BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF013P04

Length=564
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009606590.1|  PREDICTED: 60S ribosomal protein L15               255   1e-82   Nicotiana tomentosiformis
ref|XP_009796395.1|  PREDICTED: 60S ribosomal protein L15-like          255   2e-82   Nicotiana sylvestris
ref|XP_004241917.1|  PREDICTED: 60S ribosomal protein L15               254   3e-82   Solanum lycopersicum
emb|CDP10996.1|  unnamed protein product                                253   4e-82   Coffea canephora [robusta coffee]
ref|XP_004242022.1|  PREDICTED: 60S ribosomal protein L15               254   4e-82   Solanum lycopersicum
ref|XP_002301250.1|  60S ribosomal protein L15                          253   6e-82   Populus trichocarpa [western balsam poplar]
ref|XP_004236901.1|  PREDICTED: 60S ribosomal protein L15-like          252   2e-81   Solanum lycopersicum
ref|XP_006369001.1|  60S ribosomal protein L15                          251   4e-81   Populus trichocarpa [western balsam poplar]
ref|XP_011017435.1|  PREDICTED: 60S ribosomal protein L15-like          252   5e-81   Populus euphratica
sp|O82528.1|RL15_PETHY  RecName: Full=60S ribosomal protein L15         248   6e-80   Petunia x hybrida [garden petunia]
ref|XP_009764605.1|  PREDICTED: 60S ribosomal protein L15-like          248   1e-79   Nicotiana sylvestris
ref|XP_009607935.1|  PREDICTED: 60S ribosomal protein L15-like          248   1e-79   Nicotiana tomentosiformis
ref|XP_009768655.1|  PREDICTED: 60S ribosomal protein L15-like          247   2e-79   Nicotiana sylvestris
ref|XP_002304285.2|  60S ribosomal protein L15                          246   4e-79   Populus trichocarpa [western balsam poplar]
ref|XP_011031911.1|  PREDICTED: 60S ribosomal protein L15 isoform X3    246   4e-79   Populus euphratica
ref|XP_006477158.1|  PREDICTED: 60S ribosomal protein L15-like          246   4e-79   Citrus sinensis [apfelsine]
ref|XP_009618098.1|  PREDICTED: 60S ribosomal protein L15-like          246   5e-79   Nicotiana tomentosiformis
ref|XP_004152395.1|  PREDICTED: 60S ribosomal protein L15-like is...    246   5e-79   
ref|XP_011031909.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    246   5e-79   Populus euphratica
ref|XP_004152396.1|  PREDICTED: 60S ribosomal protein L15-like is...    245   5e-79   
ref|XP_011076388.1|  PREDICTED: 60S ribosomal protein L15-like          246   7e-79   Sesamum indicum [beniseed]
ref|XP_006440278.1|  hypothetical protein CICLE_v10024403mg             246   9e-79   
gb|EPS66678.1|  hypothetical protein M569_08101                         245   9e-79   Genlisea aurea
tpg|DAA40843.1|  TPA: hypothetical protein ZEAMMB73_797426              244   1e-78   
gb|KDO49939.1|  hypothetical protein CISIN_1g028757mg                   244   1e-78   Citrus sinensis [apfelsine]
ref|XP_006490145.1|  PREDICTED: 60S ribosomal protein L15-like          245   1e-78   Citrus sinensis [apfelsine]
ref|XP_007209614.1|  hypothetical protein PRUPE_ppa011603mg             245   1e-78   Prunus persica
gb|KHG00889.1|  60S ribosomal L15                                       245   1e-78   Gossypium arboreum [tree cotton]
gb|EYU24942.1|  hypothetical protein MIMGU_mgv1a013374mg                245   2e-78   Erythranthe guttata [common monkey flower]
gb|EYU43197.1|  hypothetical protein MIMGU_mgv1a012815mg                246   2e-78   Erythranthe guttata [common monkey flower]
gb|ACF88005.1|  unknown                                                 244   2e-78   Zea mays [maize]
ref|XP_010686789.1|  PREDICTED: 60S ribosomal protein L15               244   2e-78   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG22797.1|  60S ribosomal L15-1 -like protein                       244   2e-78   Gossypium arboreum [tree cotton]
ref|XP_006421625.1|  hypothetical protein CICLE_v10005611mg             246   3e-78   
ref|XP_011069801.1|  PREDICTED: 60S ribosomal protein L15               244   3e-78   Sesamum indicum [beniseed]
emb|CDP11952.1|  unnamed protein product                                243   3e-78   Coffea canephora [robusta coffee]
ref|XP_011001078.1|  PREDICTED: 60S ribosomal protein L15-like          243   5e-78   Populus euphratica
ref|XP_007038342.1|  Ribosomal protein L23/L15e family protein          243   5e-78   
ref|XP_011080625.1|  PREDICTED: 60S ribosomal protein L15-like          243   5e-78   Sesamum indicum [beniseed]
ref|XP_011076387.1|  PREDICTED: 60S ribosomal protein L15-like          243   5e-78   Sesamum indicum [beniseed]
ref|XP_004146916.1|  PREDICTED: 60S ribosomal protein L15-like is...    243   8e-78   Cucumis sativus [cucumbers]
ref|XP_010933963.1|  PREDICTED: 60S ribosomal protein L15-like          243   8e-78   Elaeis guineensis
ref|XP_008437057.1|  PREDICTED: 60S ribosomal protein L15-2 isofo...    242   1e-77   Cucumis melo [Oriental melon]
ref|NP_001148602.1|  60S ribosomal protein L15                          242   1e-77   Zea mays [maize]
ref|XP_007157273.1|  hypothetical protein PHAVU_002G057000g             242   1e-77   Phaseolus vulgaris [French bean]
ref|NP_001150386.1|  60S ribosomal protein L15                          242   2e-77   Zea mays [maize]
ref|XP_008437056.1|  PREDICTED: 60S ribosomal protein L15-2 isofo...    242   2e-77   
gb|EPS59253.1|  hypothetical protein M569_15555                         241   3e-77   Genlisea aurea
gb|EMS53506.1|  60S ribosomal protein L15                               240   4e-77   Triticum urartu
gb|EMT18644.1|  60S ribosomal protein L15                               240   4e-77   
gb|KDP39891.1|  hypothetical protein JCGZ_03422                         241   4e-77   Jatropha curcas
gb|AAT85124.1|  putative 60s ribosomal protein L15                      240   4e-77   Oryza sativa Japonica Group [Japonica rice]
pdb|3J61|N  Chain N, Localization Of The Large Subunit Ribosomal ...    241   5e-77   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009352987.1|  PREDICTED: 60S ribosomal protein L15-like          241   5e-77   Pyrus x bretschneideri [bai li]
ref|NP_001050612.1|  Os03g0598800                                       241   5e-77   
ref|XP_006650289.1|  PREDICTED: 60S ribosomal protein L15-like          241   6e-77   Oryza brachyantha
dbj|BAJ95856.1|  predicted protein                                      241   6e-77   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003573847.1|  PREDICTED: 60S ribosomal protein L15-2             240   7e-77   Brachypodium distachyon [annual false brome]
ref|XP_006655163.1|  PREDICTED: 60S ribosomal protein L15-like          240   1e-76   
ref|XP_008452210.1|  PREDICTED: 60S ribosomal protein L15-2-like        240   1e-76   Cucumis melo [Oriental melon]
ref|XP_007202591.1|  hypothetical protein PRUPE_ppa011597mg             239   2e-76   Prunus persica
tpg|DAA40844.1|  TPA: hypothetical protein ZEAMMB73_797426              238   2e-76   
ref|XP_002510977.1|  ribosomal protein L15, putative                    239   2e-76   Ricinus communis
dbj|BAD22764.1|  ribosomal protein                                      239   2e-76   Bromus inermis [awnless brome grass]
tpg|DAA62721.1|  TPA: hypothetical protein ZEAMMB73_667917              239   2e-76   
gb|EMT29287.1|  60S ribosomal protein L15                               241   2e-76   
ref|XP_010667037.1|  PREDICTED: 60S ribosomal protein L15-1             239   2e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008241281.1|  PREDICTED: 60S ribosomal protein L15-like          239   2e-76   Prunus mume [ume]
ref|NP_001150716.1|  60S ribosomal protein L15                          239   2e-76   Zea mays [maize]
ref|XP_010538411.1|  PREDICTED: 60S ribosomal protein L15-1-like        239   3e-76   Tarenaya hassleriana [spider flower]
ref|XP_010539086.1|  PREDICTED: 60S ribosomal protein L15-1-like        238   4e-76   Tarenaya hassleriana [spider flower]
gb|KDP22442.1|  hypothetical protein JCGZ_26273                         238   4e-76   Jatropha curcas
ref|XP_010540825.1|  PREDICTED: 60S ribosomal protein L15-1-like        238   5e-76   Tarenaya hassleriana [spider flower]
gb|KJB51845.1|  hypothetical protein B456_008G234000                    236   5e-76   Gossypium raimondii
gb|KCW90852.1|  hypothetical protein EUGRSUZ_A02903                     237   5e-76   Eucalyptus grandis [rose gum]
gb|AAK67641.1|  ribosomal protein L15                                   238   5e-76   Homo sapiens [man]
ref|XP_010053499.1|  PREDICTED: 60S ribosomal protein L15-2             238   6e-76   Eucalyptus grandis [rose gum]
ref|XP_008369443.1|  PREDICTED: 60S ribosomal protein L15-1             239   7e-76   
ref|XP_009334550.1|  PREDICTED: 60S ribosomal protein L15-1             239   8e-76   Pyrus x bretschneideri [bai li]
emb|CAN68893.1|  hypothetical protein VITISV_004609                     238   9e-76   Vitis vinifera
emb|CBI38664.3|  unnamed protein product                                237   1e-75   Vitis vinifera
gb|EMS52882.1|  60S ribosomal protein L15                               240   1e-75   Triticum urartu
ref|NP_001148378.1|  60S ribosomal protein L15                          238   1e-75   Zea mays [maize]
ref|XP_002460708.1|  hypothetical protein SORBIDRAFT_02g033530          238   1e-75   Sorghum bicolor [broomcorn]
gb|KHG16565.1|  60S ribosomal L15-1 -like protein                       238   1e-75   Gossypium arboreum [tree cotton]
ref|XP_002268465.1|  PREDICTED: 60S ribosomal protein L15-1-like        237   1e-75   Vitis vinifera
gb|KHG20796.1|  60S ribosomal L15-1 -like protein                       237   1e-75   Gossypium arboreum [tree cotton]
gb|KJB39740.1|  hypothetical protein B456_007G028600                    236   1e-75   Gossypium raimondii
gb|KJB51842.1|  hypothetical protein B456_008G234000                    237   2e-75   Gossypium raimondii
ref|XP_007155679.1|  hypothetical protein PHAVU_003G222000g             237   2e-75   Phaseolus vulgaris [French bean]
ref|XP_010933636.1|  PREDICTED: 60S ribosomal protein L15-1             237   2e-75   Elaeis guineensis
gb|KCW90850.1|  hypothetical protein EUGRSUZ_A02903                     236   2e-75   Eucalyptus grandis [rose gum]
gb|EEE63068.1|  hypothetical protein OsJ_17876                          243   2e-75   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010062398.1|  PREDICTED: 60S ribosomal protein L15-1             236   3e-75   Eucalyptus grandis [rose gum]
ref|NP_001235890.1|  uncharacterized protein LOC100305473               236   3e-75   Glycine max [soybeans]
gb|ACF87670.1|  unknown                                                 236   3e-75   Zea mays [maize]
ref|XP_003563105.1|  PREDICTED: 60S ribosomal protein L15-2             236   3e-75   Brachypodium distachyon [annual false brome]
ref|XP_010107162.1|  60S ribosomal protein L15                          236   3e-75   Morus notabilis
ref|XP_002530661.1|  ribosomal protein L15, putative                    236   3e-75   Ricinus communis
gb|EEC78893.1|  hypothetical protein OsI_19264                          242   4e-75   Oryza sativa Indica Group [Indian rice]
gb|KHN44085.1|  60S ribosomal protein L15                               236   4e-75   Glycine soja [wild soybean]
gb|AGL08210.1|  60S ribosomal protein L15                               236   4e-75   Arachis hypogaea [goober]
gb|ACU24496.1|  unknown                                                 236   5e-75   Glycine max [soybeans]
ref|XP_002461521.1|  hypothetical protein SORBIDRAFT_02g004020          236   5e-75   Sorghum bicolor [broomcorn]
ref|XP_003549922.1|  PREDICTED: 60S ribosomal protein L15-1-like        235   7e-75   
ref|XP_007039793.1|  Ribosomal protein L23/L15e family protein is...    235   9e-75   Theobroma cacao [chocolate]
gb|ACV50439.1|  ribosomal protein L15                                   235   1e-74   Jatropha curcas
ref|XP_007039791.1|  Ribosomal protein L23/L15e family protein is...    235   1e-74   
ref|XP_010919628.1|  PREDICTED: 60S ribosomal protein L15 isoform X2    234   1e-74   
ref|XP_008234416.1|  PREDICTED: 60S ribosomal protein L15-like          235   1e-74   Prunus mume [ume]
ref|XP_010919627.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    235   1e-74   Elaeis guineensis
ref|XP_002277836.1|  PREDICTED: 60S ribosomal protein L15-1             234   1e-74   Vitis vinifera
emb|CBI16601.3|  unnamed protein product                                234   1e-74   Vitis vinifera
ref|XP_008798983.1|  PREDICTED: 60S ribosomal protein L15-like          234   2e-74   Phoenix dactylifera
ref|XP_010529971.1|  PREDICTED: 60S ribosomal protein L15-1             234   2e-74   Tarenaya hassleriana [spider flower]
ref|XP_008775187.1|  PREDICTED: 60S ribosomal protein L15               234   2e-74   Phoenix dactylifera
ref|NP_001236804.1|  uncharacterized protein LOC100306052               234   2e-74   
ref|XP_010934657.1|  PREDICTED: 60S ribosomal protein L15-1-like        234   3e-74   Elaeis guineensis
ref|XP_008796124.1|  PREDICTED: 60S ribosomal protein L15-2             233   5e-74   Phoenix dactylifera
ref|XP_010104882.1|  60S ribosomal protein L15                          234   5e-74   
emb|CBI25842.3|  unnamed protein product                                233   6e-74   Vitis vinifera
ref|XP_003635402.1|  PREDICTED: 60S ribosomal protein L15-1             233   6e-74   Vitis vinifera
ref|XP_004955579.1|  PREDICTED: 60S ribosomal protein L15-1-like ...    233   9e-74   Setaria italica
ref|XP_010264371.1|  PREDICTED: 60S ribosomal protein L15-like          233   9e-74   Nelumbo nucifera [Indian lotus]
ref|XP_009406701.1|  PREDICTED: 60S ribosomal protein L15-1-like        232   2e-73   Musa acuminata subsp. malaccensis [pisang utan]
sp|O65050.1|RL15A_PICMA  RecName: Full=60S ribosomal protein L15-1      231   2e-73   Picea mariana [black spruce]
ref|XP_010539199.1|  PREDICTED: 60S ribosomal protein L15-1-like        231   2e-73   Tarenaya hassleriana [spider flower]
ref|XP_009398340.1|  PREDICTED: 60S ribosomal protein L15-1-like        231   3e-73   Musa acuminata subsp. malaccensis [pisang utan]
sp|O65082.1|RL15B_PICMA  RecName: Full=60S ribosomal protein L15-2      231   3e-73   Picea mariana [black spruce]
ref|XP_004957717.1|  PREDICTED: 60S ribosomal protein L15-1-like        231   3e-73   Setaria italica
ref|XP_009399011.1|  PREDICTED: 60S ribosomal protein L15-1-like        231   3e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004491939.1|  PREDICTED: 60S ribosomal protein L15-1-like ...    231   3e-73   Cicer arietinum [garbanzo]
ref|XP_009418976.1|  PREDICTED: 60S ribosomal protein L15-1             231   4e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006837338.1|  hypothetical protein AMTR_s00111p00086580          231   4e-73   Amborella trichopoda
ref|XP_004491938.1|  PREDICTED: 60S ribosomal protein L15-1-like ...    231   4e-73   
ref|XP_010258850.1|  PREDICTED: 60S ribosomal protein L15               231   5e-73   Nelumbo nucifera [Indian lotus]
ref|XP_008360544.1|  PREDICTED: 60S ribosomal protein L15               230   7e-73   
ref|XP_009408522.1|  PREDICTED: 60S ribosomal protein L15-1-like        230   8e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004512167.1|  PREDICTED: 60S ribosomal protein L15-1-like        230   1e-72   Cicer arietinum [garbanzo]
ref|XP_006837287.1|  hypothetical protein AMTR_s00111p00023340          230   2e-72   
ref|XP_006838929.1|  hypothetical protein AMTR_s00002p00270230          229   3e-72   Amborella trichopoda
gb|ACJ84067.1|  unknown                                                 227   1e-71   Medicago truncatula
gb|AFK49215.1|  unknown                                                 227   1e-71   Medicago truncatula
gb|AFK46983.1|  unknown                                                 227   1e-71   Lotus japonicus
gb|ADA67930.1|  putative 60S ribosomal protein L15                      227   2e-71   Wolffia arrhiza
ref|XP_003593619.1|  Ribosomal protein L15                              228   3e-71   Medicago truncatula
ref|XP_002879569.1|  60S ribosomal protein L15                          226   3e-71   Arabidopsis lyrata subsp. lyrata
ref|XP_004299420.1|  PREDICTED: 60S ribosomal protein L15-1             226   5e-71   Fragaria vesca subsp. vesca
emb|CAB10520.1|  ribosomal protein                                      223   5e-70   Arabidopsis thaliana [mouse-ear cress]
emb|CDX76573.1|  BnaA08g08270D                                          223   5e-70   
ref|XP_009108318.1|  PREDICTED: 60S ribosomal protein L15-1-like        223   5e-70   Brassica rapa
emb|CDY09632.1|  BnaC07g34290D                                          222   7e-70   Brassica napus [oilseed rape]
ref|XP_009136839.1|  PREDICTED: 60S ribosomal protein L15-1             223   8e-70   Brassica rapa
emb|CDY59531.1|  BnaCnng35130D                                          222   9e-70   Brassica napus [oilseed rape]
ref|XP_009136806.1|  PREDICTED: 60S ribosomal protein L15-1-like        222   9e-70   Brassica rapa
ref|XP_009145572.1|  PREDICTED: 60S ribosomal protein L15-1             222   9e-70   Brassica rapa
ref|NP_193470.1|  60S ribosomal protein L15-2                           222   9e-70   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193405.1|  60S ribosomal protein L15-1                           222   9e-70   Arabidopsis thaliana [mouse-ear cress]
gb|KFK32179.1|  hypothetical protein AALP_AA6G207900                    222   9e-70   Arabis alpina [alpine rockcress]
emb|CDY53647.1|  BnaA08g30370D                                          223   1e-69   Brassica napus [oilseed rape]
ref|XP_010434676.1|  PREDICTED: 60S ribosomal protein L15-1-like        222   1e-69   Camelina sativa [gold-of-pleasure]
ref|XP_002868106.1|  60S ribosomal protein L15                          222   1e-69   
ref|XP_006282719.1|  hypothetical protein CARUB_v10005752mg             222   1e-69   Capsella rubella
emb|CDX90499.1|  BnaA03g42820D                                          224   1e-69   
emb|CDY60707.1|  BnaC07g50070D                                          224   2e-69   Brassica napus [oilseed rape]
emb|CDY54747.1|  BnaAnng13420D                                          223   2e-69   Brassica napus [oilseed rape]
emb|CDY50842.1|  BnaC08g47880D                                          223   3e-69   Brassica napus [oilseed rape]
emb|CDY40505.1|  BnaC01g20070D                                          224   6e-69   Brassica napus [oilseed rape]
gb|AFK37409.1|  unknown                                                 219   1e-68   Lotus japonicus
ref|XP_001764493.1|  predicted protein                                  219   1e-68   
ref|XP_001753036.1|  predicted protein                                  218   5e-68   
gb|AFK40278.1|  unknown                                                 218   5e-68   Lotus japonicus
ref|XP_001771165.1|  predicted protein                                  218   7e-68   
gb|KDO49937.1|  hypothetical protein CISIN_1g028757mg                   217   8e-68   Citrus sinensis [apfelsine]
ref|XP_001757563.1|  predicted protein                                  215   6e-67   
ref|XP_004955578.1|  PREDICTED: 60S ribosomal protein L15-1-like ...    215   2e-66   
ref|XP_002961462.1|  hypothetical protein SELMODRAFT_270259             211   2e-65   Selaginella moellendorffii
ref|XP_002971348.1|  hypothetical protein SELMODRAFT_270900             209   1e-64   Selaginella moellendorffii
ref|XP_010516773.1|  PREDICTED: 60S ribosomal protein L15-2-like        209   1e-64   
ref|XP_005845356.1|  hypothetical protein CHLNCDRAFT_32281              201   2e-61   Chlorella variabilis
ref|XP_001701780.1|  ribosomal protein L15, component of cytosoli...    201   2e-61   Chlamydomonas reinhardtii
emb|CEG01197.1|  Ribosomal protein L15e, conserved site                 201   3e-61   Ostreococcus tauri
ref|XP_005646118.1|  ribosomal protein L15e                             199   1e-60   Coccomyxa subellipsoidea C-169
gb|AAF67144.1|AF230646_1  large subunit ribosomal protein L15           197   4e-60   Syntrichia ruralis
ref|XP_003056552.1|  predicted protein                                  197   5e-60   Micromonas pusilla CCMP1545
ref|XP_002946380.1|  component of cytosolic 80S ribosome and 60S ...    196   3e-59   Volvox carteri f. nagariensis
ref|XP_001416062.1|  Ribosomal protein L15, component of cytosoli...    194   1e-58   Ostreococcus lucimarinus CCE9901
ref|XP_011401241.1|  60S ribosomal protein L15                          200   2e-58   Auxenochlorella protothecoides
ref|XP_004348091.1|  ribosomal protein L15                              191   2e-57   Capsaspora owczarzaki ATCC 30864
gb|KJB61958.1|  hypothetical protein B456_009G394000                    190   4e-57   Gossypium raimondii
gb|AAC32160.1|  putative 60S ribosomal protein L15                      186   1e-56   Picea mariana [black spruce]
gb|AAC32177.1|  putative 60S ribosomal protein L15                      185   2e-56   Picea mariana [black spruce]
gb|AAF02467.1|AF127450_1  putative 60S ribosomal protein L15            184   6e-56   Picea abies
ref|XP_006470979.1|  PREDICTED: 60S ribosomal protein L15-like          185   1e-55   
ref|XP_957199.1|  60S ribosomal protein L15                             184   5e-55   Neurospora crassa OR74A
gb|ESW97334.1|  60S ribosomal protein L15-B                             184   7e-55   Ogataea parapolymorpha DL-1
ref|XP_004198963.1|  Piso0_002360                                       184   9e-55   
gb|AAT88062.1|  putative 60S ribosomal protein L15                      180   1e-54   Tsuga canadensis
gb|AAC32174.1|  putative 60S ribosomal protein L15                      180   2e-54   Picea mariana [black spruce]
gb|KIX93106.1|  60S ribosomal protein L15                               183   2e-54   Fonsecaea multimorphosa CBS 102226
ref|XP_002553867.1|  60S ribosomal protein L15                          182   3e-54   Lachancea thermotolerans CBS 6340
ref|XP_006822011.1|  PREDICTED: 60S ribosomal protein L15-like is...    182   3e-54   Saccoglossus kowalevskii
ref|XP_717445.1|  likely cytosolic ribosomal protein L15                182   4e-54   
ref|XP_005534852.1|  60S ribosomal protein L15                          182   4e-54   Cyanidioschyzon merolae strain 10D
ref|XP_503229.1|  60S ribosomal protein L15                             182   6e-54   Yarrowia lipolytica CLIB122
gb|AAT88061.1|  putative 60S ribosomal protein L15                      178   7e-54   Abies lasiocarpa [alpine fir]
emb|CEP61029.1|  LALA0S02e05138g1_1                                     182   7e-54   Lachancea lanzarotensis
gb|KIW77490.1|  60S ribosomal protein L15                               182   7e-54   Fonsecaea pedrosoi CBS 271.37
gb|AAT88055.1|  putative 60S ribosomal protein L15                      178   8e-54   Picea glauca
ref|XP_003869213.1|  Rpl15a ribosomal protein                           182   8e-54   Candida orthopsilosis Co 90-125
gb|AAF02466.1|AF127449_1  putative 60S ribosomal protein L15            178   8e-54   Picea abies
gb|AAT88060.1|  putative 60S ribosomal protein L15                      178   8e-54   Picea glauca
gb|EMG48668.1|  Ribosomal protein L15                                   181   1e-53   Candida maltosa Xu316
gb|EFX04788.1|  60S ribosomal protein l15                               181   1e-53   Grosmannia clavigera kw1407
emb|CCE42581.1|  hypothetical protein CPAR2_202240                      181   1e-53   Candida parapsilosis
ref|XP_002797110.1|  60S ribosomal protein L15                          181   1e-53   Paracoccidioides lutzii Pb01
gb|KIW07591.1|  60S ribosomal protein L15                               181   2e-53   Verruconis gallopava
ref|XP_001212942.1|  60S ribosomal protein L15                          181   2e-53   Aspergillus terreus NIH2624
ref|XP_007741637.1|  60S ribosomal protein L15                          181   2e-53   Cladophialophora psammophila CBS 110553
gb|ESZ93952.1|  60S ribosomal protein L15                               180   2e-53   Sclerotinia borealis F-4128
ref|XP_011123288.1|  hypothetical protein AOL_s00081g168                180   3e-53   Arthrobotrys oligospora ATCC 24927
gb|AAT88050.1|  putative 60S ribosomal protein L15                      176   4e-53   Picea mariana [black spruce]
ref|XP_001644954.1|  hypothetical protein Kpol_1025p16                  179   5e-53   Vanderwaltozyma polyspora DSM 70294
gb|KDD73446.1|  ribosomal L15                                           179   6e-53   Helicosporidium sp. ATCC 50920
ref|XP_006690758.1|  ribosomal protein L15-like protein                 179   6e-53   Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_004199814.1|  Piso0_002360                                       179   6e-53   
ref|NP_985761.1|  60S ribosomal protein L15                             179   7e-53   Eremothecium gossypii ATCC 10895
emb|CEI94774.1|  Putative Ribosomal protein L15                         178   8e-53   Rhizopus microsporus
gb|KGQ83010.1|  60S ribosomal protein L15-A                             179   1e-52   Candida albicans P37005
emb|CCK68268.1|  hypothetical protein KNAG_0A06060                      178   1e-52   Kazachstania naganishii CBS 8797
emb|CDO96181.1|  unnamed protein product                                178   1e-52   Kluyveromyces dobzhanskii CBS 2104
ref|XP_007872719.1|  ribosomal L15                                      178   1e-52   Pneumocystis murina B123
emb|CEI91883.1|  Putative Ribosomal protein L15                         178   2e-52   Rhizopus microsporus
gb|KEZ43818.1|  hypothetical protein SAPIO_CDS3973                      178   2e-52   Scedosporium apiospermum
ref|XP_005717822.1|  60S ribosomal protein L15                          178   2e-52   Chondrus crispus [carageen]
gb|EIE79210.1|  60S ribosomal protein L15                               178   2e-52   Rhizopus delemar RA 99-880
ref|XP_003837801.1|  hypothetical protein LEMA_P121210.1                179   2e-52   Leptosphaeria maculans JN3
ref|XP_002598589.1|  hypothetical protein BRAFLDRAFT_113717             177   3e-52   Branchiostoma floridae
ref|XP_001484435.1|  60S ribosomal protein L15-A                        177   3e-52   Meyerozyma guilliermondii ATCC 6260
ref|XP_455872.1|  60S ribosomal protein L15                             177   3e-52   Kluyveromyces lactis
ref|XP_444915.1|  60S ribosomal protein L15                             177   4e-52   [Candida] glabrata
emb|CDK25606.1|  unnamed protein product                                177   4e-52   Kuraishia capsulata CBS 1993
dbj|BAO40104.1|  60S ribosomal protein L15-B                            177   4e-52   Kluyveromyces marxianus DMKU3-1042
ref|XP_003678734.1|  60S ribosomal protein L15                          177   4e-52   Torulaspora delbrueckii
gb|KIV95599.1|  60S ribosomal protein L15                               177   4e-52   Exophiala mesophila
emb|CEJ01625.1|  Putative Ribosomal protein L15                         176   5e-52   Rhizopus microsporus
ref|XP_011115334.1|  hypothetical protein H072_9785                     177   5e-52   
gb|KIN02516.1|  hypothetical protein OIDMADRAFT_18358                   177   5e-52   Oidiodendron maius Zn
gb|KIX01331.1|  60S ribosomal protein L15                               177   5e-52   Rhinocladiella mackenziei CBS 650.93
ref|XP_003686547.1|  60S ribosomal protein L15                          177   5e-52   Tetrapisispora phaffii CBS 4417
gb|KEF63356.1|  60S ribosomal protein L15                               177   5e-52   Exophiala aquamarina CBS 119918
gb|EHN05368.1|  Rpl15bp                                                 177   6e-52   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gb|EYE94488.1|  60S ribosomal protein L15                               177   7e-52   Aspergillus ruber CBS 135680
ref|XP_004179266.1|  hypothetical protein TBLA_0B09300                  177   7e-52   Tetrapisispora blattae CBS 6284
gb|AJS80338.1|  Rpl15bp                                                 177   7e-52   Saccharomyces cerevisiae YJM1248
ref|XP_007511637.1|  60S ribosomal protein L15                          177   7e-52   Bathycoccus prasinos
ref|XP_001386507.1|  60S ribosomal protein L15                          176   7e-52   Scheffersomyces stipitis CBS 6054
ref|XP_003647297.1|  hypothetical protein Ecym_6084                     176   7e-52   Eremothecium cymbalariae DBVPG#7215
ref|XP_001388776.1|  60S ribosomal protein L15                          176   7e-52   Aspergillus niger CBS 513.88
gb|KIY71642.1|  ribosomal protein L15e                                  176   8e-52   Cylindrobasidium torrendii FP15055 ss-10
dbj|GAA24916.1|  K7_Rpl15ap                                             176   8e-52   Saccharomyces cerevisiae Kyokai no. 7
ref|NP_013840.1|  ribosomal 60S subunit protein L15B                    176   8e-52   Saccharomyces cerevisiae S288C
gb|AJS62423.1|  Rpl15bp                                                 176   8e-52   Saccharomyces cerevisiae YJM193
gb|EJT43834.1|  hypothetical protein SKUD_204406                        176   9e-52   Saccharomyces kudriavzevii IFO 1802
gb|EHN01315.1|  Rpl15bp                                                 176   9e-52   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gb|AJS78588.1|  Rpl15bp                                                 176   9e-52   Saccharomyces cerevisiae YJM1202
gb|EJT43462.1|  RPL15B-like protein                                     176   9e-52   Saccharomyces kudriavzevii IFO 1802
ref|XP_004339224.1|  ribosomal L15, putative                            176   9e-52   Acanthamoeba castellanii str. Neff
gb|KGK38943.1|  hypothetical protein JL09_g1954                         176   9e-52   Pichia kudriavzevii
gb|EWG89405.1|  Rpl15bp                                                 176   9e-52   Saccharomyces cerevisiae P301
ref|XP_003957065.1|  hypothetical protein KAFR_0D02820                  176   9e-52   Kazachstania africana CBS 2517
emb|CEG70134.1|  Putative Ribosomal protein L15                         176   1e-51   Rhizopus microsporus
gb|EGA57755.1|  Rpl15ap                                                 176   1e-51   Saccharomyces cerevisiae FostersB
emb|CEP13977.1|  hypothetical protein                                   176   1e-51   Parasitella parasitica
gb|EWG84044.1|  Rpl15bp                                                 176   1e-51   Saccharomyces cerevisiae R008
emb|CCQ18640.1|  60S ribosomal protein L15                              176   1e-51   Sycon ciliatum
gb|KIY95038.1|  60S ribosomal protein L15-1                             176   1e-51   Monoraphidium neglectum
ref|XP_002616462.1|  conserved hypothetical protein                     176   1e-51   Clavispora lusitaniae ATCC 42720
gb|EGA77362.1|  Rpl15bp                                                 176   1e-51   Saccharomyces cerevisiae Vin13
ref|XP_002836891.1|  60S ribosomal protein L15                          176   1e-51   
ref|XP_003657786.1|  60S ribosomal protein L15                          176   1e-51   
ref|XP_009036617.1|  hypothetical protein AURANDRAFT_60075              176   1e-51   
gb|EPS27962.1|  hypothetical protein PDE_02907                          176   1e-51   
gb|KIW22669.1|  60S ribosomal protein L15                               183   2e-51   
gb|EMS24660.1|  60S ribosomal protein l15                               176   2e-51   
ref|XP_008020295.1|  hypothetical protein SETTUDRAFT_40911              176   2e-51   
gb|EPB89957.1|  60S ribosomal protein L15                               176   2e-51   
gb|AJS76851.1|  Rpl15bp                                                 176   2e-51   
gb|EPB90299.1|  60S ribosomal protein L15                               176   2e-51   
gb|AAN52373.1|  ribosomal protein L15                                   175   2e-51   
gb|EPE06282.1|  60s ribosomal protein l15                               175   2e-51   
ref|XP_009159952.1|  60S ribosomal protein L15                          175   2e-51   
ref|XP_008725811.1|  60S ribosomal protein L15                          175   2e-51   
ref|XP_005703122.1|  60S ribosomal protein L15e isoform 2               175   2e-51   
dbj|GAN03271.1|  60S ribosomal protein L15                              174   2e-51   
ref|XP_011104444.1|  rpl15ap                                            175   2e-51   
gb|EHN00844.1|  Rpl15bp                                                 175   2e-51   
emb|CAY81267.1|  Rpl15ap                                                175   2e-51   
gb|EGA81785.1|  Rpl15ap                                                 175   3e-51   
emb|CDM26463.1|  60S ribosomal protein L15                              175   3e-51   
ref|XP_006686733.1|  hypothetical protein CANTEDRAFT_114246             175   3e-51   
pdb|1S1I|L  Chain L, Structure Of The Ribosomal 80s-Eef2-Sordarin...    175   3e-51   
gb|AJS94717.1|  Rpl15bp                                                 175   3e-51   
gb|AJS74671.1|  Rpl15bp                                                 175   3e-51   
gb|EDZ70729.1|  YLR029Cp-like protein                                   175   3e-51   
ref|NP_013129.1|  ribosomal 60S subunit protein L15A                    175   3e-51   
ref|XP_001225510.1|  60S ribosomal protein L15                          175   4e-51   
gb|KEQ99844.1|  hypothetical protein AUEXF2481DRAFT_25720               176   4e-51   
gb|KEQ59346.1|  60S ribosomal protein L15                               175   4e-51   
gb|KHJ35835.1|  putative 60s ribosomal protein l15                      175   4e-51   
ref|XP_001909718.1|  hypothetical protein                               174   4e-51   
gb|AJS95152.1|  Rpl15bp                                                 174   4e-51   
ref|XP_001820015.1|  60S ribosomal protein L15                          174   4e-51   
gb|EPQ66314.1|  Protein component of the large (60S) ribosomal su...    174   4e-51   
gb|AJS96882.1|  Rpl15bp                                                 174   4e-51   
gb|ACU45020.1|  60s ribosomal protein L15                               174   5e-51   
emb|CDR41295.1|  CYFA0S07e00386g1_1                                     174   5e-51   
gb|ACR24948.1|  ribosomal protein L15                                   174   5e-51   
ref|XP_002545593.1|  60S ribosomal protein L15-B                        174   5e-51   
gb|KIH94692.1|  large subunit ribosomal protein L15e                    174   5e-51   
ref|XP_003350788.1|  60S ribosomal protein L15                          174   6e-51   
gb|KIW41910.1|  60S ribosomal protein L15                               176   6e-51   
gb|ERS96332.1|  60S ribosomal protein L15                               174   6e-51   
ref|XP_007595397.1|  ribosomal L15                                      174   6e-51   
ref|XP_007788991.1|  putative 60s ribosomal protein l15 protein         174   6e-51   
ref|XP_001545571.1|  60S ribosomal protein L15                          174   6e-51   
gb|EWM27504.1|  Ribosomal protein L15e                                  174   7e-51   
ref|XP_002561234.1|  Pc16g09160                                         174   8e-51   
ref|XP_003884098.1|  hypothetical protein NCLIV_045010                  174   8e-51   
gb|EGA61325.1|  Rpl15ap                                                 174   8e-51   
gb|EIF48674.1|  60s ribosomal protein l15-b                             174   8e-51   
ref|XP_003666937.1|  hypothetical protein MYCTH_2312102                 174   9e-51   
gb|KIE03942.1|  Ribosomal protein L15e                                  174   9e-51   
ref|XP_002162844.1|  PREDICTED: 60S ribosomal protein L15-like          174   9e-51   
ref|XP_007804051.1|  60S ribosomal protein L15                          174   9e-51   
ref|XP_007762548.1|  ribosomal protein L15e                             173   1e-50   
ref|XP_002366469.1|  ribosomal protein L15, putative                    174   1e-50   
ref|XP_011274238.1|  60S ribosomal protein L15-A                        174   1e-50   
pdb|3JYW|L  Chain L, Structure Of The 60s Proteins For Eukaryotic...    173   1e-50   
ref|XP_011414691.1|  PREDICTED: 60S ribosomal protein L15-like          173   1e-50   
ref|XP_007759046.1|  60S ribosomal protein L15                          173   1e-50   
ref|XP_007782913.1|  60S ribosomal protein L15                          174   1e-50   
gb|EQL00837.1|  Ribosomal protein L15e                                  173   1e-50   
ref|XP_001932961.1|  60S ribosomal protein L15                          173   1e-50   
gb|KIW20891.1|  60S ribosomal protein L15                               173   2e-50   
ref|XP_001525424.1|  60S ribosomal protein L15-B                        173   2e-50   
ref|XP_002108683.1|  expressed hypothetical protein                     173   2e-50   
ref|XP_008080630.1|  Ribosomal proteins S24e, L23 and L15e              173   2e-50   
ref|XP_007373844.1|  hypothetical protein SPAPADRAFT_59682              173   2e-50   
ref|XP_010844755.1|  PREDICTED: 60S ribosomal protein L15               172   2e-50   
ref|XP_008612133.1|  60S ribosomal protein                              173   2e-50   
ref|XP_010986099.1|  PREDICTED: 60S ribosomal protein L15               172   2e-50   
ref|XP_009201977.1|  PREDICTED: 60S ribosomal protein L15               172   2e-50   
emb|CCX31468.1|  Similar to 60S ribosomal protein L15; acc. no. Q...    172   2e-50   
ref|XP_007421748.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    172   2e-50   
ref|XP_005699007.1|  PREDICTED: 60S ribosomal protein L15               173   2e-50   
ref|XP_008713401.1|  60S ribosomal protein L15                          172   3e-50   
gb|KIM66174.1|  hypothetical protein SCLCIDRAFT_1211398                 172   3e-50   
gb|ETE59074.1|  60S ribosomal protein L15                               172   3e-50   
ref|XP_001265199.1|  60S ribosomal protein L15                          172   3e-50   
gb|KFH71724.1|  60S ribosomal protein L15                               172   3e-50   
ref|XP_005105827.1|  PREDICTED: 60S ribosomal protein L15-like is...    172   3e-50   
ref|XP_007835687.1|  60S ribosomal protein L15                          172   4e-50   
ref|XP_007737355.1|  60S ribosomal protein L15                          172   4e-50   
ref|XP_007925894.1|  hypothetical protein MYCFIDRAFT_58365              172   4e-50   
ref|XP_003025216.1|  hypothetical protein TRV_00621                     172   4e-50   
emb|CCA20982.1|  60S ribosomal protein L151 putative                    172   4e-50   
ref|XP_003296271.1|  60S ribosomal protein L15                          173   4e-50   
ref|XP_011102974.1|  rpl15bp                                            172   4e-50   
ref|XP_007470051.1|  PREDICTED: 60S ribosomal protein L15-like          172   4e-50   
ref|XP_004021938.1|  PREDICTED: 60S ribosomal protein L15               172   4e-50   
ref|XP_003233932.1|  60S ribosomal protein L15                          172   5e-50   
ref|XP_003226267.1|  PREDICTED: 60S ribosomal protein L15               172   5e-50   
ref|XP_004654068.1|  PREDICTED: 60S ribosomal protein L15-like          172   5e-50   
tpg|DAA16199.1|  TPA: ribosomal protein L15-like                        172   5e-50   
ref|XP_007724541.1|  60S ribosomal protein L15                          172   5e-50   
sp|P79324.1|RL15_PIG  RecName: Full=60S ribosomal protein L15           170   5e-50   
gb|KIK28524.1|  hypothetical protein PISMIDRAFT_673552                  171   6e-50   
ref|XP_006021253.1|  PREDICTED: 60S ribosomal protein L15               172   6e-50   
ref|XP_007068583.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    172   6e-50   
ref|XP_003709740.1|  60S ribosomal protein L15                          171   6e-50   
ref|XP_002759698.1|  PREDICTED: 60S ribosomal protein L15               171   6e-50   
ref|XP_006986589.1|  PREDICTED: 60S ribosomal protein L15-like          171   6e-50   
dbj|BAE31437.1|  unnamed protein product                                171   6e-50   
gb|AAV38477.1|  ribosomal protein L15                                   172   6e-50   
gb|KIO08255.1|  hypothetical protein M404DRAFT_997181                   171   6e-50   
ref|XP_003415776.1|  PREDICTED: 60S ribosomal protein L15               171   6e-50   
ref|NP_079862.1|  60S ribosomal protein L15                             171   6e-50   
ref|XP_004634243.1|  PREDICTED: 60S ribosomal protein L15               171   6e-50   
ref|XP_008054634.1|  PREDICTED: 60S ribosomal protein L15               172   7e-50   
ref|XP_007505229.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    171   7e-50   
emb|CCD34791.1|  hypothetical protein BofuT4_P098500.1                  174   7e-50   
emb|CAH91644.1|  hypothetical protein                                   171   7e-50   
ref|XP_008831372.1|  PREDICTED: 60S ribosomal protein L15               171   7e-50   
ref|XP_009226880.1|  60S ribosomal protein L15                          171   8e-50   
ref|XP_007344080.1|  60S ribosomal protein L15                          171   8e-50   
gb|KEY67005.1|  hypothetical protein S7711_05126                        171   8e-50   
gb|KIK63705.1|  hypothetical protein GYMLUDRAFT_40770                   171   8e-50   
ref|XP_007671745.1|  hypothetical protein BAUCODRAFT_566278             171   8e-50   
gb|AAN73343.1|  ribosomal protein L15                                   171   9e-50   
gb|AAH30575.1|  Similar to RIKEN cDNA 2510008H07 gene                   171   1e-49   
ref|XP_009263009.1|  hypothetical protein FPSE_11617                    171   1e-49   
ref|XP_001624083.1|  predicted protein                                  171   1e-49   
gb|ADX36424.1|  60S ribosomal protein L15                               171   1e-49   
ref|XP_003281126.1|  PREDICTED: 60S ribosomal protein L15-like is...    171   1e-49   
sp|Q7T3N1.3|RL15_MYLPI  RecName: Full=60S ribosomal protein L15         171   1e-49   
ref|XP_007844218.1|  60s ribosomal protein l15                          171   1e-49   
ref|XP_011227834.1|  PREDICTED: 60S ribosomal protein L15               171   1e-49   
gb|KIL94800.1|  60s ribosomal protein l15                               171   1e-49   
emb|CEJ94099.1|  Putative Ribosomal protein L15                         171   1e-49   
ref|NP_001003447.1|  60S ribosomal protein L15                          171   1e-49   
sp|Q7T3P0.3|RL15_HYPNO  RecName: Full=60S ribosomal protein L15         171   1e-49   
gb|ETW32112.1|  hypothetical protein PFFCH_00475                        170   1e-49   
gb|EFZ14326.1|  hypothetical protein SINV_15101                         171   1e-49   
ref|XP_001828739.2|  60S ribosomal protein L15                          172   1e-49   
sp|Q7T3N4.3|RL15_MEGAM  RecName: Full=60S ribosomal protein L15         171   1e-49   
ref|XP_011054650.1|  PREDICTED: 60S ribosomal protein L15               171   1e-49   
ref|XP_003670245.1|  ribosomal protein L15                              171   2e-49   
gb|AEH41549.1|  60S ribosomal protein L15                               170   2e-49   
gb|EMT61608.1|  60S ribosomal protein L15                               171   2e-49   
ref|XP_003936085.1|  PREDICTED: 60S ribosomal protein L15               171   2e-49   
ref|XP_001541513.1|  60S ribosomal protein L15                          170   2e-49   
ref|XP_007812013.1|  60S ribosomal protein L15                          170   2e-49   
ref|XP_003054429.1|  60S ribosomal protein L15                          170   2e-49   
gb|AAG44837.1|  60S ribosomal protein L15                               170   2e-49   
ref|XP_003673359.1|  hypothetical protein NCAS_0A04140                  172   2e-49   
ref|XP_007915208.1|  putative 60s ribosomal protein l15 protein         170   2e-49   
sp|Q7T3N7.3|RL15_CYPCA  RecName: Full=60S ribosomal protein L15         170   2e-49   
ref|XP_003856171.1|  60S ribosomal protein L15                          170   2e-49   
ref|XP_003170202.1|  60S ribosomal protein L15                          171   2e-49   
gb|AAX36167.1|  ribosomal protein L15                                   170   2e-49   
ref|XP_002491583.1|  60S ribosomal protein L15                          170   2e-49   
gb|AAH14837.1|  Ribosomal protein L15                                   170   2e-49   
gb|KIK92970.1|  hypothetical protein PAXRUDRAFT_829457                  170   2e-49   
ref|XP_007589065.1|  putative 60s ribosomal protein l15 protein         170   2e-49   
gb|ERE87093.1|  60S ribosomal protein L15-like protein                  169   2e-49   
gb|KID77747.1|  Ribosomal protein L15e                                  170   2e-49   
ref|XP_009844620.1|  60S ribosomal protein                              170   3e-49   
gb|EKG10086.1|  Ribosomal protein L15e                                  170   3e-49   
gb|EJU02043.1|  ribosomal protein L15e                                  170   3e-49   
ref|NP_001080766.1|  ribosomal protein L15                              170   3e-49   
gb|KIW51029.1|  60S ribosomal protein L15                               170   3e-49   
gb|KFA61144.1|  hypothetical protein S40285_02203                       170   3e-49   
ref|XP_002808654.1|  60S ribosomal protein L15, putative                170   3e-49   
gb|AAX43023.1|  ribosomal protein L15                                   170   3e-49   
gb|ERE87094.1|  60S ribosomal protein L15-like protein                  169   4e-49   
gb|KIW64984.1|  60S ribosomal protein L15                               178   4e-49   
tpg|DAA32565.1|  TPA: ribosomal protein L15-like                        169   4e-49   
ref|XP_002583622.1|  60S ribosomal protein L15                          169   4e-49   
ref|XP_006965992.1|  60s ribosomal protein L152/L15B                    169   4e-49   
ref|XP_011260293.1|  PREDICTED: 60S ribosomal protein L15               170   4e-49   
gb|EFN65755.1|  60S ribosomal protein L15                               170   4e-49   
ref|XP_007414800.1|  hypothetical protein MELLADRAFT_91790              169   4e-49   
emb|CCJ28328.1|  unnamed protein product                                169   4e-49   
dbj|BAB79461.1|  ribosomal protein L15                                  169   4e-49   
emb|CCA75151.1|  probable RPL15A 60S large subunit ribosomal prot...    169   5e-49   
emb|CAG00252.1|  unnamed protein product                                169   5e-49   
gb|KIM85231.1|  hypothetical protein PILCRDRAFT_817231                  169   5e-49   
gb|KHN95867.1|  Ribosomal protein L15e                                  169   5e-49   
ref|XP_004221219.1|  60S ribosomal protein L15-1                        169   5e-49   
ref|XP_003969112.1|  PREDICTED: 60S ribosomal protein L15-like          169   5e-49   
gb|EEQ87750.1|  60S ribosomal protein L15                               169   5e-49   
ref|XP_762879.1|  60S ribosomal protein L15                             169   5e-49   
gb|AAX08723.1|  ribosomal protein L15                                   169   6e-49   
gb|KIM27529.1|  hypothetical protein M408DRAFT_329974                   169   6e-49   
ref|XP_002849507.1|  60S ribosomal protein L15                          170   6e-49   
gb|EXL86692.1|  60S ribosomal protein L15                               171   6e-49   
gb|KFH46732.1|  60S ribosomal protein-like protein                      169   6e-49   
ref|XP_008877609.1|  60S ribosomal protein                              169   6e-49   
ref|XP_008558014.1|  PREDICTED: 60S ribosomal protein L15               169   6e-49   
gb|EGU81126.1|  hypothetical protein FOXB_08400                         171   6e-49   
ref|XP_002623870.1|  60S ribosomal protein L15                          169   6e-49   
ref|NP_001266930.1|  60S ribosomal protein L15                          169   6e-49   
gb|EDL26238.1|  mCG16398                                                169   7e-49   
gb|EHK15888.1|  hypothetical protein TRIVIDRAFT_217112                  169   7e-49   
ref|XP_007523467.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    169   7e-49   
ref|XP_001712430.1|  rpl15                                              169   7e-49   
gb|AAV41378.1|  ribosomal protein L15                                   166   7e-49   
ref|XP_002258209.1|  ribosomal protein l15                              169   7e-49   
ref|XP_008816354.1|  ribosomal L15                                      169   8e-49   
sp|P61368.2|RL15_HYDVU  RecName: Full=60S ribosomal protein L15         169   8e-49   
ref|XP_001615040.1|  60S ribosomal protein L15-1                        169   8e-49   
gb|EKV11308.1|  hypothetical protein PDIG_51450                         176   8e-49   
ref|XP_010387454.1|  PREDICTED: 60S ribosomal protein L15-like          169   9e-49   
dbj|BAB27107.1|  unnamed protein product                                169   9e-49   
ref|NP_593663.1|  60S ribosomal protein L15                             168   9e-49   
gb|EWZ51470.1|  60S ribosomal protein L15                               170   1e-48   
gb|ETW38445.1|  hypothetical protein PFTANZ_00876                       168   1e-48   
gb|EXK95810.1|  60S ribosomal protein L15                               170   1e-48   
ref|XP_001245521.1|  60S ribosomal protein L15                          168   1e-48   
emb|CDF88438.1|  BN860_10286g1_1                                        168   1e-48   
ref|XP_658049.1|  RL15_ASPNG 60S RIBOSOMAL PROTEIN L15                  168   1e-48   
emb|CCI40961.1|  unnamed protein product                                168   1e-48   
gb|ENH84342.1|  60s ribosomal protein l15                               168   1e-48   
gb|AFJ91723.1|  60S ribosomal protein L15                               168   1e-48   
gb|AAO15464.1|AF441167_1  60S ribosomal protein L15                     168   2e-48   
ref|XP_008596519.1|  60S ribosomal protein L15                          168   2e-48   
gb|AAX62392.1|  ribosomal protein L15                                   168   2e-48   
ref|XP_009691154.1|  60S ribosomal protein L15                          168   2e-48   
ref|NP_001015155.1|  ribosomal protein L15, isoform A                   168   2e-48   



