BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF013K17

Length=693
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57292.1|  gamma-glutamyl hydrolase                               287   1e-92   Ipomoea nil [qian niu]
ref|XP_011098203.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         264   7e-83   Sesamum indicum [beniseed]
gb|KDP46038.1|  hypothetical protein JCGZ_13484                         259   4e-81   Jatropha curcas
ref|XP_010106571.1|  Gamma-glutamyl hydrolase                           260   4e-81   Morus notabilis
ref|XP_006348322.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         257   7e-81   Solanum tuberosum [potatoes]
ref|XP_010675311.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         258   9e-81   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP06032.1|  unnamed protein product                                258   1e-80   Coffea canephora [robusta coffee]
gb|KJB13015.1|  hypothetical protein B456_002G051200                    257   2e-80   Gossypium raimondii
ref|XP_010060723.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    256   2e-80   
ref|XP_006348321.1|  PREDICTED: gamma-glutamyl hydrolase 1-like         255   4e-80   Solanum tuberosum [potatoes]
ref|XP_009769712.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         255   5e-80   Nicotiana sylvestris
ref|XP_006442404.1|  hypothetical protein CICLE_v10020608mg             256   5e-80   Citrus clementina [clementine]
ref|XP_010060720.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         256   7e-80   Eucalyptus grandis [rose gum]
ref|NP_001234434.1|  gamma-glutamylhydrolase 1 precursor                253   2e-79   Solanum lycopersicum
gb|KHG06555.1|  Gamma-glutamyl hydrolase -like protein                  254   3e-79   Gossypium arboreum [tree cotton]
ref|XP_002285525.1|  PREDICTED: gamma-glutamyl hydrolase 2 isofor...    254   6e-79   Vitis vinifera
ref|XP_002524523.1|  Gamma-glutamyl hydrolase precursor, putative       253   7e-79   Ricinus communis
ref|XP_009605608.1|  PREDICTED: gamma-glutamyl hydrolase 1-like         252   9e-79   Nicotiana tomentosiformis
gb|AFK48386.1|  unknown                                                 251   1e-78   Lotus japonicus
ref|XP_009630845.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         251   1e-78   Nicotiana tomentosiformis
ref|XP_006377741.1|  hypothetical protein POPTR_0011s10890g             253   1e-78   
ref|XP_004294089.1|  PREDICTED: gamma-glutamyl hydrolase 2 isofor...    253   2e-78   Fragaria vesca subsp. vesca
ref|XP_011002760.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         253   2e-78   Populus euphratica
ref|XP_007021916.1|  Gamma-glutamyl hydrolase 1 isoform 1               252   3e-78   
ref|XP_009803991.1|  PREDICTED: gamma-glutamyl hydrolase 1-like         250   4e-78   Nicotiana sylvestris
emb|CBI20168.3|  unnamed protein product                                255   6e-78   Vitis vinifera
gb|KJB13019.1|  hypothetical protein B456_002G051600                    250   9e-78   Gossypium raimondii
ref|NP_001234438.1|  gamma-glutamylhydrolase 3 precursor                249   1e-77   Solanum lycopersicum
ref|XP_010060722.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    250   1e-77   Eucalyptus grandis [rose gum]
ref|XP_006477853.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    249   1e-77   Citrus sinensis [apfelsine]
ref|XP_006442395.1|  hypothetical protein CICLE_v10020872mg             248   3e-77   Citrus clementina [clementine]
ref|XP_006360033.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         248   3e-77   Solanum tuberosum [potatoes]
ref|XP_006477852.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    248   4e-77   Citrus sinensis [apfelsine]
ref|XP_011044052.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         249   4e-77   Populus euphratica
ref|NP_001234440.1|  gamma-glutamylhydrolase 2                          247   6e-77   Solanum lycopersicum
ref|XP_010242157.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    247   2e-76   Nelumbo nucifera [Indian lotus]
ref|XP_002318789.2|  hypothetical protein POPTR_0012s11220g             247   4e-76   
ref|XP_010540146.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         247   5e-76   Tarenaya hassleriana [spider flower]
ref|XP_010248391.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    245   5e-76   Nelumbo nucifera [Indian lotus]
gb|KCW67543.1|  hypothetical protein EUGRSUZ_F01296                     239   1e-75   Eucalyptus grandis [rose gum]
gb|EPS62480.1|  hypothetical protein M569_12307                         244   1e-75   Genlisea aurea
gb|AAC83041.1|  Strong similarity to gb|AF067141 gamma-glutamyl h...    243   1e-75   Arabidopsis thaliana [mouse-ear cress]
gb|AAC33745.1|  gamma-glutamyl hydrolase                                243   2e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002862660.1|  gamma-glutamyl hydrolase 2                         243   2e-75   Arabidopsis lyrata subsp. lyrata
ref|XP_010472700.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         243   4e-75   Camelina sativa [gold-of-pleasure]
ref|NP_565186.2|  gamma-glutamyl hydrolase 2                            243   4e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007149562.1|  hypothetical protein PHAVU_005G080700g             242   6e-75   Phaseolus vulgaris [French bean]
ref|XP_002887752.1|  gamma-glutamyl hydrolase 2                         242   8e-75   Arabidopsis lyrata subsp. lyrata
ref|XP_010429695.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         242   9e-75   Camelina sativa [gold-of-pleasure]
ref|XP_009128305.1|  PREDICTED: gamma-glutamyl hydrolase 1              241   1e-74   Brassica rapa
emb|CDY14595.1|  BnaC02g25180D                                          241   2e-74   Brassica napus [oilseed rape]
ref|XP_006389965.1|  hypothetical protein EUTSA_v10018776mg             241   3e-74   Eutrema salsugineum [saltwater cress]
ref|XP_002887751.1|  gamma-glutamyl hydrolase 3                         241   3e-74   Arabidopsis lyrata subsp. lyrata
ref|XP_002862658.1|  hypothetical protein ARALYDRAFT_359459             236   4e-74   
ref|XP_010417473.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         241   4e-74   Camelina sativa [gold-of-pleasure]
ref|XP_002862659.1|  gamma-glutamyl hydrolase 3                         240   4e-74   Arabidopsis lyrata subsp. lyrata
gb|AAM65646.1|  gamma glutamyl hydrolase, putative                      239   9e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010644101.1|  PREDICTED: gamma-glutamyl hydrolase 2 isofor...    240   1e-73   
ref|NP_177988.1|  gamma-glutamyl hydrolase 3                            239   1e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003596306.1|  Gamma-glutamylhydrolase                            239   1e-73   Medicago truncatula
ref|XP_008386275.1|  PREDICTED: gamma-glutamyl hydrolase 2              240   1e-73   
ref|XP_007213890.1|  hypothetical protein PRUPE_ppa006962mg             240   2e-73   Prunus persica
emb|CDX87443.1|  BnaA07g34300D                                          237   2e-73   
ref|XP_009106581.1|  PREDICTED: probable gamma-glutamyl hydrolase 3     238   2e-73   Brassica rapa
ref|XP_004489007.1|  PREDICTED: gamma-glutamyl hydrolase-like           237   6e-73   Cicer arietinum [garbanzo]
ref|XP_008226384.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         238   8e-73   Prunus mume [ume]
ref|XP_006477848.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    237   1e-72   Citrus sinensis [apfelsine]
ref|XP_010924708.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-glutam...    236   2e-72   Elaeis guineensis
ref|XP_003543198.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         235   3e-72   Glycine max [soybeans]
ref|XP_009334021.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         235   3e-72   Pyrus x bretschneideri [bai li]
gb|KFK42251.1|  hypothetical protein AALP_AA2G230800                    235   3e-72   Arabis alpina [alpine rockcress]
ref|XP_009342915.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    236   4e-72   Pyrus x bretschneideri [bai li]
ref|XP_008345165.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-glutam...    236   4e-72   
emb|CDX87442.1|  BnaA07g34310D                                          234   4e-72   
ref|XP_002887750.1|  ATGGH1                                             234   6e-72   
ref|XP_006302531.1|  hypothetical protein CARUB_v10020631mg             233   1e-71   
ref|XP_008463749.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         234   1e-71   Cucumis melo [Oriental melon]
emb|CDX88464.1|  BnaC06g39080D                                          233   1e-71   
ref|NP_177987.1|  gamma-glutamyl hydrolase 1                            233   2e-71   Arabidopsis thaliana [mouse-ear cress]
gb|AES66560.2|  gamma-glutamylhydrolase                                 232   3e-71   Medicago truncatula
ref|XP_009342914.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    234   3e-71   Pyrus x bretschneideri [bai li]
ref|XP_008792313.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         234   4e-71   Phoenix dactylifera
ref|NP_849900.1|  gamma-glutamyl hydrolase 1                            232   5e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010417472.1|  PREDICTED: gamma-glutamyl hydrolase 1-like         232   6e-71   Camelina sativa [gold-of-pleasure]
ref|XP_003596308.1|  Gamma-glutamylhydrolase                            231   7e-71   
ref|XP_009106586.1|  PREDICTED: gamma-glutamyl hydrolase 2              231   7e-71   Brassica rapa
ref|XP_010472701.1|  PREDICTED: gamma-glutamyl hydrolase 1              231   8e-71   Camelina sativa [gold-of-pleasure]
gb|KEH38596.1|  gamma-glutamylhydrolase                                 231   8e-71   Medicago truncatula
gb|AFK48342.1|  unknown                                                 231   1e-70   Medicago truncatula
ref|XP_010324181.1|  PREDICTED: gamma-glutamylhydrolase 3 isoform X1    230   1e-70   
ref|NP_001185429.1|  gamma-glutamyl hydrolase 2                         231   1e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010429696.1|  PREDICTED: gamma-glutamyl hydrolase 1-like         231   1e-70   Camelina sativa [gold-of-pleasure]
ref|XP_004146022.1|  PREDICTED: gamma-glutamyl hydrolase-like           231   3e-70   Cucumis sativus [cucumbers]
gb|KFK42249.1|  hypothetical protein AALP_AA2G230600                    229   3e-70   Arabis alpina [alpine rockcress]
ref|XP_007021917.1|  Gamma-glutamyl hydrolase 1 isoform 2               230   4e-70   
gb|KFK42250.1|  hypothetical protein AALP_AA2G230700                    229   4e-70   Arabis alpina [alpine rockcress]
gb|AFK41094.1|  unknown                                                 229   5e-70   Medicago truncatula
gb|KHN36904.1|  Gamma-glutamyl hydrolase                                223   7e-70   Glycine soja [wild soybean]
ref|XP_004166066.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-glutam...    231   1e-69   
ref|XP_009406770.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    228   1e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406768.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    229   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406769.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    226   3e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003568092.2|  PREDICTED: gamma-glutamyl hydrolase 2-like         225   4e-68   Brachypodium distachyon [annual false brome]
ref|XP_008359366.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-glutam...    216   9e-67   
ref|XP_004961495.1|  PREDICTED: gamma-glutamyl hydrolase-like           221   1e-66   Setaria italica
gb|EYU29531.1|  hypothetical protein MIMGU_mgv1a009742mg                219   4e-66   Erythranthe guttata [common monkey flower]
ref|XP_006655488.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         218   1e-65   Oryza brachyantha
ref|XP_006833066.1|  hypothetical protein AMTR_s00170p00050820          218   2e-65   
ref|XP_004489008.1|  PREDICTED: gamma-glutamyl hydrolase-like           216   6e-65   
ref|XP_011082781.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         215   1e-64   
ref|XP_006389966.1|  hypothetical protein EUTSA_v10018738mg             216   2e-64   
ref|XP_002441386.1|  hypothetical protein SORBIDRAFT_09g025690          213   1e-63   Sorghum bicolor [broomcorn]
ref|NP_001056052.1|  Os05g0517500                                       212   2e-63   
dbj|BAJ93186.1|  predicted protein                                      212   3e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACG46729.1|  gamma-glutamyl hydrolase precursor                      211   5e-63   Zea mays [maize]
gb|EYU26311.1|  hypothetical protein MIMGU_mgv1a022410mg                211   2e-62   Erythranthe guttata [common monkey flower]
ref|XP_006593481.1|  PREDICTED: gamma-glutamyl hydrolase isoform X1     209   4e-62   
gb|KHN36905.1|  Gamma-glutamyl hydrolase                                209   6e-62   Glycine soja [wild soybean]
ref|NP_001235549.1|  gamma-glutamyl hydrolase precursor                 206   5e-61   
ref|XP_002441385.1|  hypothetical protein SORBIDRAFT_09g025680          202   1e-59   
ref|XP_011460803.1|  PREDICTED: gamma-glutamyl hydrolase 2 isofor...    204   1e-59   Fragaria vesca subsp. vesca
ref|XP_006442394.1|  hypothetical protein CICLE_v10020872mg             199   2e-58   
gb|EMT14979.1|  Gamma-glutamyl hydrolase                                196   1e-57   
ref|XP_007149561.1|  hypothetical protein PHAVU_005G080600g             197   2e-57   Phaseolus vulgaris [French bean]
gb|ABK22567.1|  unknown                                                 194   1e-56   Picea sitchensis
gb|KGN55059.1|  hypothetical protein Csa_4G627100                       192   3e-55   Cucumis sativus [cucumbers]
ref|XP_006302530.1|  hypothetical protein CARUB_v10020631mg             190   3e-55   
gb|EYU26304.1|  hypothetical protein MIMGU_mgv1a019206mg                189   1e-54   Erythranthe guttata [common monkey flower]
gb|EYU26310.1|  hypothetical protein MIMGU_mgv1a022815mg                189   2e-54   Erythranthe guttata [common monkey flower]
ref|XP_001772336.1|  predicted protein                                  185   2e-53   
ref|XP_004146090.1|  PREDICTED: gamma-glutamyl hydrolase-like           186   3e-53   
ref|XP_002441384.1|  hypothetical protein SORBIDRAFT_09g025670          177   1e-49   
ref|XP_002984712.1|  hypothetical protein SELMODRAFT_423816             174   5e-49   Selaginella moellendorffii
ref|XP_006442390.1|  hypothetical protein CICLE_v10022857mg             168   6e-49   
ref|XP_002978801.1|  hypothetical protein SELMODRAFT_177157             174   7e-49   Selaginella moellendorffii
ref|XP_001782403.1|  predicted protein                                  171   8e-48   
dbj|BAJ98663.1|  predicted protein                                      170   2e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006442406.1|  hypothetical protein CICLE_v10020608mg             164   4e-45   
ref|XP_003596309.1|  Gamma-glutamyl hydrolase                           155   4e-44   
gb|KGN55060.1|  hypothetical protein Csa_4G627110                       161   1e-43   Cucumis sativus [cucumbers]
ref|XP_006370106.1|  hypothetical protein POPTR_0001s39540g             160   2e-43   
ref|XP_006494682.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    157   9e-43   Citrus sinensis [apfelsine]
gb|KDO42395.1|  hypothetical protein CISIN_1g023716mg                   155   4e-42   Citrus sinensis [apfelsine]
ref|XP_010242158.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    153   5e-41   
ref|XP_005645555.1|  class I glutamine amidotransferase-like protein    154   6e-41   Coccomyxa subellipsoidea C-169
gb|EMS68709.1|  Gamma-glutamyl hydrolase                                152   2e-40   Triticum urartu
ref|XP_006301184.1|  hypothetical protein CARUB_v10021583mg             148   2e-39   
ref|XP_002978799.1|  hypothetical protein SELMODRAFT_109437             145   3e-39   
ref|XP_004998304.1|  gamma-glutamyl hydrolase                           145   6e-38   Salpingoeca rosetta
ref|XP_010248393.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    143   2e-37   Nelumbo nucifera [Indian lotus]
ref|XP_004172076.1|  PREDICTED: gamma-glutamyl hydrolase-like           144   2e-37   
ref|XP_001626371.1|  predicted protein                                  143   4e-37   Nematostella vectensis
gb|AES66561.2|  class I glutamine amidotransferase                      139   4e-36   Medicago truncatula
ref|XP_006477850.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    140   4e-36   Citrus sinensis [apfelsine]
ref|XP_006477849.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    140   1e-35   Citrus sinensis [apfelsine]
ref|XP_011406499.1|  PREDICTED: gamma-glutamyl hydrolase A-like         136   6e-35   
ref|XP_003391262.1|  PREDICTED: gamma-glutamyl hydrolase A-like         135   1e-34   
ref|XP_006442396.1|  hypothetical protein CICLE_v10021719mg             135   1e-34   
ref|XP_006442405.1|  hypothetical protein CICLE_v10020608mg             135   2e-34   
gb|KDD74766.1|  hypothetical protein H632_c1088p1                       134   1e-33   Helicosporidium sp. ATCC 50920
ref|XP_001696183.1|  gamma-glutamyl hydrolase                           134   3e-33   Chlamydomonas reinhardtii
ref|XP_003596310.1|  Gamma-glutamyl hydrolase                           130   9e-33   
ref|XP_007021919.1|  Gamma-glutamyl hydrolase 1 isoform 4               130   2e-32   
ref|XP_007021918.1|  Gamma-glutamyl hydrolase 1 isoform 3               129   3e-32   
ref|XP_006494683.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    128   5e-32   Citrus sinensis [apfelsine]
ref|NP_998487.1|  gamma-glutamyl hydrolase precursor                    129   5e-32   Danio rerio [leopard danio]
pdb|4L8F|C  Chain C, Crystal Structure Of Gamma-glutamyl Hydrolas...    129   6e-32   Danio rerio [leopard danio]
pdb|4L8W|D  Chain D, Crystal Structure Of Gamma Glutamyl Hydrolas...    129   7e-32   Danio rerio [leopard danio]
ref|XP_005852047.1|  hypothetical protein CHLNCDRAFT_133025             130   8e-32   Chlorella variabilis
ref|XP_011395864.1|  Gamma-glutamyl hydrolase A                         129   1e-31   Auxenochlorella protothecoides
ref|XP_007231125.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    128   2e-31   
gb|KDO42396.1|  hypothetical protein CISIN_1g023716mg                   127   2e-31   Citrus sinensis [apfelsine]
ref|XP_006634071.1|  PREDICTED: gamma-glutamyl hydrolase-like           127   4e-31   
ref|XP_007231124.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    127   5e-31   
gb|AAH87532.1|  LOC496099 protein                                       127   5e-31   Xenopus laevis [clawed frog]
gb|AAI08439.1|  LOC496099 protein                                       126   5e-31   Xenopus laevis [clawed frog]
emb|CDQ81962.1|  unnamed protein product                                126   6e-31   Oncorhynchus mykiss
gb|ACI68420.1|  Gamma-glutamyl hydrolase precursor                      126   6e-31   Salmo salar
ref|XP_005830901.1|  hypothetical protein GUITHDRAFT_72685              126   7e-31   Guillardia theta CCMP2712
ref|XP_007021920.1|  Gamma-glutamyl hydrolase 1, putative               122   1e-30   
gb|EYU26306.1|  hypothetical protein MIMGU_mgv1a019546mg                123   2e-30   Erythranthe guttata [common monkey flower]
ref|XP_006860125.1|  PREDICTED: gamma-glutamyl hydrolase                125   3e-30   Chrysochloris asiatica
ref|XP_003287039.1|  hypothetical protein DICPUDRAFT_31892              125   3e-30   Dictyostelium purpureum
ref|XP_007937663.1|  PREDICTED: gamma-glutamyl hydrolase                124   3e-30   Orycteropus afer afer
ref|XP_006625568.1|  PREDICTED: gamma-glutamyl hydrolase-like           125   3e-30   
ref|XP_007231561.1|  PREDICTED: gamma-glutamyl hydrolase-like           124   3e-30   
ref|XP_008416492.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    124   4e-30   Poecilia reticulata
ref|XP_005795110.1|  PREDICTED: gamma-glutamyl hydrolase-like           124   4e-30   
ref|XP_008416491.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    124   4e-30   Poecilia reticulata
ref|XP_637673.1|  peptidase C26 family protein                          124   5e-30   Dictyostelium discoideum AX4
ref|XP_004372622.1|  PREDICTED: gamma-glutamyl hydrolase                124   7e-30   Trichechus manatus latirostris
ref|XP_007231126.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    123   8e-30   
gb|AAC83043.1|  Similar to gb|AF067141 gamma-glutamyl hydrolase f...    117   1e-29   Arabidopsis thaliana [mouse-ear cress]
gb|EFA81874.1|  peptidase C26 family protein                            122   2e-29   Heterostelium album PN500
ref|XP_007894923.1|  PREDICTED: gamma-glutamyl hydrolase                122   2e-29   Callorhinchus milii [Australian ghost shark]
ref|XP_002156669.1|  PREDICTED: gamma-glutamyl hydrolase A-like         121   4e-29   
gb|ACO09704.1|  Gamma-glutamyl hydrolase precursor                      122   5e-29   Osmerus mordax
ref|XP_006487640.1|  PREDICTED: gamma-glutamyl hydrolase 1-like i...    114   1e-28   
gb|KFW02734.1|  Gamma-glutamyl hydrolase                                119   2e-28   Eurypyga helias
ref|XP_008287386.1|  PREDICTED: gamma-glutamyl hydrolase-like           120   2e-28   Stegastes partitus
ref|XP_010147217.1|  PREDICTED: gamma-glutamyl hydrolase                119   2e-28   Eurypyga helias
ref|XP_005009586.1|  PREDICTED: gamma-glutamyl hydrolase                120   2e-28   
gb|KFR13230.1|  Gamma-glutamyl hydrolase                                118   4e-28   Opisthocomus hoazin [hoatzin]
ref|XP_419226.4|  PREDICTED: gamma-glutamyl hydrolase                   120   4e-28   Gallus gallus [bantam]
ref|XP_003974928.1|  PREDICTED: gamma-glutamyl hydrolase-like           118   6e-28   Takifugu rubripes [tiger puffer]
ref|NP_034411.2|  gamma-glutamyl hydrolase precursor                    118   6e-28   Mus musculus [mouse]
gb|AAI24119.1|  LOC553228 protein                                       119   6e-28   Danio rerio [leopard danio]
ref|XP_009936040.1|  PREDICTED: gamma-glutamyl hydrolase                118   6e-28   Opisthocomus hoazin [hoatzin]
ref|XP_009584845.1|  PREDICTED: gamma-glutamyl hydrolase                117   7e-28   Fulmarus glacialis
gb|KFV98034.1|  Gamma-glutamyl hydrolase                                117   8e-28   Fulmarus glacialis
ref|XP_005730485.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    118   8e-28   
emb|CDQ59361.1|  unnamed protein product                                118   8e-28   Oncorhynchus mykiss
gb|KFP45914.1|  Gamma-glutamyl hydrolase                                117   9e-28   Chlamydotis macqueenii
ref|XP_010127038.1|  PREDICTED: gamma-glutamyl hydrolase                117   9e-28   Chlamydotis macqueenii
ref|XP_008171736.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-glutam...    118   9e-28   
ref|XP_007557581.1|  PREDICTED: gamma-glutamyl hydrolase-like           118   1e-27   Poecilia formosa
ref|XP_005652325.1|  class I glutamine amidotransferase-like protein    117   1e-27   Coccomyxa subellipsoidea C-169
gb|KFZ55994.1|  Gamma-glutamyl hydrolase                                117   1e-27   Podiceps cristatus
ref|XP_010016975.1|  PREDICTED: gamma-glutamyl hydrolase                117   1e-27   Nestor notabilis
ref|XP_010071123.1|  PREDICTED: gamma-glutamyl hydrolase                116   1e-27   Pterocles gutturalis
gb|KFP82604.1|  Gamma-glutamyl hydrolase                                117   1e-27   Acanthisitta chloris
gb|KFQ53384.1|  Gamma-glutamyl hydrolase                                117   1e-27   Nestor notabilis
ref|XP_004912572.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    117   1e-27   
ref|XP_009075416.1|  PREDICTED: gamma-glutamyl hydrolase                117   2e-27   Acanthisitta chloris
ref|XP_005066278.1|  PREDICTED: gamma-glutamyl hydrolase                117   2e-27   Mesocricetus auratus [Syrian golden hamster]
gb|KFV06368.1|  Gamma-glutamyl hydrolase                                116   2e-27   Pterocles gutturalis
ref|XP_003999883.1|  PREDICTED: gamma-glutamyl hydrolase                117   2e-27   
gb|KIZ06309.1|  gamma-glutamyl hydrolase                                117   2e-27   Monoraphidium neglectum
ref|XP_009632417.1|  PREDICTED: gamma-glutamyl hydrolase                116   2e-27   Egretta garzetta
