BRAFLDRAFT_115975 [Branchiostoma floridae]
Length=944

 Score =   137 bits (346),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 107/190 (56%), Gaps = 6/190 (3%)
 Frame = -1

Query  691  AKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSST  515
            A  V V+LPG+ Q WYD+ +   Y GG T  +      IP FQR GTI+PRK+R RR+S+
Sbjct  758  ASGVQVHLPGEGQVWYDVDTHKKYNGGSTEYIPVTLTKIPVFQRGGTIVPRKERIRRASS  817

Query  514  QMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGA-YIHRRFIFSAGTLTSLNLKPSS  338
                DPYT  IAL+    A GEL++DDG SF ++    ++H+ ++F    L S  +  + 
Sbjct  818  LTNRDPYTFTIALDKQGTATGELFVDDGHSFKYRDNNRFLHKNYLFENNKLISRTMDMNG  877

Query  337  GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNV  158
               +F +   VERII++GL + P +  ++ G   + ++K  L  R +     L IRKP V
Sbjct  878  ---EFDTKSWVERIIIIGLPKAPTTVTID-GIRDIMIDKKNLEFRYTPDTQTLVIRKPAV  933

Query  157  RVGDDWSIKI  128
             V  +WSI +
Sbjct  934  NVAQNWSITL  943



>gb|EZF35783.1| hypothetical protein H101_00686 [Trichophyton interdigitale H6]
 gb|KDB24761.1| hypothetical protein H109_03393 [Trichophyton interdigitale MR816]
Length=937

 Score =   137 bits (344),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 117/207 (57%), Gaps = 11/207 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGG-LTHKLEALEESIPAFQRAGTIIPRK  539
            V+ + TE +  V VY+  D+ +YD    T Y+G    H + A  E IP   + G I+PRK
Sbjct  732  VKPVVTEGSTSVDVYIADDEKYYDYFDFTIYQGANKKHTINAPLEKIPILMQGGHIVPRK  791

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
            DR RRSS  M+ DPYTL++ L+S   AEGELY+DDG +FD+KQGAYIHRRF FS  +L+S
Sbjct  792  DRPRRSSGLMKYDPYTLIVVLDSKGQAEGELYVDDGETFDYKQGAYIHRRFSFSGTSLSS  851

Query  358  LNLKPSSGSK-----KFSSDCTVERIILLGLS---EGPKSALVEPGNNKVEVEKGPLLLR  203
             + + +SGSK     K  ++  VE+I+++G     +G  S LV     K  ++       
Sbjct  852  TD-QSTSGSKTNQYLKTMAEVHVEKIVIVGAPSSWKGKDSVLVLEDGAKSGIKASMDWHN  910

Query  202  ESQGPSVLTI-RKPNVRVGDDWSIKIL  125
               G +   I +KP V +   W I  +
Sbjct  911  SESGKAAFAIVKKPGVSITKSWKIDFV  937



>gb|EGD93017.1| glucosidase II alpha subunit [Trichophyton tonsurans CBS 112818]
 gb|EGE04676.1| neutral alpha-glucosidase AB [Trichophyton equinum CBS 127.97]
Length=966

 Score =   137 bits (344),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 117/207 (57%), Gaps = 11/207 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGG-LTHKLEALEESIPAFQRAGTIIPRK  539
            V+ + TE +  V VY+  D+ +YD    T Y+G    H + A  E IP   + G I+PRK
Sbjct  761  VKPVVTEGSTSVDVYIADDEKYYDYFDFTIYQGANKKHTINAPLEKIPILMQGGHIVPRK  820

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
            DR RRSS  M+ DPYTL++ L+S   AEGELY+DDG +FD+KQGAYIHRRF FS  +L+S
Sbjct  821  DRPRRSSGLMKYDPYTLIVVLDSKGQAEGELYVDDGETFDYKQGAYIHRRFSFSGTSLSS  880

Query  358  LNLKPSSGSK-----KFSSDCTVERIILLGLS---EGPKSALVEPGNNKVEVEKGPLLLR  203
             + + +SGSK     K  ++  VE+I+++G     +G  S LV     K  ++       
Sbjct  881  TD-QSTSGSKTNQYLKTMAEVHVEKIVIVGAPSSWKGKDSVLVLEDGAKSGIKASMDWHN  939

Query  202  ESQGPSVLTI-RKPNVRVGDDWSIKIL  125
               G +   I +KP V +   W I  +
Sbjct  940  SESGKAAFAIVKKPGVSITKSWKIDFV  966



>gb|KFZ10715.1| hypothetical protein V502_07965 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=980

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 120/208 (58%), Gaps = 16/208 (8%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            V  + TE A  V  YLP +Q +YD  +   Y+G  TH + A  ++IP   +AG IIPRKD
Sbjct  770  VHPVVTEGATSVEAYLPDNQVYYDYFTYKTYQGHGTHTINAPLDTIPVLMQAGHIIPRKD  829

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAG--TLT  362
            R RRSS  M  DPYTLV+ L+S+  A GELY+DDG++F+F+QGAYIHR F       TL+
Sbjct  830  RPRRSSDLMRYDPYTLVVILDSAGNASGELYVDDGQTFEFEQGAYIHRSFALDEATRTLS  889

Query  361  SLNL---KPSSGSKKFS-----SDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLL  206
            S++    K   G +K +     ++ TVER+I++G  +  K   VE    + + ++  + L
Sbjct  890  SVDFEDKKTRGGKEKMAFVKKMAEVTVERVIVVGAPKAWKG--VESVEVREDGKERSVRL  947

Query  205  RESQG----PSVLTIRKPNVRVGDDWSI  134
               +G     S   ++ P V +G DWS+
Sbjct  948  EWHEGAKGAASWAEVKNPKVGIGRDWSV  975



>gb|KDO57536.1| hypothetical protein CISIN_1g0024422mg, partial [Citrus sinensis]
Length=614

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            VQG+Y ERAKH+SVYLPG +SWYD+R+G   KGG+THKLE  EES+PAFQR GTIIPR+D
Sbjct  536  VQGVYEERAKHISVYLPGKESWYDIRTGARVKGGVTHKLEVSEESVPAFQRPGTIIPRRD  595

Query  535  RFRRSSTQMENDPYTLV  485
            RFRRSSTQM NDPYTLV
Sbjct  596  RFRRSSTQMVNDPYTLV  612



>ref|XP_007442138.1| PREDICTED: neutral alpha-glucosidase AB isoform X1 [Python bivittatus]
Length=905

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 111/198 (56%), Gaps = 10/198 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  + A+ V VYLPG  + WYD+ +        T  L     SIP +QR G+I+ RK
Sbjct  715  VHPVTAQGARGVQVYLPGKGEVWYDVHTHQKLHAPQTLYLAVTMNSIPVYQRGGSIVARK  774

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLT  362
            +R RRSS  M+NDPYTL +AL     A+G+L++DDG +++F+ +G Y+HR F FS   LT
Sbjct  775  ERVRRSSDCMQNDPYTLYVALGPQGTAQGDLFVDDGHTYNFETKGQYLHRLFRFSGNMLT  834

Query  361  SLNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSV  182
            +    P +    F +   +ER+++LG   G  +A+    ++  E     L        SV
Sbjct  835  ASTADPKA---SFETPAWIERVVILG--AGKPAAVFLKQDDAAETR---LDFTHEAETSV  886

Query  181  LTIRKPNVRVGDDWSIKI  128
            LTIRKP V VG DWSI +
Sbjct  887  LTIRKPAVNVGADWSISL  904



>ref|XP_007442139.1| PREDICTED: neutral alpha-glucosidase AB isoform X2 [Python bivittatus]
Length=883

 Score =   135 bits (340),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 111/198 (56%), Gaps = 10/198 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  + A+ V VYLPG  + WYD+ +        T  L     SIP +QR G+I+ RK
Sbjct  693  VHPVTAQGARGVQVYLPGKGEVWYDVHTHQKLHAPQTLYLAVTMNSIPVYQRGGSIVARK  752

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLT  362
            +R RRSS  M+NDPYTL +AL     A+G+L++DDG +++F+ +G Y+HR F FS   LT
Sbjct  753  ERVRRSSDCMQNDPYTLYVALGPQGTAQGDLFVDDGHTYNFETKGQYLHRLFRFSGNMLT  812

Query  361  SLNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSV  182
            +    P +    F +   +ER+++LG   G  +A+    ++  E     L        SV
Sbjct  813  ASTADPKA---SFETPAWIERVVILG--AGKPAAVFLKQDDAAETR---LDFTHEAETSV  864

Query  181  LTIRKPNVRVGDDWSIKI  128
            LTIRKP V VG DWSI +
Sbjct  865  LTIRKPAVNVGADWSISL  882



>ref|XP_006118290.1| PREDICTED: LOW QUALITY PROTEIN: neutral alpha-glucosidase AB 
[Pelodiscus sinensis]
Length=1034

 Score =   135 bits (341),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 113/194 (58%), Gaps = 11/194 (6%)
 Frame = -1

Query  700   TERAKH-VSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFR  527
             TE+  H V VYLPG  + WYD+ S   +       +     SIP +QR G+I+PRK+R R
Sbjct  848   TEQGAHGVQVYLPGKGEVWYDVHSHQKHHAPQMLYVPVTMSSIPVYQRGGSIVPRKERVR  907

Query  526   RSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGA-YIHRRFIFSAGTLTSLNL  350
             RSS  M +DPYTL +AL+    AEG+L+IDDG +++F+  A Y+HR F F++ TLT+   
Sbjct  908   RSSDCMHHDPYTLYVALSPQGTAEGDLFIDDGHTYNFESKAQYLHRHFSFASNTLTA---  964

Query  349   KPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIR  170
             + +     F S   +ER+++LG  +     L + G  ++ ++      +     S+LT+R
Sbjct  965   RSADSKGIFESPAWIERVVILGAGKPAAVFLRQSGMPEMRLD-----FQHEPETSILTLR  1019

Query  169   KPNVRVGDDWSIKI  128
             KP V +G DWSI +
Sbjct  1020  KPGVNIGADWSISL  1033



>gb|EGV97236.1| Neutral alpha-glucosidase C [Cricetulus griseus]
Length=182

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 106/185 (57%), Gaps = 9/185 (5%)
 Frame = -1

Query  676  VYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSSTQMEND  500
            ++LPG ++ WYD ++   +KGG T K+    ++IP FQR G+++P K    +S+  M + 
Sbjct  4    IFLPGSNEVWYDSKTFAQWKGGCTVKIPVTLDTIPVFQRGGSVVPIKTSVGKSTGWMTDS  63

Query  499  PYTLVIALNSSQAAEGELYIDDGRSFDF-KQGAYIHRRFIFSAGTLTSLNLKPSSGSKKF  323
            PY L +AL++  +AEGELY+DDG SF +  Q  ++HRRF F +G L +   + +     +
Sbjct  64   PYGLRLALSTQDSAEGELYLDDGHSFQYLHQDQFLHRRFSFCSGVLIN---RCADEKGHY  120

Query  322  SSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNVRVGDD  143
             S C VE+I++LGL + P S      + KV+    P         S L++ K ++ + DD
Sbjct  121  PSKCIVEQILVLGLRKKPSSVTTRSSDGKVQ----PAAFTYHTKASALSLEKLSLSITDD  176

Query  142  WSIKI  128
            W + I
Sbjct  177  WEVHI  181



>ref|XP_007056961.1| PREDICTED: neutral alpha-glucosidase AB [Chelonia mydas]
Length=946

 Score =   135 bits (339),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 113/194 (58%), Gaps = 11/194 (6%)
 Frame = -1

Query  700  TERAKH-VSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFR  527
            TE+  H V VYLPG  + WYD+ S   +       +     SIP +QR G+I+PRK+R R
Sbjct  760  TEQGAHGVQVYLPGKGEVWYDVHSHQKHHAPQMLYVPVTMSSIPVYQRGGSIVPRKERVR  819

Query  526  RSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLTSLNL  350
            RSS  M +DPYTL +AL+    AEG+L+IDDG +++F+ +  Y+HR F F++ TLT+   
Sbjct  820  RSSDCMYHDPYTLYVALSPQGTAEGDLFIDDGHTYNFEIKAQYLHRHFSFASNTLTA---  876

Query  349  KPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIR  170
            + +     F +   +ER+++LG  +     L +PG  +  ++      +     SVLT+R
Sbjct  877  RSADSKGIFETPAWIERVVILGAGKPAAVFLRQPGMAETRLD-----FQHEPETSVLTLR  931

Query  169  KPNVRVGDDWSIKI  128
            KP V +G +WSI +
Sbjct  932  KPGVNIGANWSISL  945



>gb|EMP38490.1| Neutral alpha-glucosidase AB [Chelonia mydas]
Length=1005

 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 113/194 (58%), Gaps = 11/194 (6%)
 Frame = -1

Query  700   TERAKH-VSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFR  527
             TE+  H V VYLPG  + WYD+ S   +       +     SIP +QR G+I+PRK+R R
Sbjct  819   TEQGAHGVQVYLPGKGEVWYDVHSHQKHHAPQMLYVPVTMSSIPVYQRGGSIVPRKERVR  878