>ref|XP_009606590.1| PREDICTED: 60S ribosomal protein L15 [Nicotiana tomentosiformis]
 ref|XP_009601449.1| PREDICTED: 60S ribosomal protein L15 [Nicotiana tomentosiformis]
 ref|XP_009780055.1| PREDICTED: 60S ribosomal protein L15 [Nicotiana sylvestris]
Length=204

 Score =   255 bits (651),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/129 (95%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYK
Sbjct  69   GGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD AHAAIRNDPRINW+CNPVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSR
Sbjct  129  YFEVILVDQAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSR  188

Query  202  RATWKRNQT  176
            RATWKRNQT
Sbjct  189  RATWKRNQT  197



>ref|XP_009796395.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana sylvestris]
Length=204

 Score =   255 bits (651),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/129 (95%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYK
Sbjct  69   GGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD AHAAIRNDPRINW+CNPVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSR
Sbjct  129  YFEVILVDQAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSR  188

Query  202  RATWKRNQT  176
            RATWKRNQT
Sbjct  189  RATWKRNQT  197



>ref|XP_004241917.1| PREDICTED: 60S ribosomal protein L15 [Solanum lycopersicum]
 ref|XP_006355022.1| PREDICTED: 60S ribosomal protein L15-like [Solanum tuberosum]
 ref|XP_006356521.1| PREDICTED: 60S ribosomal protein L15 [Solanum tuberosum]
Length=204

 Score =   254 bits (650),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/129 (96%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPV KGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK
Sbjct  69   GGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD AHAAIRNDPRINW+CNPVHK RELRGLTSAGKKYRGLRGRGHLHHKARPSR
Sbjct  129  YFEVILVDQAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSR  188