gb|KFP12067.1|  Gamma-glutamyl hydrolase                                116   2e-27   Egretta garzetta
ref|XP_002946185.1|  hypothetical protein VOLCADRAFT_102798             117   2e-27   Volvox carteri f. nagariensis
gb|KFZ45669.1|  Gamma-glutamyl hydrolase                                116   2e-27   Antrostomus carolinensis
gb|EDL05569.1|  gamma-glutamyl hydrolase                                114   2e-27   Mus musculus [mouse]
gb|ACI66462.1|  Gamma-glutamyl hydrolase precursor                      117   2e-27   Salmo salar
ref|XP_010175281.1|  PREDICTED: gamma-glutamyl hydrolase                116   2e-27   Antrostomus carolinensis
ref|XP_004551883.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    117   2e-27   
ref|XP_002710570.1|  PREDICTED: gamma-glutamyl hydrolase                117   2e-27   Oryctolagus cuniculus [domestic rabbit]
gb|KFO77933.1|  Gamma-glutamyl hydrolase                                116   2e-27   Cuculus canorus
gb|AAH93328.1|  LOC553228 protein                                       117   2e-27   Danio rerio [leopard danio]
gb|KFV00608.1|  Gamma-glutamyl hydrolase                                116   3e-27   Tauraco erythrolophus
ref|XP_005943740.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    116   3e-27   
ref|XP_008306469.1|  PREDICTED: gamma-glutamyl hydrolase-like           115   3e-27   
ref|XP_010775082.1|  PREDICTED: gamma-glutamyl hydrolase-like           116   3e-27   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_006880500.1|  PREDICTED: gamma-glutamyl hydrolase                116   3e-27   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004814095.1|  PREDICTED: gamma-glutamyl hydrolase                116   3e-27   
ref|NP_001243151.1|  gamma-glutamyl hydrolase precursor                 116   3e-27   Danio rerio [leopard danio]
ref|XP_005988287.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    116   3e-27   Latimeria chalumnae
ref|XP_005288157.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    117   3e-27   Chrysemys picta bellii
ref|XP_009979902.1|  PREDICTED: gamma-glutamyl hydrolase                116   3e-27   Tauraco erythrolophus
gb|KFP55993.1|  Gamma-glutamyl hydrolase                                115   4e-27   Cathartes aura
ref|XP_006789926.1|  PREDICTED: gamma-glutamyl hydrolase-like           116   4e-27   Neolamprologus brichardi [lyretail cichlid]
ref|XP_004773000.1|  PREDICTED: gamma-glutamyl hydrolase                116   4e-27   Mustela putorius furo [black ferret]
gb|KIZ06563.1|  gamma-glutamyl hydrolase                                117   4e-27   Monoraphidium neglectum
ref|XP_010707289.1|  PREDICTED: gamma-glutamyl hydrolase                117   4e-27   Meleagris gallopavo [common turkey]
gb|EGW11198.1|  Gamma-glutamyl hydrolase                                115   4e-27   Cricetulus griseus [Chinese hamsters]
gb|KGL97086.1|  Gamma-glutamyl hydrolase                                115   4e-27   Charadrius vociferus
ref|XP_005452234.1|  PREDICTED: gamma-glutamyl hydrolase-like           116   4e-27   
ref|XP_009561586.1|  PREDICTED: gamma-glutamyl hydrolase                115   5e-27   Cuculus canorus
gb|AAI54503.1|  LOC553228 protein                                       116   5e-27   Danio rerio [leopard danio]
gb|AAH76459.1|  LOC553228 protein                                       116   5e-27   Danio rerio [leopard danio]
gb|KFU88050.1|  Gamma-glutamyl hydrolase                                115   5e-27   Chaetura pelagica
gb|AAI34126.1|  LOC553228 protein                                       116   5e-27   Danio rerio [leopard danio]
ref|XP_009888091.1|  PREDICTED: gamma-glutamyl hydrolase                115   6e-27   Charadrius vociferus
ref|XP_004551885.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    114   6e-27   
gb|KFP85763.1|  Gamma-glutamyl hydrolase                                115   7e-27   Apaloderma vittatum
ref|XP_009993891.1|  PREDICTED: gamma-glutamyl hydrolase                115   8e-27   Chaetura pelagica
ref|XP_003505759.2|  PREDICTED: gamma-glutamyl hydrolase isoform X1     115   8e-27   Cricetulus griseus [Chinese hamsters]
ref|XP_011362877.1|  PREDICTED: gamma-glutamyl hydrolase                115   8e-27   Pteropus vampyrus
ref|XP_007613199.1|  PREDICTED: gamma-glutamyl hydrolase isoform X2     115   8e-27   
ref|XP_010288197.1|  PREDICTED: gamma-glutamyl hydrolase                115   9e-27   Phaethon lepturus
ref|XP_002595631.1|  hypothetical protein BRAFLDRAFT_200938             115   9e-27   Branchiostoma floridae
ref|XP_008945346.1|  PREDICTED: gamma-glutamyl hydrolase                114   9e-27   Merops nubicus
ref|XP_005803695.1|  PREDICTED: gamma-glutamyl hydrolase-like           115   1e-26   
ref|XP_004653382.1|  PREDICTED: gamma-glutamyl hydrolase                115   1e-26   Jaculus jaculus
ref|XP_010344363.1|  PREDICTED: gamma-glutamyl hydrolase                114   1e-26   Saimiri boliviensis boliviensis
emb|CAG05439.1|  unnamed protein product                                115   1e-26   Tetraodon nigroviridis
gb|KFQ20983.1|  Gamma-glutamyl hydrolase                                114   1e-26   Merops nubicus
gb|KFQ77761.1|  Gamma-glutamyl hydrolase                                115   1e-26   Phaethon lepturus
ref|XP_009971297.1|  PREDICTED: gamma-glutamyl hydrolase                114   1e-26   Tyto alba [Schleiereule]
gb|KFQ39814.1|  Gamma-glutamyl hydrolase                                115   1e-26   
gb|KFM77469.1|  Gamma-glutamyl hydrolase                                115   1e-26   
ref|XP_004359252.1|  hypothetical protein DFA_01284                     117   1e-26   
gb|KFV58816.1|  Gamma-glutamyl hydrolase                                114   1e-26   
ref|XP_010189075.1|  PREDICTED: gamma-glutamyl hydrolase                115   1e-26   
ref|XP_003408374.1|  PREDICTED: gamma-glutamyl hydrolase                115   1e-26   
ref|XP_007555757.1|  PREDICTED: gamma-glutamyl hydrolase-like           114   1e-26   
ref|XP_006494030.1|  PREDICTED: gamma-glutamyl hydrolase 1-like i...    109   1e-26   
ref|XP_008334216.1|  PREDICTED: gamma-glutamyl hydrolase-like           115   1e-26   
ref|XP_010874408.1|  PREDICTED: RING finger protein 122 isoform X1      114   1e-26   
ref|XP_006494028.1|  PREDICTED: gamma-glutamyl hydrolase 1-like i...    110   1e-26   
ref|XP_003439349.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    115   1e-26   
gb|KFW90224.1|  Gamma-glutamyl hydrolase                                114   1e-26   
ref|XP_005517480.1|  PREDICTED: gamma-glutamyl hydrolase                115   1e-26   
ref|XP_009501530.1|  PREDICTED: gamma-glutamyl hydrolase                114   2e-26   
ref|XP_006441704.1|  hypothetical protein CICLE_v10023089mg             108   2e-26   
ref|XP_005730486.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    114   2e-26   
ref|XP_002595632.1|  hypothetical protein BRAFLDRAFT_275357             114   2e-26   
ref|XP_004551884.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    114   2e-26   
ref|XP_005152793.1|  PREDICTED: gamma-glutamyl hydrolase                114   2e-26   
ref|XP_009707401.1|  PREDICTED: gamma-glutamyl hydrolase                114   2e-26   
ref|XP_004551881.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    114   2e-26   
ref|XP_009864501.1|  PREDICTED: gamma-glutamyl hydrolase                114   2e-26   
ref|XP_005730484.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    114   2e-26   
ref|XP_010139831.1|  PREDICTED: gamma-glutamyl hydrolase                113   2e-26   
ref|XP_005943739.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    114   2e-26   
gb|KFO85082.1|  Gamma-glutamyl hydrolase                                113   2e-26   
gb|KFP61510.1|  Gamma-glutamyl hydrolase                                114   3e-26   
ref|XP_004081412.1|  PREDICTED: gamma-glutamyl hydrolase-like           114   3e-26   
gb|KFQ12123.1|  Gamma-glutamyl hydrolase                                114   3e-26   
ref|XP_004551882.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    114   3e-26   
ref|XP_009950167.1|  PREDICTED: gamma-glutamyl hydrolase                114   3e-26   
ref|XP_010298803.1|  PREDICTED: gamma-glutamyl hydrolase                113   3e-26   
ref|XP_002166220.1|  PREDICTED: gamma-glutamyl hydrolase A-like         114   3e-26   
ref|XP_004072343.2|  PREDICTED: gamma-glutamyl hydrolase-like           114   3e-26   
gb|KFM01460.1|  Gamma-glutamyl hydrolase                                113   3e-26   
ref|XP_008067304.1|  PREDICTED: gamma-glutamyl hydrolase                113   4e-26   
ref|XP_005847461.1|  hypothetical protein CHLNCDRAFT_52559              114   4e-26   
ref|XP_005506577.1|  PREDICTED: gamma-glutamyl hydrolase                112   4e-26   
gb|KFO09908.1|  Gamma-glutamyl hydrolase                                113   4e-26   
gb|KFQ09872.1|  Gamma-glutamyl hydrolase                                112   4e-26   
ref|XP_009283787.1|  PREDICTED: gamma-glutamyl hydrolase                113   4e-26   
ref|XP_002595630.1|  hypothetical protein BRAFLDRAFT_275351             113   5e-26   
ref|XP_009924525.1|  PREDICTED: gamma-glutamyl hydrolase                112   5e-26   
ref|XP_010219839.1|  PREDICTED: gamma-glutamyl hydrolase                112   5e-26   
ref|XP_010198415.1|  PREDICTED: gamma-glutamyl hydrolase                112   5e-26   
gb|KFW77964.1|  Gamma-glutamyl hydrolase                                113   6e-26   
gb|ABQ22394.1|  gamma-glutamyl hydrolase precursor-like protein         109   6e-26   
gb|KGL82032.1|  Gamma-glutamyl hydrolase                                112   6e-26   
ref|XP_008980964.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-glutam...    112   6e-26   
gb|KFP27811.1|  Gamma-glutamyl hydrolase                                112   6e-26   
gb|KFW72792.1|  Gamma-glutamyl hydrolase                                112   6e-26   
ref|XP_010581262.1|  PREDICTED: gamma-glutamyl hydrolase                112   7e-26   
ref|XP_005919127.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    112   7e-26   
ref|XP_009330385.1|  PREDICTED: gamma-glutamyl hydrolase                112   8e-26   
ref|XP_004547177.1|  PREDICTED: gamma-glutamyl hydrolase-like           112   8e-26   
gb|KFV80511.1|  Gamma-glutamyl hydrolase                                112   8e-26   
ref|XP_010741409.1|  PREDICTED: gamma-glutamyl hydrolase-like           112   9e-26   
ref|XP_636287.1|  peptidase C26 family protein                          112   1e-25   
ref|XP_003831430.1|  PREDICTED: gamma-glutamyl hydrolase                112   1e-25   
ref|XP_005449148.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    112   1e-25   
ref|NP_003869.1|  gamma-glutamyl hydrolase precursor                    112   1e-25   
ref|XP_005423104.1|  PREDICTED: gamma-glutamyl hydrolase                112   1e-25   
ref|XP_005323027.1|  PREDICTED: gamma-glutamyl hydrolase                112   1e-25   
dbj|BAF83139.1|  unnamed protein product                                112   1e-25   
ref|XP_001159345.1|  PREDICTED: gamma-glutamyl hydrolase isoform X2     112   1e-25   
ref|XP_009902444.1|  PREDICTED: gamma-glutamyl hydrolase                112   1e-25   
ref|XP_007487124.1|  PREDICTED: gamma-glutamyl hydrolase                112   1e-25   
gb|KFV70089.1|  Gamma-glutamyl hydrolase                                112   1e-25   
ref|XP_010639617.1|  PREDICTED: gamma-glutamyl hydrolase                112   1e-25   
ref|XP_006799271.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    112   1e-25   
pdb|1L9X|A  Chain A, Structure Of Gamma-Glutamyl Hydrolase              112   1e-25   
ref|XP_010731504.1|  PREDICTED: gamma-glutamyl hydrolase-like           112   1e-25   
ref|XP_004642424.1|  PREDICTED: gamma-glutamyl hydrolase                112   1e-25   
ref|XP_008918537.1|  PREDICTED: gamma-glutamyl hydrolase                112   2e-25   
ref|XP_007526913.1|  PREDICTED: gamma-glutamyl hydrolase                111   2e-25   
gb|AAC70002.1|  gamma glutamyl hydrolase precursor                      111   2e-25   
gb|AAI50899.1|  Gamma-glutamyl hydrolase                                111   2e-25   
gb|AAH09809.1|  Gamma-glutamyl hydrolase                                111   2e-25   
ref|XP_004697814.1|  PREDICTED: gamma-glutamyl hydrolase                111   2e-25   
gb|AAC70003.1|  gamma-glutamyl hydrolase precursor                      111   2e-25   
ref|XP_004398839.1|  PREDICTED: gamma-glutamyl hydrolase                111   2e-25   
ref|XP_009671852.1|  PREDICTED: gamma-glutamyl hydrolase                111   2e-25   
gb|KFQ95121.1|  Gamma-glutamyl hydrolase                                110   3e-25   
ref|XP_009460946.1|  PREDICTED: gamma-glutamyl hydrolase                110   3e-25   
ref|XP_010358670.1|  PREDICTED: gamma-glutamyl hydrolase                111   3e-25   
ref|XP_002166069.2|  PREDICTED: gamma-glutamyl hydrolase A-like         111   3e-25   
ref|XP_002740732.1|  PREDICTED: gamma-glutamyl hydrolase-like           111   3e-25   
ref|XP_001926738.1|  PREDICTED: gamma-glutamyl hydrolase                111   3e-25   
ref|XP_004275026.1|  PREDICTED: gamma-glutamyl hydrolase                110   4e-25   
ref|XP_002671580.1|  predicted protein                                  110   4e-25   
ref|XP_008290933.1|  PREDICTED: gamma-glutamyl hydrolase                110   5e-25   
ref|XP_003802765.1|  PREDICTED: gamma-glutamyl hydrolase                110   5e-25   
ref|XP_010788500.1|  PREDICTED: gamma-glutamyl hydrolase-like           110   6e-25   
ref|XP_007998939.1|  PREDICTED: gamma-glutamyl hydrolase                110   6e-25   
ref|XP_002819168.1|  PREDICTED: gamma-glutamyl hydrolase                110   6e-25   
ref|XP_004350727.1|  peptidase C26 family protein                       110   6e-25   
ref|XP_008835806.1|  PREDICTED: gamma-glutamyl hydrolase isoform X2     110   6e-25   
ref|XP_005479735.1|  PREDICTED: gamma-glutamyl hydrolase                109   7e-25   
ref|XP_004047140.1|  PREDICTED: gamma-glutamyl hydrolase                110   7e-25   
ref|XP_004011748.1|  PREDICTED: gamma-glutamyl hydrolase                110   7e-25   
gb|EGI70452.1|  Gamma-glutamyl hydrolase B                              110   8e-25   
ref|XP_006113705.1|  PREDICTED: gamma-glutamyl hydrolase                110   8e-25   
ref|XP_007421928.1|  PREDICTED: gamma-glutamyl hydrolase                110   8e-25   
ref|XP_004435789.1|  PREDICTED: gamma-glutamyl hydrolase                110   8e-25   
gb|EHB09195.1|  Gamma-glutamyl hydrolase                                109   9e-25   
ref|XP_001636982.1|  predicted protein                                  109   9e-25   
ref|XP_003968229.1|  PREDICTED: gamma-glutamyl hydrolase-like           109   1e-24   
ref|XP_008704953.1|  PREDICTED: gamma-glutamyl hydrolase                109   1e-24   
ref|XP_006170664.1|  PREDICTED: gamma-glutamyl hydrolase                109   1e-24   
ref|XP_011401628.1|  Gamma-glutamyl hydrolase A                         110   1e-24   
ref|XP_004842191.1|  PREDICTED: gamma-glutamyl hydrolase                109   1e-24   
ref|XP_004894417.1|  PREDICTED: gamma-glutamyl hydrolase                109   1e-24   
ref|XP_003480001.1|  PREDICTED: gamma-glutamyl hydrolase isoform X1     109   1e-24   
ref|XP_010403523.1|  PREDICTED: gamma-glutamyl hydrolase                108   1e-24   
ref|XP_005008316.1|  PREDICTED: gamma-glutamyl hydrolase isoform X2     109   1e-24   
ref|XP_011058399.1|  PREDICTED: gamma-glutamyl hydrolase A-like         109   2e-24   
ref|XP_008835805.1|  PREDICTED: gamma-glutamyl hydrolase isoform X1     109   2e-24   
ref|XP_007117832.1|  PREDICTED: gamma-glutamyl hydrolase                109   2e-24   
ref|XP_008642427.1|  PREDICTED: gamma-glutamyl hydrolase                109   2e-24   
gb|EMC87051.1|  Gamma-glutamyl hydrolase                                108   2e-24   
ref|XP_010884125.1|  PREDICTED: gamma-glutamyl hydrolase-like           108   2e-24   
ref|XP_005613149.1|  PREDICTED: gamma-glutamyl hydrolase isoform X2     108   2e-24   
ref|XP_007168627.1|  PREDICTED: gamma-glutamyl hydrolase                108   2e-24   
ref|XP_001513787.2|  PREDICTED: gamma-glutamyl hydrolase                108   2e-24   
ref|XP_005972129.1|  PREDICTED: gamma-glutamyl hydrolase                108   2e-24   
ref|XP_002197287.2|  PREDICTED: gamma-glutamyl hydrolase                109   3e-24   
gb|KDD75679.1|  hypothetical protein H632_c555p0                        108   3e-24   
gb|EHH28534.1|  Gamma-glutamyl hydrolase                                107   3e-24   
gb|EFN70834.1|  Gamma-glutamyl hydrolase                                108   3e-24   
ref|XP_001495890.1|  PREDICTED: gamma-glutamyl hydrolase isoform X1     108   3e-24   
dbj|GAM18533.1|  hypothetical protein SAMD00019534_017080               108   3e-24   
ref|XP_003902852.1|  PREDICTED: gamma-glutamyl hydrolase                108   3e-24   
ref|XP_007455320.1|  PREDICTED: gamma-glutamyl hydrolase                108   4e-24   
gb|EHH64195.1|  Gamma-glutamyl hydrolase                                107   4e-24   
ref|XP_005042227.1|  PREDICTED: gamma-glutamyl hydrolase                108   4e-24   
ref|XP_006734306.1|  PREDICTED: gamma-glutamyl hydrolase                108   4e-24   
ref|NP_001247641.1|  gamma-glutamyl hydrolase precursor                 108   4e-24   
ref|XP_006055981.1|  PREDICTED: gamma-glutamyl hydrolase isoform X2     107   5e-24   
gb|ELT93533.1|  hypothetical protein CAPTEDRAFT_104938                  107   5e-24   
ref|XP_004343749.1|  gamma-glutamyl hydrolase A                         107   5e-24   
ref|XP_009088479.1|  PREDICTED: gamma-glutamyl hydrolase                108   5e-24   
ref|NP_001098864.1|  gamma-glutamyl hydrolase precursor                 107   6e-24   
ref|XP_003640062.1|  PREDICTED: gamma-glutamyl hydrolase                107   6e-24   
ref|XP_004602484.1|  PREDICTED: gamma-glutamyl hydrolase                107   6e-24   
emb|CDQ65392.1|  unnamed protein product                                107   7e-24   
ref|XP_005231600.1|  PREDICTED: gamma-glutamyl hydrolase                107   7e-24   
ref|XP_004588067.1|  PREDICTED: gamma-glutamyl hydrolase                107   7e-24   
ref|XP_006185877.1|  PREDICTED: gamma-glutamyl hydrolase                106   8e-24   
ref|XP_005643894.1|  class I glutamine amidotransferase-like protein    107   8e-24   
gb|KFO99622.1|  Gamma-glutamyl hydrolase                                107   8e-24   
ref|XP_007085095.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-glutam...    107   8e-24   
ref|XP_006055980.1|  PREDICTED: gamma-glutamyl hydrolase isoform X1     107   9e-24   
ref|NP_037092.1|  gamma-glutamyl hydrolase precursor                    107   1e-23   
ref|XP_003219641.1|  PREDICTED: gamma-glutamyl hydrolase                107   1e-23   
ref|XP_005392230.1|  PREDICTED: gamma-glutamyl hydrolase                107   1e-23   
ref|XP_010984857.1|  PREDICTED: gamma-glutamyl hydrolase                107   1e-23   
ref|XP_010968962.1|  PREDICTED: gamma-glutamyl hydrolase                107   1e-23   
ref|XP_001620294.1|  hypothetical protein NEMVEDRAFT_v1g7369            102   1e-23   
ref|XP_006012487.1|  PREDICTED: gamma-glutamyl hydrolase-like           106   1e-23   
ref|XP_004327416.1|  PREDICTED: gamma-glutamyl hydrolase isoform 1      106   1e-23   
ref|XP_002118342.1|  hypothetical protein TRIADDRAFT_34071              106   1e-23   
ref|XP_011412576.1|  PREDICTED: gamma-glutamyl hydrolase-like           106   1e-23   
ref|XP_006261097.1|  PREDICTED: gamma-glutamyl hydrolase                106   1e-23   
ref|XP_005443321.1|  PREDICTED: gamma-glutamyl hydrolase                106   2e-23   
ref|XP_006204797.1|  PREDICTED: gamma-glutamyl hydrolase                106   2e-23   
ref|XP_011252591.1|  PREDICTED: chitobiosyldiphosphodolichol beta...    109   2e-23   
ref|XP_006994586.1|  PREDICTED: gamma-glutamyl hydrolase                105   2e-23   
ref|XP_008490429.1|  PREDICTED: gamma-glutamyl hydrolase                106   2e-23   
ref|XP_002740734.1|  PREDICTED: gamma-glutamyl hydrolase-like           105   2e-23   
ref|XP_005361968.1|  PREDICTED: gamma-glutamyl hydrolase                105   2e-23   
ref|XP_005689147.1|  PREDICTED: gamma-glutamyl hydrolase                105   3e-23   
ref|NP_001104645.1|  uncharacterized protein LOC563836 precursor        105   3e-23   
gb|KDR20013.1|  Gamma-glutamyl hydrolase                                105   3e-23   
ref|XP_006300958.1|  hypothetical protein CARUB_v10021346mg             104   3e-23   
ref|XP_006019197.1|  PREDICTED: gamma-glutamyl hydrolase                105   3e-23   
ref|XP_004679905.1|  PREDICTED: gamma-glutamyl hydrolase                105   3e-23   
ref|XP_006783068.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    105   3e-23   
ref|XP_004209779.1|  PREDICTED: gamma-glutamyl hydrolase A-like         105   4e-23   
ref|XP_008214314.1|  PREDICTED: gamma-glutamyl hydrolase A-like i...    104   5e-23   
ref|XP_001749715.1|  gamma-glutamyl hydrolase                           105   5e-23   
ref|XP_008896163.1|  hypothetical protein PPTG_04091                    104   5e-23   
gb|ETI36148.1|  hypothetical protein F443_17672                         104   6e-23   
gb|ETL83038.1|  hypothetical protein L917_16928                         104   6e-23   
ref|NP_001192053.1|  gamma-glutamyl hydrolase-like precursor            104   6e-23   
ref|XP_001700978.1|  gamma-glutamyl hydrolase                           105   6e-23   
ref|XP_011160978.1|  PREDICTED: gamma-glutamyl hydrolase-like           105   6e-23   
ref|XP_006421354.1|  hypothetical protein CICLE_v10006360mg           99.0    7e-23   
ref|XP_001601392.2|  PREDICTED: gamma-glutamyl hydrolase A-like i...    104   9e-23   
ref|XP_008141528.1|  PREDICTED: gamma-glutamyl hydrolase                104   9e-23   
ref|XP_005469772.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    104   1e-22   
ref|XP_004548914.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    103   1e-22   
ref|XP_003759794.1|  PREDICTED: gamma-glutamyl hydrolase                103   1e-22   
ref|XP_005951712.1|  PREDICTED: gamma-glutamyl hydrolase-like           103   1e-22   
ref|XP_008214312.1|  PREDICTED: gamma-glutamyl hydrolase A-like i...    103   1e-22   
ref|XP_008186650.1|  PREDICTED: gamma-glutamyl hydrolase A-like         103   1e-22   
ref|XP_001636983.1|  predicted protein                                  103   2e-22   
ref|XP_002905277.1|  gamma-glutamyl hydrolase, putative                 103   2e-22   
gb|EFX77408.1|  hypothetical protein DAPPUDRAFT_305752                  103   2e-22   
gb|KDO31557.1|  hypothetical protein SPRG_03486                         103   2e-22   
gb|EPQ01877.1|  Gamma-glutamyl hydrolase                                102   3e-22   
gb|KDO17663.1|  hypothetical protein SPRG_16945                         102   4e-22   
ref|XP_005856995.1|  PREDICTED: gamma-glutamyl hydrolase                102   4e-22   
ref|XP_005893017.1|  PREDICTED: gamma-glutamyl hydrolase                102   5e-22   
gb|ELR58392.1|  Gamma-glutamyl hydrolase                                102   5e-22   
ref|XP_009521534.1|  hypothetical protein PHYSODRAFT_359609             102   5e-22   
ref|XP_006924137.1|  PREDICTED: gamma-glutamyl hydrolase                101   7e-22   
ref|XP_008589768.1|  PREDICTED: gamma-glutamyl hydrolase                101   8e-22   
gb|ELK02337.1|  Gamma-glutamyl hydrolase                                100   8e-22   
ref|XP_011139565.1|  PREDICTED: gamma-glutamyl hydrolase A-like         101   1e-21   
gb|EKC23180.1|  Gamma-glutamyl hydrolase                              99.4    1e-21   
ref|XP_007251560.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    101   1e-21   
ref|XP_008348012.1|  PREDICTED: gamma-glutamyl hydrolase 1-like       95.9    1e-21   
gb|EFZ17480.1|  hypothetical protein SINV_12245                         100   1e-21   
ref|XP_005741867.1|  PREDICTED: gamma-glutamyl hydrolase-like           100   2e-21   
gb|KDR20012.1|  Gamma-glutamyl hydrolase                                100   3e-21   
ref|XP_001625550.1|  predicted protein                                99.4    3e-21   
ref|XP_009829556.1|  hypothetical protein H257_06133                  99.8    3e-21   
ref|XP_006812070.1|  PREDICTED: gamma-glutamyl hydrolase-like         97.1    7e-21   
ref|NP_001025598.1|  gamma-glutamyl hydrolase precursor               98.6    7e-21   
ref|NP_001280356.1|  gamma-glutamyl hydrolase A-like precursor        98.6    8e-21   