Query  526   RSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLTSLNL  350
             RSS  M +DPYTL +AL+    AEG+L+IDDG +++F+ +  Y+HR F F++ TLT+   
Sbjct  879   RSSDCMYHDPYTLYVALSPQGTAEGDLFIDDGHTYNFEIKAQYLHRHFSFASNTLTA---  935

Query  349   KPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIR  170
             + +     F +   +ER+++LG  +     L +PG  +  ++      +     SVLT+R
Sbjct  936   RSADSKGIFETPAWIERVVILGAGKPAAVFLRQPGMAETRLD-----FQHEPETSVLTLR  990

Query  169   KPNVRVGDDWSIKI  128
             KP V +G +WSI +
Sbjct  991   KPGVNIGANWSISL  1004



>emb|CDQ63546.1| unnamed protein product [Oncorhynchus mykiss]
Length=252

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/200 (40%), Positives = 113/200 (57%), Gaps = 14/200 (7%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  ER+  V+ YLPG+ + WYD+ +   + G     +     SIP FQR G+II RK
Sbjct  62   VHPVTDERSSGVTAYLPGNGEVWYDVHTFQRHDGAQNLSIPVTMSSIPVFQRGGSIICRK  121

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQG-AYIHRRFIFSAGTLT  362
            +R RRSS+ MENDPYTL +AL+S   AEGE+YIDDG +F  K    +IHRR  F+A +L+
Sbjct  122  NRVRRSSSCMENDPYTLYVALDSQGNAEGEIYIDDGHTFKHKTDKQFIHRRLSFTANSLS  181

Query  361  SLNLKPSSGSKKFSSDCTVERIILLGLSEGPKSAL--VEPGNNKVEVEKGPLLLRESQGP  188
            S      S   +F +   VE++ +LG  +     L   + G + VE E  P         
Sbjct  182  S---SDLSPDSQFPTASWVEQVNILGAQKPDAVTLTATDGGESSVEFEFDP-------DT  231

Query  187  SVLTIRKPNVRVGDDWSIKI  128
            +VLT+RKP V  G +W++ +
Sbjct  232  AVLTLRKPGVNAGVNWTLHL  251



>ref|XP_001640695.1| predicted protein [Nematostella vectensis]
 gb|EDO48632.1| predicted protein [Nematostella vectensis]
Length=917

 Score =   135 bits (339),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 108/212 (51%), Gaps = 33/212 (16%)
 Frame = -1

Query  676  VYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSSTQMEND  500
            VYLPG +Q WY L     Y+GG   K+ +  + IP FQR G+IIPRK+R RRSS+   +D
Sbjct  708  VYLPGKEQYWYHLDDHKIYRGGNNVKVASPLDKIPLFQRGGSIIPRKNRIRRSSSLSHDD  767

Query  499  PYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSLNLKPS-------  341
            PYTL +AL+    AEG+LYIDD  SFD+K GA+ + +F F  G L + N   S       
Sbjct  768  PYTLTLALDPKGEAEGDLYIDDFHSFDYKTGAFAYMKFTFKQGKLAAKNETKSQFPDVSS  827

Query  340  ---------------------SGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVE  224
                                 +GS  F +   +ERI++LG+S  PKS ++       +  
Sbjct  828  PPAPKDDGLLNSVWNLMRDKPAGSTPFKTKAEIERIVILGISNSPKSVVL----TSSDTA  883

Query  223  KGPLLLRESQGPSVLTIRKPNVRVGDDWSIKI  128
               L     +    LTI+KP V    +W+I +
Sbjct  884  NRQLQFTHDKSAYTLTIKKPAVNAASEWTIAM  915



>ref|XP_008870578.1| hypothetical protein H310_07069 [Aphanomyces invadans]
 gb|ETW00443.1| hypothetical protein H310_07069 [Aphanomyces invadans]
Length=988

 Score =   134 bits (338),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 110/200 (55%), Gaps = 14/200 (7%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYK---GGLTHKLEALEESIPAFQRAGTIIP  545
            V  I +      +VYLPG   WY++    +YK   GG TH + A  + IP FQR G+I+P
Sbjct  798  VHPITSAGMTSANVYLPGTDVWYNIHE--SYKRVAGGATHSVAAPIDYIPVFQRGGSILP  855

Query  544  RKDRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQG-AYIHRRFIFSAGT  368
            ++ R RRSS  M  DPYTLV+ALN ++ A GELYIDD  +F F+    +   +F F  GT
Sbjct  856  QRWRVRRSSALMRRDPYTLVVALNHAKTATGELYIDDEHTFAFETDKKFSQVQFTFDHGT  915

Query  367  LTSLNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGP  188
            LTS  +     S  + SD TVERI+++G+ +    A +  GN     E   L        
Sbjct  916  LTSRVI-----SNGYLSDVTVERIVVVGMQKPATKATLTSGNEHTVTE---LETAYDSIE  967

Query  187  SVLTIRKPNVRVGDDWSIKI  128
              LTIRKPNV    +WSI+I
Sbjct  968  DALTIRKPNVGATAEWSIQI  987



>ref|XP_010868916.1| PREDICTED: LOW QUALITY PROTEIN: neutral alpha-glucosidase AB-like 
[Esox lucius]
Length=977

 Score =   134 bits (337),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 80/201 (40%), Positives = 121/201 (60%), Gaps = 16/201 (8%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  E ++ V+VYLPG+ + WYD+ +   + G L   +     +IP FQR G+II RK
Sbjct  787  VHPVTDEGSRGVTVYLPGNGEVWYDVHTFQRHDGALHLHIPITMSTIPVFQRGGSIICRK  846

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQG-AYIHRRFIFSAGTLT  362
            +R RRSS+ MENDP+TL +AL+    AEGELY+DDG +F  +    +IHRR  F++ TL+
Sbjct  847  NRIRRSSSCMENDPFTLYVALDPQGNAEGELYVDDGHTFKHETDRQFIHRRLRFTSNTLS  906

Query  361  SLNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEP---GNNKVEVEKGPLLLRESQG  191
            S +    S   +F +   VE++++LG  E PK+  +     G + VE E  P+ L     
Sbjct  907  SSD---LSPDSQFPTASWVEKVVILGAQE-PKAVTLTSSGGGESSVEFEFDPVTL-----  957

Query  190  PSVLTIRKPNVRVGDDWSIKI  128
              VLT+RKP+V  G DW++++
Sbjct  958  --VLTLRKPDVNAGVDWTLQL  976



>ref|XP_002848904.1| neutral alpha-glucosidase AB [Arthroderma otae CBS 113480]
 gb|EEQ29019.1| neutral alpha-glucosidase AB [Arthroderma otae CBS 113480]
Length=967

 Score =   134 bits (336),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 81/204 (40%), Positives = 117/204 (57%), Gaps = 11/204 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLT-HKLEALEESIPAFQRAGTIIPRK  539
            V+ + TE +  V +Y+  ++ +YD    T Y+G    H + A  E +P   + G IIPRK
Sbjct  762  VKPVVTEGSTSVDIYISDEEKYYDYFDFTIYQGARKKHTVNAPLEKLPILMQGGHIIPRK  821

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
            DR RRSS  M+ DPYTL++ L+S   AEGELY+DDG +FD+KQGAYIHR+F+FS  TL+S
Sbjct  822  DRPRRSSGLMKYDPYTLIVVLDSKGQAEGELYVDDGETFDYKQGAYIHRQFVFSGTTLSS  881

Query  358  LNLKPSSGSK-----KFSSDCTVERIILLGLS---EGPKSALVEPGNNKVEVEKGPLLLR  203
             N + + G+K     K  ++  VE+I+L+G+    +G  S LV     K  V+       
Sbjct  882  -NDQATIGAKTNQYLKTMAEVQVEKIVLVGIPSDWKGKGSVLVLEDGAKSGVKASLDWHD  940

Query  202  ESQGPSVLTI-RKPNVRVGDDWSI  134
               G +   I +KP V +   W I
Sbjct  941  AEDGKAAYAIVKKPGVSITKSWKI  964



>gb|KFH70851.1| hypothetical protein MVEG_03698 [Mortierella verticillata NRRL 
6337]
Length=971

 Score =   134 bits (336),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/191 (37%), Positives = 117/191 (61%), Gaps = 12/191 (6%)
 Frame = -1

Query  679  SVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSSTQMEND  500
            +VY  G + W+D++  +  +G    ++ +  + IP +QRAGTI+P+++R RRSS  MEND
Sbjct  787  TVYFAGTEKWFDIKDFSIQQGPGAKEVASPADKIPVYQRAGTIVPKRERIRRSSKAMEND  846

Query  499  PYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSLNLKPS-----SG  335
            P+TLV+A++S   A G LY+DDG +F+++ G YI R F  + GTL+S +LKP+     S 
Sbjct  847  PFTLVVAMDSKGEASGRLYLDDGETFNYEHGDYILREFKVAKGTLSSRSLKPTTEPEVSD  906

Query  334  SKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPS-VLTIRKPNV  158
              ++ +   +ERI+++GL+   K   V     +VEVE      + +QG   V T+++P V
Sbjct  907  FMQYKAGIRIERIVVVGLAAPLKQVRV--AGREVEVE----CAQAAQGGHYVCTVKEPRV  960

Query  157  RVGDDWSIKIL  125
             +G D+ +  +
Sbjct  961  TIGQDFDLSFV  971



>gb|KFY42965.1| hypothetical protein V494_02146 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=2101

 Score =   134 bits (338),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 104/167 (62%), Gaps = 13/167 (8%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            V  + TE A  V  YLP DQ++YD  +   Y+G  TH ++A  ++IP   + G IIPRKD
Sbjct  768  VHPVVTEGATSVEAYLPDDQTYYDYFTYKTYQGHGTHTIDAPLDTIPVLMQGGHIIPRKD  827

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAG--TLT  362
            R RRSS  M  DPYTLV+ L+S+  A GELY+DDG++F+F+QGAYIHR F   A   TL+
Sbjct  828  RPRRSSDLMRYDPYTLVVVLDSAGNASGELYVDDGQTFEFEQGAYIHRSFALDAATQTLS  887

Query  361  SLNL---KPSSGSKKFS-----SDCTVERIILLGLS---EGPKSALV  254
            S++    K   G +K S     +  TVER+I++G     +G +S LV
Sbjct  888  SVDFEEKKTRGGKEKMSFVKKMAAVTVERVIVVGAPKKWKGVESVLV  934



>ref|XP_001242667.1| hypothetical protein CIMG_06563 [Coccidioides immitis RS]
 gb|EAS31084.3| alpha glucosidase II [Coccidioides immitis RS]
Length=962

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/203 (41%), Positives = 112/203 (55%), Gaps = 11/203 (5%)
 Frame = -1

Query  706  IYTERAKHVSVYLPGDQSWYDLRSGTAYKG-GLTHKLEALEESIPAFQRAGTIIPRKDRF  530
            + TE A  V +Y+  D+ +YD    T Y G G TH+++A  E IP   + G IIPRKDR 
Sbjct  760  VVTEGATSVDIYIADDEKYYDYFDYTVYHGAGRTHRVQAPLEKIPLLMQGGHIIPRKDRP  819

Query  529  RRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSLNL  350
            RRSS  M+ DPYTLV+ L+ S  AEGELY+DDG +FD++ GA IHRRFIF   TL+S NL
Sbjct  820  RRSSGLMKFDPYTLVVVLDKSGHAEGELYVDDGETFDYQSGALIHRRFIFDNSTLSSENL  879

Query  349  KPSSGSK-----KFSSDCTVERIILLGLSE---GPKSALVEPGNNKVEVEKGPLLLRESQ  194
              +SG K     K  +   VE+II++G  E   G ++  V     + E +          
Sbjct  880  G-ASGPKTAKYLKSMAKVHVEKIIVVGAPEEWKGKQAVQVVEKGTQSEAQAALEWHGSRD  938

Query  193  G-PSVLTIRKPNVRVGDDWSIKI  128
            G  S   ++ P V +   W I  
Sbjct  939  GKASYAIVKNPIVSITKSWKISF  961



>gb|EFW16067.1| glucosidase II alpha subunit [Coccidioides posadasii str. Silveira]
Length=962

 Score =   133 bits (335),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/203 (41%), Positives = 112/203 (55%), Gaps = 11/203 (5%)
 Frame = -1

Query  706  IYTERAKHVSVYLPGDQSWYDLRSGTAYKG-GLTHKLEALEESIPAFQRAGTIIPRKDRF  530
            + TE A  V +Y+  D+ +YD    T Y G G TH+++A  E IP   + G IIPRKDR 
Sbjct  760  VVTEGATSVDIYISDDEKYYDYFDYTVYHGAGRTHRVQAPLEKIPLLMQGGHIIPRKDRP  819

Query  529  RRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSLNL  350
            RRSS  M+ DPYTLV+ L+ S  AEGELY+DDG +FD++ GA IHRRFIF   TL+S NL
Sbjct  820  RRSSGLMKFDPYTLVVVLDKSGHAEGELYVDDGETFDYQSGALIHRRFIFDNSTLSSENL  879