Query  202  RATWKRNQT  176
            RATWKRNQT
Sbjct  189  RATWKRNQT  197



>emb|CDP10996.1| unnamed protein product [Coffea canephora]
Length=186

 Score =   253 bits (646),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/129 (96%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK
Sbjct  51   GGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  110

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            Y+EVILVD AHAAIRNDPRINWLC PVHK RELRGLTSAGKKYRGLRGRGHLHHKARPSR
Sbjct  111  YYEVILVDPAHAAIRNDPRINWLCQPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSR  170

Query  202  RATWKRNQT  176
            RATWKRNQT
Sbjct  171  RATWKRNQT  179



>ref|XP_004242022.1| PREDICTED: 60S ribosomal protein L15 [Solanum lycopersicum]
 ref|XP_006363900.1| PREDICTED: 60S ribosomal protein L15-like [Solanum tuberosum]
Length=204

 Score =   254 bits (648),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/129 (95%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPV KGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYK
Sbjct  69   GGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVIL+D+AHAAIRNDPRINW+CNPVHK RELRGLTSAGKKYRGLRGRGHLHHKARPSR
Sbjct  129  YFEVILIDSAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSR  188

Query  202  RATWKRNQT  176
            RATWKRNQT
Sbjct  189  RATWKRNQT  197



>ref|XP_002301250.1| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_006375250.1| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_011033124.1| PREDICTED: 60S ribosomal protein L15-like [Populus euphratica]
 gb|EEE80523.1| 60S ribosomal protein L15 [Populus trichocarpa]
 gb|ERP53047.1| 60S ribosomal protein L15 [Populus trichocarpa]
Length=204

 Score =   253 bits (647),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/129 (95%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYK
Sbjct  69   GGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD AH AIRNDPRINW+CNPVHK RELRGLTSAGKKYRGLRGRGHLHHKARPSR
Sbjct  129  YFEVILVDAAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSR  188

Query  202  RATWKRNQT  176
            RATWKRNQT
Sbjct  189  RATWKRNQT  197



>ref|XP_004236901.1| PREDICTED: 60S ribosomal protein L15-like [Solanum lycopersicum]
Length=204

 Score =   252 bits (644),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/129 (95%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPV KGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK
Sbjct  69   GGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD AHA IRNDPRINW+CNPVHK RELRGLTSAGKKYRGLRGRGHLHHKARPSR
Sbjct  129  YFEVILVDQAHAGIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSR  188

Query  202  RATWKRNQT  176
            RATWKRNQT
Sbjct  189  RATWKRNQT  197



>ref|XP_006369001.1| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_011001458.1| PREDICTED: 60S ribosomal protein L15-like [Populus euphratica]
 gb|ABK93954.1| unknown [Populus trichocarpa]
 gb|ERP65570.1| 60S ribosomal protein L15 [Populus trichocarpa]
Length=204

 Score =   251 bits (642),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/129 (95%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK
Sbjct  69   GGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD AH AIRNDPRINWLCNPVHK RELRGLTSAGKKYRGLRGRGHLHHKARPSR
Sbjct  129  YFEVILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSR  188

Query  202  RATWKRNQT  176
            RA WKRN T
Sbjct  189  RANWKRNNT  197



>ref|XP_011017435.1| PREDICTED: 60S ribosomal protein L15-like [Populus euphratica]
Length=228

 Score =   252 bits (643),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/129 (95%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYK
Sbjct  93   GGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYK  152

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD AH AIRNDPRINW+C PVHK RELRGLTSAGKKYRGLRGRGHLHHKARPSR
Sbjct  153  YFEVILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSR  212

Query  202  RATWKRNQT  176
            RATWKRNQT
Sbjct  213  RATWKRNQT  221



>sp|O82528.1|RL15_PETHY RecName: Full=60S ribosomal protein L15 [Petunia x hybrida]
 gb|AAD13389.1| ribosomal protein L15 [Petunia x hybrida]
Length=204

 Score =   248 bits (634),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/129 (94%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKPT QGVTQLKFQR+KRSVAEERAGRKLGGLRVLNSYWINEDSTYK
Sbjct  69   GGRKRPVPKGIVYGKPTNQGVTQLKFQRTKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD AHAAIRNDPRINW+CNPVHK RELRGLTSAGKKYRGLRGRGHLH+KA PSR
Sbjct  129  YFEVILVDQAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLHNKAPPSR  188

Query  202  RATWKRNQT  176
            RA WKRNQT
Sbjct  189  RANWKRNQT  197



>ref|XP_009764605.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana sylvestris]
Length=204

 Score =   248 bits (632),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYK
Sbjct  69   GGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVIL+D AHAA+RNDPRINW+CNPVHK RELRGLTSAGKK RGL+G+GHLHHK RPSR
Sbjct  129  YFEVILIDAAHAAVRNDPRINWICNPVHKHRELRGLTSAGKKNRGLQGKGHLHHKQRPSR  188

Query  202  RATWKRNQT  176
            RATWKRNQT
Sbjct  189  RATWKRNQT  197



>ref|XP_009607935.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana tomentosiformis]
Length=204

 Score =   248 bits (632),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/129 (92%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYK
Sbjct  69   GGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            Y+EVILVD AHAAIRNDPRINW+CNPVHK RELRGLTSAGKKYRGLRG+GHL+HK RPSR
Sbjct  129  YYEVILVDAAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKNRPSR  188

Query  202  RATWKRNQT  176
            R TWKRNQT
Sbjct  189  RGTWKRNQT  197



>ref|XP_009768655.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana sylvestris]
Length=204

 Score =   247 bits (631),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/129 (92%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKL GL+VLNSYWINEDSTYK
Sbjct  69   GGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLAGLKVLNSYWINEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD AHAAIRNDPRINW+CNPVHK RELRGLTSAGKKYRGLRG+GHL+HK RPSR
Sbjct  129  YFEVILVDAAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKNRPSR  188

Query  202  RATWKRNQT  176
            R TWKRNQT
Sbjct  189  RGTWKRNQT  197



>ref|XP_002304285.2| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_006376227.1| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_011031910.1| PREDICTED: 60S ribosomal protein L15 isoform X2 [Populus euphratica]
 gb|ABK93503.1| unknown [Populus trichocarpa]
 gb|ERP54024.1| 60S ribosomal protein L15 [Populus trichocarpa]
 gb|EEE79264.2| 60S ribosomal protein L15 [Populus trichocarpa]
Length=204

 Score =   246 bits (628),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/126 (95%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE
Sbjct  72   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIRNDPRINWLCNPVHK RELRGLTSAGKKYRGLRGRGHLHHKARPSRRA 
Sbjct  132  VILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAN  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>ref|XP_011031911.1| PREDICTED: 60S ribosomal protein L15 isoform X3 [Populus euphratica]
Length=186

 Score =   246 bits (627),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/126 (95%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE
Sbjct  54   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  113

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIRNDPRINWLCNPVHK RELRGLTSAGKKYRGLRGRGHLHHKARPSRRA 
Sbjct  114  VILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAN  173

Query  193  WKRNQT  176
            WKRN T
Sbjct  174  WKRNNT  179



>ref|XP_006477158.1| PREDICTED: 60S ribosomal protein L15-like [Citrus sinensis]
 gb|KDO61391.1| hypothetical protein CISIN_1g028730mg [Citrus sinensis]
Length=204

 Score =   246 bits (628),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/126 (95%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE
Sbjct  72   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIRNDPRINWLCNPVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRAT
Sbjct  132  VILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRAT  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>ref|XP_009618098.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana tomentosiformis]
Length=204

 Score =   246 bits (628),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYK
Sbjct  69   GGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            Y+EVIL+D AHAA+RNDPRINW+CNPVHK RELRGLTSAGKK RGL+G+GHLHHK RPSR
Sbjct  129  YYEVILIDAAHAAVRNDPRINWICNPVHKHRELRGLTSAGKKNRGLQGKGHLHHKQRPSR  188

Query  202  RATWKRNQT  176
            RATWKRNQT
Sbjct  189  RATWKRNQT  197



>ref|XP_004152395.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis 
sativus]
 ref|XP_004158132.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis 
sativus]
 gb|KGN50265.1| hypothetical protein Csa_5G162630 [Cucumis sativus]
Length=204

 Score =   246 bits (628),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/126 (94%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+E
Sbjct  72   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH A+RNDPRINW+CNPVHKRRELRGLTSAGKKYRGLRG+GHLHHKARPSRRAT
Sbjct  132  VILVDVAHNAVRNDPRINWICNPVHKRRELRGLTSAGKKYRGLRGKGHLHHKARPSRRAT  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>ref|XP_011031909.1| PREDICTED: 60S ribosomal protein L15 isoform X1 [Populus euphratica]
Length=206

 Score =   246 bits (628),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/126 (95%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE
Sbjct  74   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  133

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIRNDPRINWLCNPVHK RELRGLTSAGKKYRGLRGRGHLHHKARPSRRA 
Sbjct  134  VILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAN  193

Query  193  WKRNQT  176
            WKRN T
Sbjct  194  WKRNNT  199



>ref|XP_004152396.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis 
sativus]
 ref|XP_004158133.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis 
sativus]
Length=186

 Score =   245 bits (626),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/126 (94%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+E
Sbjct  54   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYE  113

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH A+RNDPRINW+CNPVHKRRELRGLTSAGKKYRGLRG+GHLHHKARPSRRAT
Sbjct  114  VILVDVAHNAVRNDPRINWICNPVHKRRELRGLTSAGKKYRGLRGKGHLHHKARPSRRAT  173

Query  193  WKRNQT  176
            WKRN T
Sbjct  174  WKRNNT  179



>ref|XP_011076388.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum]
 ref|XP_011076389.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum]
Length=204

 Score =   246 bits (627),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 117/126 (93%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+E
Sbjct  72   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VIL+D AHA +RNDPRINW+CNPVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRAT
Sbjct  132  VILIDPAHATVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRAT  191

Query  193  WKRNQT  176
            WKRNQT
Sbjct  192  WKRNQT  197



>ref|XP_006440278.1| hypothetical protein CICLE_v10024403mg [Citrus clementina]
 gb|ESR53518.1| hypothetical protein CICLE_v10024403mg [Citrus clementina]
Length=230

 Score =   246 bits (628),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 120/126 (95%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE
Sbjct  98   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  157

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIRNDPRINWLCNPVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRAT
Sbjct  158  VILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRAT  217

Query  193  WKRNQT  176
            WKRN T
Sbjct  218  WKRNNT  223



>gb|EPS66678.1| hypothetical protein M569_08101, partial [Genlisea aurea]
Length=203

 Score =   245 bits (626),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEVI
Sbjct  73   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEVI  132

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AHAAIRNDPRINW+CNPVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWK
Sbjct  133  LVDPAHAAIRNDPRINWVCNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWK  192

Query  187  RNQT  176
            RNQT
Sbjct  193  RNQT  196



>tpg|DAA40843.1| TPA: hypothetical protein ZEAMMB73_797426, partial [Zea mays]
Length=176

 Score =   244 bits (623),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYK
Sbjct  41   GGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYK  100

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFE+ILVD AH  IRNDPRINWLCNPVHK RELRGLTSAGKK+RGLRG+GH HHK RPSR
Sbjct  101  YFEIILVDVAHTTIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSR  160

Query  202  RATWKRNQT  176
            RATWKRNQT
Sbjct  161  RATWKRNQT  169



>gb|KDO49939.1| hypothetical protein CISIN_1g028757mg [Citrus sinensis]
Length=186

 Score =   244 bits (624),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/126 (94%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFE
Sbjct  54   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFE  113

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIRNDPRINW+C PVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRAT
Sbjct  114  VILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRAT  173

Query  193  WKRNQT  176
            WKRNQT
Sbjct  174  WKRNQT  179



>ref|XP_006490145.1| PREDICTED: 60S ribosomal protein L15-like [Citrus sinensis]
 gb|KDO49938.1| hypothetical protein CISIN_1g028757mg [Citrus sinensis]
Length=204

 Score =   245 bits (625),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/126 (94%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFE
Sbjct  72   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIRNDPRINW+C PVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRAT
Sbjct  132  VILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRAT  191

Query  193  WKRNQT  176
            WKRNQT
Sbjct  192  WKRNQT  197



>ref|XP_007209614.1| hypothetical protein PRUPE_ppa011603mg [Prunus persica]
 ref|XP_008238447.1| PREDICTED: 60S ribosomal protein L15 [Prunus mume]
 gb|EMJ10813.1| hypothetical protein PRUPE_ppa011603mg [Prunus persica]
Length=204

 Score =   245 bits (625),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/126 (94%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE
Sbjct  72   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIRNDPRINWLCNPVHK RELRGLTSAGKKYRGLRG+GHL+HKARPSRRAT
Sbjct  132  VILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKARPSRRAT  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNTT  197



>gb|KHG00889.1| 60S ribosomal L15 [Gossypium arboreum]
 gb|KJB40093.1| hypothetical protein B456_007G046500 [Gossypium raimondii]
Length=204

 Score =   245 bits (625),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/126 (94%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFE
Sbjct  72   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVDTAH AIRNDPRINW+CNPVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRA 
Sbjct  132  VILVDTAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRAN  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>gb|EYU24942.1| hypothetical protein MIMGU_mgv1a013374mg [Erythranthe guttata]
Length=222

 Score =   245 bits (626),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/126 (93%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKL GLRVLNSYWINEDSTYKYFE
Sbjct  90   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLAGLRVLNSYWINEDSTYKYFE  149

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VIL+D AH  +RNDPRINW+CNPVHK RELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT
Sbjct  150  VILIDPAHTTVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  209

Query  193  WKRNQT  176
            WKRNQT
Sbjct  210  WKRNQT  215



>gb|EYU43197.1| hypothetical protein MIMGU_mgv1a012815mg [Erythranthe guttata]
Length=239

 Score =   246 bits (628),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/126 (94%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKL GLRVLNSYWINEDSTYKYFE
Sbjct  107  KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLAGLRVLNSYWINEDSTYKYFE  166

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH  +RNDPRINW+CNPVHK RELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT
Sbjct  167  VILVDPAHTTVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  226

Query  193  WKRNQT  176
            WKRNQT
Sbjct  227  WKRNQT  232



>gb|ACF88005.1| unknown [Zea mays]
 tpg|DAA62722.1| TPA: ribosomal protein L15 [Zea mays]
Length=204

 Score =   244 bits (624),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYK
Sbjct  69   GGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFE+ILVD AH AIRNDPRINWLCNPVHK RELRGLTSAGKK+RGLRG+GH HHK RPSR
Sbjct  129  YFEIILVDVAHTAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSR  188

Query  202  RATWKRNQT  176
            RATWKRNQT
Sbjct  189  RATWKRNQT  197



>ref|XP_010686789.1| PREDICTED: 60S ribosomal protein L15 [Beta vulgaris subsp. vulgaris]
Length=204

 Score =   244 bits (624),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFEVI
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVMNSYWINEDSTYKYFEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVDTAH AIRNDPR+NW+CNPVHK RELRGLTSAGKKYRGLRGRGHL+HKARPSRRATWK
Sbjct  134  LVDTAHNAIRNDPRVNWICNPVHKHRELRGLTSAGKKYRGLRGRGHLNHKARPSRRATWK  193

Query  187  RNQT  176
            RNQT
Sbjct  194  RNQT  197



>gb|KHG22797.1| 60S ribosomal L15-1 -like protein [Gossypium arboreum]
 gb|KJB07871.1| hypothetical protein B456_001G049600 [Gossypium raimondii]
Length=204

 Score =   244 bits (623),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/126 (94%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFE
Sbjct  72   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIRNDPRINW+CNPVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRAT
Sbjct  132  VILVDPAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRAT  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>ref|XP_006421625.1| hypothetical protein CICLE_v10005611mg [Citrus clementina]
 gb|ESR34865.1| hypothetical protein CICLE_v10005611mg [Citrus clementina]
Length=273

 Score =   246 bits (629),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/126 (94%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFE
Sbjct  141  KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFE  200

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIRNDPRINW+C PVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRAT
Sbjct  201  VILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRAT  260

Query  193  WKRNQT  176
            WKRNQT
Sbjct  261  WKRNQT  266



>ref|XP_011069801.1| PREDICTED: 60S ribosomal protein L15 [Sesamum indicum]
Length=204

 Score =   244 bits (623),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/124 (94%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            L+D AHA +RNDPRINW+CNPVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWK
Sbjct  134  LIDPAHATVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWK  193

Query  187  RNQT  176
            RNQT
Sbjct  194  RNQT  197



>emb|CDP11952.1| unnamed protein product [Coffea canephora]
Length=186

 Score =   243 bits (621),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/126 (94%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+E
Sbjct  54   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYE  113

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AHAAIRNDPRI+W+C PVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRAT
Sbjct  114  VILVDPAHAAIRNDPRIHWICEPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRAT  173

Query  193  WKRNQT  176
            WKRNQT
Sbjct  174  WKRNQT  179



>ref|XP_011001078.1| PREDICTED: 60S ribosomal protein L15-like [Populus euphratica]
Length=204

 Score =   243 bits (621),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/126 (94%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE
Sbjct  72   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIRNDPRINWLCNPV K RELRGLTSAGKKYRGLRGRGHLHHKARPSRRA 
Sbjct  132  VILVDVAHNAIRNDPRINWLCNPVQKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAN  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>ref|XP_007038342.1| Ribosomal protein L23/L15e family protein [Theobroma cacao]
 gb|EOY22843.1| Ribosomal protein L23/L15e family protein [Theobroma cacao]
Length=204

 Score =   243 bits (621),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/126 (94%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFE
Sbjct  72   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIRNDPRINW+CNPVHK RELRGLTSAGKKYRGLRGRGHLHHKARPSRRA 
Sbjct  132  VILVDPAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAN  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>ref|XP_011080625.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum]
Length=204

 Score =   243 bits (621),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/124 (94%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            L+D AH  IRNDPRINW+CNPVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWK
Sbjct  134  LIDPAHTTIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWK  193

Query  187  RNQT  176
            RNQT
Sbjct  194  RNQT  197



>ref|XP_011076387.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum]
Length=204

 Score =   243 bits (621),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/124 (94%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EVI
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AHA +RNDPRINW+CNPVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWK
Sbjct  134  LVDPAHATVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWK  193

Query  187  RNQT  176
            RNQT
Sbjct  194  RNQT  197



>ref|XP_004146916.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis 
sativus]
 ref|XP_004146917.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis 
sativus]
 ref|XP_004167164.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis 
sativus]
 ref|XP_004167165.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis 
sativus]
 gb|KGN53150.1| hypothetical protein Csa_4G022860 [Cucumis sativus]
 gb|KGN56283.1| hypothetical protein Csa_3G112770 [Cucumis sativus]
 gb|KGN56284.1| hypothetical protein Csa_3G112780 [Cucumis sativus]
Length=204

 Score =   243 bits (620),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKY+E
Sbjct  72   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYYE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH A+RNDPRINW+CNPVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRAT
Sbjct  132  VILVDVAHNAVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRAT  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>ref|XP_010933963.1| PREDICTED: 60S ribosomal protein L15-like [Elaeis guineensis]
Length=204

 Score =   243 bits (620),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYK
Sbjct  69   GGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD AH AIRNDPRINW+C  VHK RELRGLTSAGKKYRGLRG+GHLHHKARPSR
Sbjct  129  YFEVILVDAAHNAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSR  188

Query  202  RATWKRNQT  176
            RATWKRNQT
Sbjct  189  RATWKRNQT  197



>ref|XP_008437057.1| PREDICTED: 60S ribosomal protein L15-2 isoform X2 [Cucumis melo]
 ref|XP_008453903.1| PREDICTED: 60S ribosomal protein L15-2 [Cucumis melo]
Length=204

 Score =   242 bits (618),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/126 (93%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+E
Sbjct  72   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIRNDPRI W+CNPVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRAT
Sbjct  132  VILVDVAHNAIRNDPRIKWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRAT  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>ref|NP_001148602.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACF83256.1| unknown [Zea mays]
 gb|ACG32179.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACG38194.1| 60S ribosomal protein L15 [Zea mays]
 tpg|DAA59713.1| TPA: ribosomal protein L15 [Zea mays]
Length=204

 Score =   242 bits (618),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYK
Sbjct  69   GGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFE+ILVD AH AI+ DPRINWLCNPVHK RELRGLTSAGKKYRGLRG+GH HHK RPSR
Sbjct  129  YFEIILVDVAHKAIKTDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHTHHKNRPSR  188

Query  202  RATWKRNQT  176
            RATWKRNQT
Sbjct  189  RATWKRNQT  197



>ref|XP_007157273.1| hypothetical protein PHAVU_002G057000g [Phaseolus vulgaris]
 gb|ESW29267.1| hypothetical protein PHAVU_002G057000g [Phaseolus vulgaris]
Length=204

 Score =   242 bits (618),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/126 (93%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE
Sbjct  72   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            V+LVD AHAAIRNDPRINWLCNPVHK RELRGLTSAGK  RGLRGRGHL+HKARPSRRAT
Sbjct  132  VVLVDVAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHLYHKARPSRRAT  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>ref|NP_001150386.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACG38875.1| 60S ribosomal protein L15 [Zea mays]
Length=204

 Score =   242 bits (618),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYK
Sbjct  69   GGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFE+ILVD AH AIR DPRINWLCNPVHK RELRGLTSAGKK+RGLRG+GH HHK RPSR
Sbjct  129  YFEIILVDVAHTAIRKDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSR  188

Query  202  RATWKRNQT  176
            RATWKRNQT
Sbjct  189  RATWKRNQT  197



>ref|XP_008437056.1| PREDICTED: 60S ribosomal protein L15-2 isoform X1 [Cucumis melo]
Length=214

 Score =   242 bits (618),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/126 (93%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+E
Sbjct  82   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYE  141

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIRNDPRI W+CNPVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRAT
Sbjct  142  VILVDVAHNAIRNDPRIKWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRAT  201

Query  193  WKRNQT  176
            WKRN T
Sbjct  202  WKRNNT  207



>gb|EPS59253.1| hypothetical protein M569_15555, partial [Genlisea aurea]
Length=203

 Score =   241 bits (616),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKY+EVI
Sbjct  73   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYYEVI  132

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            L+D AHA +RNDPRINW+CNPVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWK
Sbjct  133  LIDPAHAVVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWK  192

Query  187  RNQT  176
            RNQT
Sbjct  193  RNQT  196



>gb|EMS53506.1| 60S ribosomal protein L15 [Triticum urartu]
Length=168

 Score =   240 bits (612),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW+NEDSTYK
Sbjct  33   GGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYWVNEDSTYK  92

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD AH+A+RNDPRINWLC PVHK RELRGLTSAGKK+RGLRG+GH HHK RPSR
Sbjct  93   YFEVILVDVAHSAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGHRHHKNRPSR  152

Query  202  RATWKRNQT  176
            RATWKRNQT
Sbjct  153  RATWKRNQT  161



>gb|EMT18644.1| 60S ribosomal protein L15 [Aegilops tauschii]
Length=183

 Score =   240 bits (613),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW+NEDSTYK
Sbjct  48   GGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYWVNEDSTYK  107

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD AH+A+RNDPRINWLC PVHK RELRGLTSAGKK+RGLRG+GH HHK RPSR
Sbjct  108  YFEVILVDVAHSAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGHRHHKNRPSR  167

Query  202  RATWKRNQT  176
            RATWKRNQT
Sbjct  168  RATWKRNQT  176



>gb|KDP39891.1| hypothetical protein JCGZ_03422 [Jatropha curcas]
Length=204

 Score =   241 bits (615),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH AIRNDPRINWLC+PVHK RELRGLTSAGKKYRGLRGRGHLHHK RPSRRATWK
Sbjct  134  LVDVAHNAIRNDPRINWLCDPVHKHRELRGLTSAGKKYRGLRGRGHLHHKNRPSRRATWK  193

Query  187  RNQT  176
            RN T
Sbjct  194  RNNT  197



>gb|AAT85124.1| putative 60s ribosomal protein L15 [Oryza sativa Japonica Group]
Length=186

 Score =   240 bits (613),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE
Sbjct  54   KRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFE  113

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +ILVD AH+AIRNDPRINWLC PVHK RELRGLTSAGKKYRGLRG+GH HHKARPSRRAT
Sbjct  114  IILVDVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRAT  173

Query  193  WKRNQT  176
            WKRNQT
Sbjct  174  WKRNQT  179



>pdb|3J61|N Chain N, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
Length=200

 Score =   241 bits (614),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE
Sbjct  72   KRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +ILVD AH+AIRNDPRINWLC PVHK RELRGLTSAGKKYRGLRG+GH HHKARPSRRAT
Sbjct  132  IILVDVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRAT  191

Query  193  WKRNQT  176
            WKRNQT
Sbjct  192  WKRNQT  197



>ref|XP_009352987.1| PREDICTED: 60S ribosomal protein L15-like [Pyrus x bretschneideri]
Length=204

 Score =   241 bits (614),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/126 (93%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPV KGIVYGKPT QGVTQLKFQRSKRSVAEERAGR+LGGLRVLNSYWINEDSTYKYFE
Sbjct  72   KRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRRLGGLRVLNSYWINEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIRNDPRINWLCNPVHK RELRGLTSAGKKYRGLRG+GHL+HKARPSRRAT
Sbjct  132  VILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKARPSRRAT  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNTT  197



>ref|NP_001050612.1| Os03g0598800 [Oryza sativa Japonica Group]
 ref|NP_001174316.1| Os05g0274700 [Oryza sativa Japonica Group]
 gb|AAN08216.1| ribosomal protein L15 [Oryza sativa Japonica Group]
 gb|AAO59978.1| ribosomal protein L15 [Oryza sativa Japonica Group]
 gb|ABF97468.1| 60S ribosomal protein L15, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12526.1| Os03g0598800 [Oryza sativa Japonica Group]
 gb|EAY90899.1| hypothetical protein OsI_12513 [Oryza sativa Indica Group]
 gb|EAZ27702.1| hypothetical protein OsJ_11650 [Oryza sativa Japonica Group]
 dbj|BAG87626.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96945.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00645.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH93044.1| Os05g0274700 [Oryza sativa Japonica Group]
Length=204

 Score =   241 bits (614),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE
Sbjct  72   KRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +ILVD AH+AIRNDPRINWLC PVHK RELRGLTSAGKKYRGLRG+GH HHKARPSRRAT
Sbjct  132  IILVDVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRAT  191

Query  193  WKRNQT  176
            WKRNQT
Sbjct  192  WKRNQT  197



>ref|XP_006650289.1| PREDICTED: 60S ribosomal protein L15-like [Oryza brachyantha]
Length=204