>dbj|BAO57292.1| gamma-glutamyl hydrolase [Ipomoea nil]
Length=343

 Score =   287 bits (735),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 166/196 (85%), Gaps = 0/196 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+++DN ILE F+A+NQAS LQ VEG N EGTLFQRFP ELL+K+ ++C
Sbjct  147  AICLGFELLTMIITKDNNILEGFNAANQASKLQFVEGANFEGTLFQRFPSELLKKMSKDC  206

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH +GISPE F+A+ADL NFF +LTTS D+DNK+YVST+Q + YPV AVQW PE+N
Sbjct  207  LVMQNHHYGISPEKFRANADLCNFFKILTTSADQDNKIYVSTVQAEHYPVTAVQWHPEKN  266

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW LSEIPH+EDAILV+Q+VANYF+SEARKS N P+  +V +NLIYNY+ SYSGK GS
Sbjct  267  AFEWGLSEIPHTEDAILVTQNVANYFISEARKSLNRPDAQEVLNNLIYNYSPSYSGKSGS  326

Query  152  GFVEVYIFS*DYGVIS  105
            GF EVYIF+ + G+ S
Sbjct  327  GFDEVYIFTQNSGLSS  342



>ref|XP_011098203.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Sesamum indicum]
Length=390

 Score =   264 bits (674),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 152/189 (80%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+IVSEDN ILE+FSA++QASTLQ VE +++ GT+FQRFP  LL+K+  EC
Sbjct  202  AICLGFELLTMIVSEDNNILEQFSAADQASTLQFVENIDINGTVFQRFPPILLKKLNTEC  261