Query  349  KPSSGSK-----KFSSDCTVERIILLGLSE---GPKSALVEPGNNKVEVEKGPLLLRESQ  194
              +SG K     K  +   VE+II++G  E   G ++  V     + E +          
Sbjct  880  G-ASGPKTAKYLKSMAKVHVEKIIVVGAPEEWKGKQAVQVVEKGTQSEAQAALEWHGSRD  938

Query  193  G-PSVLTIRKPNVRVGDDWSIKI  128
            G  S   ++ P V +   W I  
Sbjct  939  GKASYAIVKNPIVSITKSWKISF  961



>ref|XP_003069841.1| glucosidase II alpha subunit, putative [Coccidioides posadasii 
C735 delta SOWgp]
 gb|EER27696.1| glucosidase II alpha subunit, putative [Coccidioides posadasii 
C735 delta SOWgp]
Length=962

 Score =   133 bits (335),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/203 (41%), Positives = 112/203 (55%), Gaps = 11/203 (5%)
 Frame = -1

Query  706  IYTERAKHVSVYLPGDQSWYDLRSGTAYKG-GLTHKLEALEESIPAFQRAGTIIPRKDRF  530
            + TE A  V +Y+  D+ +YD    T Y G G TH+++A  E IP   + G IIPRKDR 
Sbjct  760  VVTEGATSVDIYISDDEKYYDYFDYTVYHGAGRTHRVQAPLEKIPLLMQGGHIIPRKDRP  819

Query  529  RRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSLNL  350
            RRSS  M+ DPYTLV+ L+ S  AEGELY+DDG +FD++ GA IHRRFIF   TL+S NL
Sbjct  820  RRSSGLMKFDPYTLVVVLDKSGHAEGELYVDDGETFDYQSGALIHRRFIFDNSTLSSENL  879

Query  349  KPSSGSK-----KFSSDCTVERIILLGLSE---GPKSALVEPGNNKVEVEKGPLLLRESQ  194
              +SG K     K  +   VE+II++G  E   G ++  V     + E +          
Sbjct  880  G-ASGPKTAKYLKSMAKVHVEKIIVVGAPEEWKGKQAVQVVEKGTQSEAQAALEWHGSRD  938

Query  193  G-PSVLTIRKPNVRVGDDWSIKI  128
            G  S   ++ P V +   W I  
Sbjct  939  GKASYAIVKNPIVSITKSWKISF  961



>ref|XP_002836987.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ81178.1| unnamed protein product [Tuber melanosporum]
Length=947

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 107/201 (53%), Gaps = 8/201 (4%)
 Frame = -1

Query  706  IYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFR  527
            I  E A   +VY P DQ +YD    T Y     H++ A  E IP F R G IIPRKDR R
Sbjct  746  IVKESATKTTVYFPDDQVYYDYFDHTTYHRKGHHEVSAALEEIPLFMRGGHIIPRKDRPR  805

Query  526  RSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAG--TLTSLN  353
            RSS  M+ DPYTLVIA++S   A+G LY+DDG ++  + GAYIHR F FS G  TL S N
Sbjct  806  RSSGLMKYDPYTLVIAVSSEGTADGVLYVDDGETYAHQSGAYIHRAFTFSYGDNTLRSGN  865

Query  352  LKP----SSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQG--  191
            L P    ++   K      VERI+++G+ +   +  V       +  K  ++  E +   
Sbjct  866  LHPEPAKAAAYNKDMRSVRVERIVIVGIGKEWAAKKVVEVKQGSKTWKAKIVYTEGKDGK  925

Query  190  PSVLTIRKPNVRVGDDWSIKI  128
             +   +R P V +  DWS+  
Sbjct  926  ANTAVVRDPKVSITKDWSVNF  946



>ref|XP_006011429.1| PREDICTED: neutral alpha-glucosidase C-like [Latimeria chalumnae]
Length=858

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/189 (39%), Positives = 111/189 (59%), Gaps = 13/189 (7%)
 Frame = -1

Query  682  VSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSSTQME  506
            V V+LPG D+ WY++R+   ++G  T  +    ESIP FQR G+I+PRK R  RS+  M+
Sbjct  675  VDVFLPGSDEIWYNIRTFKRHEGAQTLCVPVSIESIPVFQRGGSIVPRKTRVCRSTEWMK  734

Query  505  NDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLTSLNLKPSSGSK  329
            + PY L +AL+   +A GEL++DDG SFD++ +  +IH+RF F+  TL+S     SS  +
Sbjct  735  DIPYVLHVALDFKGSAVGELFLDDGHSFDYQAENKFIHKRFSFNNNTLSS-----SSADR  789

Query  328  K--FSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNVR  155
            +  F + C VE ++++G    P S  V+    K    +  +      G SVLT+    V 
Sbjct  790  REHFQTSCEVEEVLIMGFEAAPSSVTVQNSGEK----EAAVRFNYDAGTSVLTLENLCVN  845

Query  154  VGDDWSIKI  128
            VG +W+IKI
Sbjct  846  VGTEWTIKI  854



>ref|XP_006271041.1| PREDICTED: neutral alpha-glucosidase AB [Alligator mississippiensis]
Length=899

 Score =   132 bits (332),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 110/198 (56%), Gaps = 10/198 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +  + A+ V +YLPG  + WYD+ +        T  +     S+P +QR G+++PR+
Sbjct  709  VHPVTEQGARGVQIYLPGKGEVWYDVYTHQKLHAPQTFYIPVTLSSVPVYQRGGSVVPRQ  768

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLT  362
            +R RRSS  M +DP+TL +AL     AEGEL++DDG +FD++ Q  ++HR F F+  TLT
Sbjct  769  ERVRRSSELMRDDPFTLXVALGPQGRAEGELFLDDGHTFDYETQARFLHRHFRFAGNTLT  828

Query  361  SLNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSV  182
            + +  P      F +   +ER+++LG  +     L +    +  ++      R     SV
Sbjct  829  ASSADPRG---TFETPAWLERVVILGTGKPAAVYLHQADGTETRLD-----FRHEAETSV  880

Query  181  LTIRKPNVRVGDDWSIKI  128
            LTIRKP V +G DWSI +
Sbjct  881  LTIRKPGVNIGADWSITL  898



>gb|KFM71080.1| Neutral alpha-glucosidase AB, partial [Stegodyphus mimosarum]
Length=637

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 105/176 (60%), Gaps = 9/176 (5%)
 Frame = -1

Query  691  AKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSST  515
            A  +S+Y PG ++ WYD+ +   Y GG T  L     +IP FQR GTIIP+K+R RRSS+
Sbjct  469  ATSISIYFPGINEVWYDISNYKRYNGGQTVSLPVTLATIPVFQRGGTIIPKKNRIRRSSS  528

Query  514  QMENDPYTLVIALNSSQA-AEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSLNLKPSS  338
               NDPYTL IAL+ S + A G LYIDD  SF +++G Y+  +F F    L+S  LK   
Sbjct  529  LTYNDPYTLDIALDKSGSQANGTLYIDDFNSFQYREGNYLLLKFSFEKNVLSSKILK---  585

Query  337  GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIR  170
            G  KF ++  +ERI++LGL + PKS  +   N    V+   L+    +  ++LTIR
Sbjct  586  GPGKFKTNAWLERIVVLGLQKQPKSLTLSRKN----VKSSELIFTYDENKNMLTIR  637



>dbj|BAK62929.1| neutral alpha-glucosidase AB precursor [Pan troglodytes]
Length=219

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 105/190 (55%), Gaps = 10/190 (5%)
 Frame = -1

Query  691  AKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSST  515
            A  V VYLPG  + WYD++S   + G  T  L     SIP FQR GTI+PR  R RRSS 
Sbjct  37   AHGVQVYLPGQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRRSSE  96

Query  514  QMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLTSLNLKPSS  338
             M++DP TL +AL+    A+GEL++DDG +F+++ +  ++ RRF FS  TL S +  P  
Sbjct  97   CMKDDPITLFVALSPQGTAQGELFLDDGHTFNYQTRQEFLLRRFSFSGNTLVSSSADPEG  156

Query  337  GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNV  158
                F +   +ER++++G  +     L   G+ +       L  +     SVL +RKP +
Sbjct  157  ---HFETPIWIERVVIIGAGKPAAVVLQTKGSPESR-----LSFQHDPETSVLVLRKPGI  208

Query  157  RVGDDWSIKI  128
             V  DWSI +
Sbjct  209  NVASDWSIHL  218



>ref|XP_002109035.1| hypothetical protein TRIADDRAFT_37096 [Trichoplax adhaerens]
 gb|EDV29833.1| hypothetical protein TRIADDRAFT_37096 [Trichoplax adhaerens]
Length=947

 Score =   131 bits (330),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 106/197 (54%), Gaps = 8/197 (4%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQS-WYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V+ I    A   S+YLPG+   WYD+ +   + G  +  +      IP FQR G+I+PRK
Sbjct  756  VKPITDASASSTSIYLPGNNELWYDIENYKWFTGPRSISMSVSLNKIPVFQRGGSIVPRK  815

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
            +R RR S+ M +DPYTL +ALN    A G+LYIDDG SFD+ +G +  R+F +    L+S
Sbjct  816  ERIRRCSSLMYDDPYTLTVALNRKAQALGQLYIDDGHSFDYSKGEFSLRKFTYEDNVLSS  875

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
               +P S    + ++  +E+I++LG+   P    V   N+        L  +  +    L
Sbjct  876  ---RPGSAYGNYKTNSWLEKIVVLGMKNKPSKISVSGKNSTPR----KLKFKYDRENRRL  928

Query  178  TIRKPNVRVGDDWSIKI  128
            T++KP V + DDW I  
Sbjct  929  TVKKPEVNIVDDWEINF  945



>ref|XP_007721023.1| alpha 1,3-glucosidase [Capronia coronata CBS 617.96]
 gb|EXJ93529.1| alpha 1,3-glucosidase [Capronia coronata CBS 617.96]
Length=952

 Score =   131 bits (330),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 109/203 (54%), Gaps = 10/203 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGG-LTHKLEALEESIPAFQRAGTIIPRK  539
            V+ +  E A+ V +YL  ++ ++D    T Y GG  THK++A  + IP   + G +IPRK
Sbjct  739  VKPVTAEGAESVDIYLSDEEKYFDYFDYTIYSGGSKTHKVDAPLDRIPILMQGGHVIPRK  798

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
            DR R+SS  M+ DPYTLV+ LN    AEG LY+DDG +FD++QGAYIHRRF  S G L S
Sbjct  799  DRPRKSSGLMKWDPYTLVVVLNKKGEAEGTLYVDDGETFDYQQGAYIHRRFTLSDGVLKS  858

Query  358  LNLKPSSGSKKFS-----SDCTVERIILLGLSE---GPKSALVEPGNNKVEVEKGPLLLR  203
            +++  + GSK  S     +D  VE++I++             V  G+             
Sbjct  859  IDIG-TKGSKTASYLKSMTDVKVEKVIVVNAPNDWSATNEVTVAEGDKGTSTADLTFHAA  917

Query  202  ESQGPSVLTIRKPNVRVGDDWSI  134
                 +   +R P V +G  WSI
Sbjct  918  SGHKAAWAVVRSPGVCIGSAWSI  940



>gb|KIW45991.1| hypothetical protein PV06_01686 [Exophiala oligosperma]
Length=981

 Score =   131 bits (329),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 115/203 (57%), Gaps = 11/203 (5%)
 Frame = -1

Query  706  IYTERAKHVSVYLPGDQSWYDLRSGTAYKGG-LTHKLEALEESIPAFQRAGTIIPRKDRF  530
            + TE A+ V +YL G +++YD    T Y GG  +H++ A  + IP   + G IIPRKDR 
Sbjct  770  VTTEGAESVDIYLAGSENYYDYFDYTIYTGGSKSHRIHAPLDKIPLLMQGGHIIPRKDRP  829

Query  529  RRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSLNL  350
            R+SS  M  DPY+LV+ L+S+  A G LY+DDG +FD++QGA+IHR+F+F+ G L+S NL
Sbjct  830  RKSSGLMRWDPYSLVVVLDSNTQATGSLYVDDGETFDYEQGAFIHRKFVFADGELSSTNL  889

Query  349  KPSSGSK-----KFSSDCTVERIILLG----LSEGPKSALVEPGNNKVEVEKGPLLLRES  197
              + GSK     K   D TVE+II++      S+  + ++   G       +        
Sbjct  890  G-TKGSKTAQYLKAMKDVTVEKIIVVNAPASWSDVNEVSVTGEGIKGTASAELIYHAAAG  948

Query  196  QGPSVLTIRKPNVRVGDDWSIKI  128
               +   IR P   +G DW++ +
Sbjct  949  DKAAWAVIRNPRTSIGADWTVSL  971



>ref|XP_007081758.1| PREDICTED: neutral alpha-glucosidase C isoform X1 [Panthera tigris 
altaica]
Length=914