 Score =   241 bits (614),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE
Sbjct  72   KRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +ILVD AH+AIRNDPRINWLC PVHK RELRGLTSAGKKYRGLRG+GH HHKARPSRRAT
Sbjct  132  IILVDVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRAT  191

Query  193  WKRNQT  176
            WKRNQT
Sbjct  192  WKRNQT  197



>dbj|BAJ95856.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=204

 Score =   241 bits (614),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW+NEDSTYK
Sbjct  69   GGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYWVNEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD AH+A+RNDPRINWLC PVHK RELRGLTSAGKK+RGLRG+GH HHK RPSR
Sbjct  129  YFEVILVDVAHSAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGHRHHKNRPSR  188

Query  202  RATWKRNQT  176
            RATWKRNQT
Sbjct  189  RATWKRNQT  197



>ref|XP_003573847.1| PREDICTED: 60S ribosomal protein L15-2 [Brachypodium distachyon]
Length=204

 Score =   240 bits (613),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW+NEDSTYK
Sbjct  69   GGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYWVNEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD AH A+RNDPRINWLCNPVHK RELRGLTSAGKKYRGLRG+G  HHK RPSR
Sbjct  129  YFEVILVDVAHNAVRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGQRHHKNRPSR  188

Query  202  RATWKRNQT  176
            RATWKRNQT
Sbjct  189  RATWKRNQT  197



>ref|XP_006655163.1| PREDICTED: 60S ribosomal protein L15-like [Oryza brachyantha]
Length=213

 Score =   240 bits (613),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE
Sbjct  81   KRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFE  140

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +ILVD AH+AIRNDPRINWLC PVHK RELRGLTSAGKKYRGLRG+GH HHKARPSRRAT
Sbjct  141  IILVDVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRAT  200

Query  193  WKRNQT  176
            WKRNQT
Sbjct  201  WKRNQT  206



>ref|XP_008452210.1| PREDICTED: 60S ribosomal protein L15-2-like [Cucumis melo]
 ref|XP_008452211.1| PREDICTED: 60S ribosomal protein L15-2-like [Cucumis melo]
 ref|XP_008452213.1| PREDICTED: 60S ribosomal protein L15-2-like [Cucumis melo]
Length=204

 Score =   240 bits (612),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+E
Sbjct  72   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIRNDPRI W+C PVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRAT
Sbjct  132  VILVDVAHNAIRNDPRIKWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRAT  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>ref|XP_007202591.1| hypothetical protein PRUPE_ppa011597mg [Prunus persica]
 ref|XP_008244846.1| PREDICTED: 60S ribosomal protein L15-1-like [Prunus mume]
 gb|EMJ03790.1| hypothetical protein PRUPE_ppa011597mg [Prunus persica]
Length=204

 Score =   239 bits (611),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPV KGIVYGKPT QGVTQLKFQRS RSVAEERAGRKL GLRVLNSYWINEDSTYK
Sbjct  69   GGRKRPVSKGIVYGKPTNQGVTQLKFQRSLRSVAEERAGRKLAGLRVLNSYWINEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD AH AIRNDPRINWLCNPVHK RELRGLTSAGKK RGLRG+GHL+HKARPSR
Sbjct  129  YFEVILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKCRGLRGKGHLYHKARPSR  188

Query  202  RATWKRNQT  176
            RATWKRN T
Sbjct  189  RATWKRNTT  197



>tpg|DAA40844.1| TPA: hypothetical protein ZEAMMB73_797426, partial [Zea mays]
Length=156

 Score =   238 bits (607),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE
Sbjct  24   KRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFE  83

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +ILVD AH  IRNDPRINWLCNPVHK RELRGLTSAGKK+RGLRG+GH HHK RPSRRAT
Sbjct  84   IILVDVAHTTIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRAT  143

Query  193  WKRNQT  176
            WKRNQT
Sbjct  144  WKRNQT  149



>ref|XP_002510977.1| ribosomal protein L15, putative [Ricinus communis]
 gb|EEF51579.1| ribosomal protein L15, putative [Ricinus communis]
Length=204

 Score =   239 bits (611),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/124 (93%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFEVI
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH AIRNDPRINW+C PVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWK
Sbjct  134  LVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWK  193

Query  187  RNQT  176
            RN T
Sbjct  194  RNNT  197



>dbj|BAD22764.1| ribosomal protein [Bromus inermis]
Length=204

 Score =   239 bits (611),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW+NEDSTYK
Sbjct  69   GGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYWVNEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD AH A+RNDPRINWLC PVHK RELRGLTSAGKK+RGLRG+GH HHK RPSR
Sbjct  129  YFEVILVDVAHNAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGHRHHKNRPSR  188

Query  202  RATWKRNQT  176
            RATWKRNQT
Sbjct  189  RATWKRNQT  197



>tpg|DAA62721.1| TPA: hypothetical protein ZEAMMB73_667917 [Zea mays]
Length=186

 Score =   239 bits (609),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE
Sbjct  54   KRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFE  113

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +ILVD AH AIRNDPRINWLCNPVHK RELRGLTSAGKK+RGLRG+GH HHK RPSRRAT
Sbjct  114  IILVDVAHTAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRAT  173

Query  193  WKRNQT  176
            WKRNQT
Sbjct  174  WKRNQT  179



>gb|EMT29287.1| 60S ribosomal protein L15 [Aegilops tauschii]
Length=261

 Score =   241 bits (616),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW+NEDSTYK
Sbjct  126  GGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYWVNEDSTYK  185

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD AH+A+RNDPRINWLC PVHK RELRGLTSAGKK+RGLRG+GH HHK RPSR
Sbjct  186  YFEVILVDVAHSAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGHRHHKNRPSR  245

Query  202  RATWKRNQT  176
            RATWKRNQT
Sbjct  246  RATWKRNQT  254



>ref|XP_010667037.1| PREDICTED: 60S ribosomal protein L15-1 [Beta vulgaris subsp. 
vulgaris]
Length=204

 Score =   239 bits (610),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/124 (93%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEVI
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWLNEDSTYKYFEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVDTAH A+RN+PRINW+CNPVHK RELRGLTSAGKKYRGLRGRGHL+HK RPSRRATWK
Sbjct  134  LVDTAHNAVRNNPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLNHKNRPSRRATWK  193

Query  187  RNQT  176
            RNQT
Sbjct  194  RNQT  197



>ref|XP_008241281.1| PREDICTED: 60S ribosomal protein L15-like [Prunus mume]
Length=204

 Score =   239 bits (610),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPV KGIVYGKPT QGVTQLKFQRSKRSVAEERAGR+LGGLRVLNSYWINEDSTYK
Sbjct  69   GGRKRPVAKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRRLGGLRVLNSYWINEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD AH AIRNDPRINWLCNPVHK RELRGLTSAGKK RGL G+GHL+HKARPSR
Sbjct  129  YFEVILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKCRGLGGKGHLYHKARPSR  188

Query  202  RATWKRNQT  176
            RATWKRN T
Sbjct  189  RATWKRNNT  197



>ref|NP_001150716.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACF85905.1| unknown [Zea mays]
 gb|ACG40111.1| 60S ribosomal protein L15 [Zea mays]
 tpg|DAA62720.1| TPA: ribosomal protein L15 [Zea mays]
Length=204

 Score =   239 bits (610),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE
Sbjct  72   KRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +ILVD AH AIRNDPRINWLCNPVHK RELRGLTSAGKK+RGLRG+GH HHK RPSRRAT
Sbjct  132  IILVDVAHTAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRAT  191

Query  193  WKRNQT  176
            WKRNQT
Sbjct  192  WKRNQT  197



>ref|XP_010538411.1| PREDICTED: 60S ribosomal protein L15-1-like [Tarenaya hassleriana]
Length=204

 Score =   239 bits (609),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK
Sbjct  69   GGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            Y+EVILVD AH A+RNDPR+NW+CNPVHK RELRGLTS GKK RGLRG+GHL+HK RPSR
Sbjct  129  YYEVILVDPAHKAVRNDPRMNWICNPVHKHRELRGLTSEGKKNRGLRGKGHLYHKNRPSR  188

Query  202  RATWKRNQT  176
            RATWKRN T
Sbjct  189  RATWKRNNT  197



>ref|XP_010539086.1| PREDICTED: 60S ribosomal protein L15-1-like [Tarenaya hassleriana]
Length=204

 Score =   238 bits (608),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK
Sbjct  69   GGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            Y+EVILVD AH A+RNDPRINW+CNPVHK RELRGLTS GKK RGLRG+GHL HK RPSR
Sbjct  129  YYEVILVDPAHKAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHLFHKNRPSR  188

Query  202  RATWKRNQT  176
            RATWKRN T
Sbjct  189  RATWKRNNT  197



>gb|KDP22442.1| hypothetical protein JCGZ_26273 [Jatropha curcas]
Length=204

 Score =   238 bits (608),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/124 (93%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFEVI
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH AIRNDPRINW+C PVHK RELRGLTSAGKKYRGLRGRGHLHHKARPSRRA WK
Sbjct  134  LVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRANWK  193

Query  187  RNQT  176
            RN T
Sbjct  194  RNNT  197



>ref|XP_010540825.1| PREDICTED: 60S ribosomal protein L15-1-like [Tarenaya hassleriana]
 ref|XP_010542214.1| PREDICTED: 60S ribosomal protein L15-1 [Tarenaya hassleriana]
Length=204

 Score =   238 bits (608),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK
Sbjct  69   GGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            Y+EVILVD AH A+RNDPR+NW+CNPVHK RELRGLTS GKK RGLRG+GHL+HK RPSR
Sbjct  129  YYEVILVDVAHKAVRNDPRMNWICNPVHKHRELRGLTSEGKKNRGLRGKGHLYHKNRPSR  188

Query  202  RATWKRNQT  176
            RATWKRN +
Sbjct  189  RATWKRNNS  197



>gb|KJB51845.1| hypothetical protein B456_008G234000 [Gossypium raimondii]
Length=146

 Score =   236 bits (603),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -3

Query  556  RKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYF  377
            +K+PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYF
Sbjct  13   KKQPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYF  72

Query  376  EVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRA  197
            EVILVD AH AIRNDPRINW+CNPVHK RELRGLTSAGKK RGL G+GHLHHK RPSRRA
Sbjct  73   EVILVDVAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHLHHKNRPSRRA  132

Query  196  TWKRNQT  176
            TWKRN T
Sbjct  133  TWKRNNT  139



>gb|KCW90852.1| hypothetical protein EUGRSUZ_A02903 [Eucalyptus grandis]
Length=165

 Score =   237 bits (604),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW+NEDSTYKYFE
Sbjct  33   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWLNEDSTYKYFE  92

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH  IR DPRINW+CNPVHK RELRGLTSAGKKYRGLRG+GH HHKARPSRRAT
Sbjct  93   VILVDAAHNTIRKDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHSHHKARPSRRAT  152

Query  193  WKRNQT  176
            WKRN +
Sbjct  153  WKRNNS  158



>gb|AAK67641.1| ribosomal protein L15 [Homo sapiens]
Length=204

 Score =   238 bits (608),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW+NED TYK
Sbjct  69   GGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYWVNEDFTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD AH+A+RNDPRINWLC PVHK RELRGLTSAGKK+RGLRG+GH HHK RPSR
Sbjct  129  YFEVILVDVAHSAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGHRHHKNRPSR  188

Query  202  RATWKRNQT  176
            RATWKRNQT
Sbjct  189  RATWKRNQT  197



>ref|XP_010053499.1| PREDICTED: 60S ribosomal protein L15-2 [Eucalyptus grandis]
 gb|KCW77807.1| hypothetical protein EUGRSUZ_D02096 [Eucalyptus grandis]
Length=204

 Score =   238 bits (607),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE
Sbjct  72   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH  IR DPRI+WLCNPVHK RELRGLTSAGKKYRGLRG+GH HHKARPSRRAT
Sbjct  132  VILVDVAHTTIRRDPRISWLCNPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRAT  191

Query  193  WKRNQT  176
            WKRN +
Sbjct  192  WKRNNS  197



>ref|XP_008369443.1| PREDICTED: 60S ribosomal protein L15-1 [Malus domestica]
 ref|XP_008363794.1| PREDICTED: 60S ribosomal protein L15-1 [Malus domestica]
Length=236

 Score =   239 bits (610),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPV KGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE
Sbjct  104  KRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWLNEDSTYKYFE  163

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VI+VD AH AIRNDPRINWLCNPVHK RELRGLTSAGKKYRGLRG+GHL+HK RPSRRAT
Sbjct  164  VIMVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKNRPSRRAT  223

Query  193  WKRNQT  176
            WKRN T
Sbjct  224  WKRNTT  229



>ref|XP_009334550.1| PREDICTED: 60S ribosomal protein L15-1 [Pyrus x bretschneideri]
 ref|XP_009334556.1| PREDICTED: 60S ribosomal protein L15-1 [Pyrus x bretschneideri]
Length=235

 Score =   239 bits (609),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPV KGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE
Sbjct  103  KRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWLNEDSTYKYFE  162

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VI+VD AH AIRNDPRINWLCNPVHK RELRGLTSAGKKYRGLRG+GHL+HK RPSRRAT
Sbjct  163  VIMVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKNRPSRRAT  222

Query  193  WKRNQT  176
            WKRN T
Sbjct  223  WKRNTT  228



>emb|CAN68893.1| hypothetical protein VITISV_004609 [Vitis vinifera]
Length=204

 Score =   238 bits (606),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRS+AEERAGRKLGGL+VLNSYWINEDSTYKY+EVI
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSIAEERAGRKLGGLKVLNSYWINEDSTYKYYEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH AIRNDPRINW+C PVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWK
Sbjct  134  LVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWK  193

Query  187  RNQT  176
            RN T
Sbjct  194  RNNT  197



>emb|CBI38664.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   237 bits (604),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRS+AEERAGRKLGGL+VLNSYWINEDSTYKY+EVI
Sbjct  56   PVPKGIVYGKPTNQGVTQLKFQRSKRSIAEERAGRKLGGLKVLNSYWINEDSTYKYYEVI  115

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH AIRNDPRINW+C PVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWK
Sbjct  116  LVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWK  175

Query  187  RNQT  176
            RN T
Sbjct  176  RNNT  179



>gb|EMS52882.1| 60S ribosomal protein L15 [Triticum urartu]
Length=268

 Score =   240 bits (612),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW+NEDSTYK
Sbjct  133  GGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYWVNEDSTYK  192

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD AH+A+RNDPRINWLC PVHK RELRGLTSAGKK+RGLRG+GH HHK RPSR
Sbjct  193  YFEVILVDVAHSAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGHRHHKNRPSR  252

Query  202  RATWKRNQT  176
            RATWKRNQT
Sbjct  253  RATWKRNQT  261



>ref|NP_001148378.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACG31200.1| 60S ribosomal protein L15 [Zea mays]
Length=204

 Score =   238 bits (606),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE
Sbjct  72   KRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +ILVD AH  IRNDPRINWLCNPVHK RELRGLTSAGKK+RGLRG+GH HHK RPSRRAT
Sbjct  132  IILVDVAHTTIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRAT  191

Query  193  WKRNQT  176
            WKRNQT
Sbjct  192  WKRNQT  197



>ref|XP_002460708.1| hypothetical protein SORBIDRAFT_02g033530 [Sorghum bicolor]
 gb|ACG25131.1| 60S ribosomal protein L15 [Zea mays]
 gb|EER97229.1| hypothetical protein SORBIDRAFT_02g033530 [Sorghum bicolor]
 tpg|DAA40842.1| TPA: ribosomal protein L15 [Zea mays]
Length=204

 Score =   238 bits (606),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE
Sbjct  72   KRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +ILVD AH  IRNDPRINWLCNPVHK RELRGLTSAGKK+RGLRG+GH HHK RPSRRAT
Sbjct  132  IILVDVAHTTIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRAT  191

Query  193  WKRNQT  176
            WKRNQT
Sbjct  192  WKRNQT  197



>gb|KHG16565.1| 60S ribosomal L15-1 -like protein [Gossypium arboreum]
Length=204

 Score =   238 bits (606),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFE
Sbjct  72   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIRNDPRINW+CNPVHK RELRGLTSAGKK RGL G+GHLHHK RPSRRAT
Sbjct  132  VILVDVAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHLHHKNRPSRRAT  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>ref|XP_002268465.1| PREDICTED: 60S ribosomal protein L15-1-like [Vitis vinifera]
Length=204

 Score =   237 bits (605),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRS+AEERAGRKLGGL+VLNSYWINEDSTYKY+EVI
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSIAEERAGRKLGGLKVLNSYWINEDSTYKYYEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH AIRNDPRINW+C PVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWK
Sbjct  134  LVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWK  193

Query  187  RNQT  176
            RN T
Sbjct  194  RNNT  197



>gb|KHG20796.1| 60S ribosomal L15-1 -like protein [Gossypium arboreum]
 gb|KJB39739.1| hypothetical protein B456_007G028600 [Gossypium raimondii]
Length=204

 Score =   237 bits (605),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFE
Sbjct  72   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIRNDPRINW+CNPVHK RELRGLTSAGKK RGL G+GHLHHK RPSRRAT
Sbjct  132  VILVDVAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHLHHKNRPSRRAT  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>gb|KJB39740.1| hypothetical protein B456_007G028600 [Gossypium raimondii]
Length=186

 Score =   236 bits (603),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFE
Sbjct  54   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFE  113

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIRNDPRINW+CNPVHK RELRGLTSAGKK RGL G+GHLHHK RPSRRAT
Sbjct  114  VILVDVAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHLHHKNRPSRRAT  173

Query  193  WKRNQT  176
            WKRN T
Sbjct  174  WKRNNT  179



>gb|KJB51842.1| hypothetical protein B456_008G234000 [Gossypium raimondii]
 gb|KJB51843.1| hypothetical protein B456_008G234000 [Gossypium raimondii]
 gb|KJB51844.1| hypothetical protein B456_008G234000 [Gossypium raimondii]
 gb|KJB51846.1| hypothetical protein B456_008G234000 [Gossypium raimondii]
Length=204

 Score =   237 bits (605),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFE
Sbjct  72   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIRNDPRINW+CNPVHK RELRGLTSAGKK RGL G+GHLHHK RPSRRAT
Sbjct  132  VILVDVAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHLHHKNRPSRRAT  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>ref|XP_007155679.1| hypothetical protein PHAVU_003G222000g [Phaseolus vulgaris]
 gb|ESW27673.1| hypothetical protein PHAVU_003G222000g [Phaseolus vulgaris]
Length=204

 Score =   237 bits (605),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSV+EERAGRKLGGLRVLNSYW+NEDSTYKYFE
Sbjct  72   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVSEERAGRKLGGLRVLNSYWVNEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            V+LVD AH+A+RNDPRINWLCNPVHK RELRGLTSAGK  RGLRGRGHL+HK RPSRRAT
Sbjct  132  VVLVDVAHSAVRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHLYHKNRPSRRAT  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>ref|XP_010933636.1| PREDICTED: 60S ribosomal protein L15-1 [Elaeis guineensis]
Length=204

 Score =   237 bits (604),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI
Sbjct  74   PVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH AIRNDPRINW+CN VHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWK
Sbjct  134  LVDAAHNAIRNDPRINWICNGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWK  193

Query  187  RNQT  176
            RNQT
Sbjct  194  RNQT  197



>gb|KCW90850.1| hypothetical protein EUGRSUZ_A02903 [Eucalyptus grandis]
Length=183

 Score =   236 bits (602),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW+NEDSTYKYFE
Sbjct  51   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWLNEDSTYKYFE  110

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH  IR DPRINW+CNPVHK RELRGLTSAGKKYRGLRG+GH HHKARPSRRAT
Sbjct  111  VILVDAAHNTIRKDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHSHHKARPSRRAT  170

Query  193  WKRNQT  176
            WKRN +
Sbjct  171  WKRNNS  176



>gb|EEE63068.1| hypothetical protein OsJ_17876 [Oryza sativa Japonica Group]
Length=377

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE
Sbjct  245  KRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFE  304

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +ILVD AH+AIRNDPRINWLC PVHK RELRGLTSAGKKYRGLRG+GH HHKARPSRRAT
Sbjct  305  IILVDVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRAT  364

Query  193  WKRNQT  176
            WKRNQT
Sbjct  365  WKRNQT  370



>ref|XP_010062398.1| PREDICTED: 60S ribosomal protein L15-1 [Eucalyptus grandis]
 gb|KCW90851.1| hypothetical protein EUGRSUZ_A02903 [Eucalyptus grandis]
Length=204

 Score =   236 bits (603),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW+NEDSTYKYFE
Sbjct  72   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWLNEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH  IR DPRINW+CNPVHK RELRGLTSAGKKYRGLRG+GH HHKARPSRRAT
Sbjct  132  VILVDAAHNTIRKDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHSHHKARPSRRAT  191

Query  193  WKRNQT  176
            WKRN +
Sbjct  192  WKRNNS  197



>ref|NP_001235890.1| uncharacterized protein LOC100305473 [Glycine max]
 ref|XP_003538942.1| PREDICTED: 60S ribosomal protein L15-1-like [Glycine max]
 gb|ACU13151.1| unknown [Glycine max]
 gb|KHN34919.1| 60S ribosomal protein L15 [Glycine soja]
 gb|KHN42683.1| 60S ribosomal protein L15 [Glycine soja]
Length=204

 Score =   236 bits (603),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/124 (93%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEVI
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AHAAIRNDPRINWL NPVHK RELRGLTSAGK  RGLRGRGHL+HKARPSRRATWK
Sbjct  134  LVDVAHAAIRNDPRINWLANPVHKHRELRGLTSAGKSNRGLRGRGHLYHKARPSRRATWK  193

Query  187  RNQT  176
            RN T
Sbjct  194  RNNT  197



>gb|ACF87670.1| unknown [Zea mays]
Length=204

 Score =   236 bits (603),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKP  QG+TQL+FQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE
Sbjct  72   KRPVPKGIVYGKPKHQGITQLRFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +ILVD AH  IRNDPRINWLCNPVHK RELRGLTSAGKK+RGLRG+GH HHK RPSRRAT
Sbjct  132  IILVDVAHTTIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRAT  191

Query  193  WKRNQT  176
            WKRNQT
Sbjct  192  WKRNQT  197



>ref|XP_003563105.1| PREDICTED: 60S ribosomal protein L15-2 [Brachypodium distachyon]
Length=204

 Score =   236 bits (602),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW+NEDSTYK
Sbjct  69   GGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYWVNEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD AH A+RNDPRINWLC PVHK RELRGLTSAGKK+RGLRG+G  HHK RPSR
Sbjct  129  YFEVILVDVAHNAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGTRHHKNRPSR  188

Query  202  RATWKRNQT  176
            RATWKRNQT
Sbjct  189  RATWKRNQT  197



>ref|XP_010107162.1| 60S ribosomal protein L15 [Morus notabilis]
 gb|EXC13927.1| 60S ribosomal protein L15 [Morus notabilis]
Length=204

 Score =   236 bits (602),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFE+I
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEII  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH AIRNDPRINW+C PVHK RELRGLTSAGKKYRGLRG+GH HHKARPSRRATWK
Sbjct  134  LVDPAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRATWK  193

Query  187  RNQT  176
            RN T
Sbjct  194  RNNT  197



>ref|XP_002530661.1| ribosomal protein L15, putative [Ricinus communis]
 gb|EEF31730.1| ribosomal protein L15, putative [Ricinus communis]
Length=204

 Score =   236 bits (602),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH AIRNDPRINWLC PVHK RELRGLTS+GKKYRGLRG+GHLHHK RPSRR TWK
Sbjct  134  LVDVAHNAIRNDPRINWLCKPVHKHRELRGLTSSGKKYRGLRGKGHLHHKNRPSRRGTWK  193

Query  187  RNQT  176
            RN T
Sbjct  194  RNNT  197



>gb|EEC78893.1| hypothetical protein OsI_19264 [Oryza sativa Indica Group]
Length=377

 Score =   242 bits (617),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE
Sbjct  245  KRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFE  304

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +ILVD AH+AIRNDPRINWLC PVHK RELRGLTSAGKKYRGLRG+GH HHKARPSRRAT
Sbjct  305  IILVDVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRAT  364

Query  193  WKRNQT  176
            WKRNQT
Sbjct  365  WKRNQT  370



>gb|KHN44085.1| 60S ribosomal protein L15 [Glycine soja]
Length=204

 Score =   236 bits (602),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEVI
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH+A+RNDPRINWLCNPVHK RELRGLTSAGK  RGLRGRGHL+HK RPSRRATWK
Sbjct  134  LVDVAHSAVRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHLYHKNRPSRRATWK  193

Query  187  RNQT  176
            RN T
Sbjct  194  RNNT  197



>gb|AGL08210.1| 60S ribosomal protein L15 [Arachis hypogaea]
 gb|AGL08221.1| 60S ribosomal protein L15 [Arachis hypogaea]
Length=204

 Score =   236 bits (602),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEE+AGRKLGGLRVLNSYW+NEDSTYKYFE
Sbjct  72   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEEKAGRKLGGLRVLNSYWVNEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +I+VD AH AIRNDPRINWLCNPVHK RELRGLTSAGK  RGLRG+GHL+HK RPSRRAT
Sbjct  132  IIMVDVAHTAIRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGKGHLYHKNRPSRRAT  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>gb|ACU24496.1| unknown [Glycine max]
Length=204

 Score =   236 bits (601),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEVI
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH+A+RNDPRINWLCNPVHK RELRGLTSAGK  RGLRGRGHL+HK RPSRRATWK
Sbjct  134  LVDVAHSAVRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHLYHKNRPSRRATWK  193

Query  187  RNQT  176
            RN T
Sbjct  194  RNNT  197



>ref|XP_002461521.1| hypothetical protein SORBIDRAFT_02g004020 [Sorghum bicolor]
 gb|EER98042.1| hypothetical protein SORBIDRAFT_02g004020 [Sorghum bicolor]
Length=204

 Score =   236 bits (601),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE
Sbjct  72   KRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +ILVD AH AI+ DPRINWLCNPVHK RELRGLTSAGKK+RGLRG+GH HHK RPSRRAT
Sbjct  132  IILVDVAHTAIKTDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRAT  191

Query  193  WKRNQT  176
            WKRNQT
Sbjct  192  WKRNQT  197



>ref|XP_003549922.1| PREDICTED: 60S ribosomal protein L15-1-like [Glycine max]
 gb|KHN09835.1| 60S ribosomal protein L15 [Glycine soja]
Length=204

 Score =   235 bits (600),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEVI
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH A+RNDPRINWLCNPVHK RELRGLTSAGK  RGLRGRGHL+HK RPSRRATWK
Sbjct  134  LVDVAHTAVRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHLYHKNRPSRRATWK  193