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH++GISPE FQ +  L +FF +LTTS+D+D+KVYVST+Q  +YPV AVQW PE+N
Sbjct  262  LVMQNHRYGISPEKFQKNKSLCSFFKILTTSVDEDDKVYVSTVQACRYPVTAVQWHPEKN  321

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW LS IPHSEDAI V+Q VAN+F+ EAR S N P    V DNLIYNY+ +Y GK G 
Sbjct  322  AFEWGLSRIPHSEDAIQVTQHVANFFIREARMSINRPPAKKVLDNLIYNYSPTYCGKAGR  381

Query  152  GFVEVYIFS  126
            GF EVYIFS
Sbjct  382  GFDEVYIFS  390



>gb|KDP46038.1| hypothetical protein JCGZ_13484 [Jatropha curcas]
Length=385

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 152/189 (80%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+S+DN ILE F+A++QASTLQ ++ +N+EGT+FQRFP +LL+K+  +C
Sbjct  195  AICLGFELLTMIISKDNNILESFNATDQASTLQFMKNINIEGTVFQRFPPDLLKKLSTDC  254

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH +GISP+  Q + DLS+FF +LTTS D DNKVYVST+Q  +YPV A QW PE+N
Sbjct  255  LVMQNHHYGISPQRLQENHDLSSFFKILTTSADTDNKVYVSTVQAHRYPVSAFQWHPEKN  314

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW LS IPHSEDAI V+Q VAN+FVSEARKS N P    V DNLIYN++ +Y GK G 
Sbjct  315  AFEWGLSMIPHSEDAIQVTQHVANFFVSEARKSLNRPPARKVLDNLIYNFSPTYCGKAGR  374

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  375  GYDEVYIFT  383



>ref|XP_010106571.1| Gamma-glutamyl hydrolase [Morus notabilis]
 gb|EXC10782.1| Gamma-glutamyl hydrolase [Morus notabilis]
Length=401

 Score =   260 bits (664),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF++LT+I+S+DN ILE FSAS+ ASTLQ  + +N+EGT+FQRFP +LLRK+  +C
Sbjct  209  AICLGFEILTMIISKDNKILESFSASDMASTLQFTQNVNIEGTVFQRFPPDLLRKLSTDC  268

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            L+MQNHK+GISPE FQ + DL  FF +LTTS D+DNKVYVST+    YPV A QW PE+N
Sbjct  269  LIMQNHKYGISPERFQENRDLCQFFKILTTSADEDNKVYVSTVHAHNYPVTAFQWHPEKN  328

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW L +IPHSEDAI V+Q VAN+ VSEARKS N P    V DNLIYNY+ +Y GK G 
Sbjct  329  AFEWGLKQIPHSEDAIHVTQHVANFLVSEARKSLNRPPLQKVLDNLIYNYSPTYCGKAGK  388

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  389  GYDEVYIFT  397



>ref|XP_006348322.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Solanum tuberosum]
Length=340

 Score =   257 bits (657),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 153/189 (81%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LG++LLT+I++ DN ILE+FSA++QAST+Q VE +N++GT+F RFP  LL+K+  +C
Sbjct  144  AICLGYELLTMIITNDNNILEEFSAASQASTVQFVENVNIDGTVFGRFPPVLLKKMSIDC  203

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH +GISPE FQA+ DLS+FF VLTTS D++NKVYVSTIQ  +YP+ A QW PE+N
Sbjct  204  LVMQNHHFGISPERFQANKDLSSFFRVLTTSTDENNKVYVSTIQATRYPIAAFQWHPEKN  263

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S IPHSEDAI V+  VANYF+SEARKSSN P   +V D+LIYNYN +Y GK G 
Sbjct  264  AFEWGSSRIPHSEDAIQVTTHVANYFISEARKSSNKPVAREVLDSLIYNYNPTYGGKAGK  323

Query  152  GFVEVYIFS  126
            G+ EVY+F+
Sbjct  324  GYDEVYLFT  332



>ref|XP_010675311.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Beta vulgaris subsp. 
vulgaris]
Length=376

 Score =   258 bits (659),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 151/189 (80%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+S+DN ILE FSAS Q STLQ V+ +N+ GT+FQRFP ELLRK+  +C
Sbjct  188  AICLGFELLTMIISKDNNILESFSASYQPSTLQFVKNININGTVFQRFPPELLRKLNTDC  247

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNHK+G+SPE+ Q +  LS+FFN+LTTS D+D+KVYVST+Q + YP+ A QW PE+N
Sbjct  248  LVMQNHKYGLSPETLQGNQRLSSFFNILTTSTDRDDKVYVSTVQAQHYPITAFQWHPEKN  307

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  + IPHSEDAI V+Q VAN F+SEARKS N P   DV +N+IYNY+ +Y GK G 
Sbjct  308  AFEWGYAMIPHSEDAIQVTQHVANSFISEARKSPNRPPARDVLENVIYNYSPTYCGKQGR  367

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  368  GYDEVYIFA  376



>emb|CDP06032.1| unnamed protein product [Coffea canephora]
Length=397

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 151/189 (80%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+S+DN ILE+FSA++QASTLQ V  +N+EGT+FQRFP +LL+K+  +C
Sbjct  209  AICLGFELLTMIISKDNDILEQFSAADQASTLQFVGSINLEGTVFQRFPPDLLKKLSTDC  268

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH +GISPE+F+  A L NFF +LTTS D+++KVYVST++   YPV A QW PE+N
Sbjct  269  LVMQNHHYGISPETFRKTAALCNFFQILTTSADENDKVYVSTVKANDYPVTAFQWHPEKN  328

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW LS IPHSEDAI V+Q VAN+FVSEARKS N P    V DNLIYNY  +Y GK G 
Sbjct  329  AFEWGLSMIPHSEDAIQVTQYVANFFVSEARKSLNRPPARKVLDNLIYNYTPTYCGKAGR  388

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  389  GYDEVYIFT  397



>gb|KJB13015.1| hypothetical protein B456_002G051200 [Gossypium raimondii]
Length=386

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+IVSED  ILE FSASNQAS+LQ VE +N+EGT+FQRFP  LL+K+G +C
Sbjct  192  AICLGFELLTMIVSEDKNILEPFSASNQASSLQFVENVNIEGTVFQRFPPNLLQKLGTDC  251

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH+ GISPE  Q   +LS FF +LTTS DK+NKVYVST Q   YPV A QW PE+N
Sbjct  252  LVMQNHRCGISPEKLQNTPNLSRFFKILTTSTDKNNKVYVSTAQAHGYPVTAFQWHPEKN  311

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW LS IPHS+DAI V+Q VAN+F+ EAR+S N P    V D+LIYNY+ +Y GK G 
Sbjct  312  AFEWGLSMIPHSDDAIEVTQHVANFFIREARRSLNRPAAQKVLDSLIYNYSPTYCGKAGK  371

Query  152  GFVEVYIFS  126
            GF EVYIF+
Sbjct  372  GFDEVYIFT  380



>ref|XP_010060723.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X2 [Eucalyptus 
grandis]
Length=360

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            A  LGFQLLT+IVS+D  ILE+F+A++QASTLQ +   N+EGT+FQRFP +LL+K+  +C
Sbjct  172  ATCLGFQLLTMIVSKDKGILEEFNAAHQASTLQFMRNTNIEGTVFQRFPPDLLKKLSTDC  231

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH +GISPE      DL+NFF VLTTS D+DNKVYVST+Q   YP+ A QW PE+N
Sbjct  232  LVMQNHHYGISPERLMQSTDLTNFFKVLTTSTDRDNKVYVSTVQAHSYPITAFQWHPEKN  291

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW LS IPHS+DAI V+Q VAN+FVSEARKS+N  +   V DNLIYNY+ +Y GK G 
Sbjct  292  AFEWGLSMIPHSDDAIQVTQHVANFFVSEARKSTNRASARKVLDNLIYNYSPTYCGKAGK  351

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  352  GYDEVYIFT  360



>ref|XP_006348321.1| PREDICTED: gamma-glutamyl hydrolase 1-like [Solanum tuberosum]
Length=335

 Score =   255 bits (651),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 152/189 (80%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AIN GF+LL +IVS+DN ILEKFS SNQA+ L  VE +N+E T+F RFP  L++K+ +EC
Sbjct  142  AINHGFELLMMIVSKDNNILEKFSVSNQATKLHFVETVNIEDTVFGRFPPTLIKKLSKEC  201

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LV+Q+HK+G+SP+ FQA+ DLS+FF +LTTS D  NKVYVST++ + YP+ A+QW PE++
Sbjct  202  LVLQSHKYGLSPDKFQANDDLSSFFIMLTTSTDTRNKVYVSTVKAENYPITALQWHPEKS  261

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW LS IPHSEDA+ V+Q VANYFVSEARKSSN P    V DNLIYNYN +YSGK G 
Sbjct  262  AFEWGLSAIPHSEDAVQVTQLVANYFVSEARKSSNKPEAQKVLDNLIYNYNPTYSGKTGK  321

Query  152  GFVEVYIFS  126
            G+ EVY+F+
Sbjct  322  GYDEVYVFN  330



>ref|XP_009769712.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Nicotiana sylvestris]
 gb|AIE54277.1| gamma-glutamylhydrolase 2 [Nicotiana tabacum]
Length=342

 Score =   255 bits (652),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 150/189 (79%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+S+DN ILE+FSA+NQAST+Q VE + +E T+F RFP  L++K+  +C
Sbjct  146  AICLGFELLTMIISKDNNILEEFSAANQASTVQFVENVKLERTVFGRFPSVLIKKMSTDC  205

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH +GISPE  QA+ DL +FF +LTTS DK NKVYVST Q ++YPV AVQW PE+N
Sbjct  206  LVMQNHHFGISPERLQANKDLCSFFRILTTSTDKKNKVYVSTAQARRYPVTAVQWHPEKN  265

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
             FEW  S+IPH+EDAI V+Q VANYFVSEARKSSN P    + DNLIYNY+ S++GK G 
Sbjct  266  VFEWRSSQIPHTEDAIQVTQHVANYFVSEARKSSNKPAPSKLLDNLIYNYSPSFAGKAGG  325

Query  152  GFVEVYIFS  126
             F EVY+FS
Sbjct  326  SFDEVYLFS  334



>ref|XP_006442404.1| hypothetical protein CICLE_v10020608mg [Citrus clementina]
 ref|XP_006442407.1| hypothetical protein CICLE_v10020608mg [Citrus clementina]
 gb|ESR55644.1| hypothetical protein CICLE_v10020608mg [Citrus clementina]
 gb|ESR55647.1| hypothetical protein CICLE_v10020608mg [Citrus clementina]
Length=380

 Score =   256 bits (655),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LL++IVSED  ILE F  +NQASTLQ V+ +N+EGTLFQRFP ELL+K+  +C
Sbjct  192  AICLGFELLSMIVSEDRNILETFDGANQASTLQFVKNINIEGTLFQRFPPELLKKLSTDC  251

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH +GISPE  QA+ +L+ FF +LTTS+D+ NKVYVST+Q   YPV A QW PE+N
Sbjct  252  LVMQNHHYGISPERMQANQELAKFFKILTTSMDEYNKVYVSTVQAYNYPVTAFQWHPEKN  311

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW    IPH+EDAI V+Q  AN+F+SEARKSSN P    V DNLIYNY+ +Y GK G 
Sbjct  312  AFEWGPKAIPHTEDAIRVTQQAANFFISEARKSSNRPPARKVLDNLIYNYSPTYCGKAGK  371

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  372  GYDEVYIFT  380



>ref|XP_010060720.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Eucalyptus grandis]
 gb|KCW67545.1| hypothetical protein EUGRSUZ_F01299 [Eucalyptus grandis]
Length=394

 Score =   256 bits (655),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+IVS+D  ILE+F+A++QASTLQ +   N+EGT+FQRFP +LL+K+  +C
Sbjct  206  AICLGFELLTMIVSKDKSILEEFNAADQASTLQFMRNTNIEGTVFQRFPPDLLKKLSTDC  265

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH +GISPE      DL+NFF VLTTS+D DNKVYVST+Q   YPV A QW PE+N
Sbjct  266  LVMQNHHYGISPERLIRSTDLTNFFKVLTTSMDGDNKVYVSTVQAHSYPVTAFQWHPEKN  325

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW LS IPHS+DAI V+Q VAN+FVSEARKS+N  +   V DNLIYNY+ +Y GK G 
Sbjct  326  AFEWGLSMIPHSDDAIQVTQHVANFFVSEARKSTNRASARKVLDNLIYNYSPTYCGKAGK  385

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  386  GYDEVYIFT  394



>ref|NP_001234434.1| gamma-glutamylhydrolase 1 precursor [Solanum lycopersicum]
 gb|ACC86848.1| gamma-glutamylhydrolase 1 [Solanum lycopersicum]
Length=340

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 151/188 (80%), Gaps = 0/188 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LG++LLT+I++ DN ILE+FSA++QAST+Q VE +N+EGT+F RFP  LL+K+  +C
Sbjct  144  AICLGYELLTMIITNDNNILEEFSAASQASTVQFVENVNIEGTIFGRFPPVLLKKMSIDC  203

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH +GISPE FQ + DLS+FF VLTTS D++NKVYVSTIQ ++YP+ A QW PE+N
Sbjct  204  LVMQNHHFGISPERFQVNKDLSSFFRVLTTSTDENNKVYVSTIQAQRYPIAAFQWHPEKN  263

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S IPHSEDAI V+  VANYF+SEARKSSN P   +V D+LIYN N +Y GK G 
Sbjct  264  AFEWGSSRIPHSEDAIQVTTHVANYFISEARKSSNKPVAREVLDSLIYNNNPTYGGKAGK  323

Query  152  GFVEVYIF  129
            G+ EVY+F
Sbjct  324  GYDEVYLF  331



>gb|KHG06555.1| Gamma-glutamyl hydrolase -like protein [Gossypium arboreum]
Length=385

 Score =   254 bits (649),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+SED  ILE FSASNQAS+LQ VE +N+EGT+FQRFP  LL+K+G +C
Sbjct  191  AICLGFELLTMIISEDKNILEPFSASNQASSLQFVENVNIEGTVFQRFPPNLLQKLGTDC  250

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH++GISPE  Q   +LS FF +LTTS DK+NKVYVST Q   YPV A QW PE+N
Sbjct  251  LVMQNHRYGISPEKLQNTPNLSRFFKILTTSTDKNNKVYVSTAQAHGYPVTAFQWHPEKN  310

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW L  IPHS+DAI V+Q VAN+ + EAR+S N P    V DNLIYNY+ ++ GK G 
Sbjct  311  AFEWGLPMIPHSDDAIEVTQHVANFLIREARRSLNRPAAQKVLDNLIYNYSPTFCGKAGR  370

Query  152  GFVEVYIFS  126
            GF EVYIF+
Sbjct  371  GFDEVYIFT  379



>ref|XP_002285525.1| PREDICTED: gamma-glutamyl hydrolase 2 isoform X1 [Vitis vinifera]
Length=384

 Score =   254 bits (648),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            A  LGF+LLT+I+S+D  ILE+FSA++QASTL  ++  ++ GT+FQRFP +LLRK+  +C
Sbjct  196  ATCLGFELLTMIISKDIKILEEFSAADQASTLNFMKNTDIRGTVFQRFPPDLLRKLSTDC  255

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH +GISPE FQ + DLS+FF +LTTS D+D+KVYVST Q   YPV A QW PE+N
Sbjct  256  LVMQNHHYGISPERFQENTDLSSFFKILTTSTDEDDKVYVSTAQAHSYPVTAFQWHPEKN  315

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW LS IPHSEDA+ V+Q VAN+F+SEARKS N P    V DNLIYNY+ +Y GK G 
Sbjct  316  AFEWGLSRIPHSEDAVQVTQHVANFFISEARKSLNRPPARKVLDNLIYNYSPTYCGKAGK  375

Query  152  GFVEVYIFS  126
            G+ EVYIFS
Sbjct  376  GYDEVYIFS  384



>ref|XP_002524523.1| Gamma-glutamyl hydrolase precursor, putative [Ricinus communis]
 gb|EEF37850.1| Gamma-glutamyl hydrolase precursor, putative [Ricinus communis]
Length=388

 Score =   253 bits (647),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+S+D  ILE F+A++QASTLQ +  +N+EGT+FQRFP  LL+K+  +C
Sbjct  198  AICLGFELLTMIISKDRNILESFNAADQASTLQFMGNINIEGTVFQRFPPGLLKKLSTDC  257

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH +GISPE  Q + DLS FF +LTTS D DNKVYVST+Q   YPV A QW PE+N
Sbjct  258  LVMQNHHYGISPERLQENQDLSGFFKILTTSADADNKVYVSTVQALSYPVTAFQWHPEKN  317

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW LS IPHSEDAI V+Q VAN+FVSEARKS N P    V DNLIYN++ +Y GK G 
Sbjct  318  AFEWGLSMIPHSEDAIQVTQHVANFFVSEARKSLNRPPARKVLDNLIYNFSPTYCGKAGK  377

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  378  GYDEVYIFT  386



>ref|XP_009605608.1| PREDICTED: gamma-glutamyl hydrolase 1-like [Nicotiana tomentosiformis]
Length=340

 Score =   252 bits (643),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 150/188 (80%), Gaps = 0/188 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AINLGF+LL +IVS+DN ILEKFS SNQAS L  VE +N+E T+F RFP  LL+K+ +EC
Sbjct  145  AINLGFELLMMIVSKDNNILEKFSVSNQASKLHFVETVNIEDTVFGRFPPTLLKKLSKEC  204