 Score =   131 bits (329),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 113/200 (57%), Gaps = 13/200 (7%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +   +A  VSV+LPG ++ WYD ++GT ++G  T K+    ++IP FQR G+I+P K
Sbjct  723  VHPVTEPKATTVSVFLPGSNEVWYDSKTGTHWEGACTVKIPVTLDTIPVFQRGGSIVPIK  782

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDF-KQGAYIHRRFIFSAGTLT  362
                +S+  M + PY L +AL++  +A GELY+DDG SF +  Q  ++HR+F F +G LT
Sbjct  783  TTIGKSTGYMTDSPYGLRVALSTKGSAAGELYLDDGHSFQYLHQKQFLHRKFSFLSGVLT  842

Query  361  SLNLKPSSGSKK--FSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGP  188
            +     S   K+    S C VER+ +LGL + P S      + K E    P++       
Sbjct  843  N-----SCADKRGHHPSKCVVERVFVLGLKKQPSSVTTHSSDGKEE----PVVFTYCTTM  893

Query  187  SVLTIRKPNVRVGDDWSIKI  128
            S L++ K ++ +G DW + I
Sbjct  894  STLSLEKLSLNIGADWEVHI  913



>ref|XP_003174057.1| neutral alpha-glucosidase AB [Microsporum gypseum CBS 118893]
 gb|EFR01227.1| neutral alpha-glucosidase AB [Microsporum gypseum CBS 118893]
Length=968

 Score =   131 bits (329),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 116/204 (57%), Gaps = 11/204 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGG-LTHKLEALEESIPAFQRAGTIIPRK  539
            V+ + TE +  V VY+  ++ +YD    T Y+G    H + A  E IP   + G IIPRK
Sbjct  763  VKPVVTEGSTSVDVYISDEEKYYDYFDLTIYQGANKKHTVNAPLEKIPMLMQGGHIIPRK  822

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
            DR RRSS  M+ DPYTL++ L+S   A GELY+DDG +FD+K+GAYIHR+F FS  +L+S
Sbjct  823  DRPRRSSGLMKYDPYTLIVVLDSKGQAAGELYVDDGETFDYKEGAYIHRQFSFSDASLSS  882

Query  358  LNLKPSSGSK-----KFSSDCTVERIILLGLS---EGPKSALVEPGNNKVEVEKGPLLLR  203
             + + +SG K     K  ++  VE+I+++G     EG  S LV     K  ++      +
Sbjct  883  TD-QCTSGPKTNQYLKTMAEVYVEKIVIVGAPSSWEGKDSVLVLEDGAKSGIKASMDWHK  941

Query  202  ESQGPSVL-TIRKPNVRVGDDWSI  134
               G +   T++KP V +   W I
Sbjct  942  AENGKAAYATVKKPGVSIAKTWKI  965



>ref|XP_001657347.1| AAEL015337-PA [Aedes aegypti]
 gb|EAT32540.1| AAEL015337-PA [Aedes aegypti]
Length=704

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 108/190 (57%), Gaps = 14/190 (7%)
 Frame = -1

Query  682  VSVYLPGDQS-----WYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSS  518
            V VY P  ++     WYDL +   Y       +      +P FQR G+++PRKDR RR++
Sbjct  522  VDVYFPAKENGEGDLWYDLDNNRKYSSTGYESISVDNYKVPVFQRGGSVVPRKDRIRRAA  581

Query  517  TQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSLNLKPSS  338
            T M++DPYTLV+AL+ + AA+G LYIDD  SF+++ G Y++  F F    L+S   K   
Sbjct  582  TLMKDDPYTLVVALDKNAAAKGTLYIDDETSFEYRSGKYLYLEFEFKDSVLSS---KKID  638

Query  337  GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNV  158
             +  + +   +ER+IL+GL++ PKSA +   N     E   L +    G +V  +RKP V
Sbjct  639  TTASYPTKSWLERVILVGLTKTPKSATLHLSNG----ESSTLEVYLEGGAAV--VRKPGV  692

Query  157  RVGDDWSIKI  128
             + D WSIK+
Sbjct  693  SMLDSWSIKL  702



>gb|ELU04203.1| hypothetical protein CAPTEDRAFT_178821 [Capitella teleta]
Length=932

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 114/197 (58%), Gaps = 18/197 (9%)
 Frame = -1

Query  691  AKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEA-LEES-----IPAFQRAGTIIPRKDR  533
            A  VSVYLPG D  WYD+ +   + G  T  +   L ++     IP F+R G IIP++DR
Sbjct  744  ATGVSVYLPGTDDVWYDMDTSQRFHGAQTVYVAVKLNKARSRFLIPVFRRGGCIIPQRDR  803

Query  532  FRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSLN  353
             RRSS+   +DP+TLV+AL+   +A+G+LY DD  SF ++ GAYIHR+F F    LTS N
Sbjct  804  IRRSSSLTYHDPFTLVVALDKHNSAKGDLYSDDYNSFKYQAGAYIHRQFTFEHNKLTSKN  863

Query  352  LKPSSGSKKFSSDCTVERIILLGLSEGPKS--ALVEPGNNKVEVEKGPLLLRESQGPSVL  179
            L P+     FS+   +E+II++G+   PK+  A VE G  +  +E      +      +L
Sbjct  864  LNPAGS---FSTPAWIEKIIVIGVKSSPKAVYASVE-GTGQSSLE-----FKYDDTTQML  914

Query  178  TIRKPNVRVGDDWSIKI  128
             IRKP + V  D+ I +
Sbjct  915  IIRKPGMGVNKDFDITL  931



>ref|XP_008080131.1| (Trans)glycosidase [Glarea lozoyensis ATCC 20868]
 gb|EHK97932.1| putative Glucosidase 2 subunit alpha [Glarea lozoyensis 74030]
 gb|EPE33514.1| (Trans)glycosidase [Glarea lozoyensis ATCC 20868]
Length=943

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 111/202 (55%), Gaps = 16/202 (8%)
 Frame = -1

Query  706  IYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFR  527
            +  E A+ V +YLP ++ +YD      Y G  +H + A  E IP   + G IIPRKDR R
Sbjct  749  VVKEGAESVDIYLPDNEVYYDYFDYKTYSGRGSHSVAAPLEKIPLLMQGGHIIPRKDRPR  808

Query  526  RSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSLNL-  350
            RSS  M+ DPYTLV+AL+    AEGELY+DDG +FD++ GAYI R F F    L S N  
Sbjct  809  RSSGLMKWDPYTLVVALDKQGNAEGELYVDDGETFDYESGAYIKRAFGFKDNVLESTNRG  868

Query  349  ---KPSSGSKKFSSDCTVERIILLGLSEGPKS----ALVEPGNNKVEVEKGPLLLRESQG  191
               K +S   K      VERI+++G    PKS    A+V+ G  +  +E  P    ES G
Sbjct  869  TKGKMTSSYIKAMKAVGVERIVIVG---APKSWSTKAVVKIGKTEARLEYHP----ESGG  921

Query  190  PSVL-TIRKPNVRVGDDWSIKI  128
             +    I+ P + + +DW I+ 
Sbjct  922  KAAWAVIKSPKISIAEDWKIEF  943



>ref|XP_006033277.1| PREDICTED: neutral alpha-glucosidase AB, partial [Alligator sinensis]
Length=1323

 Score =   131 bits (329),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/198 (35%), Positives = 109/198 (55%), Gaps = 10/198 (5%)
 Frame = -1

Query  715   VQGIYTERAKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
             V  +  + A+ V +YLPG  + WYD+ +        T  +     S+P +QR G+++PR+
Sbjct  1133  VHPVTEQGARGVQIYLPGKGEVWYDVYTHQKLHAPQTFYIPVTLSSVPVYQRGGSVVPRQ  1192

Query  538   DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLT  362
             +R RRSS  M +DP+TL +AL     AEGEL++DDG +FD++ Q  ++HR F F+  TLT
Sbjct  1193  ERVRRSSELMRDDPFTLYVALGPQGRAEGELFLDDGHTFDYETQARFLHRHFSFAGNTLT  1252

Query  361   SLNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSV  182
             + +  P      F +   +ER+++LG  +     L +    +  ++      R     SV
Sbjct  1253  ASSADPRG---TFETPAWLERVVILGTGKPAAVYLHQADGTETRLD-----FRHEAETSV  1304

Query  181   LTIRKPNVRVGDDWSIKI  128
             LTIR P V +G DWSI +
Sbjct  1305  LTIRNPGVNIGADWSITL  1322



>ref|XP_011404505.1| PREDICTED: neutral alpha-glucosidase AB [Amphimedon queenslandica]
Length=948

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 111/197 (56%), Gaps = 9/197 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQS-WYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V+ +  E A +V +YLPG  + WYD    TA+ GG    + A    IP F R G IIP K
Sbjct  759  VRPVMDEGANYVQLYLPGSSTLWYDYDDQTAHNGGRRQHVTAPLSKIPLFIRGGHIIPTK  818

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
             R RRSS+   +DPYTL+IAL++ + A+G+L++DDG SFD++   ++ R F F+    +S
Sbjct  819  QRVRRSSSLTLDDPYTLLIALDAQEKAKGQLFVDDGHSFDYQNEKFLLRDFNFNGNVFSS  878

Query  358  LNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVL  179
               K  +GS +  +   VER++++G  + P S  ++ G N  E     L    +    VL
Sbjct  879  ---KAGNGSGQLVTKAWVERLVIIGYGKKPSSVAMKTGGNTEE-----LRFSYNDNAKVL  930

Query  178  TIRKPNVRVGDDWSIKI  128
            TI +P V +  D+++ I
Sbjct  931  TIGRPGVVISTDFTVTI  947



>dbj|BAE90752.1| unnamed protein product [Macaca fascicularis]
Length=428

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 106/190 (56%), Gaps = 10/190 (5%)
 Frame = -1

Query  691  AKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSST  515
            A  V VYLPG  + WYD++S   + G  T  L     SIP FQR GTI+PR  R RRSS 
Sbjct  246  AHGVQVYLPGQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRRSSE  305

Query  514  QMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLTSLNLKPSS  338
             M++DP TL +AL+    AEGEL++DDG +F+++ +  ++ RRF+FS  TL S +  P  
Sbjct  306  CMKDDPITLFVALSPQGTAEGELFLDDGHTFNYETRQEFLLRRFLFSGNTLVSSSADPEG  365

Query  337  GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNV  158
                F +   +ER++++G  +     L   G+ +       L  +     SVL +RKP +
Sbjct  366  ---HFETPIWIERVVIIGAGKPAAVVLQTKGSPESR-----LSFQHDPETSVLVLRKPGI  417

Query  157  RVGDDWSIKI  128
             V  DWSI +
Sbjct  418  NVASDWSIHL  427



>gb|EZF22344.1| hypothetical protein H100_04804 [Trichophyton rubrum MR850]
 gb|EZF41492.1| hypothetical protein H102_04791 [Trichophyton rubrum CBS 100081]
 gb|EZF52066.1| hypothetical protein H103_04795 [Trichophyton rubrum CBS 288.86]
 gb|EZF62723.1| hypothetical protein H104_04782 [Trichophyton rubrum CBS 289.86]
 gb|EZF73346.1| hypothetical protein H105_04812 [Trichophyton soudanense CBS 
452.61]
 gb|EZF83970.1| hypothetical protein H110_04791 [Trichophyton rubrum MR1448]
 gb|EZF94607.1| hypothetical protein H113_04832 [Trichophyton rubrum MR1459]
 gb|EZG05580.1| hypothetical protein H106_04617 [Trichophyton rubrum CBS 735.88]
 gb|EZG16277.1| hypothetical protein H107_04922 [Trichophyton rubrum CBS 202.88]
 gb|KDB33218.1| hypothetical protein H112_04795 [Trichophyton rubrum D6]
 gb|EGD88310.2| hypothetical protein TERG_04559 [Trichophyton rubrum CBS 118892]
Length=677

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 114/204 (56%), Gaps = 11/204 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGG-LTHKLEALEESIPAFQRAGTIIPRK  539
            V+ + T+ +  V VY+  ++ +YD    T Y+G    H + A  E IP   + G I+PRK
Sbjct  472  VKPVVTQGSTSVDVYIADEEKYYDYFDFTIYQGANKKHIINAPLEKIPILMQGGHIVPRK  531

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
            DR RRSS  M+ DPYTL++ L+S   AEGELY+DDG +FD+KQGAYIHR+F FS  +L+S
Sbjct  532  DRPRRSSGLMKYDPYTLIVVLDSKGQAEGELYVDDGETFDYKQGAYIHRQFSFSGTSLSS  591

Query  358  LNLKPSSGSK-----KFSSDCTVERIILLGLS---EGPKSALVEPGNNKVEVEKGPLLLR  203
             + +  SGSK     K  ++  VE+I+++G     +G  S LV     K  +        
Sbjct  592  TD-QSISGSKTNQYLKAMAEVHVEKIVIVGAPSSWKGKDSVLVLEDGAKSGIRASMDWHN  650

Query  202  ESQGPSVLTI-RKPNVRVGDDWSI  134
               G +   I +KP V +   W I
Sbjct  651  AESGKAAFAIVKKPGVSITKSWKI  674



>ref|XP_008845039.1| PREDICTED: neutral alpha-glucosidase C [Nannospalax galili]
Length=914