Query  187  RNQT  176
            RN T
Sbjct  194  RNNT  197



>ref|XP_007039793.1| Ribosomal protein L23/L15e family protein isoform 3 [Theobroma 
cacao]
 gb|EOY24294.1| Ribosomal protein L23/L15e family protein isoform 3 [Theobroma 
cacao]
Length=204

 Score =   235 bits (600),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFE
Sbjct  72   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIRNDPRINW+CNPVHK RELRGLTSAGKK RGL G+GHL+HK RPSRRAT
Sbjct  132  VILVDVAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHLYHKNRPSRRAT  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>gb|ACV50439.1| ribosomal protein L15 [Jatropha curcas]
Length=204

 Score =   235 bits (599),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFE I
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEDI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVDTAH AIRNDPRINW+C PVHK RELRGLT AGKKYRGLRGRGHLHHKARPSRRA WK
Sbjct  134  LVDTAHNAIRNDPRINWICKPVHKHRELRGLTFAGKKYRGLRGRGHLHHKARPSRRANWK  193

Query  187  RNQT  176
            RN T
Sbjct  194  RNNT  197



>ref|XP_007039791.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007039792.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24292.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24293.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma 
cacao]
Length=206

 Score =   235 bits (599),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYWINEDSTYKYFE
Sbjct  74   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWINEDSTYKYFE  133

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIRNDPRINW+CNPVHK RELRGLTSAGKK RGL G+GHL+HK RPSRRAT
Sbjct  134  VILVDVAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHLYHKNRPSRRAT  193

Query  193  WKRNQT  176
            WKRN T
Sbjct  194  WKRNNT  199



>ref|XP_010919628.1| PREDICTED: 60S ribosomal protein L15 isoform X2 [Elaeis guineensis]
Length=186

 Score =   234 bits (597),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI
Sbjct  56   PVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  115

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH AIRNDPRINW+C  VHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWK
Sbjct  116  LVDAAHNAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWK  175

Query  187  RNQT  176
            RNQT
Sbjct  176  RNQT  179



>ref|XP_008234416.1| PREDICTED: 60S ribosomal protein L15-like [Prunus mume]
Length=204

 Score =   235 bits (599),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPV KGIVYGKPT QGV+QLKFQRSKRSVAEERAGRKL GL+VLNSYW+NEDSTYK
Sbjct  69   GGRKRPVAKGIVYGKPTNQGVSQLKFQRSKRSVAEERAGRKLAGLKVLNSYWVNEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD AH AIRNDPRINW+CNPVHK RELRGLTSAGKK RGL G+GHLHHKARPSR
Sbjct  129  YFEVILVDAAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLCGKGHLHHKARPSR  188

Query  202  RATWKRNQT  176
            RA WK N T
Sbjct  189  RANWKSNNT  197



>ref|XP_010919627.1| PREDICTED: 60S ribosomal protein L15 isoform X1 [Elaeis guineensis]
Length=204

 Score =   235 bits (599),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI
Sbjct  74   PVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH AIRNDPRINW+C  VHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWK
Sbjct  134  LVDAAHNAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWK  193

Query  187  RNQT  176
            RNQT
Sbjct  194  RNQT  197



>ref|XP_002277836.1| PREDICTED: 60S ribosomal protein L15-1 [Vitis vinifera]
Length=204

 Score =   234 bits (598),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKY+E+I
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYYEII  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH AIRNDPRINW+C PVHK RELRGLTSAGKKYRGLRG+GH HHKARPSRRATWK
Sbjct  134  LVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHRHHKARPSRRATWK  193

Query  187  RNQT  176
            RN T
Sbjct  194  RNNT  197



>emb|CBI16601.3| unnamed protein product [Vitis vinifera]
Length=206

 Score =   234 bits (598),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKY+E+I
Sbjct  76   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYYEII  135

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH AIRNDPRINW+C PVHK RELRGLTSAGKKYRGLRG+GH HHKARPSRRATWK
Sbjct  136  LVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHRHHKARPSRRATWK  195

Query  187  RNQT  176
            RN T
Sbjct  196  RNNT  199



>ref|XP_008798983.1| PREDICTED: 60S ribosomal protein L15-like [Phoenix dactylifera]
 ref|XP_008810110.1| PREDICTED: 60S ribosomal protein L15-like [Phoenix dactylifera]
Length=204

 Score =   234 bits (598),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI
Sbjct  74   PVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH A+RNDPRINW+C  VHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWK
Sbjct  134  LVDAAHNAVRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWK  193

Query  187  RNQT  176
            RNQT
Sbjct  194  RNQT  197



>ref|XP_010529971.1| PREDICTED: 60S ribosomal protein L15-1 [Tarenaya hassleriana]
 ref|XP_010529975.1| PREDICTED: 60S ribosomal protein L15-1 [Tarenaya hassleriana]
Length=204

 Score =   234 bits (597),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EVI
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVDTAH+AIRNDPR+NW+CNPVHK RELRGLTS GKK RGLRG+GHL+HK RPSRRATWK
Sbjct  134  LVDTAHSAIRNDPRVNWICNPVHKHRELRGLTSEGKKNRGLRGKGHLYHKNRPSRRATWK  193

Query  187  RNQT  176
            RN T
Sbjct  194  RNNT  197



>ref|XP_008775187.1| PREDICTED: 60S ribosomal protein L15 [Phoenix dactylifera]
Length=204

 Score =   234 bits (597),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKY+EVI
Sbjct  74   PVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYYEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH+AIRNDPRINW+C  VHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWK
Sbjct  134  LVDAAHSAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWK  193

Query  187  RNQT  176
            RNQT
Sbjct  194  RNQT  197



>ref|NP_001236804.1| uncharacterized protein LOC100306052 [Glycine max]
 gb|ACU14044.1| unknown [Glycine max]
Length=204

 Score =   234 bits (597),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEVI
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH+A+RNDPRINWLCNPVHK RELRGLTSAGK  RGLRGRGHL+HK RPSRRATWK
Sbjct  134  LVDVAHSAVRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHLYHKNRPSRRATWK  193

Query  187  RN  182
            RN
Sbjct  194  RN  195



>ref|XP_010934657.1| PREDICTED: 60S ribosomal protein L15-1-like [Elaeis guineensis]
Length=204

 Score =   234 bits (596),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGI+YGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKY+EVI
Sbjct  74   PVPKGIIYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYYEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH+AIRNDPRINW+C  VHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWK
Sbjct  134  LVDAAHSAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWK  193

Query  187  RNQT  176
            RNQT
Sbjct  194  RNQT  197



>ref|XP_008796124.1| PREDICTED: 60S ribosomal protein L15-2 [Phoenix dactylifera]
Length=204

 Score =   233 bits (595),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI
Sbjct  74   PVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH  IRNDPRINW+C  VHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWK
Sbjct  134  LVDAAHNTIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWK  193

Query  187  RNQT  176
            RNQT
Sbjct  194  RNQT  197



>ref|XP_010104882.1| 60S ribosomal protein L15 [Morus notabilis]
 gb|EXC02118.1| 60S ribosomal protein L15 [Morus notabilis]
Length=241

 Score =   234 bits (598),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW NEDSTYKYFEVI
Sbjct  111  PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWTNEDSTYKYFEVI  170

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH AIRNDPRINWL  PVHK RELRGLTSAGKKYRGLRG+GH HHKARPSRRATWK
Sbjct  171  LVDVAHNAIRNDPRINWLSKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRATWK  230

Query  187  RNQT  176
            RN T
Sbjct  231  RNNT  234



>emb|CBI25842.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   233 bits (593),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKY+E+I
Sbjct  56   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYYEII  115

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH  IRNDPRINW+C PVHK RELRGLTSAGKKYRGLRG+GH HHKARPSRRATWK
Sbjct  116  LVDAAHNTIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHRHHKARPSRRATWK  175

Query  187  RNQT  176
            RN T
Sbjct  176  RNNT  179



>ref|XP_003635402.1| PREDICTED: 60S ribosomal protein L15-1 [Vitis vinifera]
Length=204

 Score =   233 bits (594),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKY+E+I
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYYEII  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH  IRNDPRINW+C PVHK RELRGLTSAGKKYRGLRG+GH HHKARPSRRATWK
Sbjct  134  LVDAAHNTIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHRHHKARPSRRATWK  193

Query  187  RNQT  176
            RN T
Sbjct  194  RNNT  197



>ref|XP_004955579.1| PREDICTED: 60S ribosomal protein L15-1-like isoform X2 [Setaria 
italica]
Length=204

 Score =   233 bits (593),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKP  QGVTQLKFQR+KRSVAEERAGRK+GGLRVLNSYW+NEDSTYKYFE
Sbjct  72   KRPVPKGIVYGKPKHQGVTQLKFQRNKRSVAEERAGRKIGGLRVLNSYWVNEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +ILVD AHAAIRNDPRINWLC  VHK RELRGLTSAGKKYRGLRG+G  HHK RPSRRAT
Sbjct  132  IILVDVAHAAIRNDPRINWLCKDVHKHRELRGLTSAGKKYRGLRGKGSSHHKNRPSRRAT  191

Query  193  WKRNQT  176
            WKRNQT
Sbjct  192  WKRNQT  197



>ref|XP_010264371.1| PREDICTED: 60S ribosomal protein L15-like [Nelumbo nucifera]
Length=204

 Score =   233 bits (593),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGI+YGKPT QG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYWINEDSTYKY+E+I
Sbjct  74   PVPKGIMYGKPTNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYYEII  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH AIRNDPRINW+C PVHK RELRGLTSAGKKYRGL G+GHLHHKARPSRRATWK
Sbjct  134  LVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLHGKGHLHHKARPSRRATWK  193

Query  187  RNQT  176
            RN T
Sbjct  194  RNNT  197



>ref|XP_009406701.1| PREDICTED: 60S ribosomal protein L15-1-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   232 bits (591),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKY+E+I
Sbjct  74   PVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYYEII  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            L+D AH+AIRNDPRINW+C  VHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWK
Sbjct  134  LIDPAHSAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWK  193

Query  187  RNQT  176
            RNQT
Sbjct  194  RNQT  197



>sp|O65050.1|RL15A_PICMA RecName: Full=60S ribosomal protein L15-1 [Picea mariana]
 gb|AAC32112.1| probable 60S ribosomal protein L15 [Picea mariana]
 gb|ABK22257.1| unknown [Picea sitchensis]
Length=204

 Score =   231 bits (590),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKP  QG+TQLKFQRS RSVAEERAGRKLGGLRVLNSYWIN+DSTYKY+E
Sbjct  72   KRPVPKGIVYGKPKNQGITQLKFQRSLRSVAEERAGRKLGGLRVLNSYWINQDSTYKYYE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +ILVD AH+AIR DPRINW+CN VHK RELRGLTSAGKKYRGLRGRGHL+HKARPS+RAT
Sbjct  132  IILVDQAHSAIRKDPRINWICNAVHKHRELRGLTSAGKKYRGLRGRGHLYHKARPSKRAT  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>ref|XP_010539199.1| PREDICTED: 60S ribosomal protein L15-1-like [Tarenaya hassleriana]
Length=197

 Score =   231 bits (590),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKL GLRVLNSYWINEDSTYKY+EVI
Sbjct  67   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLAGLRVLNSYWINEDSTYKYYEVI  126

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVDTAH+A+RNDPR+NW+CNPVHK RELRGLTS GKK RGLRG+GHL+HK RPSRRATWK
Sbjct  127  LVDTAHSAVRNDPRMNWICNPVHKHRELRGLTSEGKKNRGLRGKGHLYHKNRPSRRATWK  186

Query  187  RNQT  176
            RN T
Sbjct  187  RNNT  190



>ref|XP_009398340.1| PREDICTED: 60S ribosomal protein L15-1-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   231 bits (590),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKY+E+I
Sbjct  74   PVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYYEII  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            L+D AH AIRNDPRINW+C  VHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWK
Sbjct  134  LIDPAHGAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWK  193

Query  187  RNQT  176
            RNQT
Sbjct  194  RNQT  197



>sp|O65082.1|RL15B_PICMA RecName: Full=60S ribosomal protein L15-2 [Picea mariana]
 gb|AAC32144.1| probable 60S ribosomal protein L15 [Picea mariana]
 gb|ABK25889.1| unknown [Picea sitchensis]
Length=204

 Score =   231 bits (590),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKP  QG+TQLKFQRS RSVAEERAGRKLGGLRVLNSYWIN+DSTYKY+E
Sbjct  72   KRPVPKGIVYGKPKNQGITQLKFQRSLRSVAEERAGRKLGGLRVLNSYWINQDSTYKYYE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            V+LVD AH  IRNDPRINW+CN VHK RELRGLTSAGKKYRGLRGRGHL+HKARPS+RAT
Sbjct  132  VVLVDQAHTVIRNDPRINWICNAVHKHRELRGLTSAGKKYRGLRGRGHLYHKARPSKRAT  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>ref|XP_004957717.1| PREDICTED: 60S ribosomal protein L15-1-like [Setaria italica]
Length=204

 Score =   231 bits (590),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRK+GGLRVLNSYW+NEDSTYKYFE
Sbjct  72   KRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKIGGLRVLNSYWVNEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIRNDPRINWLC  VHK RELRGLTSAGKKYRGLRG+G  HHK RPSRRAT
Sbjct  132  VILVDVAHTAIRNDPRINWLCKDVHKHRELRGLTSAGKKYRGLRGKGSAHHKNRPSRRAT  191

Query  193  WKRNQT  176
            WKRNQT
Sbjct  192  WKRNQT  197



>ref|XP_009399011.1| PREDICTED: 60S ribosomal protein L15-1-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   231 bits (590),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKY+EVI
Sbjct  74   PVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYYEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            L+D AH AIRNDPRINW+C  VHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWK
Sbjct  134  LIDPAHNAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWK  193

Query  187  RNQT  176
            RNQT
Sbjct  194  RNQT  197



>ref|XP_004491939.1| PREDICTED: 60S ribosomal protein L15-1-like isoform X2 [Cicer 
arietinum]
Length=204

 Score =   231 bits (589),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDST+KYFE
Sbjct  72   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTFKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIRNDPRINWL NPVHK RELRGLTSAGK+ RGLRG+GH +HK RPSRRAT
Sbjct  132  VILVDVAHTAIRNDPRINWLVNPVHKHRELRGLTSAGKENRGLRGKGHRYHKNRPSRRAT  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>ref|XP_009418976.1| PREDICTED: 60S ribosomal protein L15-1 [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   231 bits (589),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+I
Sbjct  74   PVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVVNSYWVNEDSTYKYYEII  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            L+D AH+AIRNDPRINW+C  VHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWK
Sbjct  134  LIDPAHSAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWK  193

Query  187  RNQT  176
            RNQT
Sbjct  194  RNQT  197



>ref|XP_006837338.1| hypothetical protein AMTR_s00111p00086580 [Amborella trichopoda]
 gb|ERN00192.1| hypothetical protein AMTR_s00111p00086580 [Amborella trichopoda]
Length=204

 Score =   231 bits (589),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYWIN+DSTYKY+EVI
Sbjct  74   PVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYWINQDSTYKYYEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH AIRNDPRINW+CNPVHK RELRGLTSAGKKYRGLRG+GHL+HK RPSRRATWK
Sbjct  134  LVDAAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKNRPSRRATWK  193

Query  187  RNQT  176
            RN T
Sbjct  194  RNNT  197



>ref|XP_004491938.1| PREDICTED: 60S ribosomal protein L15-1-like isoform X1 [Cicer 
arietinum]
Length=216

 Score =   231 bits (589),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDST+KYFE
Sbjct  84   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTFKYFE  143

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIRNDPRINWL NPVHK RELRGLTSAGK+ RGLRG+GH +HK RPSRRAT
Sbjct  144  VILVDVAHTAIRNDPRINWLVNPVHKHRELRGLTSAGKENRGLRGKGHRYHKNRPSRRAT  203

Query  193  WKRNQT  176
            WKRN T
Sbjct  204  WKRNNT  209



>ref|XP_010258850.1| PREDICTED: 60S ribosomal protein L15 [Nelumbo nucifera]
Length=204

 Score =   231 bits (588),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGI+YGKPT QG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYWINEDSTYKY+E+I
Sbjct  74   PVPKGIMYGKPTNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYYEII  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH AIRNDPRINW+C PVHK RELRGLTSAGKKYRGL G+GHLHHKARPSRRA WK
Sbjct  134  LVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLHGKGHLHHKARPSRRANWK  193

Query  187  RNQT  176
            RN T
Sbjct  194  RNNT  197



>ref|XP_008360544.1| PREDICTED: 60S ribosomal protein L15 [Malus domestica]
Length=204

 Score =   230 bits (587),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPV KGIVYGKPT QGVTQLKFQRSKRSVAEERAGR+LGGLRVLNSYWINEDSTY YFE
Sbjct  72   KRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRRLGGLRVLNSYWINEDSTYXYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIRND RIN LCNPVHK RELRGLTSAGKKYRGLRG+GHL+HKARPSRRAT
Sbjct  132  VILVDVAHNAIRNDARINXLCNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKARPSRRAT  191

Query  193  WKRN  182
            WKRN
Sbjct  192  WKRN  195



>ref|XP_009408522.1| PREDICTED: 60S ribosomal protein L15-1-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   230 bits (587),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKY+E+I
Sbjct  74   PVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYYEII  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            L+D +H+AIRNDPRINW+C  VHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWK
Sbjct  134  LLDPSHSAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWK  193

Query  187  RNQT  176
            RNQT
Sbjct  194  RNQT  197



>ref|XP_004512167.1| PREDICTED: 60S ribosomal protein L15-1-like [Cicer arietinum]
Length=204

 Score =   230 bits (586),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKY+EVI
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWMNEDSTYKYYEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH AIRNDPR+NW+CNPVHK RELRGLTSAGK+ RGL+G+GH +HKARPSRRATWK
Sbjct  134  LVDVAHTAIRNDPRVNWVCNPVHKHRELRGLTSAGKQNRGLQGKGHRYHKARPSRRATWK  193

Query  187  RNQT  176
            RN T
Sbjct  194  RNNT  197



>ref|XP_006837287.1| hypothetical protein AMTR_s00111p00023340 [Amborella trichopoda]
 gb|ERN00141.1| hypothetical protein AMTR_s00111p00023340 [Amborella trichopoda]
Length=233

 Score =   230 bits (587),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYWIN+DSTYKY+EVI
Sbjct  103  PVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYWINQDSTYKYYEVI  162

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH AIRNDPRINW+CNPVHK RELRGLTSAGKKYRGLRG+GHL+HK RPSRRATWK
Sbjct  163  LVDAAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKNRPSRRATWK  222

Query  187  RNQT  176
            RN T
Sbjct  223  RNNT  226



>ref|XP_006838929.1| hypothetical protein AMTR_s00002p00270230 [Amborella trichopoda]
 gb|ERN01498.1| hypothetical protein AMTR_s00002p00270230 [Amborella trichopoda]
Length=204

 Score =   229 bits (583),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYWIN+DSTYKY+E+I
Sbjct  74   PVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYWINQDSTYKYYEII  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH AIRNDPRINW+  PVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWK
Sbjct  134  LVDAAHNAIRNDPRINWITKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWK  193

Query  187  RNQT  176
            RN T
Sbjct  194  RNNT  197



>gb|ACJ84067.1| unknown [Medicago truncatula]
Length=204

 Score =   227 bits (579),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPV KGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDST+KYFE
Sbjct  72   KRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTFKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH+AIRNDPRINWL NPVHK RELRGLTSAGK+ RGL G+GH +HKARPSRRA 
Sbjct  132  VILVDVAHSAIRNDPRINWLTNPVHKHRELRGLTSAGKENRGLSGKGHRYHKARPSRRAN  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>gb|AFK49215.1| unknown [Medicago truncatula]
 gb|KEH35101.1| 60S ribosomal protein L15-1 [Medicago truncatula]
Length=204

 Score =   227 bits (579),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPV KGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDST+KYFE
Sbjct  72   KRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTFKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH+AIRNDPRINWL NPVHK RELRGLTSAGK+ RGL G+GH +HKARPSRRA 
Sbjct  132  VILVDVAHSAIRNDPRINWLTNPVHKHRELRGLTSAGKENRGLSGKGHRYHKARPSRRAN  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>gb|AFK46983.1| unknown [Lotus japonicus]
Length=204

 Score =   227 bits (578),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKY+E
Sbjct  72   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYYE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +ILVD AH AIRNDPRINWLCNPVHK REL G TSAGK  RGL G+GH HHKARPSRRAT
Sbjct  132  IILVDVAHTAIRNDPRINWLCNPVHKHRELTGKTSAGKHNRGLVGKGHRHHKARPSRRAT  191

Query  193  WKRNQT  176
            WK+N +
Sbjct  192  WKKNNS  197



>gb|ADA67930.1| putative 60S ribosomal protein L15 [Wolffia arrhiza]
Length=204

 Score =   227 bits (578),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKP  QG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYW+NEDSTYKY+EVI
Sbjct  74   PVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYWVNEDSTYKYYEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD A  AIRNDPRINW+C  VHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWK
Sbjct  134  LVDGALNAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWK  193

Query  187  RNQT  176
            RNQT
Sbjct  194  RNQT  197



>ref|XP_003593619.1| Ribosomal protein L15 [Medicago truncatula]
 gb|AES63870.1| 60S ribosomal protein L15-1 [Medicago truncatula]
Length=252

 Score =   228 bits (581),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPV KGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDST+KYFE
Sbjct  120  KRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTFKYFE  179

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH+AIRNDPRINWL NPVHK RELRGLTSAGK+ RGL G+GH +HKARPSRRA 
Sbjct  180  VILVDVAHSAIRNDPRINWLTNPVHKHRELRGLTSAGKENRGLSGKGHRYHKARPSRRAN  239

Query  193  WKRNQT  176
            WKRN T
Sbjct  240  WKRNNT  245



>ref|XP_002879569.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55828.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
Length=204

 Score =   226 bits (576),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKL GLRV+NSYWINEDSTYKY+E
Sbjct  72   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLSGLRVVNSYWINEDSTYKYYE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +ILVD AH A+RNDPRINW+CNPVHK RELRGLTS GKK RGLRG+GH +HK RPSRRAT
Sbjct  132  IILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRAT  191

Query  193  WKRNQT  176
            WK+N T
Sbjct  192  WKKNNT  197



>ref|XP_004299420.1| PREDICTED: 60S ribosomal protein L15-1 [Fragaria vesca subsp. 
vesca]
Length=204

 Score =   226 bits (575),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PV KGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI
Sbjct  74   PVAKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH+ I+ DPRINW+ NPVHK RELRGLTSAGKKYRGLRG+GH +HK RPSRRATWK
Sbjct  134  LVDVAHSVIKKDPRINWIVNPVHKHRELRGLTSAGKKYRGLRGKGHRYHKNRPSRRATWK  193

Query  187  RNQT  176
            RN T
Sbjct  194  RNNT  197



>emb|CAB10520.1| ribosomal protein [Arabidopsis thaliana]
 emb|CAB78742.1| ribosomal protein [Arabidopsis thaliana]
Length=216

 Score =   223 bits (569),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+I
Sbjct  86   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEII  145

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH A+RNDPRINW+CNPVHK RELRGLTS GKK RGLRG+GH +HK RPSRRATWK
Sbjct  146  LVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWK  205

Query  187  RNQT  176
            +N +
Sbjct  206  KNNS  209



>emb|CDX76573.1| BnaA08g08270D [Brassica napus]
Length=186

 Score =   223 bits (567),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+I
Sbjct  56   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEII  115

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH AIRNDPRINW+CNPVHK RELRGLTS GKK RGLRG+GH +HK RPSRRATWK
Sbjct  116  LVDPAHNAIRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWK  175

Query  187  RNQT  176
            +N +
Sbjct  176  KNNS  179



>ref|XP_009108318.1| PREDICTED: 60S ribosomal protein L15-1-like [Brassica rapa]
Length=204

 Score =   223 bits (568),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+I
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEII  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH AIRNDPRINW+CNPVHK RELRGLTS GKK RGLRG+GH +HK RPSRRATWK
Sbjct  134  LVDPAHNAIRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWK  193

Query  187  RNQT  176
            +N +
Sbjct  194  KNNS  197



>emb|CDY09632.1| BnaC07g34290D [Brassica napus]
 emb|CDX90478.1| BnaA03g43030D [Brassica napus]
Length=186

 Score =   222 bits (566),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+I
Sbjct  56   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEII  115

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH A+RNDPRINW+CNPVHK RELRGLTS GKK RGLRG+GH +HK RPSRRATWK
Sbjct  116  LVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHRNHKNRPSRRATWK  175

Query  187  RNQT  176
            +N +
Sbjct  176  KNNS  179



>ref|XP_009136839.1| PREDICTED: 60S ribosomal protein L15-1 [Brassica rapa]
 gb|ABD65137.1| 60S ribosomal protein L15 [Brassica oleracea]
Length=204

 Score =   223 bits (567),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+I
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEII  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH A+RNDPRINW+CNPVHK RELRGLTS GKK RGLRG+GH +HK RPSRRATWK
Sbjct  134  LVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHRNHKNRPSRRATWK  193

Query  187  RNQT  176
            +N +
Sbjct  194  KNNS  197



>emb|CDY59531.1| BnaCnng35130D [Brassica napus]
Length=186

 Score =   222 bits (565),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+I
Sbjct  56   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEII  115

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH A+RNDPRINW+CNPVHK RELRGLTS GKK RGLRG+GH +HK RPSRRATWK
Sbjct  116  LVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWK  175

Query  187  RNQT  176
            +N +
Sbjct  176  KNNS  179



>ref|XP_009136806.1| PREDICTED: 60S ribosomal protein L15-1-like [Brassica rapa]
Length=204

 Score =   222 bits (566),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+I
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEII  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH A+RNDPRINW+CNPVHK RELRGLTS GKK RGLRG+GH +HK RPSRRATWK
Sbjct  134  LVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHRNHKNRPSRRATWK  193

Query  187  RNQT  176
            +N +
Sbjct  194  KNNS  197



>ref|XP_009145572.1| PREDICTED: 60S ribosomal protein L15-1 [Brassica rapa]
 ref|XP_009123031.1| PREDICTED: 60S ribosomal protein L15-1 [Brassica rapa]
Length=204

 Score =   222 bits (566),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+I
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEII  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH A+RNDPRINW+CNPVHK RELRGLTS GKK RGLRG+GH +HK RPSRRATWK
Sbjct  134  LVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWK  193