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LV+Q +K+G+SPE FQA+ DLS+FF +LTTS D  NKV+VST+Q + YP+ A+QW PE++
Sbjct  205  LVLQRNKYGLSPEKFQANDDLSSFFIMLTTSTDTRNKVFVSTLQAENYPITALQWHPEKS  264

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S IPHSEDA+ V+Q VANYFVSEARKSSN P+   V DNLIYNY+ +YSG  G 
Sbjct  265  AFEWGSSAIPHSEDAVQVTQLVANYFVSEARKSSNKPDAQKVLDNLIYNYSPTYSGNAGK  324

Query  152  GFVEVYIF  129
            G+ EVYIF
Sbjct  325  GYDEVYIF  332



>gb|AFK48386.1| unknown [Lotus japonicus]
Length=342

 Score =   251 bits (642),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 150/189 (79%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+L+T+IVS+DN ILE+F ASNQASTLQ VE  N++GTLFQRFP +LL+K+  +C
Sbjct  152  AICLGFELITMIVSKDNNILEEFCASNQASTLQFVENANIKGTLFQRFPPDLLKKLSTDC  211

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH++GISP   Q +  LS+FF +LTT  D+D+ VYVST++ + YPV A QW PE+N
Sbjct  212  LVMQNHRYGISPGKLQGNHKLSSFFEILTTCEDEDDMVYVSTMRSRNYPVSAFQWHPEKN  271

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEWA SEIPH++DAI ++Q  AN+ VSEARKS N P   +VRDNLIYNY+ +Y GK G 
Sbjct  272  AFEWASSEIPHTKDAIQITQYAANFLVSEARKSINRPVAQEVRDNLIYNYSPTYCGKAGK  331

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  332  GYDEVYIFA  340



>ref|XP_009630845.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Nicotiana tomentosiformis]
Length=341

 Score =   251 bits (642),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+S+DN ILE+FSA+NQAST+Q +E + +E T+F RFP  L++K+   C
Sbjct  145  AICLGFELLTMIISKDNNILEEFSAANQASTVQFMENIKLERTVFGRFPPVLIKKMSTLC  204

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH +GISPE  QA+ DL +FF +LTTS DK NKVYVST Q ++YPV A+QW PE+N
Sbjct  205  LVMQNHHFGISPERLQANKDLCSFFRILTTSTDKKNKVYVSTAQARRYPVTALQWHPEKN  264

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
             FEW  S+IPH+EDAI V+Q VANYFVSEARKSSN P    + DNLIYNY+ S++GK G 
Sbjct  265  VFEWRSSQIPHTEDAIQVTQHVANYFVSEARKSSNKPAPSKLLDNLIYNYSPSFAGKAGG  324

Query  152  GFVEVYIFS  126
             F EVY+FS
Sbjct  325  SFDEVYLFS  333



>ref|XP_006377741.1| hypothetical protein POPTR_0011s10890g [Populus trichocarpa]
 gb|ERP55538.1| hypothetical protein POPTR_0011s10890g [Populus trichocarpa]
Length=412

 Score =   253 bits (647),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 152/189 (80%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF++LT+I+SEDN ILE F+A++QASTLQ +  +N++GT+F+RFP +LL+++  +C
Sbjct  202  AICLGFEILTMIISEDNQILETFNAADQASTLQFMNNINIKGTVFRRFPPDLLKRLSTDC  261

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH++GISP+ FQ +  LS+FF +LTTS D+DN+VYVST+Q   YPV A QW PE+N
Sbjct  262  LVMQNHRYGISPQRFQENEHLSSFFEILTTSTDEDNQVYVSTVQACGYPVTAFQWHPEKN  321

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW LS IPHSEDAI V+Q +AN+FVSEARKS N P+   V  NLIYNY+ +Y GK G 
Sbjct  322  AFEWGLSMIPHSEDAIQVTQHIANFFVSEARKSLNRPSSRKVLANLIYNYSPTYCGKAGK  381

Query  152  GFVEVYIFS  126
            G+ EVYIFS
Sbjct  382  GYDEVYIFS  390



>ref|XP_004294089.1| PREDICTED: gamma-glutamyl hydrolase 2 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=388

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 147/188 (78%), Gaps = 0/188 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+S++  ILE FSA++ ASTLQ  E +N+EGT+FQRFP +LLRK+  +C
Sbjct  193  AICLGFELLTMIISKNKKILESFSAADMASTLQFTENMNIEGTVFQRFPPDLLRKLSTDC  252

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            +VMQNH +GISPE+ Q + DLS+FF +LTTS D+D+KVYVST+    YPV A QW PE+N
Sbjct  253  IVMQNHHYGISPETLQQNPDLSSFFKILTTSTDEDDKVYVSTVHAYHYPVTAFQWHPEKN  312

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW L  IPHSEDAI V+Q +AN+ VSEARKS N P   DV DNLIYNY+ ++ GK G 
Sbjct  313  AFEWGLQMIPHSEDAIQVTQHIANFLVSEARKSLNRPPLQDVLDNLIYNYSPTFCGKAGK  372

Query  152  GFVEVYIF  129
            G+ EVYIF
Sbjct  373  GYDEVYIF  380



>ref|XP_011002760.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Populus euphratica]
Length=407

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 151/189 (80%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF++LT+I+SEDN ILE ++A++QASTLQ +E +++EGT+FQRFP  LL+K+  +C
Sbjct  197  AICLGFEILTMIISEDNQILETYNATDQASTLQFMENISIEGTVFQRFPPVLLKKLSTDC  256

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH +GISP+ FQ +  LS+FF +LT S D+DN+VYVST+Q + YPV A QW PE+N
Sbjct  257  LVMQNHHYGISPQRFQENEHLSSFFEILTNSADEDNQVYVSTVQARNYPVTAFQWHPEKN  316

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW LS IPHSEDAI V+Q VAN+FVSEARKS N P    V DNLIYNY+ ++ GK G 
Sbjct  317  AFEWGLSMIPHSEDAIQVTQHVANFFVSEARKSLNRPPARRVLDNLIYNYSPTFCGKAGK  376

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  377  GYDEVYIFA  385



>ref|XP_007021916.1| Gamma-glutamyl hydrolase 1 isoform 1 [Theobroma cacao]
 gb|EOY13441.1| Gamma-glutamyl hydrolase 1 isoform 1 [Theobroma cacao]
Length=388

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+SED  ILE FSA++QAS+LQ V+ +N+EGT+FQRFP +LL+K+G +C
Sbjct  194  AICLGFELLTMIISEDRNILESFSAADQASSLQFVKNINIEGTVFQRFPPDLLKKLGADC  253

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH +GISPE  + + +LS+FF +LTTS D +N+VYVST+Q   YPV A QW PE+N
Sbjct  254  LVMQNHHYGISPERLRNNPNLSSFFKILTTSTDDNNEVYVSTVQAHGYPVTAFQWHPEKN  313

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  + IPHSEDAI V+Q VAN+ +SEARKS N P    V DNLIYNY+ +Y GK G 
Sbjct  314  AFEWGSTMIPHSEDAIQVTQHVANFLISEARKSLNRPPPRKVLDNLIYNYSPTYCGKAGK  373

Query  152  GFVEVYIFS  126
            GF EVYIF+
Sbjct  374  GFDEVYIFT  382



>ref|XP_009803991.1| PREDICTED: gamma-glutamyl hydrolase 1-like [Nicotiana sylvestris]
Length=337

 Score =   250 bits (638),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 151/188 (80%), Gaps = 0/188 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AINLGF+LL +IVS+DN ILEKFS SNQAS L  VE +N+E T+F RFP  L++K+ +EC
Sbjct  142  AINLGFELLMMIVSKDNNILEKFSVSNQASKLHFVETVNIEDTVFGRFPPTLIKKLSKEC  201

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LV+Q +K+G+SPE FQA+ DLS+FF +LTTS D  NKV+VST+Q + YP+ A+QW PE++
Sbjct  202  LVLQRNKYGLSPEKFQANDDLSSFFIMLTTSTDTRNKVFVSTLQAENYPITALQWHPEKS  261

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  + IPHSEDA+ V+Q VANYFVSEARKSSN P+   V D+LIYNY+ +YSGK G 
Sbjct  262  AFEWGSAAIPHSEDAVQVTQLVANYFVSEARKSSNKPDAQKVLDSLIYNYSPTYSGKAGK  321

Query  152  GFVEVYIF  129
            G+ EVYIF
Sbjct  322  GYDEVYIF  329



>emb|CBI20168.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   255 bits (651),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            A  LGF+LLT+I+S+D  ILE+FSA++QASTL  ++  ++ GT+FQRFP +LLRK+  +C
Sbjct  326  ATCLGFELLTMIISKDIKILEEFSAADQASTLNFMKNTDIRGTVFQRFPPDLLRKLSTDC  385

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH +GISPE FQ + DLS+FF +LTTS D+D+KVYVST Q   YPV A QW PE+N
Sbjct  386  LVMQNHHYGISPERFQENTDLSSFFKILTTSTDEDDKVYVSTAQAHSYPVTAFQWHPEKN  445

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW LS IPHSEDA+ V+Q VAN+F+SEARKS N P    V DNLIYNY+ +Y GK G 
Sbjct  446  AFEWGLSRIPHSEDAVQVTQHVANFFISEARKSLNRPPARKVLDNLIYNYSPTYCGKAGK  505

Query  152  GFVEVYIFS  126
            G+ EVYIFS
Sbjct  506  GYDEVYIFS  514



>gb|KJB13019.1| hypothetical protein B456_002G051600 [Gossypium raimondii]
Length=379

 Score =   250 bits (639),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 145/189 (77%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+SED  ILE+FSA N+AS+LQ VE +N+EGT+FQRFP  LL+K+G + 
Sbjct  185  AICLGFELLTMIISEDKKILERFSALNRASSLQFVENVNIEGTVFQRFPPNLLQKLGTDL  244

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH WGISPE  Q   +LS FF +LTTS DK+NKVYVST Q  +YPV A QW PE+N
Sbjct  245  LVMQNHCWGISPEKLQNTPNLSRFFKILTTSTDKNNKVYVSTAQAHRYPVTAFQWHPEKN  304

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFE  LS IPHS+DAI V+Q VAN+F+ EAR+S N P    VRD+LIYNY   Y GK G 
Sbjct  305  AFESGLSMIPHSDDAIEVTQHVANFFIREARRSLNRPAAQKVRDSLIYNYRPKYYGKAGK  364

Query  152  GFVEVYIFS  126
            GF +VYIF+
Sbjct  365  GFDQVYIFT  373



>ref|NP_001234438.1| gamma-glutamylhydrolase 3 precursor [Solanum lycopersicum]
 gb|ACC86849.1| gamma-glutamylhydrolase 3 [Solanum lycopersicum]
Length=337

 Score =   249 bits (635),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 149/188 (79%), Gaps = 0/188 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AIN GF+LL +IVS+DN ILEKFS SNQA+ L  VE +N+E T+F RFP  L++K+ +EC
Sbjct  142  AINHGFELLMMIVSKDNNILEKFSVSNQATKLHFVETVNIEDTIFGRFPPTLVKKLSKEC  201

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LV+Q+HK+G+SPE FQA+ DLS+FF +LTTS D  NKVYVST++ + YP+ A+QW PE++
Sbjct  202  LVLQSHKYGLSPEKFQANDDLSSFFIMLTTSTDTRNKVYVSTLKAENYPITALQWHPEKS  261

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S IPHSEDA+ V+Q VANYFVSEARKSSN P    V DNLIYNY  +YSGK G 
Sbjct  262  AFEWGSSAIPHSEDAVQVTQLVANYFVSEARKSSNKPEAQKVLDNLIYNYEPTYSGKIGI  321

Query  152  GFVEVYIF  129
            G+ EVY+F
Sbjct  322  GYDEVYVF  329



>ref|XP_010060722.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Eucalyptus 
grandis]
Length=373

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+IVS+D  ILE+F+A+++ASTLQ +   N+EGTLFQRFP +LL+K+  +C
Sbjct  185  AICLGFELLTMIVSKDKSILEEFNAADEASTLQFMRNTNIEGTLFQRFPPDLLKKLSTDC  244

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH +GIS E    + +L+NFF VLTTS+D DNKVYVST Q   YPV A QW PE+N
Sbjct  245  LVMQNHHYGISSERLMQNINLTNFFKVLTTSMDGDNKVYVSTAQAHSYPVTAFQWHPEKN  304

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW LS IPHS+DAI V+Q VAN+FVSEARKS+N  +   V DNLIYNY+ +Y GK G 
Sbjct  305  AFEWGLSMIPHSDDAIQVTQHVANFFVSEARKSTNRASARKVLDNLIYNYSPTYCGKAGK  364

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  365  GYDEVYIFT  373



>ref|XP_006477853.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Citrus 
sinensis]
Length=354

 Score =   249 bits (636),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 145/189 (77%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LL++IVSED  ILE F  +NQASTLQ V+ +N+EGTLFQRFP ELL+K+  +C
Sbjct  166  AICLGFELLSMIVSEDRNILETFDGANQASTLQFVKNINIEGTLFQRFPPELLKKLSTDC  225

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH +GISPE  QA+ +L+ FF +LTTS+D+ NKVYV T+Q   YPV A QW  E+N
Sbjct  226  LVMQNHHYGISPERMQANQELAKFFKILTTSVDEYNKVYVLTVQAYNYPVTAFQWHSEKN  285

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW    IPH+EDAI V+Q  AN+F+SEARKSSN P    V DNLIYNY+ +Y GK G 
Sbjct  286  AFEWGPKAIPHTEDAIRVTQQAANFFISEARKSSNRPPARKVLDNLIYNYSPTYCGKAGK  345

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  346  GYDEVYIFT  354



>ref|XP_006442395.1| hypothetical protein CICLE_v10020872mg [Citrus clementina]
 gb|ESR55635.1| hypothetical protein CICLE_v10020872mg [Citrus clementina]
Length=352

 Score =   248 bits (633),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 145/186 (78%), Gaps = 0/186 (0%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+LLT+I+ +D  ILE F+A++QASTLQ +E  ++EGT+FQRFP +L++K+  +CLVM
Sbjct  163  LGFELLTMIIGKDKNILESFNAADQASTLQFIENTSIEGTVFQRFPPQLIKKLSTDCLVM  222

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
            QNH +GISPE+ + + DLS FF +LTTS D+DNKVYVST+Q   YPV A QW PE+NAFE
Sbjct  223  QNHHYGISPETLRKNLDLSRFFKMLTTSADEDNKVYVSTVQAYDYPVTAFQWHPEKNAFE  282

Query  323  WALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFV  144
            W  S IPHSEDAI V+Q VANYF+SEAR+S N P    V DNLIYNY  ++ GK G GF 
Sbjct  283  WGSSAIPHSEDAIEVTQHVANYFISEARRSVNRPPAQKVLDNLIYNYRPTFCGKAGKGFD  342

Query  143  EVYIFS  126
            EVYIF+
Sbjct  343  EVYIFT  348



>ref|XP_006360033.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Solanum tuberosum]
Length=344

 Score =   248 bits (633),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 148/190 (78%), Gaps = 1/190 (1%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+S+DN ILE+FSAS+QAST+Q VE +  +GT+F RFP  LL+K+   C
Sbjct  147  AICLGFELLTMIISKDNNILEEFSASHQASTVQFVENIKFDGTVFGRFPPVLLKKMSTHC  206

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH +GISPE  QA+ DL  FF VLTTS+DK NKVYVS++Q + YPV A+QW PE+N
Sbjct  207  LVMQNHHFGISPERLQANNDLCGFFRVLTTSVDKKNKVYVSSVQAQHYPVTALQWHPEKN  266

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSS-NVPNEPDVRDNLIYNYNTSYSGKDG  156
             FEW  S+IPH+EDAI V+Q VANYFVSEARKSS N P    V DNLIYNY+ SY+GK  
Sbjct  267  VFEWGSSQIPHTEDAIQVTQHVANYFVSEARKSSNNKPATSKVLDNLIYNYSPSYAGKVR  326

Query  155  SGFVEVYIFS  126
              F EVY+F+
Sbjct  327  GSFEEVYLFT  336



>ref|XP_006477852.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Citrus 
sinensis]
Length=348

 Score =   248 bits (633),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 145/186 (78%), Gaps = 0/186 (0%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+LLT+I+S+D  ILE F+A++QASTLQ +E  ++EGT+FQRFP +L++K+  +CLVM
Sbjct  163  LGFELLTMIISKDKNILESFNAADQASTLQFMENTSIEGTVFQRFPPKLIKKLSTDCLVM  222

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
            QNH +GISPE+ Q + DLS FF +LTTS D+DNKVYVST+Q   YPV A QW PE+NAFE
Sbjct  223  QNHHYGISPETLQKNLDLSRFFKMLTTSADEDNKVYVSTVQAYDYPVTAFQWHPEKNAFE  282

Query  323  WALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFV  144
            W  S IPHSEDAI V+Q VANYF+SEAR S N P    V DNLIYNY  ++ GK G GF 
Sbjct  283  WGSSAIPHSEDAIEVTQHVANYFISEARWSVNRPPAQKVLDNLIYNYRPTFCGKAGKGFD  342

Query  143  EVYIFS  126
            EVYIF+
Sbjct  343  EVYIFT  348



>ref|XP_011044052.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Populus euphratica]
Length=408

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 150/189 (79%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF++LT+I+SEDN ILE F+ ++QASTLQ +  +N+EGT+F+RFP +LL+++  +C
Sbjct  198  AICLGFEILTMIISEDNQILETFNGADQASTLQFMNNINIEGTVFRRFPPDLLKRLSTDC  257

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH++GISP+ F  +  LS+FF +LTTS D+DN+VYVST+Q   YPV A QW PE+N
Sbjct  258  LVMQNHRYGISPQRFLENEHLSSFFEILTTSTDEDNQVYVSTVQACGYPVTAFQWHPEKN  317