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 110/191 (58%), Gaps = 9/191 (5%)
 Frame = -1

Query  694  RAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSS  518
            +A  V V+LPG ++ WYD ++   +KGG T K+    ++IP FQR G+++P K    +S+
Sbjct  730  QAAMVDVFLPGPNEIWYDSKTFAHWKGGCTVKIPVALDTIPVFQRGGSVVPIKTTVGKST  789

Query  517  TQMENDPYTLVIALNSSQAAEGELYIDDGRSFDF-KQGAYIHRRFIFSAGTLTSLNLKPS  341
              M + PY L IAL++  +A GELY+DDG SF +  Q  ++HR+  FS+  L +   + +
Sbjct  790  GWMADSPYGLHIALSTKDSAVGELYLDDGHSFQYLHQKQFLHRKLSFSSSVLIN---RCA  846

Query  340  SGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPN  161
                 + S C VE+I++LGL + P S    P + KV+    P     S   S L++ K +
Sbjct  847  DERGHYPSKCKVEQILVLGLQKKPSSVTTHPSDGKVQ----PAAFTYSARTSTLSLEKLS  902

Query  160  VRVGDDWSIKI  128
            + +GDDW + I
Sbjct  903  LNIGDDWEVHI  913



>ref|XP_001660931.1| AAEL010599-PA [Aedes aegypti]
 gb|EAT37392.1| AAEL010599-PA [Aedes aegypti]
Length=1662

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 108/190 (57%), Gaps = 14/190 (7%)
 Frame = -1

Query  682   VSVYLPGDQS-----WYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSS  518
             V VY P  ++     WYDL +   Y       +      +P FQR G+++PRKDR RR++
Sbjct  1480  VDVYFPAKENGEGDLWYDLDNNRKYSSTGYESISVDNYKVPVFQRGGSVVPRKDRIRRAA  1539

Query  517   TQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSLNLKPSS  338
             T M++DPYTLV+AL+ + AA+G LYIDD  SF+++ G Y++  F F    L+S   K   
Sbjct  1540  TLMKDDPYTLVVALDKNAAAKGTLYIDDETSFEYRSGKYLYLEFEFKDSVLSS---KKID  1596

Query  337   GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNV  158
              +  + +   +ER+IL+GL++ PKSA +   N     E   L +    G +V  +RKP V
Sbjct  1597  TTASYPTKSWLERVILVGLTKTPKSATLHLSNG----ESSTLEVYLEGGAAV--VRKPGV  1650

Query  157   RVGDDWSIKI  128
              + D WSIK+
Sbjct  1651  SMLDSWSIKL  1660


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 48/89 (54%), Gaps = 5/89 (6%)
 Frame = -1

Query  685  HVSVYLPGDQS-----WYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRS  521
            +VSVY P  +      WYD+ +   +       +   E  IP FQR GT+IP K   R+S
Sbjct  635  NVSVYFPVKKDGTSDVWYDIDNHHIFNHAGFVTVMVDELKIPVFQRGGTVIPIKRIARKS  694

Query  520  STQMENDPYTLVIALNSSQAAEGELYIDD  434
            S  M  DPY L++ALN    A+G LYIDD
Sbjct  695  SMLMRQDPYALIVALNDKGRAKGTLYIDD  723



>ref|XP_008713093.1| hypothetical protein HMPREF1541_10200 [Cyphellophora europaea 
CBS 101466]
 gb|ETN44530.1| hypothetical protein HMPREF1541_10200 [Cyphellophora europaea 
CBS 101466]
Length=919

 Score =   129 bits (325),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 78/199 (39%), Positives = 113/199 (57%), Gaps = 12/199 (6%)
 Frame = -1

Query  706  IYTERAKHVSVYLPGDQSWYDLRSGTAYKG-GLTHKLEALEESIPAFQRAGTIIPRKDRF  530
            + TE A+ V VYL  D++++D    T Y G G +H + A  E IP   + G IIPRKDR 
Sbjct  711  VVTEGAESVEVYLADDENYFDYFDYTVYNGAGKSHHVAAPLEKIPLLMQGGHIIPRKDRP  770

Query  529  RRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSLNL  350
            R+SS  M+ DPYTLV+ L+    AEG LY+DDG +F+++QGAYIHRRF  + G L+S ++
Sbjct  771  RKSSGLMKWDPYTLVLVLDKQGEAEGTLYVDDGETFEYQQGAYIHRRFKLTDGKLSSEDI  830

Query  349  KPSSGSK-----KFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQG--  191
              + G+K     K   D  VE+II++      +S    P +     E   L+   ++G  
Sbjct  831  G-TKGAKTAAYLKTMRDVRVEKIIVVNAPSSWESKAEVPVSGGAAAE---LIYHAAEGKK  886

Query  190  PSVLTIRKPNVRVGDDWSI  134
             +   +R P V VG DW +
Sbjct  887  AAWAVVRNPGVGVGTDWVV  905



>gb|AAH05405.1| GANAB protein, partial [Homo sapiens]
Length=313

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/190 (39%), Positives = 106/190 (56%), Gaps = 10/190 (5%)
 Frame = -1

Query  691  AKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSST  515
            A  V VYLPG  + WYD++S   + G  T  L     SIP FQR GTI+PR  R RRSS 
Sbjct  131  AHGVQVYLPGQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRRSSE  190

Query  514  QMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLTSLNLKPSS  338
             M++DP TL +AL+    A+GEL++DDG +F+++ +  ++ RRF FS  TL S +  P  
Sbjct  191  CMKDDPITLFVALSPQGTAQGELFLDDGHTFNYQTRQEFLLRRFSFSGNTLVSSSADPEG  250

Query  337  GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNV  158
                F +   +ER++++G   G  +A+V       E     L  +     SVL +RKP +
Sbjct  251  ---HFETPIWIERVVIIG--AGKPAAVVLQTKGSPESR---LSFQHDPETSVLVLRKPGI  302

Query  157  RVGDDWSIKI  128
             V  DWSI +
Sbjct  303  NVASDWSIHL  312



>ref|XP_011053092.1| PREDICTED: neutral alpha-glucosidase AB isoform X2 [Acromyrmex 
echinatior]
Length=917

 Score =   129 bits (324),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 115/201 (57%), Gaps = 13/201 (6%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGD--QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPR  542
            V+ ++   A  V+VY PG+   +WYD+ +  AY+ G   K+      IP FQR+G+++PR
Sbjct  725  VRPVFQSSATEVAVYFPGEGKVTWYDIDTMQAYEKGGYIKIPVTIHKIPVFQRSGSVVPR  784

Query  541  KDRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLT  362
            K R RRS+  M NDPYTL+I  +S+  A G LYIDD  SF+++ G Y++ R    +  + 
Sbjct  785  KMRIRRSTVAMRNDPYTLIIIADSNGRASGNLYIDDEVSFEYRHGKYLYLRITLDSNKIA  844

Query  361  SLNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGP--  188
            S  +   +    + +   +ERI +    +G KSA +E  +       G + L  +  P  
Sbjct  845  STLIDKLAS---YETQSWLERIDIANPPQGIKSAQLESHS------MGKVTLETTYNPHN  895

Query  187  SVLTIRKPNVRVGDDWSIKIL  125
            +VLTIRKP V +G++W+I++L
Sbjct  896  NVLTIRKPAVNMGEEWTIELL  916



>ref|XP_011053085.1| PREDICTED: neutral alpha-glucosidase AB isoform X1 [Acromyrmex 
echinatior]
Length=922

 Score =   129 bits (324),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 115/201 (57%), Gaps = 13/201 (6%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGD--QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPR  542
            V+ ++   A  V+VY PG+   +WYD+ +  AY+ G   K+      IP FQR+G+++PR
Sbjct  730  VRPVFQSSATEVAVYFPGEGKVTWYDIDTMQAYEKGGYIKIPVTIHKIPVFQRSGSVVPR  789

Query  541  KDRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLT  362
            K R RRS+  M NDPYTL+I  +S+  A G LYIDD  SF+++ G Y++ R    +  + 
Sbjct  790  KMRIRRSTVAMRNDPYTLIIIADSNGRASGNLYIDDEVSFEYRHGKYLYLRITLDSNKIA  849

Query  361  SLNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGP--  188
            S  +   +    + +   +ERI +    +G KSA +E  +       G + L  +  P  
Sbjct  850  STLIDKLAS---YETQSWLERIDIANPPQGIKSAQLESHS------MGKVTLETTYNPHN  900

Query  187  SVLTIRKPNVRVGDDWSIKIL  125
            +VLTIRKP V +G++W+I++L
Sbjct  901  NVLTIRKPAVNMGEEWTIELL  921



>ref|XP_007993639.1| PREDICTED: LOW QUALITY PROTEIN: neutral alpha-glucosidase AB 
[Chlorocebus sabaeus]
Length=966

 Score =   129 bits (324),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 107/192 (56%), Gaps = 14/192 (7%)
 Frame = -1

Query  691  AKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSST  515
            A  V VYLPG  + WYD++S   + G  T  L     SIP FQR GTI+PR  R RRSS 
Sbjct  784  AHGVQVYLPGQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRRSSE  843

Query  514  QMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLTSLNLKPSS  338
             M++DP TL +AL+    AEGEL++DDG +F+++ +  ++ RRF+FS  TL S +  P  
Sbjct  844  CMKDDPITLFVALSPQGTAEGELFLDDGHTFNYQTRQEFLLRRFLFSGNTLVSSSADPEG  903

Query  337  GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGP--SVLTIRKP  164
                F +   +ER++++G  +     L   G       + P+ L     P  SVL +RKP
Sbjct  904  ---HFETPIWIERVVIIGAGKPAAVVLQTKG-------EXPICLSFQHDPETSVLVLRKP  953

Query  163  NVRVGDDWSIKI  128
             + V  DWSI +
Sbjct  954  GINVASDWSIHL  965



>ref|XP_005718347.1| Neutral alpha-glucosidase AB [Chondrus crispus]
 emb|CDF38454.1| Neutral alpha-glucosidase AB [Chondrus crispus]
Length=993

 Score =   129 bits (324),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 79/203 (39%), Positives = 117/203 (58%), Gaps = 18/203 (9%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTH----KLEALEESIPAFQRAGTII  548
            V  +  E A   +VYLP ++ WYDL   + +   +      ++E   + +   QR GTI+
Sbjct  801  VAPVVKEGASKHTVYLPDNELWYDLYDPSGFGKAVVKAGNVEIECELDRMVVLQRGGTIV  860

Query  547  PRKDRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGT  368
            P+++R RRS+  M  DPYTLV+ALN+ + AEGELY+DDG+S+D K GAY+ RRF F+  T
Sbjct  861  PKQERRRRSTAAMGRDPYTLVVALNARREAEGELYMDDGKSYDHKSGAYVVRRFRFADNT  920

Query  367  LTSLNLKPSSGSKKF-SSDCTVERIILLGL-SEGPKSALVEPGNNKVEVEKGPLLLRESQ  194
            L+   +    G K F  SD  VER+++LG    G  SA VE     V+V         + 
Sbjct  921  LSVETV--GGGKKPFHGSDALVERVVILGYGGRGAGSATVE--GRTVDVAY-------AA  969

Query  193  GPSVLTIRKPNVRVGD-DWSIKI  128
               VLT+++  V+ GD DW++K+
Sbjct  970  STGVLTVQRIQVKAGDGDWALKV  992



>ref|XP_002544360.1| hypothetical protein UREG_03877 [Uncinocarpus reesii 1704]
 gb|EEP79031.1| hypothetical protein UREG_03877 [Uncinocarpus reesii 1704]
Length=1583

 Score =   129 bits (325),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 102/168 (61%), Gaps = 11/168 (7%)
 Frame = -1

Query  706  IYTERAKHVSVYLPGDQSWYDLRSGTAYKG-GLTHKLEALEESIPAFQRAGTIIPRKDRF  530
            + TE A  V +Y+  D+ +YD    T Y+G G  H ++A  E IP   + G IIPRKDR 
Sbjct  761  VVTEGATSVDIYIADDEKYYDYFDYTIYQGAGKFHTVQAPLEKIPLLMQGGHIIPRKDRP  820

Query  529  RRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSLNL  350
            RRSS  M+ DPYTLV+ L+ +  AEGELY+DDG +FD++ GA IHRRF+F   TL+S NL
Sbjct  821  RRSSGLMKFDPYTLVVVLDKNGYAEGELYVDDGETFDYQSGAKIHRRFVFDKATLSSENL  880

Query  349  -KPSSGSKKF---SSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKG  218
              P + + K+    ++  VE+II++G     KS         V+VE G
Sbjct  881  VTPGAKTAKYLRSMAEVYVEKIIVVGAPNKWKS------KETVQVEDG  922



>gb|EGI70745.1| Neutral alpha-glucosidase AB [Acromyrmex echinatior]
Length=968

 Score =   129 bits (324),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 115/201 (57%), Gaps = 13/201 (6%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGD--QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPR  542
            V+ ++   A  V+VY PG+   +WYD+ +  AY+ G   K+      IP FQR+G+++PR
Sbjct  776  VRPVFQSSATEVAVYFPGEGKVTWYDIDTMQAYEKGGYIKIPVTIHKIPVFQRSGSVVPR  835