Query  187  RNQT  176
            +N +
Sbjct  194  KNNS  197



>ref|NP_193470.1| 60S ribosomal protein L15-2 [Arabidopsis thaliana]
 ref|XP_006282721.1| hypothetical protein CARUB_v10005754mg [Capsella rubella]
 sp|Q8VYF1.1|RL152_ARATH RecName: Full=60S ribosomal protein L15-2 [Arabidopsis thaliana]
 gb|AAL59940.1| putative 60S ribosomal protein L15-like protein [Arabidopsis 
thaliana]
 gb|AAM64649.1| 60S ribosomal protein L15 homolog [Arabidopsis thaliana]
 gb|AAM67498.1| putative 60S ribosomal protein L15-like protein [Arabidopsis 
thaliana]
 dbj|BAE98399.1| 60S ribosomal protein L15 homolog [Arabidopsis thaliana]
 gb|AEE83883.1| 60S ribosomal protein L15-2 [Arabidopsis thaliana]
 gb|EOA15619.1| hypothetical protein CARUB_v10005754mg [Capsella rubella]
Length=204

 Score =   222 bits (566),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+I
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEII  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH A+RNDPRINW+CNPVHK RELRGLTS GKK RGLRG+GH +HK RPSRRATWK
Sbjct  134  LVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWK  193

Query  187  RNQT  176
            +N +
Sbjct  194  KNNS  197



>ref|NP_193405.1| 60S ribosomal protein L15-1 [Arabidopsis thaliana]
 ref|XP_002868071.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006391552.1| hypothetical protein EUTSA_v10019144mg [Eutrema salsugineum]
 ref|XP_006414312.1| hypothetical protein EUTSA_v10026269mg [Eutrema salsugineum]
 ref|XP_010440111.1| PREDICTED: 60S ribosomal protein L15-1 [Camelina sativa]
 ref|XP_010449726.1| PREDICTED: 60S ribosomal protein L15-1 [Camelina sativa]
 sp|O23515.1|RL151_ARATH RecName: Full=60S ribosomal protein L15-1 [Arabidopsis thaliana]
 gb|AAK44167.1|AF370352_1 putative ribosomal protein [Arabidopsis thaliana]
 emb|CAB10447.1| ribosomal protein [Arabidopsis thaliana]
 emb|CAB78714.1| ribosomal protein [Arabidopsis thaliana]
 gb|AAL24229.1| AT4g16720/dl4385c [Arabidopsis thaliana]
 gb|AAL91619.1| AT4g16720/dl4385c [Arabidopsis thaliana]
 gb|AAM64387.1| ribosomal protein [Arabidopsis thaliana]
 gb|AAM91731.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAN28757.1| At4g16720/dl4385c [Arabidopsis thaliana]
 gb|EFH44330.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
 gb|AEE83791.1| 60S ribosomal protein L15-1 [Arabidopsis thaliana]
 gb|ESQ28838.1| hypothetical protein EUTSA_v10019144mg [Eutrema salsugineum]
 gb|ESQ55765.1| hypothetical protein EUTSA_v10026269mg [Eutrema salsugineum]
 gb|KFK23089.1| hypothetical protein AALP_AAs51321U000100 [Arabis alpina]
Length=204

 Score =   222 bits (566),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+I
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEII  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH A+RNDPRINW+CNPVHK RELRGLTS GKK RGLRG+GH +HK RPSRRATWK
Sbjct  134  LVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWK  193

Query  187  RNQT  176
            +N +
Sbjct  194  KNNS  197



>gb|KFK32179.1| hypothetical protein AALP_AA6G207900 [Arabis alpina]
Length=204

 Score =   222 bits (566),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+I
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEII  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH A+RNDPRINW+CNPVHK RELRGLTS GKK RGLRG+GH +HK RPSRRATWK
Sbjct  134  LVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWK  193

Query  187  RNQT  176
            +N +
Sbjct  194  KNNS  197



>emb|CDY53647.1| BnaA08g30370D [Brassica napus]
Length=237

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+I
Sbjct  107  PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEII  166

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH A+RNDPRINW+CNPVHK RELRGLTS GKK RGLRG+GH +HK RPSRRATWK
Sbjct  167  LVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWK  226

Query  187  RNQT  176
            +N +
Sbjct  227  KNNS  230



>ref|XP_010434676.1| PREDICTED: 60S ribosomal protein L15-1-like [Camelina sativa]
Length=204

 Score =   222 bits (566),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+I
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEII  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH A+RNDPRINW+CNPVHK RELRGLTS GKK RGLRG+GH +HK RPSRRATWK
Sbjct  134  LVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWK  193

Query  187  RNQT  176
            +N +
Sbjct  194  KNNS  197



>ref|XP_002868106.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_010434780.1| PREDICTED: 60S ribosomal protein L15-1-like [Camelina sativa]
 ref|XP_010440015.1| PREDICTED: 60S ribosomal protein L15-1-like [Camelina sativa]
 ref|XP_010449626.1| PREDICTED: 60S ribosomal protein L15-1-like [Camelina sativa]
 gb|EFH44365.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
Length=204

 Score =   222 bits (566),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+I
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEII  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH A+RNDPRINW+CNPVHK RELRGLTS GKK RGLRG+GH +HK RPSRRATWK
Sbjct  134  LVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWK  193

Query  187  RNQT  176
            +N +
Sbjct  194  KNNS  197



>ref|XP_006282719.1| hypothetical protein CARUB_v10005752mg [Capsella rubella]
 gb|EOA15617.1| hypothetical protein CARUB_v10005752mg [Capsella rubella]
Length=204

 Score =   222 bits (566),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+I
Sbjct  74   PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEII  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH A+RNDPRINW+CNPVHK RELRGLTS GKK RGLRG+GH +HK RPSRRATWK
Sbjct  134  LVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWK  193

Query  187  RNQT  176
            +N +
Sbjct  194  KNNS  197



>emb|CDX90499.1| BnaA03g42820D [Brassica napus]
Length=275

 Score =   224 bits (572),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+I
Sbjct  145  PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEII  204

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH A+RNDPRINW+CNPVHK RELRGLTS GKK RGLRG+GH +HK RPSRRATWK
Sbjct  205  LVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHRNHKNRPSRRATWK  264

Query  187  RNQT  176
            +N +
Sbjct  265  KNNS  268



>emb|CDY60707.1| BnaC07g50070D [Brassica napus]
Length=274

 Score =   224 bits (571),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+I
Sbjct  144  PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEII  203

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH A+RNDPRINW+CNPVHK RELRGLTS GKK RGLRG+GH +HK RPSRRATWK
Sbjct  204  LVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHRNHKNRPSRRATWK  263

Query  187  RNQT  176
            +N +
Sbjct  264  KNNS  267



>emb|CDY54747.1| BnaAnng13420D [Brassica napus]
Length=239

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+I
Sbjct  109  PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEII  168

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH A+RNDPRINW+CNPVHK RELRGLTS GKK RGLRG+GH +HK RPSRRATWK
Sbjct  169  LVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWK  228

Query  187  RNQT  176
            +N +
Sbjct  229  KNNS  232



>emb|CDY50842.1| BnaC08g47880D, partial [Brassica napus]
Length=260

 Score =   223 bits (568),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+I
Sbjct  130  PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEII  189

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH A+RNDPRINW+CNPVHK RELRGLTS GKK RGLRG+GH +HK RPSRRATWK
Sbjct  190  LVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWK  249

Query  187  RNQT  176
            +N +
Sbjct  250  KNNS  253



>emb|CDY40505.1| BnaC01g20070D [Brassica napus]
Length=318

 Score =   224 bits (571),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+I
Sbjct  188  PVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEII  247

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH A+RNDPRINW+CNPVHK RELRGLTS GKK RGLRG+GH +HK RPSRRATWK
Sbjct  248  LVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWK  307

Query  187  RNQT  176
            +N +
Sbjct  308  KNNS  311



>gb|AFK37409.1| unknown [Lotus japonicus]
Length=204

 Score =   219 bits (559),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPV KGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE
Sbjct  72   KRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +ILV  AH AIRNDPRINWLC PVH  RELRG TSAGK  R LRGRGH +HKARPSRRAT
Sbjct  132  IILVGIAHTAIRNDPRINWLCKPVHNHRELRGNTSAGKSNRCLRGRGHRYHKARPSRRAT  191

Query  193  WKRNQT  176
            W+RN +
Sbjct  192  WRRNNS  197



>ref|XP_001764493.1| predicted protein [Physcomitrella patens]
 gb|EDQ70760.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   219 bits (559),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPV KGIVYGKP  QG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYWIN+DSTYKYFE
Sbjct  72   KRPVAKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYWINQDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +ILVD  HA IR DPRINW+ NPVHK RELRGLTSAGKKYRGLRGRGHL+ KARPS RAT
Sbjct  132  IILVDPQHAVIRKDPRINWIVNPVHKHRELRGLTSAGKKYRGLRGRGHLYTKARPSIRAT  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>ref|XP_001753036.1| predicted protein [Physcomitrella patens]
 ref|XP_001758957.1| predicted protein [Physcomitrella patens]
 ref|XP_001772614.1| predicted protein [Physcomitrella patens]
 gb|EDQ62656.1| predicted protein [Physcomitrella patens]
 gb|EDQ76463.1| predicted protein [Physcomitrella patens]
 gb|EDQ82077.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   218 bits (555),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPV KGIVYGKP  QG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYWIN+DSTYKYFE
Sbjct  72   KRPVAKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYWINQDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +ILVD  H  IR DPRINW+ NPVHK RELRGLTSAGKKYRGLRGRGHL+ KARPS RAT
Sbjct  132  IILVDPQHTVIRKDPRINWIVNPVHKHRELRGLTSAGKKYRGLRGRGHLYTKARPSIRAT  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>gb|AFK40278.1| unknown [Lotus japonicus]
Length=222

 Score =   218 bits (556),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPV KGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE
Sbjct  66   KRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFE  125

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +ILVD AH AIRNDPRINWLC PVH  RELRG TSAGK  R LRGRGH +HKARPSRRAT
Sbjct  126  IILVDIAHTAIRNDPRINWLCKPVHNHRELRGNTSAGKSNRCLRGRGHRYHKARPSRRAT  185

Query  193  W  191
            W
Sbjct  186  W  186



>ref|XP_001771165.1| predicted protein [Physcomitrella patens]
 gb|EDQ64014.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   218 bits (554),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPV KGIVYGKP  QG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYWIN+DSTYKYFE
Sbjct  72   KRPVAKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYWINQDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +IL+D  H  IR DPRINW+ NPVHK RELRGLTSAGKKYRGLRGRGHL+ KARPS RAT
Sbjct  132  IILIDPQHTVIRKDPRINWIVNPVHKHRELRGLTSAGKKYRGLRGRGHLYTKARPSIRAT  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>gb|KDO49937.1| hypothetical protein CISIN_1g028757mg [Citrus sinensis]
Length=195

 Score =   217 bits (553),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 112/126 (89%), Gaps = 9/126 (7%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRSVAEERAGRKLGGL+         DSTYKYFE
Sbjct  72   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLK---------DSTYKYFE  122

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIRNDPRINW+C PVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRAT
Sbjct  123  VILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRAT  182

Query  193  WKRNQT  176
            WKRNQT
Sbjct  183  WKRNQT  188



>ref|XP_001757563.1| predicted protein [Physcomitrella patens]
 gb|EDQ77620.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   215 bits (548),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPV KGIVYGKP  QG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYWIN+DSTYKYFE
Sbjct  72   KRPVAKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYWINQDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +ILVD  H  IR D RINW+ NPVHK RELRGLTSAGKKYRGLRGRGHL+ KARPS RAT
Sbjct  132  IILVDPQHTVIRKDSRINWIVNPVHKHRELRGLTSAGKKYRGLRGRGHLYTKARPSIRAT  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>ref|XP_004955578.1| PREDICTED: 60S ribosomal protein L15-1-like isoform X1 [Setaria 
italica]
Length=238

 Score =   215 bits (547),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 117/160 (73%), Gaps = 34/160 (21%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINE--------  398
            KRPVPKGIVYGKP  QGVTQLKFQR+KRSVAEERAGRK+GGLRVLNSYW+NE        
Sbjct  72   KRPVPKGIVYGKPKHQGVTQLKFQRNKRSVAEERAGRKIGGLRVLNSYWVNEVCWILWRN  131

Query  397  --------------------------DSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHK  296
                                      DSTYKYFE+ILVD AHAAIRNDPRINWLC  VHK
Sbjct  132  FLLEGSYCSCPIYFVLMPATVHLSTQDSTYKYFEIILVDVAHAAIRNDPRINWLCKDVHK  191

Query  295  RRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  176
             RELRGLTSAGKKYRGLRG+G  HHK RPSRRATWKRNQT
Sbjct  192  HRELRGLTSAGKKYRGLRGKGSSHHKNRPSRRATWKRNQT  231



>ref|XP_002961462.1| hypothetical protein SELMODRAFT_270259 [Selaginella moellendorffii]
 gb|EFJ36722.1| hypothetical protein SELMODRAFT_270259 [Selaginella moellendorffii]
Length=204

 Score =   211 bits (538),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPV KGIVYGKP  QG+TQLKFQR+ RSVAEERAGRKLG LRVLNSYWIN+DSTYKYFE
Sbjct  72   KRPVSKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGNLRVLNSYWINQDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +IL+D  H AIR DPRINW+C PVHK RELRG+TSAG+K+RGLRG+GH +HK RPS RAT
Sbjct  132  IILIDPMHTAIRKDPRINWICQPVHKHRELRGITSAGRKHRGLRGKGHRNHKNRPSIRAT  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>ref|XP_002971348.1| hypothetical protein SELMODRAFT_270900 [Selaginella moellendorffii]
 gb|EFJ27946.1| hypothetical protein SELMODRAFT_270900 [Selaginella moellendorffii]
Length=204

 Score =   209 bits (533),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPV KGIVYGKP  QG+TQLKFQR+ RSVAEERAGRKLG LRVLNSYWIN+DSTYKYFE
Sbjct  72   KRPVSKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGNLRVLNSYWINQDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +IL+D  H AIR DPRINW+C PVHK RELRG+TSAG+K+RGLRG+GH +HK RPS R T
Sbjct  132  IILIDPMHTAIRKDPRINWICQPVHKHRELRGITSAGRKHRGLRGKGHRNHKNRPSIRGT  191

Query  193  WKRNQT  176
            WKRN T
Sbjct  192  WKRNNT  197



>ref|XP_010516773.1| PREDICTED: 60S ribosomal protein L15-2-like [Camelina sativa]
Length=212

 Score =   209 bits (533),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 113/134 (84%), Gaps = 8/134 (6%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            KRPVPKGIVYGKPT QGVTQLKFQRSKRS +EERAGRKLGGLR LNSYWINEDSTYKY+E
Sbjct  72   KRPVPKGIVYGKPTNQGVTQLKFQRSKRSGSEERAGRKLGGLRDLNSYWINEDSTYKYYE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHK--------RRELRGLTSAGKKYRGLRGRGHLHHK  218
            +ILVD AH A+ NDPRINW+CNPVHK         RELRGLTS GKK +GLRG+GH ++K
Sbjct  132  IILVDLAHNAVSNDPRINWICNPVHKHQLRSSSHNRELRGLTSEGKKNKGLRGKGHNNNK  191

Query  217  ARPSRRATWKRNQT  176
             RPSRRATWK N T
Sbjct  192  NRPSRRATWKNNNT  205



>ref|XP_005845356.1| hypothetical protein CHLNCDRAFT_32281 [Chlorella variabilis]
 gb|EFN53254.1| hypothetical protein CHLNCDRAFT_32281 [Chlorella variabilis]
Length=204

 Score =   201 bits (512),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            K+PV KGIVYGKP  QGVTQLK  R+ +++AEER GRK GGLRVLNSYW+N+D+ YKYFE
Sbjct  72   KKPVSKGIVYGKPVHQGVTQLKPTRNLQNIAEERVGRKCGGLRVLNSYWVNQDAVYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD AH AIR D R+NW+CNPVHK RE RGLTSAGKKYRGL G+GHLHHKARPSRRA 
Sbjct  132  VILVDPAHKAIRKDARVNWICNPVHKHREQRGLTSAGKKYRGLVGKGHLHHKARPSRRAV  191

Query  193  WKRNQT  176
            W++N +
Sbjct  192  WRKNNS  197



>ref|XP_001701780.1| ribosomal protein L15, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP06755.1| ribosomal protein L15 [Chlamydomonas reinhardtii]
Length=204

 Score =   201 bits (512),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            G RKRPV KGIVYGKP  QG+TQLK  R+ R+VAEERAGRK GGLRVLNSYW+N+DS YK
Sbjct  69   GNRKRPVHKGIVYGKPVNQGITQLKPARNLRNVAEERAGRKCGGLRVLNSYWVNQDSCYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVI+VD AH AIRND RINWLCNPVHK RELRGLT+AGK YRGLR +GH   K RPS+
Sbjct  129  YFEVIMVDPAHNAIRNDARINWLCNPVHKHRELRGLTAAGKNYRGLRAKGHKASKTRPSK  188

Query  202  RATWKRNQT  176
            RA+WKR  +
Sbjct  189  RASWKRRNS  197



>emb|CEG01197.1| Ribosomal protein L15e, conserved site [Ostreococcus tauri]
Length=204

 Score =   201 bits (510),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKG VYGKP   G+T+LKF R+ RSVAEERA R+ G LRVLNSYW+N+DS YK
Sbjct  69   GGRKRPVPKGQVYGKPVHCGITKLKFARNLRSVAEERAARRCGALRVLNSYWLNQDSVYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            Y+EVI+VD  H  IRNDPRINW+CNP HK RE+RGLTSAG+KYRGLRG+GH + K+RPS+
Sbjct  129  YYEVIMVDPMHKCIRNDPRINWICNPTHKHREMRGLTSAGRKYRGLRGKGHNYTKSRPSK  188

Query  202  RATWKRN  182
            RATW+ N
Sbjct  189  RATWRNN  195



>ref|XP_005646118.1| ribosomal protein L15e [Coccomyxa subellipsoidea C-169]
 gb|EIE21574.1| ribosomal protein L15e [Coccomyxa subellipsoidea C-169]
Length=204

 Score =   199 bits (506),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            K+PV KGIVYGKP  QG+TQLK  R+ RSVAEERAGRKLGGLRVLNSYW+N+DSTYKYFE
Sbjct  72   KKPVHKGIVYGKPVNQGITQLKPTRNLRSVAEERAGRKLGGLRVLNSYWVNQDSTYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            +ILVD AH  +R DPR+NW+ +PVHK RELRGLTSAGKK+RGLR +GH  +K RPSRRAT
Sbjct  132  IILVDIAHKVVREDPRVNWIVDPVHKHRELRGLTSAGKKFRGLRHKGHATNKLRPSRRAT  191

Query  193  WKRN  182
            WKRN
Sbjct  192  WKRN  195



>gb|AAF67144.1|AF230646_1 large subunit ribosomal protein L15 [Syntrichia ruralis]
Length=203

 Score =   197 bits (502),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -3

Query  541  PKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILV  362
            P+ +   KP  QG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYWIN+DSTYKYFE+ILV
Sbjct  75   PRVLCMEKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYWINQDSTYKYFEIILV  134

Query  361  DTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRN  182
            D  H  IR DPRINW+ NPVHK R++RGLTSAGKKYRGLRGRGHL+ KARPS RATWKRN
Sbjct  135  DPQHKVIRKDPRINWIVNPVHKHRDVRGLTSAGKKYRGLRGRGHLYTKARPSIRATWKRN  194

Query  181  QT  176
             T
Sbjct  195  NT  196



>ref|XP_003056552.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59928.1| predicted protein [Micromonas pusilla CCMP1545]
Length=204

 Score =   197 bits (501),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPV KGI YGKP  QGV +LKF R+ RSVAEER  R+ G LRVLNSYW+NEDS YK
Sbjct  69   GGRKRPVSKGIRYGKPVHQGVKKLKFARNLRSVAEERTARRCGALRVLNSYWLNEDSVYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            Y+EVI+VD  H  IR DPRINW+C PVHK RELRGLTSAG+KYRGL+G+GH ++K+RPS+
Sbjct  129  YYEVIMVDPMHKVIRGDPRINWICAPVHKHRELRGLTSAGRKYRGLQGKGHNYNKSRPSK  188

Query  202  RATWKRNQ  179
            R TWKRNQ
Sbjct  189  RGTWKRNQ  196



>ref|XP_002946380.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ52307.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=204

 Score =   196 bits (497),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PV KGIVYGKP  QG+TQLK  R+ RSVAEER GRK GGLRVLNSYW+N+DS YKYFEVI
Sbjct  74   PVHKGIVYGKPVNQGITQLKAARNLRSVAEERVGRKCGGLRVLNSYWVNQDSCYKYFEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH  IRND RINWLCNPVHK RELRGLTSAGK YRGLR +GH   K RPS+RA+WK
Sbjct  134  LVDPAHTTIRNDARINWLCNPVHKHRELRGLTSAGKHYRGLRAKGHKASKTRPSKRASWK  193

Query  187  RNQT  176
            R  +
Sbjct  194  RRNS  197



>ref|XP_001416062.1| Ribosomal protein L15, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO94354.1| Ribosomal protein L15, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
Length=204

 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPV KG VYGKP   G+T+LKF R+ RSVAEERA R+ G LRVLNSYW+N+DS YK
Sbjct  69   GGRKRPVAKGQVYGKPVHCGITKLKFARNLRSVAEERAARRCGALRVLNSYWLNQDSVYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            Y+EVI+VD  H  +RNDPRINW+CNP HK RE+RGLTSAG+KYRGL G+GH   K+RPS+
Sbjct  129  YYEVIMVDPMHKCVRNDPRINWICNPTHKHREMRGLTSAGRKYRGLHGKGHNFTKSRPSK  188

Query  202  RATWKRN  182
            RATW+ N
Sbjct  189  RATWRNN  195



>ref|XP_011401241.1| 60S ribosomal protein L15 [Auxenochlorella protothecoides]
 gb|KFM28228.1| 60S ribosomal protein L15 [Auxenochlorella protothecoides]
Length=437

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -3

Query  553  KRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFE  374
            K+PVPKGIVYGKP  QG+TQLK  R+  ++AEER GRK GGLRVLNSYW+N+D+ YKYFE
Sbjct  72   KKPVPKGIVYGKPVNQGITQLKPTRNLANLAEERVGRKCGGLRVLNSYWVNQDAVYKYFE  131

Query  373  VILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRAT  194
            VILVD  H AIRND RINW+ NPVHK RELRGLTSAGKKYRGL G+GHLH K RPSRRA 
Sbjct  132  VILVDPFHKAIRNDARINWIANPVHKHRELRGLTSAGKKYRGLTGKGHLHTKNRPSRRAV  191

Query  193  WKRN  182
            WK+N
Sbjct  192  WKKN  195



>ref|XP_004348091.1| ribosomal protein L15 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE93479.1| ribosomal protein L15 [Capsaspora owczarzaki ATCC 30864]
Length=204

 Score =   191 bits (484),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 110/130 (85%), Gaps = 2/130 (2%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPV KGI+YGKP  QGVTQLK QRS R++AEER GR +GGLRVLNSYWI +DST+K
Sbjct  69   GGRKRPVFKGIIYGKPAAQGVTQLKNQRSHRAIAEERIGRAIGGLRVLNSYWICQDSTFK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHK-ARPS  206
            Y+EVI+VDTAH AIR DPRINW+C  VHK RELRGLT+AG+K+RG+ G+GHLH+K A  S
Sbjct  129  YYEVIMVDTAHKAIRRDPRINWICENVHKHRELRGLTAAGRKHRGV-GKGHLHNKTAGSS  187

Query  205  RRATWKRNQT  176
            RRA WKR  T
Sbjct  188  RRANWKRRNT  197



>gb|KJB61958.1| hypothetical protein B456_009G394000 [Gossypium raimondii]
Length=206

 Score =   190 bits (483),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 100/124 (81%), Gaps = 15/124 (12%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKGIVYGKPT QGVTQLKFQR+KRSVAEERAGR+LGGLRV+NSYWINEDSTYKYFEVI
Sbjct  91   PVPKGIVYGKPTNQGVTQLKFQRNKRSVAEERAGRQLGGLRVVNSYWINEDSTYKYFEVI  150

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD AH  IRND RINW+CNP               K RGL G+GHLHHK RPSRRATWK
Sbjct  151  LVDVAHNGIRNDLRINWICNP---------------KNRGLHGKGHLHHKNRPSRRATWK  195

Query  187  RNQT  176
            RN T
Sbjct  196  RNNT  199



>gb|AAC32160.1| putative 60S ribosomal protein L15 [Picea mariana]
 gb|AAC32161.1| putative 60S ribosomal protein L15 [Picea mariana]
Length=108

 Score =   186 bits (471),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -3

Query  478  SKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVH  299
            S RSVAEERAGRKLGGLRVLNSYWIN+DSTYKY+E+ILVD AH+AIR DPRINW+CN VH
Sbjct  1    SLRSVAEERAGRKLGGLRVLNSYWINQDSTYKYYEIILVDQAHSAIRKDPRINWICNAVH  60

Query  298  KRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  176
            K RELRGLTSAGKKYRGLRGRGHL+HKARPS+RATWKRN T
Sbjct  61   KHRELRGLTSAGKKYRGLRGRGHLYHKARPSKRATWKRNNT  101



>gb|AAC32177.1| putative 60S ribosomal protein L15 [Picea mariana]
Length=106

 Score =   185 bits (470),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/99 (88%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = -3

Query  472  RSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKR  293
            RSVAEERAGRKLGGLRVLNSYWIN+DSTYKY+EV+LVD AH  IRNDPRINW+CN VHK 
Sbjct  1    RSVAEERAGRKLGGLRVLNSYWINQDSTYKYYEVVLVDQAHTVIRNDPRINWICNAVHKH  60

Query  292  RELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  176
            RELRGLTSAGKKYRGLRGRGHL+HKARPS+RATWKRN T
Sbjct  61   RELRGLTSAGKKYRGLRGRGHLYHKARPSKRATWKRNNT  99



>gb|AAF02467.1|AF127450_1 putative 60S ribosomal protein L15 [Picea abies]
Length=105

 Score =   184 bits (466),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -3

Query  469  SVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKRR  290
            SVAEERAGRKLGGLRVLNSYWIN+DSTYKY+EV+LVD AH  IRNDPRINW+CN VHK R
Sbjct  1    SVAEERAGRKLGGLRVLNSYWINQDSTYKYYEVVLVDQAHTVIRNDPRINWICNAVHKHR  60