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW LS IPHSEDAI V+Q +AN+FVSEARKS N P+   V  NLIYNY+ +Y GK G 
Sbjct  318  AFEWGLSMIPHSEDAIQVTQHIANFFVSEARKSLNRPSSRKVLANLIYNYSPTYCGKAGK  377

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  378  GYDEVYIFA  386



>ref|NP_001234440.1| gamma-glutamylhydrolase 2 [Solanum lycopersicum]
 gb|ACC86850.1| gamma-glutamylhydrolase 2 [Solanum lycopersicum]
Length=344

 Score =   247 bits (631),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 148/190 (78%), Gaps = 1/190 (1%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+S+DN ILE+FSA +QAST+Q VE +  EGT+F RFP  LL+K+   C
Sbjct  147  AICLGFELLTMIISKDNNILEEFSALHQASTVQFVENIKFEGTVFGRFPPVLLKKMTTHC  206

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH++GISPE  QA+ DL  FF +LTTS+DK NKVYVS++Q + YP+ A+QW PE+N
Sbjct  207  LVMQNHRFGISPERLQANNDLCGFFKILTTSVDKKNKVYVSSVQAQHYPITALQWHPEKN  266

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSS-NVPNEPDVRDNLIYNYNTSYSGKDG  156
             FEW  S+IPH+EDAI VSQ VANYF+SEARKSS N P    V DNLIYNY+ SY+GK  
Sbjct  267  VFEWGSSQIPHTEDAIQVSQHVANYFISEARKSSNNKPATSKVLDNLIYNYSPSYAGKVR  326

Query  155  SGFVEVYIFS  126
              F EVY+F+
Sbjct  327  GSFEEVYLFT  336



>ref|XP_010242157.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Nelumbo 
nucifera]
Length=384

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LL++I+S+D+ ILE+F+A +QASTLQ  E  N+ GT+FQRFP ELL+K+  +C
Sbjct  196  AICLGFELLSMIISKDDGILERFNALDQASTLQFTEKSNIGGTVFQRFPPELLKKLTTDC  255

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQ+H++G+SPE FQ +  LS+FF +LTTS D+D KVYVST+Q   YPV A QW PE+N
Sbjct  256  LVMQHHQYGVSPERFQENPLLSSFFRILTTSKDEDGKVYVSTVQAYNYPVSAFQWHPEKN  315

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW LS IPH+EDA+ V+Q VAN F+SEARKSSN P    V DNLIYNY+ +Y GK G 
Sbjct  316  AFEWGLSMIPHTEDAVQVTQLVANSFISEARKSSNRPPARKVLDNLIYNYSPTYCGKAGR  375

Query  152  GFVEVYIFS  126
            G+ EVYIFS
Sbjct  376  GYDEVYIFS  384



>ref|XP_002318789.2| hypothetical protein POPTR_0012s11220g [Populus trichocarpa]
 gb|EEE97009.2| hypothetical protein POPTR_0012s11220g [Populus trichocarpa]
Length=411

 Score =   247 bits (631),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF++LT+I+SEDN ILE F+ ++QASTLQ +  +N++GT+F+RFP +LL+++  +C
Sbjct  201  AICLGFEILTMIISEDNQILETFNGADQASTLQFMNNINIKGTVFRRFPPDLLKRLSTDC  260

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH +GISP+ FQ    LS+F  +LTTS D+DN+VYVST+Q   YPV A QW PE+N
Sbjct  261  LVMQNHHYGISPQRFQESEHLSSFLEILTTSTDEDNQVYVSTVQACGYPVTAFQWHPEKN  320

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW LS IPHSEDAI V+Q +AN+FVSEARKS N P+   V  NLIYNY+ +Y GK G 
Sbjct  321  AFEWGLSMIPHSEDAIQVTQHIANFFVSEARKSLNRPSSRKVLANLIYNYSPTYCGKAGK  380

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  381  GYDEVYIFA  389



>ref|XP_010540146.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Tarenaya hassleriana]
Length=405

 Score =   247 bits (630),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LL++I+S+D  ILE+F+A + ASTLQ VE +N+EGT+FQRFP +LLRK+  +C
Sbjct  211  AICLGFELLSMIISQDRNILEEFAAEDAASTLQFVENINIEGTVFQRFPPQLLRKLSTDC  270

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH++GISPE    +  LS+FFN+LTT +D+ +K YVST+Q K+YPV   QW PE+N
Sbjct  271  LVMQNHRYGISPERLLGNPALSSFFNILTTCIDEHDKTYVSTVQSKRYPVTGFQWHPEKN  330

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S+IPHSEDAI V+Q  ANY VSEARKS N P    V +NLIYNY+ +Y G  G 
Sbjct  331  AFEWGSSKIPHSEDAIQVTQHAANYLVSEARKSLNRPPSQKVLENLIYNYSPTYCGYAGR  390

Query  152  GFVEVYIFS  126
            GF EVYIF+
Sbjct  391  GFDEVYIFT  399



>ref|XP_010248391.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Nelumbo 
nucifera]
Length=346

 Score =   245 bits (625),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI L F+LLT+I+S+D  ILE+F+A NQASTLQ  E   +EGT+FQRF  ELL+K+  +C
Sbjct  158  AICLSFELLTMIISKDVNILERFNALNQASTLQFTENSIIEGTVFQRFSPELLKKLTTDC  217

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            +VM+NH++GIS E FQ +  LS+FF +LTTS D+D KVYVST++   YPV A QW PE+N
Sbjct  218  IVMENHQYGISLERFQKNPSLSSFFRILTTSKDRDGKVYVSTVKSHNYPVSAFQWHPEKN  277

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW LS IPH+EDA+LV+Q VANYF+SEARKS N P    V DNLIYNY  +YSGK G+
Sbjct  278  AFEWGLSMIPHTEDAVLVTQHVANYFISEARKSLNRPPAQKVLDNLIYNYRPTYSGKAGT  337

Query  152  GFVEVYIFS  126
            G+ EVYIFS
Sbjct  338  GYDEVYIFS  346



>gb|KCW67543.1| hypothetical protein EUGRSUZ_F01296 [Eucalyptus grandis]
Length=188

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 136/181 (75%), Gaps = 0/181 (0%)
 Frame = -2

Query  668  LTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKW  489
            L  I   D  ILE+F+A++QASTLQ +   N+EGT+FQRFP +LL+K+  +CLVMQNH +
Sbjct  8    LESISRHDKGILEEFNAAHQASTLQFMRNTNIEGTVFQRFPPDLLKKLSTDCLVMQNHHY  67

Query  488  GISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE  309
            GISPE      DL+NFF VLTTS+D DNKVYVST Q   YPV A QW PE+NAFEW LS 
Sbjct  68   GISPERLMQSTDLTNFFKVLTTSMDGDNKVYVSTAQAHSYPVTAFQWHPEKNAFEWGLSM  127

Query  308  IPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            IPHS+DAI V+Q VAN+FVSEARKS+N  +   V DNLIYNY+ +Y GK G G+ EVYIF
Sbjct  128  IPHSDDAIQVTQHVANFFVSEARKSTNRASARKVLDNLIYNYSPTYCGKAGKGYDEVYIF  187

Query  128  S  126
            +
Sbjct  188  T  188



>gb|EPS62480.1| hypothetical protein M569_12307, partial [Genlisea aurea]
Length=351

 Score =   244 bits (623),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 143/188 (76%), Gaps = 0/188 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+IVSEDN ILE FSA +Q S LQ V+  NV GT+FQRFP +LL K+  +C
Sbjct  164  AICLGFELLTMIVSEDNEILENFSAVDQVSALQFVDNSNVNGTVFQRFPPDLLHKLSTDC  223

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH++GISP+  Q +  L++FF  LTT+ D+D KVYVST Q  ++PV AVQW PE+N
Sbjct  224  LVMQNHRYGISPDKLQNNEKLNDFFTTLTTTADEDGKVYVSTAQAHRFPVTAVQWHPEKN  283

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S IPHS+DA+ V+Q VAN+FV EAR S   P   +V DNLIYNY+ +YSGK GS
Sbjct  284  AFEWGSSRIPHSDDAVRVTQHVANFFVREARLSKIRPQSKEVLDNLIYNYSPAYSGKAGS  343

Query  152  GFVEVYIF  129
            GF EVYIF
Sbjct  344  GFDEVYIF  351



>gb|AAC83041.1| Strong similarity to gb|AF067141 gamma-glutamyl hydrolase from 
Arabidopsis thaliana. ESTs gb|R83955, gb|T45062, gb|T22220, 
gb|AA586207, gb|AI099851 and gb|AI00672 come from this gene 
[Arabidopsis thaliana]
Length=327

 Score =   243 bits (620),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 143/189 (76%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+S++  I EK  A N AS+LQ VE +N++GT+FQRFP ELL+K+G +C
Sbjct  133  AICLGFELLTMIISQNRDIFEKMDARNSASSLQFVENVNIQGTIFQRFPPELLKKLGTDC  192

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH++GISP+SF+ +  LSNFF ++TT +D + KVYVST+Q  KYPV   QW PE+N
Sbjct  193  LVMQNHRFGISPQSFEGNIALSNFFKIVTTCVDDNGKVYVSTVQSTKYPVTGFQWHPEKN  252

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S+IPHSEDAI V+Q  AN+ VSEARKS N P    V  NLIYNY  +Y G  G 
Sbjct  253  AFEWGSSKIPHSEDAIQVTQHAANHLVSEARKSLNRPESKKVLSNLIYNYKPTYCGYAGI  312

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  313  GYDEVYIFT  321



>gb|AAC33745.1| gamma-glutamyl hydrolase [Arabidopsis thaliana]
Length=326

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 143/189 (76%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+S++  I EK  A N AS+LQ VE +N++GT+FQRFP ELL+K+G +C
Sbjct  132  AICLGFELLTMIISQNRDIFEKMDARNSASSLQFVENVNIQGTIFQRFPPELLKKLGTDC  191

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH++GISP+SF+ +  LSNFF ++TT +D + KVYVST+Q  KYPV   QW PE+N
Sbjct  192  LVMQNHRFGISPQSFEGNIALSNFFKIVTTCVDDNGKVYVSTVQSTKYPVTGFQWHPEKN  251

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S+IPHSEDAI V+Q  AN+ VSEARKS N P    V  NLIYNY  +Y G  G 
Sbjct  252  AFEWGSSKIPHSEDAIQVTQHAANHLVSEARKSLNRPESKKVLSNLIYNYKPTYCGYAGI  311

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  312  GYDEVYIFT  320



>ref|XP_002862660.1| gamma-glutamyl hydrolase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38918.1| gamma-glutamyl hydrolase 2 [Arabidopsis lyrata subsp. lyrata]
Length=347

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+S++  I EK  A N AS+LQ +E +N++GT+FQRFP ELL+K+G +C
Sbjct  153  AICLGFELLTMIISQNRDIFEKMDARNSASSLQFLENVNIQGTIFQRFPPELLKKLGTDC  212

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH++GISPESF+ +  LS+FF ++TTS+D ++KVYVST+Q KKYPV   QW PE+N
Sbjct  213  LVMQNHRFGISPESFEGNVALSSFFKIVTTSVDNNSKVYVSTVQSKKYPVTGFQWHPEKN  272

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S+IPHSEDAI V+Q  AN+ VSEARKS N P+   V   LIYNY  +Y G  G+
Sbjct  273  AFEWGSSKIPHSEDAIQVTQHAANHLVSEARKSLNRPDSKKVLSYLIYNYKPTYCGYAGN  332

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  333  GYDEVYIFT  341



>ref|XP_010472700.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Camelina sativa]
Length=368

 Score =   243 bits (621),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 143/189 (76%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+IVS++  I EK  A N AS+LQ +E +N+EGT+FQRFP EL  ++  +C
Sbjct  174  AICLGFELLTMIVSQNRGIFEKVDARNCASSLQFIENVNIEGTVFQRFPPELFNQLSTDC  233

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH++GISP+SF+    LSNFFN++TT  D  NK+YVST++ K+YPV   QW PE+N
Sbjct  234  LVMQNHQYGISPDSFEGTVALSNFFNIVTTCSDNHNKIYVSTVKSKQYPVTGFQWHPEKN  293

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW LS IPHSEDAI V+Q VANY VSEARKS N P+   V  NLIYNY  +Y G +G 
Sbjct  294  AFEWGLSGIPHSEDAIQVTQHVANYLVSEARKSQNRPSSEKVLSNLIYNYTPTYCGYEGR  353

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  354  GYDEVYIFT  362



>ref|NP_565186.2| gamma-glutamyl hydrolase 2 [Arabidopsis thaliana]
 sp|O65355.2|GGH2_ARATH RecName: Full=Gamma-glutamyl hydrolase 2; Short=AtGGH2; AltName: 
Full=Conjugase; AltName: Full=GH; AltName: Full=Gamma-Glu-X 
carboxypeptidase; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL49804.1| putative gamma glutamyl hydrolase [Arabidopsis thaliana]
 gb|AAM20068.1| putative gamma glutamyl hydrolase [Arabidopsis thaliana]
 gb|AEE36137.1| gamma-glutamyl hydrolase 2 [Arabidopsis thaliana]
Length=347

 Score =   243 bits (619),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 143/189 (76%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+S++  I EK  A N AS+LQ VE +N++GT+FQRFP ELL+K+G +C
Sbjct  153  AICLGFELLTMIISQNRDIFEKMDARNSASSLQFVENVNIQGTIFQRFPPELLKKLGTDC  212

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH++GISP+SF+ +  LSNFF ++TT +D + KVYVST+Q  KYPV   QW PE+N
Sbjct  213  LVMQNHRFGISPQSFEGNIALSNFFKIVTTCVDDNGKVYVSTVQSTKYPVTGFQWHPEKN  272

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S+IPHSEDAI V+Q  AN+ VSEARKS N P    V  NLIYNY  +Y G  G 
Sbjct  273  AFEWGSSKIPHSEDAIQVTQHAANHLVSEARKSLNRPESKKVLSNLIYNYKPTYCGYAGI  332

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  333  GYDEVYIFT  341



>ref|XP_007149562.1| hypothetical protein PHAVU_005G080700g [Phaseolus vulgaris]
 gb|ESW21556.1| hypothetical protein PHAVU_005G080700g [Phaseolus vulgaris]
Length=342

 Score =   242 bits (617),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            A+ LGF+L+T+I+SEDN ILE+F+ASNQAST+Q VE  N+E +LFQRFP ELLRK+  +C
Sbjct  152  AVCLGFELITMIISEDNNILEEFTASNQASTIQFVESANIEESLFQRFPPELLRKMTTDC  211

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH++GISP     +  LS+FF +LTT  D+D+KVYVST++ + YPV   QW PE+N
Sbjct  212  LVMQNHRYGISPGKLLDNRKLSSFFEILTTCSDEDDKVYVSTVRSRNYPVTGFQWHPEKN  271

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW    IPH+EDA+ ++Q VAN+ VSEARKS N P   +V DNL+YNY+ +Y GK G 
Sbjct  272  AFEWGSPRIPHTEDAVQITQHVANFLVSEARKSINRPFTQEVLDNLVYNYSPTYGGKAGK  331

Query  152  GFVEVYIFS  126
            G+ EVY+F+
Sbjct  332  GYDEVYLFA  340



>ref|XP_002887752.1| gamma-glutamyl hydrolase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64011.1| gamma-glutamyl hydrolase 2 [Arabidopsis lyrata subsp. lyrata]
Length=343

 Score =   242 bits (617),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+S++  I EK  A N AS+LQ +E +N++GT+FQRFP ELL+K+G +C
Sbjct  153  AICLGFELLTMIISQNRDIFEKMDARNSASSLQFLENVNIQGTIFQRFPPELLKKLGTDC  212

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH++GISPESF+ +  LS+FF ++TT +D +NKVYVST+Q KKYPV   QW PE+N
Sbjct  213  LVMQNHRFGISPESFEGNVALSSFFKIVTTCVDNNNKVYVSTVQSKKYPVTGFQWHPEKN  272

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S+IPHSEDAI V+Q  AN+ VSEARKS N P+   V   LIY+Y  +Y G  G+
Sbjct  273  AFEWGSSKIPHSEDAIQVTQHAANHLVSEARKSLNRPDSKKVLSYLIYSYKPTYCGYAGN  332

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  333  GYDEVYIFT  341



>ref|XP_010429695.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Camelina sativa]
Length=355

 Score =   242 bits (617),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 143/189 (76%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+S++  I +K  A N AS+LQ +E +N+EGT+FQRFP +L  K+  +C
Sbjct  161  AICLGFELLTMIISQNRDIFKKVDARNCASSLQFIENVNIEGTVFQRFPPDLFNKLSTDC  220

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH++GISP+SF+    LSNFFN++TT  D  NK+YVST++ K+YPV   QW PE+N
Sbjct  221  LVMQNHQFGISPDSFEGTVALSNFFNIVTTCSDTHNKIYVSTVKSKQYPVTGFQWHPEKN  280

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW LS IPHSEDAI V+Q VANY VSEARKS N P+   V  NLIYNY  +Y G +G 
Sbjct  281  AFEWGLSTIPHSEDAIQVTQHVANYLVSEARKSQNRPSSEKVLSNLIYNYTPTYCGYEGR  340

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  341  GYDEVYIFT  349



>ref|XP_009128305.1| PREDICTED: gamma-glutamyl hydrolase 1 [Brassica rapa]
 emb|CDY26875.1| BnaA02g19000D [Brassica napus]
Length=344

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 144/189 (76%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             I LGF+L++IIVS+D  IL++F A + AS+LQ VE +N+EGTLFQRFP ELLRK+  +C
Sbjct  150  GICLGFELMSIIVSQDRGILQRFDAEDNASSLQFVENVNIEGTLFQRFPPELLRKLSTDC  209