Query  541  KDRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLT  362
            K R RRS+  M NDPYTL+I  +S+  A G LYIDD  SF+++ G Y++ R    +  + 
Sbjct  836  KMRIRRSTVAMRNDPYTLIIIADSNGRASGNLYIDDEVSFEYRHGKYLYLRITLDSNKIA  895

Query  361  SLNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGP--  188
            S  +   +    + +   +ERI +    +G KSA +E  +       G + L  +  P  
Sbjct  896  STLIDKLAS---YETQSWLERIDIANPPQGIKSAQLESHS------MGKVTLETTYNPHN  946

Query  187  SVLTIRKPNVRVGDDWSIKIL  125
            +VLTIRKP V +G++W+I++L
Sbjct  947  NVLTIRKPAVNMGEEWTIELL  967



>ref|XP_003235505.1| glucosidase II alpha subunit [Trichophyton rubrum CBS 118892]
Length=966

 Score =   129 bits (323),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 114/204 (56%), Gaps = 11/204 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGG-LTHKLEALEESIPAFQRAGTIIPRK  539
            V+ + T+ +  V VY+  ++ +YD    T Y+G    H + A  E IP   + G I+PRK
Sbjct  761  VKPVVTQGSTSVDVYIADEEKYYDYFDFTIYQGANKKHIINAPLEKIPILMQGGHIVPRK  820

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
            DR RRSS  M+ DPYTL++ L+S   AEGELY+DDG +FD+KQGAYIHR+F FS  +L+S
Sbjct  821  DRPRRSSGLMKYDPYTLIVVLDSKGQAEGELYVDDGETFDYKQGAYIHRQFSFSGTSLSS  880

Query  358  LNLKPSSGSK-----KFSSDCTVERIILLGLS---EGPKSALVEPGNNKVEVEKGPLLLR  203
             + +  SGSK     K  ++  VE+I+++G     +G  S LV     K  +        
Sbjct  881  TD-QSISGSKTNQYLKAMAEVHVEKIVIVGAPSSWKGKDSVLVLEDGAKSGIRASMDWHN  939

Query  202  ESQGPSVLTI-RKPNVRVGDDWSI  134
               G +   I +KP V +   W I
Sbjct  940  AESGKAAFAIVKKPGVSITKSWKI  963



>ref|XP_011427688.1| PREDICTED: neutral alpha-glucosidase AB-like isoform X3 [Crassostrea 
gigas]
 gb|EKC40929.1| Neutral alpha-glucosidase AB [Crassostrea gigas]
Length=934

 Score =   129 bits (323),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 102/185 (55%), Gaps = 9/185 (5%)
 Frame = -1

Query  679  SVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSSTQMEN  503
            SVY PG D+ WYD+ +  +Y G     + A  + IP FQR G+I+PRK R RRSS+ M +
Sbjct  757  SVYFPGKDEVWYDIDTYQSYAGSQNTYVNAPLDKIPVFQRGGSIVPRKMRVRRSSSLMAS  816

Query  502  DPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSLNLKPSSGSKKF  323
            DP+TL+I L+    A G+LY DD +SF +++G YIHR F F    L S N  PS    K 
Sbjct  817  DPFTLIICLDKQGEASGDLYADDYKSFAYRRGEYIHRTFSFKNNILQSSNADPSG---KG  873

Query  322  SSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNVRVGDD  143
            S+   VE++I++G  +   S  +    N   +              VLT+RKP V +  D
Sbjct  874  STKEWVEKLIIVGYPKAATSVHITVDGNSQSLHHS-----YDSNSRVLTVRKPEVNIAKD  928

Query  142  WSIKI  128
            ++I I
Sbjct  929  FTITI  933



>ref|XP_011427687.1| PREDICTED: neutral alpha-glucosidase AB-like isoform X2 [Crassostrea 
gigas]
Length=946

 Score =   129 bits (323),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 102/185 (55%), Gaps = 9/185 (5%)
 Frame = -1

Query  679  SVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSSTQMEN  503
            SVY PG D+ WYD+ +  +Y G     + A  + IP FQR G+I+PRK R RRSS+ M +
Sbjct  769  SVYFPGKDEVWYDIDTYQSYAGSQNTYVNAPLDKIPVFQRGGSIVPRKMRVRRSSSLMAS  828

Query  502  DPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSLNLKPSSGSKKF  323
            DP+TL+I L+    A G+LY DD +SF +++G YIHR F F    L S N  PS    K 
Sbjct  829  DPFTLIICLDKQGEASGDLYADDYKSFAYRRGEYIHRTFSFKNNILQSSNADPSG---KG  885

Query  322  SSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNVRVGDD  143
            S+   VE++I++G  +   S  +    N   +              VLT+RKP V +  D
Sbjct  886  STKEWVEKLIIVGYPKAATSVHITVDGNSQSLHHS-----YDSNSRVLTVRKPEVNIAKD  940

Query  142  WSIKI  128
            ++I I
Sbjct  941  FTITI  945



>ref|XP_011427686.1| PREDICTED: neutral alpha-glucosidase AB-like isoform X1 [Crassostrea 
gigas]
Length=952

 Score =   129 bits (323),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 102/185 (55%), Gaps = 9/185 (5%)
 Frame = -1

Query  679  SVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSSTQMEN  503
            SVY PG D+ WYD+ +  +Y G     + A  + IP FQR G+I+PRK R RRSS+ M +
Sbjct  775  SVYFPGKDEVWYDIDTYQSYAGSQNTYVNAPLDKIPVFQRGGSIVPRKMRVRRSSSLMAS  834

Query  502  DPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSLNLKPSSGSKKF  323
            DP+TL+I L+    A G+LY DD +SF +++G YIHR F F    L S N  PS    K 
Sbjct  835  DPFTLIICLDKQGEASGDLYADDYKSFAYRRGEYIHRTFSFKNNILQSSNADPSG---KG  891

Query  322  SSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNVRVGDD  143
            S+   VE++I++G  +   S  +    N   +              VLT+RKP V +  D
Sbjct  892  STKEWVEKLIIVGYPKAATSVHITVDGNSQSLHHS-----YDSNSRVLTVRKPEVNIAKD  946

Query  142  WSIKI  128
            ++I I
Sbjct  947  FTITI  951



>emb|CCC94599.1| unnamed protein product [Trypanosoma congolense IL3000]
Length=806

 Score =   128 bits (322),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 101/179 (56%), Gaps = 4/179 (2%)
 Frame = -1

Query  670  LPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSSTQMENDPYT  491
            +P    WY   +G     G  H ++   ++IP F R G IIP K R RR++  M++DPYT
Sbjct  628  IPSGSKWYSYTTGEVVPPG-NHHMKVDMDTIPMFLRGGHIIPVKLRIRRATLAMKHDPYT  686

Query  490  LVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSLNLKPSSGSKKFSSDC  311
            L +ALN    + GEL+IDDG SFD++ GAYI+R   FS G LT+     S+ S  F++  
Sbjct  687  LYVALNEKGNSAGELFIDDGESFDYESGAYIYRYLTFSDGKLTNRAHPNSTASSLFTAKN  746

Query  310  TVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNVRVGDDWSI  134
             VERI++ G    P  A+VE     ++V  G  +  + +G   L ++ P + +G+DW I
Sbjct  747  KVERIVIFGYEGKPSVAMVEVVTQSIKV--GKEIEYDVKG-GALVLKNPGLHIGEDWVI  802



>ref|XP_004621567.1| PREDICTED: neutral alpha-glucosidase AB isoform X5 [Sorex araneus]
Length=831

 Score =   128 bits (321),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 75/193 (39%), Positives = 110/193 (57%), Gaps = 16/193 (8%)
 Frame = -1

Query  691  AKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSST  515
            A  V +YLPG  + WYD+++   Y G  T  L     +IP FQR GTI+ R  R RRSS 
Sbjct  649  AHGVQIYLPGQGEVWYDMQTHQKYHGPQTLYLPVTLSTIPVFQRGGTIVARWMRVRRSSA  708

Query  514  QMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLTSLNLKPSS  338
             M++DP TL +AL+    A+GEL++DDG SF+++ Q A++ RRF F+  TL S +  P  
Sbjct  709  CMKDDPLTLFVALSPQGTAQGELFLDDGHSFNYQNQHAFLLRRFSFAGNTLVSSSADPQG  768

Query  337  GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGP---LLLRESQGPSVLTIRK  167
                F +   +ER++++G   G  +A+V      +++E  P   L  +     SVL +RK
Sbjct  769  ---HFETPIWIERVVIIG--AGKPAAVV------LQMEGSPESRLSFQHDPETSVLVLRK  817

Query  166  PNVRVGDDWSIKI  128
            P V V  DWSI +
Sbjct  818  PGVNVASDWSIHL  830



>gb|EDL79939.1| rCG26875 [Rattus norvegicus]
Length=653

 Score =   127 bits (319),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 110/198 (56%), Gaps = 9/198 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPG-DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +   +   + V+LPG ++ WY+ ++   +KGG   K+    ++IP FQR G+++P K
Sbjct  462  VHPVTAPQTTMIDVFLPGSNEVWYNSKTFAYWKGGCAVKVPVTLDTIPVFQRGGSVVPVK  521

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDF-KQGAYIHRRFIFSAGTLT  362
                +S+  M + PY L +ALN+  +A GELY+DDG SF +  Q  ++HR+F+F +  LT
Sbjct  522  TTVGKSTGWMTDSPYGLRVALNTQGSAVGELYLDDGHSFQYLHQNQFLHRKFLFCSSVLT  581

Query  361  SLNLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSV  182
            +   + +     + S C VE+I++LGL + P S      + KV+    P           
Sbjct  582  N---RCADEKGHYPSKCIVEQILVLGLKKKPSSVTTHSSDGKVQ----PATFAYCAKTCT  634

Query  181  LTIRKPNVRVGDDWSIKI  128
            L+++K ++ VGDDW + +
Sbjct  635  LSLKKLSLSVGDDWEVHV  652



>ref|XP_002799568.1| PREDICTED: neutral alpha-glucosidase AB-like [Macaca mulatta]
Length=830

 Score =   128 bits (321),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 107/190 (56%), Gaps = 10/190 (5%)
 Frame = -1

Query  691  AKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSST  515
            A  V VYLPG  + WYD++S   + G  T  L     SIP FQR GTI+PR  R RRSS 
Sbjct  648  AHGVQVYLPGQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRRSSE  707

Query  514  QMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLTSLNLKPSS  338
             M++DP TL +AL+    AEGEL++DDG +F+++ +  ++ RRF+FS  TL S +  P  
Sbjct  708  CMKDDPITLFVALSPQGTAEGELFLDDGHTFNYETRQEFLLRRFLFSGNTLVSSSADPEG  767

Query  337  GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNV  158
                F +   +ER++++G  +   + L   G+ +       L  +     SVL +RKP +
Sbjct  768  ---HFETPIWIERVVIIGAGKPAAAVLQTKGSPESR-----LSFQHDPETSVLVLRKPGI  819

Query  157  RVGDDWSIKI  128
             V  DWSI +
Sbjct  820  NVASDWSIHL  829



>ref|XP_004621565.1| PREDICTED: neutral alpha-glucosidase AB isoform X3 [Sorex araneus]
Length=853

 Score =   128 bits (321),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 75/193 (39%), Positives = 110/193 (57%), Gaps = 16/193 (8%)
 Frame = -1

Query  691  AKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSST  515
            A  V +YLPG  + WYD+++   Y G  T  L     +IP FQR GTI+ R  R RRSS 
Sbjct  671  AHGVQIYLPGQGEVWYDMQTHQKYHGPQTLYLPVTLSTIPVFQRGGTIVARWMRVRRSSA  730

Query  514  QMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLTSLNLKPSS  338
             M++DP TL +AL+    A+GEL++DDG SF+++ Q A++ RRF F+  TL S +  P  
Sbjct  731  CMKDDPLTLFVALSPQGTAQGELFLDDGHSFNYQNQHAFLLRRFSFAGNTLVSSSADPQG  790

Query  337  GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGP---LLLRESQGPSVLTIRK  167
                F +   +ER++++G   G  +A+V      +++E  P   L  +     SVL +RK
Sbjct  791  ---HFETPIWIERVVIIG--AGKPAAVV------LQMEGSPESRLSFQHDPETSVLVLRK  839

Query  166  PNVRVGDDWSIKI  128
            P V V  DWSI +
Sbjct  840  PGVNVASDWSIHL  852



>ref|XP_004621566.1| PREDICTED: neutral alpha-glucosidase AB isoform X4 [Sorex araneus]
Length=846

 Score =   128 bits (321),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 75/193 (39%), Positives = 110/193 (57%), Gaps = 16/193 (8%)
 Frame = -1

Query  691  AKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSST  515
            A  V +YLPG  + WYD+++   Y G  T  L     +IP FQR GTI+ R  R RRSS 
Sbjct  664  AHGVQIYLPGQGEVWYDMQTHQKYHGPQTLYLPVTLSTIPVFQRGGTIVARWMRVRRSSA  723