Query  289  ELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  176
            ELRGLTSAGKKYRGLRGRGHL+HKARPS+RATWKRN T
Sbjct  61   ELRGLTSAGKKYRGLRGRGHLYHKARPSKRATWKRNNT  98



>ref|XP_006470979.1| PREDICTED: 60S ribosomal protein L15-like [Citrus sinensis]
Length=164

 Score =   185 bits (469),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = -3

Query  538  KGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVD  359
            +G   G     G+ +L          E+RAGRKLGGL+VLNSYWINEDSTYKYFEVILVD
Sbjct  37   QGSPLGLQGQAGLCRLSCACKTWRTKEKRAGRKLGGLKVLNSYWINEDSTYKYFEVILVD  96

Query  358  TAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQ  179
             AH AIRNDPRINW+C PVHK RELRGLTSAGKKYRGLRG+GHLHHKARPSRRATWKRNQ
Sbjct  97   AAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQ  156

Query  178  T  176
            T
Sbjct  157  T  157



>ref|XP_957199.1| 60S ribosomal protein L15 [Neurospora crassa OR74A]
 ref|XP_009852151.1| hypothetical protein NEUTE1DRAFT_117386 [Neurospora tetrasperma 
FGSC 2508]
 sp|Q8X034.1|RL15_NEUCR RecName: Full=60S ribosomal protein L15 [Neurospora crassa OR74A]
 emb|CAD21192.1| probable ribosomal protein L15.e.B, cytosolic [Neurospora crassa]
 gb|EAA27963.1| 60S ribosomal protein L15 [Neurospora crassa OR74A]
 gb|EGO56565.1| hypothetical protein NEUTE1DRAFT_117386 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGZ70567.1| putative ribosomal protein L15.e.B, cytosolic [Neurospora tetrasperma 
FGSC 2509]
 gb|KHE83595.1| hypothetical protein GE21DRAFT_3246 [Neurospora crassa]
Length=203

 Score =   184 bits (468),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 102/129 (79%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRK+PVPKG  YGKPT QGV QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYK
Sbjct  69   GGRKKPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD  H AIR DPRINW+ NPVHK RE RGLTS GK+ RGL  +GH ++K R  R
Sbjct  129  YFEVILVDPQHKAIRRDPRINWIVNPVHKHRESRGLTSTGKRSRGL-NKGHRYNKTRAGR  187

Query  202  RATWKRNQT  176
            R TWKR+ T
Sbjct  188  RKTWKRHNT  196



>gb|ESW97334.1| 60S ribosomal protein L15-B [Ogataea parapolymorpha DL-1]
Length=204

 Score =   184 bits (467),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 101/129 (78%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKG  YGKPT QGV QLK+Q++ RS AEER GRK   LRVLNSYW+NEDSTYK
Sbjct  69   GGRKRPVPKGATYGKPTNQGVNQLKYQKALRSTAEERVGRKAANLRVLNSYWVNEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            Y+EVI VD  H AIR DPR NW+CNPVHK RE RGLT+ GKK RG+  +GHL +K R  R
Sbjct  129  YYEVICVDPQHKAIRRDPRYNWICNPVHKHREARGLTATGKKSRGI-AKGHLFNKTRKGR  187

Query  202  RATWKRNQT  176
            R TWK++ T
Sbjct  188  RHTWKQHNT  196



>ref|XP_004198963.1| Piso0_002360 [Millerozyma farinosa CBS 7064]
 emb|CCE82626.1| Piso0_002360 [Millerozyma farinosa CBS 7064]
Length=204

 Score =   184 bits (467),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKG+ YGKPT QGV QLK+Q+  RS AEER GR+   LRVLNSYW+N+DSTYK
Sbjct  69   GGRKRPVPKGVTYGKPTNQGVNQLKYQKPLRSTAEERVGRRAANLRVLNSYWVNQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            +FEVI+VD +H AIR DPR NW+ NPVHK RE RGLT+AGKKYRG+  +GHL++ +R  R
Sbjct  129  FFEVIMVDPSHKAIRRDPRFNWIANPVHKHRESRGLTAAGKKYRGI-NKGHLYNNSRSGR  187

Query  202  RATWKRNQT  176
            R  WK++ T
Sbjct  188  RHIWKKHNT  196



>gb|AAT88062.1| putative 60S ribosomal protein L15 [Tsuga canadensis]
Length=101

 Score =   180 bits (457),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/95 (89%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = -3

Query  460  EERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKRRELR  281
            EERAGRKLGGLRVLNSYWIN+DSTYKYFEVILVD AH  IRNDPRINW+CN VHK RELR
Sbjct  1    EERAGRKLGGLRVLNSYWINQDSTYKYFEVILVDQAHTVIRNDPRINWICNAVHKHRELR  60

Query  280  GLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  176
            GLTSAGKKYRGLRGRGHL+HKARPS+RATWKRN T
Sbjct  61   GLTSAGKKYRGLRGRGHLYHKARPSKRATWKRNNT  95



>gb|AAC32174.1| putative 60S ribosomal protein L15 [Picea mariana]
 gb|AAC32175.1| putative 60S ribosomal protein L15 [Picea mariana]
 gb|AAC32176.1| putative 60S ribosomal protein L15 [Picea mariana]
Length=103

 Score =   180 bits (456),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -3

Query  463  AEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKRREL  284
            AEERAGRKLGGLRVLNSYWIN+DSTYKY+EV+LVD AH  IRNDPRINW+CN VHK REL
Sbjct  1    AEERAGRKLGGLRVLNSYWINQDSTYKYYEVVLVDQAHTVIRNDPRINWICNAVHKHREL  60

Query  283  RGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  176
            RGLTSAGKKYRGLRGRGHL+HKARPS+RATWKRN T
Sbjct  61   RGLTSAGKKYRGLRGRGHLYHKARPSKRATWKRNNT  96



>gb|KIX93106.1| 60S ribosomal protein L15 [Fonsecaea multimorphosa CBS 102226]
Length=203

 Score =   183 bits (464),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 101/129 (78%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKG  YGKPT QGV QLK+QRS RS AEER GR+   LRVLNSYWIN+DSTYK
Sbjct  69   GGRKRPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRCANLRVLNSYWINQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            Y+E+ILVD  H AIR DPRINW+ NPVHK RE RGLT+ GKK RGL G+GH + K    R
Sbjct  129  YYEIILVDPNHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHGYTKTTSGR  187

Query  202  RATWKRNQT  176
            R TWKR+ T
Sbjct  188  RKTWKRHNT  196



>ref|XP_002553867.1| 60S ribosomal protein L15 [Lachancea thermotolerans]
 emb|CAR23430.1| KLTH0E09020p [Lachancea thermotolerans CBS 6340]
Length=204

 Score =   182 bits (463),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 99/129 (77%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            G RKRPVPKG  YGKPT QGV QLK+QR+ R+ AEER GR+   LRVLNSYW+N+DSTYK
Sbjct  69   GNRKRPVPKGATYGKPTNQGVNQLKYQRALRATAEERVGRRAANLRVLNSYWVNQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVIL+D +H AIR D R NW+CNPVHK RE RGLTS GKK RG+  +GHL H  +  R
Sbjct  129  YFEVILLDPSHKAIRRDARYNWICNPVHKHREARGLTSTGKKSRGI-NKGHLFHNTQAGR  187

Query  202  RATWKRNQT  176
            R TWKR  T
Sbjct  188  RKTWKRQNT  196



>ref|XP_006822011.1| PREDICTED: 60S ribosomal protein L15-like isoform X1 [Saccoglossus 
kowalevskii]
 ref|XP_006822012.1| PREDICTED: 60S ribosomal protein L15-like isoform X2 [Saccoglossus 
kowalevskii]
Length=204

 Score =   182 bits (463),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKG  YGKPT QGV QLK+QRS +S+AEERAGR+ GGLRVLNSYW+ +DSTYK
Sbjct  69   GGRKRPVPKGATYGKPTNQGVNQLKWQRSLQSLAEERAGRRCGGLRVLNSYWVGQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKA-RPS  206
            +FEVI+VD  H AIR +P   W+CNPVHK RELRGLTSAGKK RG+ G+GHLH +    S
Sbjct  129  FFEVIMVDPFHKAIRRNPDTQWICNPVHKHRELRGLTSAGKKNRGI-GKGHLHTQTIGGS  187

Query  205  RRATWKRNQT  176
            RRA WKR  T
Sbjct  188  RRAAWKRRNT  197



>ref|XP_717445.1| likely cytosolic ribosomal protein L15 [Candida albicans SC5314]
 ref|XP_717356.1| likely cytosolic ribosomal protein L15 [Candida albicans SC5314]
 ref|XP_002421973.1| 60S ribosomal protein L15 [Candida dubliniensis CD36]
 gb|EAK98387.1| likely cytosolic ribosomal protein L15 [Candida albicans SC5314]
 gb|EAK98479.1| likely cytosolic ribosomal protein L15 [Candida albicans SC5314]
 emb|CAX39974.1| ribosomal protein, large subunit, putative [Candida dubliniensis 
CD36]
 gb|EEQ43509.1| 60S ribosomal protein L15-B [Candida albicans WO-1]
 gb|KGQ81742.1| 60S ribosomal protein L15-A [Candida albicans P94015]
 gb|KGQ82421.1| 60S ribosomal protein L15-A [Candida albicans GC75]
 gb|KGR01884.1| 60S ribosomal protein L15-A [Candida albicans P57072]
 gb|KGR03380.1| 60S ribosomal protein L15-A [Candida albicans P78048]
 gb|KGR06697.1| 60S ribosomal protein L15-A [Candida albicans P37037]
 gb|KGU01202.1| 60S ribosomal protein L15-A [Candida albicans P87]
 gb|KGU19047.1| 60S ribosomal protein L15-A [Candida albicans P34048]
 gb|KGU21267.1| 60S ribosomal protein L15-A [Candida albicans P57055]
 gb|KGU22062.1| 60S ribosomal protein L15-A [Candida albicans P75063]
 gb|KHC28236.1| 60S ribosomal protein L15-A [Candida albicans P76067]
 gb|KHC29192.1| 60S ribosomal protein L15-A [Candida albicans Ca6]
 gb|KHC29778.1| 60S ribosomal protein L15-A [Candida albicans P76055]
 gb|KHC45171.1| 60S ribosomal protein L15-A [Candida albicans P60002]
 gb|KHC45723.1| 60S ribosomal protein L15-A [Candida albicans P37039]
 gb|KHC54469.1| 60S ribosomal protein L15-A [Candida albicans P75010]
 gb|KHC61439.1| 60S ribosomal protein L15-A [Candida albicans P75016]
 gb|KHC66364.1| 60S ribosomal protein L15-A [Candida albicans P78042]
 gb|KHC71356.1| 60S ribosomal protein L15-A [Candida albicans SC5314]
 gb|KHC78351.1| 60S ribosomal protein L15-A [Candida albicans SC5314]
Length=204

 Score =   182 bits (462),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 102/129 (79%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKG  YGKPT QGV QLK+Q+S RS AEER GR+   LRVLNSYW+N+DSTYK
Sbjct  69   GGRKRPVPKGATYGKPTNQGVNQLKYQKSLRSTAEERVGRRASNLRVLNSYWVNQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD +H AIR D R NW+ NPVHK RE RGLTSAGKK RG+  +GHL +K +  R
Sbjct  129  YFEVILVDPSHKAIRRDARYNWIVNPVHKHREARGLTSAGKKSRGI-NKGHLFNKTKAGR  187

Query  202  RATWKRNQT  176
            R TWK++ T
Sbjct  188  RHTWKKHNT  196



>ref|XP_005534852.1| 60S ribosomal protein L15 [Cyanidioschyzon merolae strain 10D]
 dbj|BAM80245.1| 60S ribosomal protein L15 [Cyanidioschyzon merolae strain 10D]
Length=205

 Score =   182 bits (462),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 102/125 (82%), Gaps = 1/125 (1%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKL-GGLRVLNSYWINEDSTYKYFEV  371
            PVPKGI YGKP  QG+TQLKFQR+KRSVAEER GRK+   LRVLNSYWINED+ YKY+EV
Sbjct  74   PVPKGIQYGKPKHQGITQLKFQRNKRSVAEERVGRKICANLRVLNSYWINEDALYKYYEV  133

Query  370  ILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATW  191
            IL+D  H AIR DPRINW+C P  K RELRGLTSAG+K RGL  +GHL +KARPS R+ W
Sbjct  134  ILIDPNHNAIRRDPRINWICRPTMKHRELRGLTSAGRKGRGLHRKGHLVNKARPSVRSVW  193

Query  190  KRNQT  176
            KR+ T
Sbjct  194  KRHNT  198



>ref|XP_503229.1| 60S ribosomal protein L15 [Yarrowia lipolytica]
 emb|CAG81430.1| YALI0D24387p [Yarrowia lipolytica CLIB122]
Length=203

 Score =   182 bits (461),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 99/129 (77%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            G RKRP  KG  YGKPT QG+ QLK QRS R+VAEER GR+ G LRVLNSYW+N+DSTYK
Sbjct  69   GNRKRPSKKGATYGKPTNQGINQLKLQRSLRAVAEERVGRRAGNLRVLNSYWVNQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD +H  IRNDPRINW+CNPVHK RE RGLT+AGKK RG+  +GH +H     R
Sbjct  129  YFEVILVDPSHVVIRNDPRINWICNPVHKHRESRGLTAAGKKNRGI-NKGHKYHNTSAGR  187

Query  202  RATWKRNQT  176
            R TWK   T
Sbjct  188  RHTWKLQNT  196



>gb|AAT88061.1| putative 60S ribosomal protein L15 [Abies lasiocarpa]
Length=97

 Score =   178 bits (452),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = -3

Query  460  EERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKRRELR  281
            EERAGRKLGGLRVLNSYW+N+DSTYKYFEVILVD AH  IRNDPRINW+CN VHK RELR
Sbjct  1    EERAGRKLGGLRVLNSYWLNQDSTYKYFEVILVDQAHTVIRNDPRINWICNAVHKHRELR  60

Query  280  GLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  176
            GLTSAGKKYRGLRGRGHL+HKARPS+RATWKRN +
Sbjct  61   GLTSAGKKYRGLRGRGHLYHKARPSKRATWKRNNS  95



>emb|CEP61029.1| LALA0S02e05138g1_1 [Lachancea lanzarotensis]
Length=204

 Score =   182 bits (461),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 98/129 (76%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            G RKRP PKG  YGKPT QG+ QLK+QRS R+ AEER GR+   LRVLNSYW+N+DSTYK
Sbjct  69   GNRKRPAPKGATYGKPTNQGINQLKYQRSLRATAEERVGRRAANLRVLNSYWVNQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVIL+D +H AIR D R NW+CNPVHK RE RGLTS GKK RG+  +GHL H  +  R
Sbjct  129  YFEVILLDPSHKAIRRDARYNWICNPVHKHREARGLTSTGKKSRGI-NKGHLFHNTQAGR  187

Query  202  RATWKRNQT  176
            R TWKR  T
Sbjct  188  RKTWKRQNT  196



>gb|KIW77490.1| 60S ribosomal protein L15 [Fonsecaea pedrosoi CBS 271.37]
Length=203

 Score =   182 bits (461),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 101/129 (78%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKG  YGKPT QGV QLK+QRS RS AEER GR+   LRVLNSYWIN+DSTYK
Sbjct  69   GGRKRPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRCANLRVLNSYWINQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            Y+EVILVD +H AIR DPRINW+ N VHK RE RGLT+ GKK RGL G+GH + K    R
Sbjct  129  YYEVILVDPSHKAIRRDPRINWIVNAVHKHRESRGLTATGKKSRGL-GKGHGYTKTTSGR  187

Query  202  RATWKRNQT  176
            R TWKR+ T
Sbjct  188  RKTWKRHNT  196



>gb|AAT88055.1| putative 60S ribosomal protein L15 [Picea glauca]
Length=101

 Score =   178 bits (452),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = -3

Query  460  EERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKRRELR  281
            EERAGRKLGGLRVLNSYWIN+DSTYKY+EV+LVD AH  IRNDPRINW+CN VHK RELR
Sbjct  1    EERAGRKLGGLRVLNSYWINQDSTYKYYEVVLVDQAHTVIRNDPRINWICNAVHKHRELR  60

Query  280  GLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  176
            GLTSAGKKYRGLRGRGHL+HKARPS+RATWKRN T
Sbjct  61   GLTSAGKKYRGLRGRGHLYHKARPSKRATWKRNNT  95



>ref|XP_003869213.1| Rpl15a ribosomal protein [Candida orthopsilosis Co 90-125]
 emb|CCG23077.1| Rpl15a ribosomal protein [Candida orthopsilosis]
Length=204

 Score =   182 bits (461),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 101/129 (78%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKG  YGKPT QGV  LK+QRS RS AEER GR+   LRVLNSYWIN+DSTYK
Sbjct  69   GGRKRPVPKGATYGKPTNQGVNHLKYQRSLRSTAEERVGRRAANLRVLNSYWINQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            Y+EVILVD  H AIR DPR NW+ N VHK RE RGLTSAGKK RG+  +GHL++K R  R
Sbjct  129  YYEVILVDPQHKAIRRDPRYNWIANAVHKHRESRGLTSAGKKSRGI-NKGHLYNKTRAGR  187

Query  202  RATWKRNQT  176
            R TWK++ T
Sbjct  188  RHTWKKHNT  196



>gb|AAF02466.1|AF127449_1 putative 60S ribosomal protein L15 [Picea abies]
 gb|AAF02468.1|AF127451_1 putative 60S ribosomal protein L15 [Picea abies]
 gb|AAT88049.1| putative 60S ribosomal protein L15 [Picea abies]
 gb|AAT88051.1| putative 60S ribosomal protein L15 [Picea mariana]
 gb|AAT88052.1| putative 60S ribosomal protein L15 [Picea abies]
 gb|AAT88053.1| putative 60S ribosomal protein L15 [Picea mariana]
 gb|AAT88054.1| putative 60S ribosomal protein L15 [Picea mariana]
 gb|AAT88056.1| putative 60S ribosomal protein L15 [Picea glauca]
 gb|AAT88057.1| putative 60S ribosomal protein L15 [Picea abies]
 gb|AAT88058.1| putative 60S ribosomal protein L15 [Picea mariana]
 gb|AAT88059.1| putative 60S ribosomal protein L15 [Picea mariana]
Length=102

 Score =   178 bits (452),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = -3

Query  460  EERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKRRELR  281
            EERAGRKLGGLRVLNSYWIN+DSTYKY+EV+LVD AH  IRNDPRINW+CN VHK RELR
Sbjct  1    EERAGRKLGGLRVLNSYWINQDSTYKYYEVVLVDQAHTVIRNDPRINWICNAVHKHRELR  60

Query  280  GLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  176
            GLTSAGKKYRGLRGRGHL+HKARPS+RATWKRN T
Sbjct  61   GLTSAGKKYRGLRGRGHLYHKARPSKRATWKRNNT  95



>gb|AAT88060.1| putative 60S ribosomal protein L15 [Picea glauca]
Length=100

 Score =   178 bits (451),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = -3

Query  460  EERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKRRELR  281
            EERAGRKLGGLRVLNSYWIN+DSTYKY+EV+LVD AH  IRNDPRINW+CN VHK RELR
Sbjct  1    EERAGRKLGGLRVLNSYWINQDSTYKYYEVVLVDQAHTVIRNDPRINWICNAVHKHRELR  60

Query  280  GLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  176
            GLTSAGKKYRGLRGRGHL+HKARPS+RATWKRN T
Sbjct  61   GLTSAGKKYRGLRGRGHLYHKARPSKRATWKRNNT  95



>gb|EMG48668.1| Ribosomal protein L15, partial [Candida maltosa Xu316]
Length=204

 Score =   181 bits (459),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 102/129 (79%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKG  YGKPT QGV QLK+Q+S RS AEER GR+   LRVLNSYW+N+DSTYK
Sbjct  69   GGRKRPVPKGATYGKPTNQGVNQLKYQKSLRSTAEERVGRRAANLRVLNSYWVNQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD +H AIR D R NW+ N VHK RE RGLTSAGKK RG+  +GHL++K +  R
Sbjct  129  YFEVILVDPSHKAIRRDARYNWIANAVHKHREARGLTSAGKKSRGI-NKGHLYNKTKAGR  187

Query  202  RATWKRNQT  176
            R TWK++ T
Sbjct  188  RHTWKKHNT  196



>gb|EFX04788.1| 60S ribosomal protein l15 [Grosmannia clavigera kw1407]
Length=203

 Score =   181 bits (459),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 102/129 (79%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRK+PV KG  +GKPT QGV QLK+QRS +S AEER GR+ G LRVLNSYW+N+DSTYK
Sbjct  69   GGRKKPVAKGATFGKPTNQGVNQLKYQRSLKSTAEERVGRRCGNLRVLNSYWVNQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            Y+EVILVD  HAAIR DPRINW+ NPVHK RE RGLT+ GKK RGL  +GH  +K R  R
Sbjct  129  YYEVILVDPNHAAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHKFNKTRAGR  187

Query  202  RATWKRNQT  176
            R TWKR+ T
Sbjct  188  RKTWKRHNT  196



>emb|CCE42581.1| hypothetical protein CPAR2_202240 [Candida parapsilosis]
Length=204

 Score =   181 bits (459),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 101/129 (78%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKG  YGKPT QGV  LK+QRS RS AEER GR+   LRVLNSYW+N+DSTYK
Sbjct  69   GGRKRPVPKGATYGKPTNQGVNHLKYQRSLRSTAEERVGRRAANLRVLNSYWVNQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            Y+EVILVD  H AIR DPR NW+ N VHK RE RGLTSAGKK RG+  +GHL++K R  R
Sbjct  129  YYEVILVDPQHKAIRRDPRYNWIANAVHKHRESRGLTSAGKKSRGI-NKGHLYNKTRAGR  187

Query  202  RATWKRNQT  176
            R TWK++ T
Sbjct  188  RHTWKKHNT  196



>ref|XP_002797110.1| 60S ribosomal protein L15 [Paracoccidioides sp. 'lutzii' Pb01]
 ref|XP_010759628.1| 60S ribosomal protein L15 [Paracoccidioides brasiliensis Pb18]
 gb|EEH18959.1| 60S ribosomal protein L15 [Paracoccidioides brasiliensis Pb03]
 gb|EEH38048.1| 60S ribosomal protein L15 [Paracoccidioides sp. 'lutzii' Pb01]
 gb|EEH47772.1| 60S ribosomal protein L15 [Paracoccidioides brasiliensis Pb18]
Length=203

 Score =   181 bits (459),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 99/129 (77%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRP PKG  YGKPT  G+ QLK+QRS RS AEER GR+   LRVLNSYWIN+DSTYK
Sbjct  69   GGRKRPAPKGATYGKPTNHGINQLKYQRSLRSTAEERVGRRCANLRVLNSYWINQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            Y+EVILVD  H AIR DPRINW+ NPVHK RE RGLT+ GKK RGL GRGH ++K    R
Sbjct  129  YYEVILVDPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GRGHKYNKTTAGR  187

Query  202  RATWKRNQT  176
            R TWKR  T
Sbjct  188  RKTWKRLNT  196



>gb|KIW07591.1| 60S ribosomal protein L15 [Verruconis gallopava]
Length=203

 Score =   181 bits (458),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 100/129 (78%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRP PKG  YGKPT QG+ QLK+QRS R+ AEER GR+   LRVLNSYWIN+DSTYK
Sbjct  69   GGRKRPAPKGATYGKPTNQGINQLKYQRSLRATAEERVGRRCANLRVLNSYWINQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            Y+EVILVD  H AIR DPRINW+ NPVHK RE RGLTS GKK RGL  +GH ++K R  R
Sbjct  129  YYEVILVDPQHKAIRRDPRINWIVNPVHKHREARGLTSTGKKSRGL-NKGHRYNKTRGGR  187

Query  202  RATWKRNQT  176
            R  WKR+ T
Sbjct  188  RKAWKRHNT  196



>ref|XP_001212942.1| 60S ribosomal protein L15 [Aspergillus terreus NIH2624]
 gb|EAU35566.1| 60S ribosomal protein L15 [Aspergillus terreus NIH2624]
Length=203

 Score =   181 bits (458),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 98/129 (76%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKG  YGKPT  GV QLK+QR+ R+ AEER GR+   LRVLNSYWIN+DSTYK
Sbjct  69   GGRKRPVPKGATYGKPTNMGVNQLKYQRALRATAEERVGRRCANLRVLNSYWINQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVI VD  H AIR D RINW+CNPVHK RE RGLTS GKK RG+  +GH ++  R  R
Sbjct  129  YFEVICVDPQHKAIRRDARINWICNPVHKHREARGLTSTGKKSRGI-NKGHRYNNTRSGR  187

Query  202  RATWKRNQT  176
            R TWKR  T
Sbjct  188  RHTWKRQNT  196



>ref|XP_007741637.1| 60S ribosomal protein L15 [Cladophialophora psammophila CBS 110553]
 gb|EXJ74537.1| 60S ribosomal protein L15 [Cladophialophora psammophila CBS 110553]
 gb|KIW92380.1| 60S ribosomal protein L15 [Cladophialophora bantiana CBS 173.52]
Length=203

 Score =   181 bits (458),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 100/129 (78%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKG  YGKPT QGV QLK+QRS RS AEER GR+   LRVLNSYWIN+DSTYK
Sbjct  69   GGRKRPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRCANLRVLNSYWINQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            Y+EVILVD  H AIR D RINW+ NPVHK RE RGLT+ GKK RGL G+GH + K    R
Sbjct  129  YYEVILVDPNHKAIRRDARINWIVNPVHKHRESRGLTATGKKSRGL-GKGHGYTKTTSGR  187

Query  202  RATWKRNQT  176
            R TWKR+ T
Sbjct  188  RKTWKRHNT  196



>gb|ESZ93952.1| 60S ribosomal protein L15 [Sclerotinia borealis F-4157]
Length=203

 Score =   180 bits (457),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 100/129 (78%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRP PKG  YGKPT QG+ QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYK
Sbjct  69   GGRKRPAPKGATYGKPTNQGINQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFE+ILVD  H AIR DPRINW+ NPVHK RE RG+T+ GKK RGL G+GH  +K    R
Sbjct  129  YFEIILVDPQHKAIRRDPRINWIVNPVHKHRESRGMTATGKKSRGL-GKGHGFNKTTAGR  187

Query  202  RATWKRNQT  176
            R TWK++ T
Sbjct  188  RKTWKKHNT  196



>ref|XP_011123288.1| hypothetical protein AOL_s00081g168 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX48064.1| hypothetical protein AOL_s00081g168 [Arthrobotrys oligospora 
ATCC 24927]
Length=204