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQ H+WGI+PE F+A+  LS+FF ++TT +D+++K YVST++ KKYP+   QW PE+N
Sbjct  210  LVMQKHRWGITPEKFKANHALSSFFEIVTTCIDENSKTYVSTVKAKKYPITGFQWHPEKN  269

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S+IPHS DAI V+Q  A+Y VSEARKS N P+   V  NLIYNY  +Y G  G 
Sbjct  270  AFEWGSSQIPHSADAIQVTQYAASYLVSEARKSLNRPSSEKVLKNLIYNYKPTYCGYAGK  329

Query  152  GFVEVYIFS  126
            G+ EVY+F+
Sbjct  330  GYDEVYLFT  338



>emb|CDY14595.1| BnaC02g25180D [Brassica napus]
Length=344

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 144/189 (76%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             I LGF+L++IIVS+D  IL++F A + AS+LQ VE +N+EGTLFQRFP ELLRK+  +C
Sbjct  150  GICLGFELMSIIVSQDRGILQRFDAEDNASSLQFVENVNIEGTLFQRFPPELLRKLSTDC  209

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQ H+WGI+PE F+A+  LS+FF ++TT +D+++K YVST++ KKYP+   QW PE+N
Sbjct  210  LVMQKHRWGITPEKFKANHALSSFFEIVTTCIDENSKTYVSTVKAKKYPITGFQWHPEKN  269

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S+IPHS DAI V+Q  A+Y VSEARKS N P+   V  NLIYNY  +Y G  G 
Sbjct  270  AFEWGSSQIPHSADAIQVTQYAASYLVSEARKSLNRPSSEKVLKNLIYNYKPTYCGYAGK  329

Query  152  GFVEVYIFS  126
            G+ EVY+F+
Sbjct  330  GYDEVYLFT  338



>ref|XP_006389965.1| hypothetical protein EUTSA_v10018776mg [Eutrema salsugineum]
 gb|ESQ27251.1| hypothetical protein EUTSA_v10018776mg [Eutrema salsugineum]
Length=355

 Score =   241 bits (614),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 144/189 (76%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+S++  ILEK  A N AS+LQ VE ++ EGT+FQRFP ELL+K+  +C
Sbjct  161  AICLGFELLTMIISQNTDILEKVDAKNSASSLQFVENVSTEGTVFQRFPPELLKKLSTDC  220

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH++GISP+SF+ +  LS FF ++TT  D ++K YVST+Q KKYPV   QW PE+N
Sbjct  221  LVMQNHQFGISPDSFEGNIALSRFFKIVTTCTDDNSKAYVSTVQSKKYPVTGFQWHPEKN  280

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW LS IPHSEDAI V+Q  AN+ VSEARKS N P+  +V  NLIYNY  +Y G +G 
Sbjct  281  AFEWGLSRIPHSEDAIQVTQLAANHLVSEARKSLNRPSPKEVLSNLIYNYKPTYCGYEGR  340

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  341  GYDEVYIFT  349



>ref|XP_002887751.1| gamma-glutamyl hydrolase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64010.1| gamma-glutamyl hydrolase 3 [Arabidopsis lyrata subsp. lyrata]
Length=350

 Score =   241 bits (614),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 145/188 (77%), Gaps = 0/188 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            A+ LGF++L++I+S++  ILE+F + N AS+LQ  E +N+E T+FQRFP ELL+K+  +C
Sbjct  162  AMCLGFEILSMIISQNRDILERFDSVNYASSLQFFENVNIEATVFQRFPPELLKKLSTDC  221

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH +GISP++FQ +  LS+FFN+LTTS DKD+K +VSTI+ K YPV A QW PE+N
Sbjct  222  LVMQNHYFGISPDNFQGNPSLSSFFNILTTSADKDSKTFVSTIRSKGYPVTAFQWHPEKN  281

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  SEIPHSEDAI V+Q  ANY VSEARKS N P+   V  NLIYNY  +YSG  GS
Sbjct  282  AFEWGSSEIPHSEDAIQVTQYAANYLVSEARKSMNRPSSEKVLSNLIYNYKPTYSGYKGS  341

Query  152  GFVEVYIF  129
            G  EVYIF
Sbjct  342  GDDEVYIF  349



>ref|XP_002862658.1| hypothetical protein ARALYDRAFT_359459 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38916.1| hypothetical protein ARALYDRAFT_359459 [Arabidopsis lyrata subsp. 
lyrata]
Length=210

 Score =   236 bits (601),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 142/189 (75%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             I LGF+L++II+S++  ILE+F A + ASTLQ V+ +N++GTLFQRFP ELL+K+  +C
Sbjct  16   GICLGFELMSIIISQNRDILERFDAEDNASTLQFVDNVNIDGTLFQRFPPELLKKLSTDC  75

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQ HK+GI+P +FQ +  LS+FF +LTT +D+++K YVST++ K+YP+   QW PE+N
Sbjct  76   LVMQKHKYGITPANFQGNPALSSFFEILTTCIDENSKTYVSTVKAKRYPITGFQWHPEKN  135

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S IPHSEDAI V+Q  A+Y VSEARKS N P    V  NLIYNY  +Y G  G 
Sbjct  136  AFEWGSSAIPHSEDAIQVTQHAASYLVSEARKSLNRPPSKKVLSNLIYNYKPTYCGYAGR  195

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  196  GYDEVYIFT  204



>ref|XP_010417473.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Camelina sativa]
Length=368

 Score =   241 bits (614),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 143/189 (76%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+S++  I EK  A N AS+LQ ++ +N+EGT+FQRFP EL +++  +C
Sbjct  174  AICLGFELLTMIISQNRDIFEKVDARNCASSLQFIKNVNIEGTVFQRFPPELFKQLSTDC  233

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH++GISP+SF+    LSNFFN++TT  D  NK YVSTI+ K+YPV   QW PE+N
Sbjct  234  LVMQNHQYGISPDSFEGTVALSNFFNIVTTCSDNHNKTYVSTIKSKQYPVTGFQWHPEKN  293

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW LS IPHSEDAI V+Q VANY VSEARKS N P+   V  NLIYN+  +Y G +G 
Sbjct  294  AFEWGLSGIPHSEDAIQVTQHVANYLVSEARKSQNRPSSEKVLSNLIYNHTPTYCGYEGR  353

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  354  GYDEVYIFT  362



>ref|XP_002862659.1| gamma-glutamyl hydrolase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38917.1| gamma-glutamyl hydrolase 3 [Arabidopsis lyrata subsp. lyrata]
Length=350

 Score =   240 bits (612),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 145/188 (77%), Gaps = 0/188 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            A+ LGF++L++I+S++  ILE+F++ N AS+LQ  E +N+E T+FQRFP ELL+K+  +C
Sbjct  162  AMCLGFEILSMIISQNRDILERFNSVNYASSLQFFENVNIEATVFQRFPPELLKKLSTDC  221

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH +GISP++FQ    LS+FFN+LTTS DKD+K +VSTI+ K YPV A QW PE+N
Sbjct  222  LVMQNHYFGISPDNFQGKPSLSSFFNILTTSADKDSKTFVSTIRSKGYPVTAFQWHPEKN  281

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  SEIPHSEDAI V+Q  ANY VSEARKS N P+   V  NLIYNY  +YSG  GS
Sbjct  282  AFEWGSSEIPHSEDAIQVTQYAANYLVSEARKSMNRPSSEKVLSNLIYNYKPTYSGYKGS  341

Query  152  GFVEVYIF  129
            G  EVYIF
Sbjct  342  GDDEVYIF  349



>gb|AAM65646.1| gamma glutamyl hydrolase, putative [Arabidopsis thaliana]
Length=352

 Score =   239 bits (610),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            A+ LGF++L++I+S++  ILE+F++ N AS+LQ  + +N+E T+FQRFP ELL+K+  +C
Sbjct  164  AMCLGFEILSMIISQNRDILERFNSVNYASSLQFFKNVNIEATVFQRFPPELLKKLSADC  223

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH +GISP++FQ +  LS+FFN++TTS DKD+K +VSTI+ K+YPV A QW PE+N
Sbjct  224  LVMQNHYFGISPDNFQGNPYLSSFFNIVTTSADKDSKTFVSTIRSKRYPVTAFQWHPEKN  283

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  SEIPHSEDAI V+Q  ANY VSEARKS N P+   V  NLIYNY  +YSG  GS
Sbjct  284  AFEWGSSEIPHSEDAIQVTQHAANYLVSEARKSMNRPSSEKVLSNLIYNYKPTYSGYKGS  343

Query  152  GFVEVYIFS  126
            G  EVYIF+
Sbjct  344  GDDEVYIFT  352



>ref|XP_010644101.1| PREDICTED: gamma-glutamyl hydrolase 2 isoform X2 [Vitis vinifera]
Length=374

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 140/179 (78%), Gaps = 0/179 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            A  LGF+LLT+I+S+D  ILE+FSA++QASTL  ++  ++ GT+FQRFP +LLRK+  +C
Sbjct  196  ATCLGFELLTMIISKDIKILEEFSAADQASTLNFMKNTDIRGTVFQRFPPDLLRKLSTDC  255

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH +GISPE FQ + DLS+FF +LTTS D+D+KVYVST Q   YPV A QW PE+N
Sbjct  256  LVMQNHHYGISPERFQENTDLSSFFKILTTSTDEDDKVYVSTAQAHSYPVTAFQWHPEKN  315

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDG  156
            AFEW LS IPHSEDA+ V+Q VAN+F+SEARKS N P    V DNLIYNY+ +Y GK G
Sbjct  316  AFEWGLSRIPHSEDAVQVTQHVANFFISEARKSLNRPPARKVLDNLIYNYSPTYCGKAG  374



>ref|NP_177988.1| gamma-glutamyl hydrolase 3 [Arabidopsis thaliana]
 sp|Q9ZV85.1|GGH3_ARATH RecName: Full=Probable gamma-glutamyl hydrolase 3; Short=AtGGH3; 
AltName: Full=Conjugase; AltName: Full=GH; AltName: Full=Gamma-Glu-X 
carboxypeptidase; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK63854.1|AF389281_1 At1g78670/F9K20_29 [Arabidopsis thaliana]
 gb|AAC83042.1| Similar to gb|AF067141 gamma-glutamyl hydrolase from Arabidopsis 
thaliana. ESTs gb|T46595 and gb|AI09918 come from this gene 
[Arabidopsis thaliana]
 gb|AAN18123.1| At1g78670/F9K20_29 [Arabidopsis thaliana]
 gb|AEE36136.1| gamma-glutamyl hydrolase 3 [Arabidopsis thaliana]
Length=352

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            A+ LGF++L++I+S++  ILE+F++ N AS+LQ  + +N+E T+FQRFP ELL+K+  +C
Sbjct  164  AMCLGFEILSMIISQNRDILERFNSVNYASSLQFFKNVNIEATVFQRFPPELLKKLSADC  223

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH +GISP++FQ +  LS+FFN++TTS DKD+K +VSTI+ K+YPV A QW PE+N
Sbjct  224  LVMQNHYFGISPDNFQGNPYLSSFFNIVTTSADKDSKTFVSTIRSKRYPVTAFQWHPEKN  283

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  SEIPHSEDAI V+Q  ANY VSEARKS N P+   V  NLIYNY  +YSG  GS
Sbjct  284  AFEWGSSEIPHSEDAIQVTQHAANYLVSEARKSMNRPSSEKVLSNLIYNYKPTYSGYKGS  343

Query  152  GFVEVYIFS  126
            G  EVYIF+
Sbjct  344  GDDEVYIFT  352



>ref|XP_003596306.1| Gamma-glutamylhydrolase [Medicago truncatula]
 gb|AES66557.1| gamma-glutamylhydrolase [Medicago truncatula]
Length=341

 Score =   239 bits (609),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 142/188 (76%), Gaps = 0/188 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            A  LGF+L+++I+SEDN ILE+FSA NQAS+LQ V+   +EG++FQRFP +LL+K+  +C
Sbjct  153  ATCLGFELISMIISEDNNILEEFSARNQASSLQFVKNAYIEGSVFQRFPPDLLKKLSTDC  212

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            L+MQNH++GISP     +  L++FF +LTT  D+DNKVYVST++ + YPV   QW PE+N
Sbjct  213  LIMQNHRYGISPAKLLGNKKLASFFEILTTCNDEDNKVYVSTVRSRNYPVTGFQWHPEKN  272

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW    IPH+EDAI  +Q VAN+ VSEARKSS  P   ++RDNLIYNY  +Y GK G 
Sbjct  273  AFEWGTPSIPHTEDAIRTTQYVANFLVSEARKSSKRPVAQELRDNLIYNYRPTYCGKAGK  332

Query  152  GFVEVYIF  129
            GF EVYIF
Sbjct  333  GFDEVYIF  340



>ref|XP_008386275.1| PREDICTED: gamma-glutamyl hydrolase 2 [Malus domestica]
Length=387

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 141/189 (75%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+S++  ILE FSA + ASTLQ  E   +EGT+FQRFP +LLRK+  +C
Sbjct  192  AICLGFELLTMIISKNKKILESFSAVDVASTLQFTENTIIEGTVFQRFPPDLLRKLSTDC  251

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNHK+GISPE    + +LS+FF +LTT  D+D+KVYVST     YPV A QW PE+N
Sbjct  252  LVMQNHKYGISPERLXXNENLSSFFKILTTCTDEDBKVYVSTAHAYNYPVTAFQWHPEKN  311

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW L  IPHSEDAI V+Q VAN+ VSEARKS N P    V DNLIYNY+ ++ GK G 
Sbjct  312  AFEWGLPMIPHSEDAIQVTQHVANFLVSEARKSLNRPPVGQVLDNLIYNYSPTFCGKAGK  371

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  372  GYDEVYIFT  380



>ref|XP_007213890.1| hypothetical protein PRUPE_ppa006962mg [Prunus persica]
 gb|EMJ15089.1| hypothetical protein PRUPE_ppa006962mg [Prunus persica]
Length=388

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 141/189 (75%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            A  LGF+LLT+I+S++  ILE FSA N ASTL   E   +EGT+FQRFP +LL+K+  +C
Sbjct  193  ATCLGFELLTMIISKNKKILESFSAENMASTLLFTENTIIEGTVFQRFPPDLLKKLSTDC  252

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            +VMQNH +GISPE  Q + +LS+FF +LTTS DKDNKVYVST+    YPV A QW PE+N
Sbjct  253  IVMQNHHYGISPERLQENPNLSSFFKILTTSTDKDNKVYVSTVHAYSYPVTAFQWHPEKN  312

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW    IPHSEDAI V+Q VAN+ VSEARKS N P    V DNLIYNY+ ++ GK G+
Sbjct  313  AFEWGSPMIPHSEDAIQVTQHVANFLVSEARKSLNRPPVRKVLDNLIYNYSPTFCGKAGN  372

Query  152  GFVEVYIFS  126
            GF EVYIF+
Sbjct  373  GFDEVYIFT  381



>emb|CDX87443.1| BnaA07g34300D [Brassica napus]
Length=294

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 143/189 (76%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            A+ LGF++L++I+S+   ILE+F++   AS+LQ +E  N+EGTLFQRF  ELL+K+  +C
Sbjct  106  AMCLGFEILSMIISQSRDILERFNSVYYASSLQFIENANIEGTLFQRFSSELLKKISTDC  165

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LV+QNH++GISPE+F A+  LS+FF++LTTS DKD K YVSTI  K+YPV A QW PE+N
Sbjct  166  LVLQNHQFGISPENFLANPSLSSFFSILTTSADKDGKTYVSTITSKRYPVTAFQWHPEKN  225

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  SEIPHSEDAI V+Q  ANY  SEARKS N P+  +V  NLIYNY   YSG  GS
Sbjct  226  AFEWGSSEIPHSEDAIQVTQHAANYLASEARKSLNRPSHEEVLSNLIYNYKLVYSGYKGS  285

Query  152  GFVEVYIFS  126
            G  E YIF+
Sbjct  286  GNDEAYIFT  294



>ref|XP_009106581.1| PREDICTED: probable gamma-glutamyl hydrolase 3 [Brassica rapa]
Length=343

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            A+ LGF++L++I+S+   ILE+F++   AS+LQ +E  N+EGTLFQRF  ELL+K+  +C
Sbjct  155  AMCLGFEILSMIISQSRDILERFNSVYYASSLQFIENANIEGTLFQRFSPELLKKISTDC  214

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LV+QNH++GISP++F A+  LS+FF++LTTS DKD K YVSTI+ K+YPV A QW PE+N
Sbjct  215  LVLQNHQFGISPDNFLANPSLSSFFSILTTSADKDGKTYVSTIRSKRYPVTAFQWHPEKN  274

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  SEIPHSEDAI V+Q  ANY VSEARKS N P+  +V  NLIYNY  +YSG  GS
Sbjct  275  AFEWGSSEIPHSEDAIQVTQHAANYLVSEARKSLNRPSHEEVLSNLIYNYKLTYSGYKGS  334

Query  152  GFVEVYIFS  126
            G  E YIF+
Sbjct  335  GNDEAYIFT  343



>ref|XP_004489007.1| PREDICTED: gamma-glutamyl hydrolase-like [Cicer arietinum]
Length=343

 Score =   237 bits (604),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 142/188 (76%), Gaps = 0/188 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             + LGF+L+T+I+SEDN ILE+FS  NQAS+LQ+VE  N+EG++F RFP +LL+K+  EC
Sbjct  155  GVCLGFELITMIISEDNNILEEFSGKNQASSLQIVENANIEGSVFGRFPPDLLKKLSTEC  214

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH +GISP     +  LS+FF +LTT  D+D+KVYVST++ + YPV   QW PE+N
Sbjct  215  LVMQNHCFGISPAKLLDNPKLSSFFEILTTCNDEDDKVYVSTVRSRNYPVTGFQWHPEKN  274