Query  514  QMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLTSLNLKPSS  338
             M++DP TL +AL+    A+GEL++DDG SF+++ Q A++ RRF F+  TL S +  P  
Sbjct  724  CMKDDPLTLFVALSPQGTAQGELFLDDGHSFNYQNQHAFLLRRFSFAGNTLVSSSADPQG  783

Query  337  GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGP---LLLRESQGPSVLTIRK  167
                F +   +ER++++G   G  +A+V      +++E  P   L  +     SVL +RK
Sbjct  784  ---HFETPIWIERVVIIG--AGKPAAVV------LQMEGSPESRLSFQHDPETSVLVLRK  832

Query  166  PNVRVGDDWSIKI  128
            P V V  DWSI +
Sbjct  833  PGVNVASDWSIHL  845



>ref|XP_002799567.1| PREDICTED: neutral alpha-glucosidase AB-like [Macaca mulatta]
Length=852

 Score =   128 bits (321),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 107/190 (56%), Gaps = 10/190 (5%)
 Frame = -1

Query  691  AKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSST  515
            A  V VYLPG  + WYD++S   + G  T  L     SIP FQR GTI+PR  R RRSS 
Sbjct  670  AHGVQVYLPGQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRRSSE  729

Query  514  QMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLTSLNLKPSS  338
             M++DP TL +AL+    AEGEL++DDG +F+++ +  ++ RRF+FS  TL S +  P  
Sbjct  730  CMKDDPITLFVALSPQGTAEGELFLDDGHTFNYETRQEFLLRRFLFSGNTLVSSSADPEG  789

Query  337  GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNV  158
                F +   +ER++++G  +   + L   G+ +       L  +     SVL +RKP +
Sbjct  790  ---HFETPIWIERVVIIGAGKPAAAVLQTKGSPESR-----LSFQHDPETSVLVLRKPGI  841

Query  157  RVGDDWSIKI  128
             V  DWSI +
Sbjct  842  NVASDWSIHL  851



>ref|XP_001116364.1| PREDICTED: neutral alpha-glucosidase AB-like isoform 1 [Macaca 
mulatta]
Length=847

 Score =   128 bits (321),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 107/190 (56%), Gaps = 10/190 (5%)
 Frame = -1

Query  691  AKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSST  515
            A  V VYLPG  + WYD++S   + G  T  L     SIP FQR GTI+PR  R RRSS 
Sbjct  665  AHGVQVYLPGQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRRSSE  724

Query  514  QMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLTSLNLKPSS  338
             M++DP TL +AL+    AEGEL++DDG +F+++ +  ++ RRF+FS  TL S +  P  
Sbjct  725  CMKDDPITLFVALSPQGTAEGELFLDDGHTFNYETRQEFLLRRFLFSGNTLVSSSADPEG  784

Query  337  GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNV  158
                F +   +ER++++G  +   + L   G+ +       L  +     SVL +RKP +
Sbjct  785  ---HFETPIWIERVVIIGAGKPAAAVLQTKGSPESR-----LSFQHDPETSVLVLRKPGI  836

Query  157  RVGDDWSIKI  128
             V  DWSI +
Sbjct  837  NVASDWSIHL  846



>ref|XP_004621564.1| PREDICTED: neutral alpha-glucosidase AB isoform X2 [Sorex araneus]
Length=945

 Score =   128 bits (321),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 75/193 (39%), Positives = 110/193 (57%), Gaps = 16/193 (8%)
 Frame = -1

Query  691  AKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSST  515
            A  V +YLPG  + WYD+++   Y G  T  L     +IP FQR GTI+ R  R RRSS 
Sbjct  763  AHGVQIYLPGQGEVWYDMQTHQKYHGPQTLYLPVTLSTIPVFQRGGTIVARWMRVRRSSA  822

Query  514  QMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLTSLNLKPSS  338
             M++DP TL +AL+    A+GEL++DDG SF+++ Q A++ RRF F+  TL S +  P  
Sbjct  823  CMKDDPLTLFVALSPQGTAQGELFLDDGHSFNYQNQHAFLLRRFSFAGNTLVSSSADPQG  882

Query  337  GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGP---LLLRESQGPSVLTIRK  167
                F +   +ER++++G   G  +A+V      +++E  P   L  +     SVL +RK
Sbjct  883  ---HFETPIWIERVVIIG--AGKPAAVV------LQMEGSPESRLSFQHDPETSVLVLRK  931

Query  166  PNVRVGDDWSIKI  128
            P V V  DWSI +
Sbjct  932  PGVNVASDWSIHL  944



>ref|XP_004621563.1| PREDICTED: neutral alpha-glucosidase AB isoform X1 [Sorex araneus]
Length=967

 Score =   128 bits (321),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 75/193 (39%), Positives = 110/193 (57%), Gaps = 16/193 (8%)
 Frame = -1

Query  691  AKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSST  515
            A  V +YLPG  + WYD+++   Y G  T  L     +IP FQR GTI+ R  R RRSS 
Sbjct  785  AHGVQIYLPGQGEVWYDMQTHQKYHGPQTLYLPVTLSTIPVFQRGGTIVARWMRVRRSSA  844

Query  514  QMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLTSLNLKPSS  338
             M++DP TL +AL+    A+GEL++DDG SF+++ Q A++ RRF F+  TL S +  P  
Sbjct  845  CMKDDPLTLFVALSPQGTAQGELFLDDGHSFNYQNQHAFLLRRFSFAGNTLVSSSADPQG  904

Query  337  GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGP---LLLRESQGPSVLTIRK  167
                F +   +ER++++G   G  +A+V      +++E  P   L  +     SVL +RK
Sbjct  905  ---HFETPIWIERVVIIG--AGKPAAVV------LQMEGSPESRLSFQHDPETSVLVLRK  953

Query  166  PNVRVGDDWSIKI  128
            P V V  DWSI +
Sbjct  954  PGVNVASDWSIHL  966



>ref|XP_005771424.1| hypothetical protein EMIHUDRAFT_419333 [Emiliania huxleyi CCMP1516]
 ref|XP_005780928.1| hypothetical protein EMIHUDRAFT_415505 [Emiliania huxleyi CCMP1516]
 gb|EOD18995.1| hypothetical protein EMIHUDRAFT_419333 [Emiliania huxleyi CCMP1516]
 gb|EOD28499.1| hypothetical protein EMIHUDRAFT_415505 [Emiliania huxleyi CCMP1516]
Length=713

 Score =   127 bits (319),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 115/197 (58%), Gaps = 9/197 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKD  536
            V+ +  + A    VYLPG Q WY +R GT +    T  +EA   ++P FQR G+I+PR+ 
Sbjct  525  VRPVTQQGATSAPVYLPGSQPWYAVRDGTKHAAPATPTVEAPLGAVPVFQRGGSILPRQM  584

Query  535  RFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSL  356
            R RR+S+ M+ DPYTLV+A ++  AA G LY+D G  F++  GAY  RR+  +AG LTS 
Sbjct  585  RLRRASSLMKLDPYTLVVAPDADGAAAGTLYLDAGDGFEYLDGAYAERRYELAAGVLTST  644

Query  355  NLKPSSGSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLT  176
             +     S  F+    +ER+ LLG ++ P   L+E G    E+E       E+ G +V  
Sbjct  645  AVH---ASDAFTPPNMLERLELLG-TKPPGKVLLESGGETRELEA---TWSEATGRTV--  695

Query  175  IRKPNVRVGDDWSIKIL  125
            +RKP V +  DW+I+++
Sbjct  696  VRKPGVPMAADWTIRLV  712



>ref|XP_001116402.1| PREDICTED: neutral alpha-glucosidase AB-like isoform 4 [Macaca 
mulatta]
Length=944

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 107/190 (56%), Gaps = 10/190 (5%)
 Frame = -1

Query  691  AKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSST  515
            A  V VYLPG  + WYD++S   + G  T  L     SIP FQR GTI+PR  R RRSS 
Sbjct  762  AHGVQVYLPGQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRRSSE  821

Query  514  QMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLTSLNLKPSS  338
             M++DP TL +AL+    AEGEL++DDG +F+++ +  ++ RRF+FS  TL S +  P  
Sbjct  822  CMKDDPITLFVALSPQGTAEGELFLDDGHTFNYETRQEFLLRRFLFSGNTLVSSSADPEG  881

Query  337  GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNV  158
                F +   +ER++++G  +   + L   G+ +       L  +     SVL +RKP +
Sbjct  882  ---HFETPIWIERVVIIGAGKPAAAVLQTKGSPESR-----LSFQHDPETSVLVLRKPGI  933

Query  157  RVGDDWSIKI  128
             V  DWSI +
Sbjct  934  NVASDWSIHL  943



>ref|NP_001181640.1| neutral alpha-glucosidase AB precursor [Macaca mulatta]
 gb|EHH22780.1| hypothetical protein EGK_06108 [Macaca mulatta]
Length=966

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 107/190 (56%), Gaps = 10/190 (5%)
 Frame = -1

Query  691  AKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSST  515
            A  V VYLPG  + WYD++S   + G  T  L     SIP FQR GTI+PR  R RRSS 
Sbjct  784  AHGVQVYLPGQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRRSSE  843

Query  514  QMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLTSLNLKPSS  338
             M++DP TL +AL+    AEGEL++DDG +F+++ +  ++ RRF+FS  TL S +  P  
Sbjct  844  CMKDDPITLFVALSPQGTAEGELFLDDGHTFNYETRQEFLLRRFLFSGNTLVSSSADPEG  903

Query  337  GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNV  158
                F +   +ER++++G  +   + L   G+ +       L  +     SVL +RKP +
Sbjct  904  ---HFETPIWIERVVIIGAGKPAAAVLQTKGSPESR-----LSFQHDPETSVLVLRKPGI  955

Query  157  RVGDDWSIKI  128
             V  DWSI +
Sbjct  956  NVASDWSIHL  965



>gb|KEF54650.1| alpha 1,3-glucosidase [Exophiala aquamarina CBS 119918]
Length=981

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 118/205 (58%), Gaps = 10/205 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGG-LTHKLEALEESIPAFQRAGTIIPRK  539
            V+ +  E  + V +YL  +++++D    T Y GG  THK+ A  E +P   + G IIPRK
Sbjct  768  VKPVTREGEESVDIYLSDEENYFDYFDYTVYSGGSKTHKIAAPLEKLPILMQGGHIIPRK  827

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
            DR R+SS  M+ DPYTLV+ L+ +  A+G +Y+DDG +FD++QGAY+HR+  FS   LTS
Sbjct  828  DRPRKSSGLMKWDPYTLVVVLSKTGEADGTIYVDDGETFDYQQGAYVHRQLAFSNNQLTS  887

Query  358  LNLKPSSGSKKFS-----SDCTVERIILLGL-SEGPKSALVEPGNNKVEVEKGPLLLRES  197
             N+  + GSK  S      +  VE+II++   +    S  V    ++ +  K  L    +
Sbjct  888  SNIG-TKGSKTASYLKTIQEVKVEKIIIVNAPATWAASTDVAVSQDQSQDAKVDLNYHAA  946

Query  196  QG--PSVLTIRKPNVRVGDDWSIKI  128
             G   +   +R+P+V++G DWSI  
Sbjct  947  VGGKAAWAVVRRPDVKIGADWSINF  971



>dbj|GAM21733.1| hypothetical protein SAMD00019534_049080, partial [Acytostelium 
subglobosum LB1]
Length=892

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 112/190 (59%), Gaps = 15/190 (8%)
 Frame = -1

Query  691  AKHVSVYLPG--DQSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSS  518
            AK   V LPG   Q+WYD+ +   Y          L++ IP +QR GTI+P+K+R R S+
Sbjct  715  AKTTRVMLPGGDTQTWYDIDTLKRYFACHMEVATPLDK-IPVYQRGGTIVPKKERVRPST  773

Query  517  TQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTSLNLKPSS  338
              M +DPYTLV+AL+++Q A GELYIDDG SFD+++G Y++R F+++ G + S ++  S+
Sbjct  774  KHMVDDPYTLVVALSATQQARGELYIDDGHSFDYQKGQYLYRSFVYNHGKIQSSSMDNSA  833

Query  337  GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNV  158
              K  S   TVERI+++G+ + P S   E  N   E ++  L          LTI K  +
Sbjct  834  VYKPAS---TVERIVVMGVDKRPSSVTREGHNLPFEYDRTML---------KLTIDKLYI  881

Query  157  RVGDDWSIKI  128
             +  +W I++
Sbjct  882  PISSNWLIEV  891



>ref|XP_006214918.1| PREDICTED: neutral alpha-glucosidase AB isoform X3 [Vicugna pacos]
Length=851

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 108/190 (57%), Gaps = 11/190 (6%)
 Frame = -1

Query  691  AKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSST  515
            A  V VYLPG  + WYD++S   + G  T  L     SIP FQR GTI+PR  R RRSS 
Sbjct  670  AHGVQVYLPGQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRRSSD  729