 Score =   180 bits (456),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 100/129 (78%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKG  YGKPT QGV QLK+QRS RS AEER GR+   LRVLNSYWIN+DSTYK
Sbjct  69   GGRKRPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRCANLRVLNSYWINQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD  H AIR D RINW+ NPVHK RE RGLT+ GKK RG+  +GH ++  +  R
Sbjct  129  YFEVILVDPQHKAIRRDARINWIVNPVHKHRESRGLTATGKKSRGI-NKGHRYNNTKAGR  187

Query  202  RATWKRNQT  176
            R TWKR+ T
Sbjct  188  RKTWKRHNT  196



>gb|AAT88050.1| putative 60S ribosomal protein L15 [Picea mariana]
Length=102

 Score =   176 bits (447),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = -3

Query  460  EERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDTAHAAIRNDPRINWLCNPVHKRRELR  281
            EERAGRKLGGLRVLNSYWIN+DSTYKY+EV+LVD AH  IRNDPRINW+CN VHK RELR
Sbjct  1    EERAGRKLGGLRVLNSYWINQDSTYKYYEVVLVDQAHTVIRNDPRINWICNAVHKHRELR  60

Query  280  GLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQT  176
            GLTSAGKKYRGLRGRGHL+H ARPS+RATWKRN T
Sbjct  61   GLTSAGKKYRGLRGRGHLYHMARPSKRATWKRNNT  95



>ref|XP_001644954.1| hypothetical protein Kpol_1025p16 [Vanderwaltozyma polyspora 
DSM 70294]
 gb|EDO17096.1| hypothetical protein Kpol_1025p16 [Vanderwaltozyma polyspora 
DSM 70294]
Length=204

 Score =   179 bits (455),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 99/129 (77%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            G RKRPVPKG  YGKPT +GV +LK+QRS R+ AEER GR+   LRVLNSYWIN+DSTYK
Sbjct  69   GNRKRPVPKGATYGKPTNEGVNELKYQRSLRATAEERVGRRAANLRVLNSYWINQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVIL+D +H AIR D R NW+CNPVHK RE RGLT+ GKK RG+  +GH +H  +  R
Sbjct  129  YFEVILIDPSHKAIRRDARYNWICNPVHKHREARGLTATGKKSRGI-NKGHRYHNTQAGR  187

Query  202  RATWKRNQT  176
            R TWKR  T
Sbjct  188  RKTWKRQNT  196



>gb|KDD73446.1| ribosomal L15, partial [Helicosporidium sp. ATCC 50920]
Length=200

 Score =   179 bits (454),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PV KGIVYGKP  QG+TQLK +R+ ++++E R GR   GLRVLNSYW+N+D+++KY+EVI
Sbjct  74   PVAKGIVYGKPVNQGITQLKPRRNLQAISEGRVGRACRGLRVLNSYWVNQDASHKYYEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            +VD AH  IRNDP INW+CNPVHK RE  GLTSAGKK+RGL G+GH H  ARPSRRATW+
Sbjct  134  MVDPAHTVIRNDPHINWICNPVHKHREGHGLTSAGKKHRGLGGKGHGHVHARPSRRATWR  193

Query  187  RNQ  179
            RNQ
Sbjct  194  RNQ  196



>ref|XP_006690758.1| ribosomal protein L15-like protein [Chaetomium thermophilum var. 
thermophilum DSM 1495]
 gb|EGS23516.1| ribosomal protein L15-like protein [Chaetomium thermophilum var. 
thermophilum DSM 1495]
Length=203

 Score =   179 bits (454),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 97/124 (78%), Gaps = 1/124 (1%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKG  YGKPT QGV QLK+QRS R+ AEER GR+   LRVLNSYW+N+DSTYKY+EVI
Sbjct  74   PVPKGATYGKPTNQGVNQLKYQRSLRATAEERVGRRCSNLRVLNSYWVNQDSTYKYYEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD  H AIR DPRINW+CNPVHK RE RGLTS GKK RGL  +GH  +K R  RR TWK
Sbjct  134  LVDPNHKAIRRDPRINWICNPVHKHRECRGLTSTGKKSRGL-NKGHRFNKTRAGRRKTWK  192

Query  187  RNQT  176
            R+ T
Sbjct  193  RHNT  196



>ref|XP_004199814.1| Piso0_002360 [Millerozyma farinosa CBS 7064]
 emb|CCE81695.1| Piso0_002360 [Millerozyma farinosa CBS 7064]
Length=204

 Score =   179 bits (454),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 102/129 (79%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKG+ YGKPT QGV QLK+Q+  RS AEER GR+   LRVLNSYW+N+DSTYK
Sbjct  69   GGRKRPVPKGVTYGKPTNQGVNQLKYQKPLRSTAEERVGRRAANLRVLNSYWVNQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVI+VD +H AIR DPR NW+   VHK RE RGLT+AGKKYRG+  +GHL++ +R  R
Sbjct  129  YFEVIMVDPSHKAIRRDPRYNWIAKSVHKHRESRGLTAAGKKYRGI-NKGHLYNNSRSGR  187

Query  202  RATWKRNQT  176
            R  WK++ T
Sbjct  188  RHIWKKHNT  196



>ref|NP_985761.1| 60S ribosomal protein L15 [Ashbya gossypii ATCC 10895]
 gb|AAS53585.1| AFR214Cp [Ashbya gossypii ATCC 10895]
 gb|AEY97898.1| FAFR214Cp [Ashbya gossypii FDAG1]
 gb|AGO13355.1| AaceriAFR214Cp [Saccharomycetaceae sp. 'Ashbya aceri']
Length=204

 Score =   179 bits (454),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 98/129 (76%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            G RKRPVPKG  YGKPT QGV QLK+QR+ R+ AEER GR+   LRVLNSYWIN+DSTYK
Sbjct  69   GNRKRPVPKGATYGKPTNQGVNQLKYQRALRATAEERVGRRAANLRVLNSYWINQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD +H AIR D RINW+ NPVHK RE RGLT+ GKK RG+  +GH  H  +  R
Sbjct  129  YFEVILVDPSHKAIRRDARINWIANPVHKHREARGLTATGKKSRGI-NKGHRFHNTQAGR  187

Query  202  RATWKRNQT  176
            R TWKR  T
Sbjct  188  RKTWKRQNT  196



>emb|CEI94774.1| Putative Ribosomal protein L15 [Rhizopus microsporus]
Length=181

 Score =   178 bits (452),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKG  YGKP  +GV QLK+QRS RS AEER GRK   LRVLNSYWIN+D+TYK
Sbjct  46   GGRKRPVPKGATYGKPVNEGVNQLKYQRSLRSTAEERVGRKCRNLRVLNSYWINQDATYK  105

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPS-  206
            Y+EVILVD +H AIRNDPRINW+ NPVHKRRE RGLT+ GKK RG + +GH  +  + S 
Sbjct  106  YYEVILVDPSHKAIRNDPRINWIVNPVHKRREARGLTAIGKKSRGHQ-KGHRFNNTKGSG  164

Query  205  RRATWKRNQT  176
            RRATWKR  T
Sbjct  165  RRATWKRRNT  174



>gb|KGQ83010.1| 60S ribosomal protein L15-A [Candida albicans P37005]
 gb|KGT63650.1| 60S ribosomal protein L15-A [Candida albicans 12C]
 gb|KGU02265.1| 60S ribosomal protein L15-A [Candida albicans L26]
 gb|KGU02520.1| 60S ribosomal protein L15-A [Candida albicans 19F]
Length=204

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 101/129 (78%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPV KG  YGKPT QGV QLK+Q+S RS AEER GR+   LRVLNSYW+N+DSTYK
Sbjct  69   GGRKRPVLKGATYGKPTNQGVNQLKYQKSLRSTAEERVGRRASNLRVLNSYWVNQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD +H AIR D R NW+ NPVHK RE RGLTSAGKK RG+  +GHL +K +  R
Sbjct  129  YFEVILVDPSHKAIRRDARYNWIVNPVHKHREARGLTSAGKKSRGI-NKGHLFNKTKAGR  187

Query  202  RATWKRNQT  176
            R TWK++ T
Sbjct  188  RHTWKKHNT  196



>emb|CCK68268.1| hypothetical protein KNAG_0A06060 [Kazachstania naganishii CBS 
8797]
Length=204

 Score =   178 bits (452),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 98/129 (76%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            G RKRPVPKG  YGKPT QGV +LK+QRS R+ AEER GR+   LRVLNSYW+N+DSTYK
Sbjct  69   GNRKRPVPKGATYGKPTNQGVNELKYQRSLRATAEERVGRRAANLRVLNSYWVNQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFE+ILVD  H AIR D R NW+CNPVHK RE RGLT+ GKK RG+  +GH +H  +  R
Sbjct  129  YFEIILVDPQHKAIRRDARYNWICNPVHKHRENRGLTATGKKSRGI-NKGHRYHNTQAGR  187

Query  202  RATWKRNQT  176
            R TWKR  T
Sbjct  188  RKTWKRQNT  196



>emb|CDO96181.1| unnamed protein product [Kluyveromyces dobzhanskii CBS 2104]
Length=204

 Score =   178 bits (452),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 97/129 (75%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            G RKRPV KG  YGKPT QGV QLK+QRS RS AEER GR+   LRVLNSYW+N+DSTYK
Sbjct  69   GNRKRPVSKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRAANLRVLNSYWVNQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFE+ILVD +H AIR D + NW+CNPVHK RE RGLTS GKK RG+  +GH  H  +  R
Sbjct  129  YFEIILVDPSHKAIRRDAKYNWICNPVHKHRENRGLTSTGKKSRGI-NKGHKFHNTQAGR  187

Query  202  RATWKRNQT  176
            R TWKR  T
Sbjct  188  RKTWKRQNT  196



>ref|XP_007872719.1| ribosomal L15 [Pneumocystis murina B123]
 gb|EMR11223.1| ribosomal L15 [Pneumocystis murina B123]
Length=204

 Score =   178 bits (452),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKG  YGKPT  GV QLK+Q+S R  AEER GR+   LRVLNSYW+N+DSTYK
Sbjct  69   GGRKRPVPKGATYGKPTNMGVNQLKYQKSLRVTAEERVGRRCSNLRVLNSYWVNQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            Y+EVILVD  H AIR DPRINW+ N VHK RE RGLT+ G+K RG+ G+GHL++K+   R
Sbjct  129  YYEVILVDPHHKAIRRDPRINWIVNAVHKHREARGLTAIGRKSRGVSGKGHLYNKSSCGR  188

Query  202  RATWKRNQT  176
            R  WKR+ T
Sbjct  189  RKIWKRHNT  197



>emb|CEI91883.1| Putative Ribosomal protein L15 [Rhizopus microsporus]
Length=204

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKG  YGKP  +GV QLK+QRS RS AEER GRK   LRVLNSYWIN+D+TYK
Sbjct  69   GGRKRPVPKGATYGKPVNEGVNQLKYQRSLRSTAEERVGRKCRNLRVLNSYWINQDATYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPS-  206
            Y+EVILVD +H AIRNDPRINW+ NPVHKRRE RGLT+ GKK RG + +GH  +  + S 
Sbjct  129  YYEVILVDPSHKAIRNDPRINWIVNPVHKRREARGLTAIGKKSRGHQ-KGHRFNNTKGSG  187

Query  205  RRATWKRNQT  176
            RRATWKR  T
Sbjct  188  RRATWKRRNT  197



>gb|KEZ43818.1| hypothetical protein SAPIO_CDS3973 [Scedosporium apiospermum]
Length=203

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 99/129 (77%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRK+P PKG  YGKPT  G+ QLK+QRS R+ AEER GR+   LRVLNSYWINEDSTYK
Sbjct  69   GGRKKPAPKGATYGKPTSHGINQLKYQRSLRATAEERVGRRCANLRVLNSYWINEDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            Y+EVILVD  H AIR DPRINW+ NPVHK RE RGLT+ GKK RGL  +GH ++  R  R
Sbjct  129  YYEVILVDPQHKAIRLDPRINWIVNPVHKHREARGLTATGKKSRGL-NKGHRYNNTRAGR  187

Query  202  RATWKRNQT  176
            R TWKR+ T
Sbjct  188  RKTWKRHNT  196



>ref|XP_005717822.1| 60S ribosomal protein L15, partial [Chondrus crispus]
 emb|CDF37953.1| 60S ribosomal protein L15, partial [Chondrus crispus]
Length=216

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PV KGI YGKP  QG+T+LKF+R+KR+VAEERAGR+ G LRVLNSYW+NED+ YKYFE+I
Sbjct  86   PVKKGIQYGKPKHQGITELKFKRNKRAVAEERAGRRCGNLRVLNSYWVNEDAAYKYFEII  145

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD +H AIRNDPR+NWL  PV K RELRGLT+AG+K RGL  RGH  +  RPS RA WK
Sbjct  146  LVDPSHNAIRNDPRLNWLARPVMKHRELRGLTAAGRKGRGLHVRGHRANSTRPSVRAVWK  205

Query  187  RNQT  176
            ++ T
Sbjct  206  KHNT  209



>gb|EIE79210.1| 60S ribosomal protein L15 [Rhizopus delemar RA 99-880]
 gb|EIE81685.1| 60S ribosomal protein L15 [Rhizopus delemar RA 99-880]
 gb|EIE82356.1| 60S ribosomal protein L15 [Rhizopus delemar RA 99-880]
 gb|EIE85034.1| 60S ribosomal protein L15 [Rhizopus delemar RA 99-880]
Length=204

 Score =   178 bits (451),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKG  YGKP  +GV+QLK+QRS RS AEER GRK   LRVLNSYWIN+D+TYK
Sbjct  69   GGRKRPVPKGATYGKPVNEGVSQLKYQRSLRSTAEERVGRKCRNLRVLNSYWINQDATYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPS-  206
            YFEVILVD +H AIRND RINW+ NPVHKRRE RGLT+ GKK RG + +GH  +  + S 
Sbjct  129  YFEVILVDPSHKAIRNDARINWIVNPVHKRREARGLTAVGKKSRGHQ-KGHRFNNTKGSG  187

Query  205  RRATWKRNQT  176
            RRATWKR  T
Sbjct  188  RRATWKRRNT  197



>ref|XP_003837801.1| hypothetical protein LEMA_P121210.1 [Leptosphaeria maculans JN3]
 emb|CBX94357.1| hypothetical protein LEMA_P121210.1 [Leptosphaeria maculans JN3]
Length=248

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 99/129 (77%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRP PKG  YGKPT QG+ QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYK
Sbjct  114  GGRKRPAPKGATYGKPTNQGINQLKYQRSLKSTAEERIGRRCANLRVLNSYWINQDSTYK  173

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            Y+EVILVD  H AIR DPRINW+  PVHK RE RGLT+ GKK RGL GRGH ++     R
Sbjct  174  YYEVILVDPQHKAIRRDPRINWIVKPVHKHRESRGLTATGKKSRGL-GRGHKYNNTTAGR  232

Query  202  RATWKRNQT  176
            R TWKR+ T
Sbjct  233  RKTWKRHNT  241



>ref|XP_002598589.1| hypothetical protein BRAFLDRAFT_113717 [Branchiostoma floridae]
 gb|EEN54601.1| hypothetical protein BRAFLDRAFT_113717 [Branchiostoma floridae]
Length=204

 Score =   177 bits (450),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 101/130 (78%), Gaps = 2/130 (2%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRK+PVPKG  YGKP  QGV Q+KF R+ RSVAEER GR  G LRV+NSYW+ +DSTYK
Sbjct  69   GGRKKPVPKGATYGKPVHQGVNQMKFARNLRSVAEERVGRACGALRVMNSYWVGQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKAR-PS  206
            +FEVILVD  H A+R+DP + W+C PV K RELRGLTSAGK  RGL G+GHLHHK +  S
Sbjct  129  FFEVILVDPFHKAVRHDPEVQWICKPVMKHRELRGLTSAGKSSRGL-GKGHLHHKTKGGS  187

Query  205  RRATWKRNQT  176
             RA+WKR  T
Sbjct  188  WRASWKRRNT  197



>ref|XP_001484435.1| 60S ribosomal protein L15-A [Meyerozyma guilliermondii ATCC 6260]
 gb|EDK39718.1| 60S ribosomal protein L15-A [Meyerozyma guilliermondii ATCC 6260]
Length=204

 Score =   177 bits (450),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 101/129 (78%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            G RKRPVPKG  YGKPT QGV  LK+QRS R+ AEER GR+   LRVLNSYWIN+DSTYK
Sbjct  69   GNRKRPVPKGATYGKPTNQGVKHLKYQRSLRTTAEERVGRRAANLRVLNSYWINQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            Y+EVILVD +H AIR D R NW+ NPVHK RE RGLTSAGKK RG+  +GHL++K +  R
Sbjct  129  YYEVILVDPSHKAIRRDARYNWIVNPVHKHRESRGLTSAGKKSRGI-NKGHLYNKTKAGR  187

Query  202  RATWKRNQT  176
            R TWK++ T
Sbjct  188  RHTWKKHNT  196



>ref|XP_455872.1| 60S ribosomal protein L15 [Kluyveromyces lactis NRRL Y-1140]
 emb|CAG98580.1| KLLA0F17633p [Kluyveromyces lactis]
Length=204

 Score =   177 bits (450),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 97/129 (75%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            G RKRPV KG  YGKPT QGV QLK+QRS R+ AEER GR+   LRVLNSYWIN+DSTYK
Sbjct  69   GNRKRPVSKGATYGKPTNQGVNQLKYQRSLRATAEERVGRRAANLRVLNSYWINQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD +H AIR D + NW+CNPVHK RE RGLT+ GKK RG+  +GH  H  +  R
Sbjct  129  YFEVILVDPSHKAIRRDAKYNWICNPVHKHREARGLTATGKKSRGI-NKGHKFHNTQAGR  187

Query  202  RATWKRNQT  176
            R TWKR  T
Sbjct  188  RKTWKRQNT  196



>ref|XP_444915.1| 60S ribosomal protein L15 [Candida glabrata CBS 138]
 emb|CAG57808.1| unnamed protein product [Candida glabrata]
Length=204

 Score =   177 bits (449),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 99/129 (77%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            G RKRPVPKG  YGKPT QGV +LK+QRS R+ AEER GR+   LRVLNSYW+N+DSTYK
Sbjct  69   GNRKRPVPKGATYGKPTNQGVNELKYQRSLRATAEERVGRRASNLRVLNSYWVNQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD +H AIR D R NW+CNPVHK RE RGLT+ GKK RG+  +GH +   +  R
Sbjct  129  YFEVILVDPSHKAIRRDARYNWICNPVHKHREARGLTATGKKSRGI-NKGHRYTNTKAGR  187

Query  202  RATWKRNQT  176
            R TWKR+ T
Sbjct  188  RKTWKRHNT  196



>emb|CDK25606.1| unnamed protein product [Kuraishia capsulata CBS 1993]
Length=197

 Score =   177 bits (448),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            G RKRPVPKG  YGKPT QGV+QLK+Q+S ++ AEER GR+   LRVLNSYWIN+DSTYK
Sbjct  62   GNRKRPVPKGATYGKPTNQGVSQLKYQKSLQTTAEERVGRRAANLRVLNSYWINQDSTYK  121

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVIL+D  H AIR D R NW+ NPVHK RE RGLTS+GKK RG+  +GHL +K +  R
Sbjct  122  YFEVILIDPQHKAIRRDARYNWIANPVHKHREARGLTSSGKKSRGI-NKGHLFNKTKAGR  180

Query  202  RATWKRNQT  176
            R TWK++ T
Sbjct  181  RHTWKKHNT  189



>dbj|BAO40104.1| 60S ribosomal protein L15-B [Kluyveromyces marxianus DMKU3-1042]
 dbj|BAP71594.1| 60S ribosomal protein L15-B [Kluyveromyces marxianus]
Length=204

 Score =   177 bits (449),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 97/129 (75%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            G RKRPV KG  YGKPT QGV QLK+QRS R+ AEER GR+   LRVLNSYW+N+DSTYK
Sbjct  69   GNRKRPVSKGATYGKPTNQGVNQLKYQRSLRATAEERVGRRAANLRVLNSYWVNQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD +H AIR D + NW+CNPVHK RE RGLT+ GKK RG+  +GH  H  +  R
Sbjct  129  YFEVILVDPSHKAIRRDAKYNWICNPVHKHREARGLTATGKKSRGI-NKGHKFHNTQAGR  187

Query  202  RATWKRNQT  176
            R TWKR  T
Sbjct  188  RKTWKRQNT  196



>ref|XP_003678734.1| 60S ribosomal protein L15 [Torulaspora delbrueckii]
 emb|CCE89523.1| hypothetical protein TDEL_0A01910 [Torulaspora delbrueckii]
Length=204

 Score =   177 bits (449),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 99/129 (77%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            G RKRPVPKG  YGKPT QGV +LK+QR+ R+ AEER GR+   LRVLNSYW+N+DSTYK
Sbjct  69   GNRKRPVPKGATYGKPTNQGVNELKYQRALRATAEERVGRRASNLRVLNSYWVNQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD +H AIR D R NW+CNPVHK RE RGLT+ GKK RG+  +GH  +  +  R
Sbjct  129  YFEVILVDPSHKAIRRDARYNWICNPVHKHREARGLTATGKKSRGI-NKGHRFNNTKAGR  187

Query  202  RATWKRNQT  176
            R TWK+N T
Sbjct  188  RKTWKKNNT  196



>gb|KIV95599.1| 60S ribosomal protein L15 [Exophiala mesophila]
Length=203

 Score =   177 bits (449),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 97/124 (78%), Gaps = 1/124 (1%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKG  YGKPT QGV QLK+QRS RS AEER GR+   LRVLNSYWIN+DSTYKYFEVI
Sbjct  74   PVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRAANLRVLNSYWINQDSTYKYFEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD  H AIR DPRINW+ NPVHK RE RGLT+ GKK RGL G+GH ++K    RR TWK
Sbjct  134  LVDPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHGYNKTTAGRRKTWK  192

Query  187  RNQT  176
            R+ T
Sbjct  193  RHNT  196



>emb|CEJ01625.1| Putative Ribosomal protein L15 [Rhizopus microsporus]
Length=181

 Score =   176 bits (447),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKG  YGKP  +GV QLK+QRS RS AEER GRK   LRVLNSYWIN+D+TYK
Sbjct  46   GGRKRPVPKGATYGKPVNEGVNQLKYQRSLRSTAEERVGRKCRNLRVLNSYWINQDATYK  105

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPS-  206
            Y+EVILVD +H AIRNDPRI+W+ NPVHKRRE RGLT+ GKK RG + +GH  +  + S 
Sbjct  106  YYEVILVDPSHKAIRNDPRISWIVNPVHKRREARGLTAIGKKSRGHQ-KGHRFNNTKGSG  164

Query  205  RRATWKRNQT  176
            RRATWKR  T
Sbjct  165  RRATWKRRNT  174



>ref|XP_011115334.1| hypothetical protein H072_9785 [Dactylellina haptotyla CBS 200.50]
 gb|EPS36651.1| hypothetical protein H072_9785 [Dactylellina haptotyla CBS 200.50]
Length=204

 Score =   177 bits (448),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 98/129 (76%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            GGRKRPVPKG  YGKPT QGV QLK+QRS R+ AEER GR+   LRVLNSYW+N+DSTYK
Sbjct  69   GGRKRPVPKGATYGKPTNQGVNQLKYQRSHRATAEERVGRRCANLRVLNSYWVNQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVILVD  H AIR DPRINW+  PVHK RE RGLT  GK+ RG+  +GH ++  +  R
Sbjct  129  YFEVILVDPQHKAIRRDPRINWIVKPVHKHRESRGLTGTGKRSRGI-NKGHRYNNTKAGR  187

Query  202  RATWKRNQT  176
            R TWKR  T
Sbjct  188  RKTWKRQNT  196



>gb|KIN02516.1| hypothetical protein OIDMADRAFT_18358 [Oidiodendron maius Zn]
Length=203

 Score =   177 bits (448),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 97/124 (78%), Gaps = 1/124 (1%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKG  YGKPT QGV QLK+QRS +S AEER GR+   LRVLNSYWIN+DSTYKYFE+I
Sbjct  74   PVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYWINQDSTYKYFEII  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD  H AIR DPRINW+ NPVHK RE RGLT+ GKK RGL G+GH ++K    RR TWK
Sbjct  134  LVDPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHSYNKTTAGRRKTWK  192

Query  187  RNQT  176
            R+ T
Sbjct  193  RHNT  196



>gb|KIX01331.1| 60S ribosomal protein L15 [Rhinocladiella mackenziei CBS 650.93]
Length=203

 Score =   177 bits (448),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 97/124 (78%), Gaps = 1/124 (1%)
 Frame = -3

Query  547  PVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  368
            PVPKG  YGKPT QGV QLK+QRS RS AEER GR+   LRVLNSYWIN+DSTYKY+EVI
Sbjct  74   PVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRCANLRVLNSYWINQDSTYKYYEVI  133

Query  367  LVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWK  188
            LVD  H AIR DPRINW+ NPVHK RE RGLT+ GKK RGL G+GH+ +K    RR TWK
Sbjct  134  LVDPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHVFNKTTAGRRKTWK  192

Query  187  RNQT  176
            R+ T
Sbjct  193  RHNT  196



>ref|XP_003686547.1| 60S ribosomal protein L15 [Tetrapisispora phaffii CBS 4417]
 emb|CCE64113.1| hypothetical protein TPHA_0G02750 [Tetrapisispora phaffii CBS 
4417]
Length=204

 Score =   177 bits (448),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 97/129 (75%), Gaps = 1/129 (1%)
 Frame = -3

Query  562  GGRKRPVPKGIVYGKPTXQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYK  383
            G RKRPV KG  YGKPT +GV +LK+QRS RS AEER GR+   LRVLNSYW+N+DSTYK
Sbjct  69   GNRKRPVSKGATYGKPTNEGVNELKYQRSLRSTAEERVGRRAANLRVLNSYWVNQDSTYK  128

Query  382  YFEVILVDTAHAAIRNDPRINWLCNPVHKRRELRGLTSAGKKYRGLRGRGHLHHKARPSR  203
            YFEVIL+D  H AIR D R NW+CNPVHK RE RGLT+ GKK RGL  +GH +H  +  R
Sbjct  129  YFEVILIDPQHKAIRRDARYNWICNPVHKHRESRGLTATGKKSRGL-NKGHRYHNTQAGR  187

Query  202  RATWKRNQT  176
            R TWKR  T
Sbjct  188  RKTWKRQNT  196



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920