Query  514  QMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLTSLNLKPSS  338
             M+NDP TL +AL+    A+GEL++DDG +F+++ +  ++ RRF FS  TL S +  P  
Sbjct  730  CMKNDPITLFVALSLQGTAQGELFLDDGHTFNYETRHEFLLRRFSFSGNTLVSSSADPKG  789

Query  337  GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNV  158
                F +   +ER++++G  + P S +++      E  +  L  +     SVL +RKP V
Sbjct  790  ---HFETPIWIERVVIIGAGK-PASVVLQ-----TEGSESRLSFQHDPETSVLILRKPGV  840

Query  157  RVGDDWSIKI  128
             V  DWSI +
Sbjct  841  NVASDWSIHL  850



>ref|NP_999069.1| neutral alpha-glucosidase AB precursor [Sus scrofa]
 sp|P79403.1|GANAB_PIG RecName: Full=Neutral alpha-glucosidase AB; AltName: Full=Alpha-glucosidase 
2; AltName: Full=Glucosidase II subunit alpha; 
Flags: Precursor [Sus scrofa]
 gb|AAB49757.1| glucosidase II [Sus scrofa]
Length=944

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/199 (39%), Positives = 108/199 (54%), Gaps = 12/199 (6%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +    A  V VYLPG  + WYD+ S   Y G  T  L     SIP FQR GTI+PR 
Sbjct  754  VHPVTDSEAHGVQVYLPGQGEVWYDVHSYQKYHGPQTLYLPVTLSSIPVFQRGGTIVPRW  813

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQG-AYIHRRFIFSAGTLT  362
             R RRSS  M++DP TL +AL+    A+GEL++DDG +F+++ G  ++ RRF FS  TL 
Sbjct  814  MRVRRSSDCMKDDPITLFVALSPQGTAQGELFLDDGHTFNYQTGHEFLLRRFSFSGNTLV  873

Query  361  SLNLKPSSGSK-KFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPS  185
            S     S+ SK  F +   +ER++++G  +     L   G+ +       L  +     S
Sbjct  874  S----SSADSKGHFETPVWIERVVIIGAGKPATVVLQTKGSPESR-----LSFQHDPETS  924

Query  184  VLTIRKPNVRVGDDWSIKI  128
            VL +RKP V V  DWSI +
Sbjct  925  VLILRKPGVNVASDWSIHL  943



>ref|XP_007728474.1| alpha 1,3-glucosidase [Capronia epimyces CBS 606.96]
 gb|EXJ91584.1| alpha 1,3-glucosidase [Capronia epimyces CBS 606.96]
Length=951

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/204 (37%), Positives = 110/204 (54%), Gaps = 11/204 (5%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGDQSWYDLRSGTAYKGG-LTHKLEALEESIPAFQRAGTIIPRK  539
            V+ + TE A+ V +YL  D++++D    T Y GG   HK++A    +P   + G IIPRK
Sbjct  737  VKPVTTEGAESVDIYLSDDENYFDYFDYTIYSGGSKIHKVDAPLHKLPILMQGGHIIPRK  796

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQGAYIHRRFIFSAGTLTS  359
            DR R+SS  M+ DPYTLV+ L+    AEG +Y+DDG +FD++ GAYIHRRF  S G L S
Sbjct  797  DRPRKSSGLMKWDPYTLVVVLDKKGEAEGTVYVDDGETFDYQHGAYIHRRFSLSGGVLRS  856

Query  358  LNLKPSSGSK-----KFSSDCTVERIILLG----LSEGPKSALVEPGNNKVEVEKGPLLL  206
             ++  + GSK     K   D  VE+II++      S   ++ + E G       +     
Sbjct  857  SDIG-TKGSKTASYLKTMKDVKVEKIIVVNAPAEWSTYTEATVTEEGTKGTSTAELSFHS  915

Query  205  RESQGPSVLTIRKPNVRVGDDWSI  134
                  +   +R P +R+G  W I
Sbjct  916  ASGNKAAWAVVRSPGIRIGGVWGI  939



>ref|XP_005660830.1| PREDICTED: neutral alpha-glucosidase AB isoform X2 [Sus scrofa]
Length=852

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/199 (39%), Positives = 108/199 (54%), Gaps = 12/199 (6%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +    A  V VYLPG  + WYD+ S   Y G  T  L     SIP FQR GTI+PR 
Sbjct  662  VHPVTDSEAHGVQVYLPGQGEVWYDVHSYQKYHGPQTLYLPVTLSSIPVFQRGGTIVPRW  721

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQG-AYIHRRFIFSAGTLT  362
             R RRSS  M++DP TL +AL+    A+GEL++DDG +F+++ G  ++ RRF FS  TL 
Sbjct  722  MRVRRSSDCMKDDPITLFVALSPQGTAQGELFLDDGHTFNYQTGHEFLLRRFSFSGNTLV  781

Query  361  SLNLKPSSGSK-KFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPS  185
            S     S+ SK  F +   +ER++++G  +     L   G+ +       L  +     S
Sbjct  782  S----SSADSKGHFETPVWIERVVIIGAGKPATVVLQTKGSPESR-----LSFQHDPETS  832

Query  184  VLTIRKPNVRVGDDWSIKI  128
            VL +RKP V V  DWSI +
Sbjct  833  VLILRKPGVNVASDWSIHL  851



>ref|XP_006214919.1| PREDICTED: neutral alpha-glucosidase AB isoform X4 [Vicugna pacos]
Length=829

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 108/190 (57%), Gaps = 11/190 (6%)
 Frame = -1

Query  691  AKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSST  515
            A  V VYLPG  + WYD++S   + G  T  L     SIP FQR GTI+PR  R RRSS 
Sbjct  648  AHGVQVYLPGQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRRSSD  707

Query  514  QMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLTSLNLKPSS  338
             M+NDP TL +AL+    A+GEL++DDG +F+++ +  ++ RRF FS  TL S +  P  
Sbjct  708  CMKNDPITLFVALSLQGTAQGELFLDDGHTFNYETRHEFLLRRFSFSGNTLVSSSADPKG  767

Query  337  GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNV  158
                F +   +ER++++G  + P S +++      E  +  L  +     SVL +RKP V
Sbjct  768  ---HFETPIWIERVVIIGAGK-PASVVLQ-----TEGSESRLSFQHDPETSVLILRKPGV  818

Query  157  RVGDDWSIKI  128
             V  DWSI +
Sbjct  819  NVASDWSIHL  828



>ref|XP_010954731.1| PREDICTED: neutral alpha-glucosidase AB isoform X2 [Camelus bactrianus]
 ref|XP_010981304.1| PREDICTED: neutral alpha-glucosidase AB isoform X2 [Camelus dromedarius]
Length=846

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 108/190 (57%), Gaps = 11/190 (6%)
 Frame = -1

Query  691  AKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSST  515
            A  V VYLPG  + WYD++S   + G  T  L     SIP FQR GTI+PR  R RRSS 
Sbjct  665  AHGVQVYLPGQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRRSSD  724

Query  514  QMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLTSLNLKPSS  338
             M+NDP TL +AL+    A+GEL++DDG +F+++ +  ++ RRF FS  TL S +  P  
Sbjct  725  CMKNDPITLFVALSLQGTAQGELFLDDGHTFNYETRHEFLLRRFSFSGNTLVSSSADPKG  784

Query  337  GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNV  158
                F +   +ER++++G  + P S +++      E  +  L  +     SVL +RKP V
Sbjct  785  ---HFETPIWIERVVIIGAGK-PASVVLQ-----TEGSESRLSFQHDPETSVLILRKPGV  835

Query  157  RVGDDWSIKI  128
             V  DWSI +
Sbjct  836  NVASDWSIHL  845



>ref|XP_006181827.1| PREDICTED: neutral alpha-glucosidase AB isoform X3 [Camelus ferus]
Length=851

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 108/190 (57%), Gaps = 11/190 (6%)
 Frame = -1

Query  691  AKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSST  515
            A  V VYLPG  + WYD++S   + G  T  L     SIP FQR GTI+PR  R RRSS 
Sbjct  670  AHGVQVYLPGQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRRSSD  729

Query  514  QMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLTSLNLKPSS  338
             M+NDP TL +AL+    A+GEL++DDG +F+++ +  ++ RRF FS  TL S +  P  
Sbjct  730  CMKNDPITLFVALSLQGTAQGELFLDDGHTFNYETRHEFLLRRFSFSGNTLVSSSADPKG  789

Query  337  GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNV  158
                F +   +ER++++G  + P S +++      E  +  L  +     SVL +RKP V
Sbjct  790  ---HFETPIWIERVVIIGAGK-PASVVLQ-----TEGSESRLSFQHDPETSVLILRKPGV  840

Query  157  RVGDDWSIKI  128
             V  DWSI +
Sbjct  841  NVASDWSIHL  850



>ref|XP_005660829.1| PREDICTED: neutral alpha-glucosidase AB isoform X1 [Sus scrofa]
Length=966

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/199 (39%), Positives = 108/199 (54%), Gaps = 12/199 (6%)
 Frame = -1

Query  715  VQGIYTERAKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRK  539
            V  +    A  V VYLPG  + WYD+ S   Y G  T  L     SIP FQR GTI+PR 
Sbjct  776  VHPVTDSEAHGVQVYLPGQGEVWYDVHSYQKYHGPQTLYLPVTLSSIPVFQRGGTIVPRW  835

Query  538  DRFRRSSTQMENDPYTLVIALNSSQAAEGELYIDDGRSFDFKQG-AYIHRRFIFSAGTLT  362
             R RRSS  M++DP TL +AL+    A+GEL++DDG +F+++ G  ++ RRF FS  TL 
Sbjct  836  MRVRRSSDCMKDDPITLFVALSPQGTAQGELFLDDGHTFNYQTGHEFLLRRFSFSGNTLV  895

Query  361  SLNLKPSSGSK-KFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPS  185
            S     S+ SK  F +   +ER++++G  +     L   G+ +       L  +     S
Sbjct  896  S----SSADSKGHFETPVWIERVVIIGAGKPATVVLQTKGSPESR-----LSFQHDPETS  946

Query  184  VLTIRKPNVRVGDDWSIKI  128
            VL +RKP V V  DWSI +
Sbjct  947  VLILRKPGVNVASDWSIHL  965



>ref|XP_006156645.1| PREDICTED: neutral alpha-glucosidase AB isoform X2 [Tupaia chinensis]
Length=847

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 105/190 (55%), Gaps = 10/190 (5%)
 Frame = -1

Query  691  AKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSST  515
            A  V +YLPG  + WYD++S   Y G  T  L     SIP FQR GT++PR  R RRSS 
Sbjct  665  AHGVQIYLPGQGEVWYDIQSYQKYHGPQTLYLPVTLSSIPVFQRGGTVVPRWMRVRRSSD  724

Query  514  QMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLTSLNLKPSS  338
             M+NDP TL +AL+    A+GEL++DDG +F+++ +  ++ RRF FS  TL S +  P  
Sbjct  725  CMKNDPITLFVALSPQGTAQGELFLDDGHTFNYQTRHEFLLRRFSFSGNTLVSSSADPKG  784

Query  337  GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNV  158
                F +   +ER++++G  +     L   G+ +       L  +     SVL +RKP V
Sbjct  785  ---HFETPVWIERVVIIGAGKPASVVLQTKGSPESR-----LSFQHDPETSVLILRKPGV  836

Query  157  RVGDDWSIKI  128
             V  DWSI +
Sbjct  837  NVASDWSIHL  846



>ref|XP_006911268.1| PREDICTED: neutral alpha-glucosidase AB isoform X2 [Pteropus 
alecto]
Length=944

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 104/190 (55%), Gaps = 10/190 (5%)
 Frame = -1

Query  691  AKHVSVYLPGD-QSWYDLRSGTAYKGGLTHKLEALEESIPAFQRAGTIIPRKDRFRRSST  515
            A  V VYLPG  + WYD+ S   + G  T  L     SIPAFQR GTIIPR  R RRSS 
Sbjct  762  AHGVQVYLPGQGEVWYDVHSYQKHHGPQTLYLPVTLSSIPAFQRGGTIIPRWMRVRRSSE  821

Query  514  QMENDPYTLVIALNSSQAAEGELYIDDGRSFDFK-QGAYIHRRFIFSAGTLTSLNLKPSS  338
             M+ DP TL +AL+    A+GELY+DDG +F+++ +  ++ RRF FS  TL S +  P  
Sbjct  822  CMKEDPITLFVALSPQGTAQGELYLDDGHTFNYQTRHEFLLRRFSFSGNTLVSSSADPKG  881

Query  337  GSKKFSSDCTVERIILLGLSEGPKSALVEPGNNKVEVEKGPLLLRESQGPSVLTIRKPNV  158
                F +   +ER++++G  +     L   G+ +       L  +     SVL +RKP V
Sbjct  882  ---HFETPVWIERVVIIGAGKPAAVVLQTKGSPESH-----LSFQHDPETSVLILRKPGV  933

Query  157  RVGDDWSIKI  128
             V  DWSI +
Sbjct  934  NVASDWSIHL  943



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1246782646395