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S+IPH+EDAI ++Q VAN+ VSEARKS N P   ++ DNLIYNY  +Y G  G 
Sbjct  275  AFEWGSSKIPHTEDAIQITQHVANFLVSEARKSLNRPVSQELLDNLIYNYKPTYCGYAGK  334

Query  152  GFVEVYIF  129
            GF EVYIF
Sbjct  335  GFDEVYIF  342



>ref|XP_008226384.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Prunus mume]
Length=388

 Score =   238 bits (607),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 141/189 (75%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            A  LGF+LLT+I+S++  ILE FSA N ASTLQ  E   +EGT+FQRFP +LL+K+  +C
Sbjct  193  ATCLGFELLTMIISKNKEILESFSAENMASTLQFTENAIIEGTVFQRFPPDLLKKLSTDC  252

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            +VMQNH +GISP   Q + +LS+FF +LTTS D+DNKVYVST+    YPV A QW PE+N
Sbjct  253  IVMQNHHYGISPVRLQENPNLSSFFKILTTSTDEDNKVYVSTVHAYSYPVTAFQWHPEKN  312

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW    IPHSEDAI V+Q VAN+ VSEARKS N P    V DNLIYNY+ ++ GK G+
Sbjct  313  AFEWGSPMIPHSEDAIQVTQHVANFLVSEARKSLNRPPVRKVLDNLIYNYSPTFCGKAGT  372

Query  152  GFVEVYIFS  126
            GF EVYIF+
Sbjct  373  GFDEVYIFT  381



>ref|XP_006477848.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Citrus 
sinensis]
Length=371

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 142/189 (75%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+L+++I+S+D  ILE+F+ ++QASTL+ ++   +EGT+FQRF  ELL+K+  +C
Sbjct  183  AICLGFELISMIISKDRNILERFNGADQASTLKFIKNSKIEGTVFQRFVPELLKKLSTDC  242

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQ H +GISPE  Q + DLS FF +LTTS D  NKVYVST+Q   YP    QW PE+N
Sbjct  243  LVMQKHIYGISPERMQENLDLSKFFRILTTSEDIYNKVYVSTVQAYNYPFTGFQWHPEKN  302

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S +PHSEDAILV+Q VAN+FVSEARKS N P    V DNLIYNY+  Y GKDG 
Sbjct  303  AFEWGFSGVPHSEDAILVTQHVANFFVSEARKSLNRPPARKVLDNLIYNYSPIYCGKDGR  362

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  363  GYDEVYIFT  371



>ref|XP_010924708.1| PREDICTED: LOW QUALITY PROTEIN: gamma-glutamyl hydrolase 2-like 
[Elaeis guineensis]
Length=363

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 142/189 (75%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             I LGF+LL++I+++DN   E+FS  NQASTLQ  + +N++G++F+RFP ELL+K+  +C
Sbjct  175  GICLGFELLSMIITQDNNFCERFSGENQASTLQFPDYVNIQGSVFERFPSELLKKLSTDC  234

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            L MQNH +GISP+S Q +  LS+FF +LTTS D + +VY+ST Q   YPV   QW PE+N
Sbjct  235  LAMQNHMYGISPKSLQENDALSSFFRILTTSTDANGEVYISTAQAYNYPVTGFQWHPEKN  294

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S IPHSEDA+ V+Q  ANYF+SEARKSSN P+   V DNLIYNY+ +Y GK G 
Sbjct  295  AFEWGPSMIPHSEDAVRVTQHTANYFISEARKSSNRPSARKVLDNLIYNYSPTYGGKAGK  354

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  355  GYDEVYIFT  363



>ref|XP_003543198.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Glycine max]
Length=342

 Score =   235 bits (600),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 143/189 (76%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            A  LGF+L+T+I+S+DN ILE+FSASNQASTLQ VE  N+  ++FQRFP ELL K+  +C
Sbjct  152  ATCLGFELITMIISQDNNILEEFSASNQASTLQFVENANIGESVFQRFPPELLGKMSTDC  211

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH++GISP     +  LS+FF +LTT  D+D+KVYVST++ + YPV   QW PE+N
Sbjct  212  LVMQNHRYGISPGKLLNNPKLSSFFEILTTCTDEDDKVYVSTVRSQNYPVTGFQWHPEKN  271

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW    IPH+EDAI ++Q VAN+ VSEARKS N P   ++ DNLIYNY+ +Y GK G 
Sbjct  272  AFEWGSPRIPHTEDAIQITQYVANFLVSEARKSLNRPVAQELLDNLIYNYSPTYCGKAGK  331

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  332  GYDEVYIFA  340



>ref|XP_009334021.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Pyrus x bretschneideri]
Length=347

 Score =   235 bits (600),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 141/189 (75%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            A  LGF+LLT+I+S++  ILE FSA + ASTLQ  +   +EGT+FQRFP +LL+K+  +C
Sbjct  152  ATCLGFELLTMIISKNKNILETFSAVDAASTLQFTKNAVIEGTVFQRFPPDLLKKLSTDC  211

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNHK+GISPE    + +LS+FF +LTT  D+D+KVYVST+    YPV A QW PE+N
Sbjct  212  LVMQNHKYGISPERLMENENLSSFFKILTTCTDEDDKVYVSTVHAYNYPVTAFQWHPEKN  271

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW L  IPHSEDAI V+Q  AN+ VSEARKS N P   +V DNLIYNY+ ++ GK G 
Sbjct  272  AFEWGLPMIPHSEDAIQVTQHAANFLVSEARKSLNRPPVREVLDNLIYNYSPTFCGKAGR  331

Query  152  GFVEVYIFS  126
            GF EVYIF+
Sbjct  332  GFDEVYIFT  340



>gb|KFK42251.1| hypothetical protein AALP_AA2G230800 [Arabis alpina]
Length=352

 Score =   235 bits (600),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 139/189 (74%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+S++  ILE   A N A++LQ VE  ++ GT+FQRFP EL +K+  +C
Sbjct  158  AICLGFELLTMIISQNRDILEHVDAKNSATSLQFVENAHINGTVFQRFPTELFKKLSTDC  217

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH++GISP  ++++  LS+FF+++TT  D  NK YVST+Q KKYPV   QW PE+N
Sbjct  218  LVMQNHQYGISPGRYESNIALSSFFSIITTCTDNHNKAYVSTVQSKKYPVTGFQWHPEKN  277

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW LS IPHSEDAI V+Q  ANY VSEARKS N P    V  NLIYNY  +Y G +G 
Sbjct  278  AFEWGLSRIPHSEDAIQVTQLAANYLVSEARKSKNRPPAKKVLSNLIYNYKPTYCGYEGR  337

Query  152  GFVEVYIFS  126
            GF EVYIF+
Sbjct  338  GFDEVYIFT  346



>ref|XP_009342915.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X2 [Pyrus 
x bretschneideri]
Length=387

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 140/189 (74%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+S++  ILE FSA +  STLQ  E   +EGT+FQRFP +LLRK+  +C
Sbjct  192  AICLGFELLTMIISKNKKILESFSAVDVPSTLQFTENTIIEGTVFQRFPPDLLRKLSTDC  251

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNHK+GISPE    + +LS+FF +LTT  D+D+KVYVST     YPV A QW PE+N
Sbjct  252  LVMQNHKYGISPERLMENENLSSFFKILTTCTDEDDKVYVSTAHAYNYPVTAFQWHPEKN  311

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW L  IPHSEDAI V+Q VAN+ VSEARKS N P    V DNLIYNY+ ++ GK G 
Sbjct  312  AFEWGLPMIPHSEDAIQVTQHVANFLVSEARKSLNRPPVGQVLDNLIYNYSPTFCGKVGK  371

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  372  GYDEVYIFT  380



>ref|XP_008345165.1| PREDICTED: LOW QUALITY PROTEIN: gamma-glutamyl hydrolase 2-like 
[Malus domestica]
Length=382

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 140/189 (74%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            A  LGF+LLT+I+S++  ILE FSA + ASTLQ  E   +EGT+FQRFP +LL+K+  +C
Sbjct  187  ATCLGFELLTMIISKNKKILETFSAVDVASTLQFTENAVIEGTVFQRFPPDLLKKLSTDC  246

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNHK+GISPE    + +LS+FF +LTT  D+D+KVYVST     YPV A QW PE+N
Sbjct  247  LVMQNHKYGISPERLMENENLSSFFKILTTCTDEDDKVYVSTXHAYNYPVTAFQWHPEKN  306

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW L  IPHSEDAI V+Q  AN+ VSEARKS N P   +V DNLIYNY+ ++ GK G 
Sbjct  307  AFEWGLPMIPHSEDAIQVTQHAANFLVSEARKSLNRPPVREVLDNLIYNYSPTFCGKAGR  366

Query  152  GFVEVYIFS  126
            GF EVYIF+
Sbjct  367  GFDEVYIFT  375



>emb|CDX87442.1| BnaA07g34310D [Brassica napus]
Length=344

 Score =   234 bits (598),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 142/189 (75%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+S++  I EK  A N AS+LQ VE ++ +GT+FQRFP ELL+K+  +C
Sbjct  150  AICLGFELLTMIISQNTDIFEKVDAKNAASSLQFVENVSTQGTVFQRFPPELLKKLTTDC  209

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH++GISP++F+ +  LS FF ++TT LD + K YVST+Q KKYPV   QW PE+N
Sbjct  210  LVMQNHQFGISPDNFEGNIALSRFFKIVTTCLDGNRKAYVSTVQSKKYPVTGFQWHPEKN  269

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S+IPHSEDA+ V+Q  ANY VSEARKS N P+   V  NLIYN+  +Y G +G 
Sbjct  270  AFEWGSSKIPHSEDAVHVTQLTANYLVSEARKSQNRPSPEKVLSNLIYNFKPTYCGYEGR  329

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  330  GYDEVYIFT  338



>ref|XP_002887750.1| ATGGH1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64009.1| ATGGH1 [Arabidopsis lyrata subsp. lyrata]
Length=344

 Score =   234 bits (597),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 142/189 (75%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             I LGF+L++II+S++  ILE+F A + ASTLQ V+ +N++GTLFQRFP ELL+K+  +C
Sbjct  150  GICLGFELMSIIISQNRDILERFDAEDNASTLQFVDNVNIDGTLFQRFPPELLKKLSTDC  209

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQ HK+GI+P +FQ +  LS+FF +LTT +D+++K YVST++ K+YP+   QW PE+N
Sbjct  210  LVMQKHKYGITPANFQGNPALSSFFEILTTCIDENSKTYVSTVKAKRYPITGFQWHPEKN  269

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S IPHSEDAI V+Q  A+Y VSEARKS N P    V  NLIYNY  +Y G  G 
Sbjct  270  AFEWGSSAIPHSEDAIQVTQHAASYLVSEARKSLNRPPSKKVLSNLIYNYKPTYCGYAGR  329

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  330  GYDEVYIFT  338



>ref|XP_006302531.1| hypothetical protein CARUB_v10020631mg, partial [Capsella rubella]
 gb|EOA35429.1| hypothetical protein CARUB_v10020631mg, partial [Capsella rubella]
Length=331

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 142/189 (75%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             I LGF+L++II+S++  ILE+F A + AS+LQ V+ +N++GTLFQRFP +LL+K+  +C
Sbjct  137  GICLGFELMSIIISQNRDILERFDAEDNASSLQFVDNVNLDGTLFQRFPPQLLKKLSTDC  196

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQ HK+GI+P +FQ +  LS+FF +LTT +D+++K YVST++ KKYP+   QW PE+N
Sbjct  197  LVMQKHKYGITPANFQGNPALSSFFEILTTCIDENSKTYVSTVKAKKYPITGFQWHPEKN  256

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  SEIPHSEDAI V+Q  A+Y VSEARKS N P    V  NLIY Y  +Y G  G 
Sbjct  257  AFEWGSSEIPHSEDAIQVTQHAASYLVSEARKSLNRPPSKKVLSNLIYKYKPTYCGYAGR  316

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  317  GYDEVYIFT  325



>ref|XP_008463749.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Cucumis melo]
Length=364

 Score =   234 bits (597),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 143/189 (76%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             + LGF++L++I+S++  ILE F+AS  ASTLQ V+ +N++GT+FQRFP+ LL K+  +C
Sbjct  176  GVCLGFEILSMIISKNRNILEPFNASYMASTLQFVDNVNIQGTVFQRFPHYLLEKLSTDC  235

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            +V QNH +GISPE F  + +LS FF +LTTS DKDNKVYVS++Q   YPV A QW PE+N
Sbjct  236  IVFQNHLYGISPERFAHNEELSRFFQILTTSSDKDNKVYVSSVQAWDYPVTAFQWHPEKN  295

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S IPH+E AI V+Q VANY VSEARKSSN P    V +NLIYNY+ ++ GK G 
Sbjct  296  AFEWGYSVIPHTEHAIEVTQHVANYLVSEARKSSNRPPAQKVIENLIYNYSPTFGGKAGK  355

Query  152  GFVEVYIFS  126
            GF EVYIF+
Sbjct  356  GFDEVYIFT  364



>emb|CDX88464.1| BnaC06g39080D [Brassica napus]
Length=344

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 142/189 (75%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+S++  I EK  A N AS+LQ VE ++++GT+FQRFP ELL+K+  +C
Sbjct  150  AICLGFELLTMIISQNTDIFEKVDAKNAASSLQFVEIVSIQGTVFQRFPPELLKKLTTDC  209

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH++GISP++F+ +  LS FF ++TT LD + K YVST+Q K YPV   QW PE+N
Sbjct  210  LVMQNHQFGISPDNFEGNIALSRFFKIVTTCLDGNRKAYVSTVQSKTYPVTGFQWHPEKN  269

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S+IPHSEDA+ V+Q +ANY V EARKS N P+   V  NLIYNY  +Y G +G 
Sbjct  270  AFEWGSSKIPHSEDAVHVTQLIANYLVGEARKSQNRPSPEKVLSNLIYNYKPTYCGYEGR  329

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  330  GYDEVYIFA  338



>ref|NP_177987.1| gamma-glutamyl hydrolase 1 [Arabidopsis thaliana]
 ref|NP_974172.1| gamma-glutamyl hydrolase 1 [Arabidopsis thaliana]
 sp|Q9SYL6.1|GGH1_ARATH RecName: Full=Gamma-glutamyl hydrolase 1; Short=AtGGH1; AltName: 
Full=Conjugase; AltName: Full=GH; AltName: Full=Gamma-Glu-X 
carboxypeptidase; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD30570.1|AC007260_1 putative gamma-glutamyl hydrolase [Arabidopsis thaliana]
 gb|AEE36133.1| gamma-glutamyl hydrolase 1 [Arabidopsis thaliana]
 gb|AEE36135.1| gamma-glutamyl hydrolase 1 [Arabidopsis thaliana]
Length=348

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 142/189 (75%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             I LGF+L++II+S++  ILE+F A + AS+LQ V+ +N +GTLFQRFP ELL+K+  +C
Sbjct  154  GICLGFELMSIIISQNRDILERFDAEDNASSLQFVDNVNNDGTLFQRFPPELLKKLSTDC  213

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQ HK+GI+P +FQA+  LS+FF +LTT +D+++K YVST++ K+YP+   QW PE+N
Sbjct  214  LVMQKHKYGITPANFQANPALSSFFEILTTCIDENSKTYVSTVKAKRYPITGFQWHPEKN  273

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S IPHSEDAI V+Q  A+Y VSEARKS N P    V  NLIYNY  +Y G  G 
Sbjct  274  AFEWGSSAIPHSEDAIQVTQHAASYLVSEARKSLNRPESQKVLSNLIYNYKPTYCGYAGR  333

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  334  GYDEVYIFT  342



>gb|AES66560.2| gamma-glutamylhydrolase [Medicago truncatula]
Length=311

 Score =   232 bits (591),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 140/188 (74%), Gaps = 0/188 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            A  LGF+L+T+IVSEDN ILE F+A NQAS+LQ VE +N++ ++FQRFP +LL+K+  +C
Sbjct  123  ATCLGFELITMIVSEDNDILEDFAAENQASSLQFVENVNIKESVFQRFPPDLLKKLSTDC  182

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            +VMQNH++GISP     +  LS+FF +LTTS D+D+KVYVST++ + YPV   QW PE+N
Sbjct  183  IVMQNHQYGISPVKLLGNQKLSSFFEILTTSNDQDDKVYVSTVRSRNYPVTGFQWHPEKN  242

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW    IPH+EDAI  +Q  ANY VSEARKS N P   ++ DNLIYNY  +Y G  G 
Sbjct  243  AFEWGSPSIPHTEDAIRTTQYAANYLVSEARKSLNRPVAQELLDNLIYNYRPTYCGYAGK  302

Query  152  GFVEVYIF  129
            GF EVYIF
Sbjct  303  GFDEVYIF  310



>ref|XP_009342914.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=387

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 139/189 (74%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+S++  ILE FSA +  STLQ  E   +EGT+FQRFP +LLRK+  +C
Sbjct  192  AICLGFELLTMIISKNKKILESFSAVDVPSTLQFTENTIIEGTVFQRFPPDLLRKLSTDC  251

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNHK+GISPE    + +LS+FF +LTT  D+D+KVYVST     YPV A QW PE+N
Sbjct  252  LVMQNHKYGISPERLMENENLSSFFKILTTCTDEDDKVYVSTAHAYNYPVTAFQWHPEKN  311

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW L  IPHSEDAI V+Q VAN+ VSEA KS N P    V DNLIYNY+ ++ GK G 
Sbjct  312  AFEWGLPMIPHSEDAIQVTQHVANFLVSEAGKSLNRPPVGQVLDNLIYNYSPTFCGKAGK  371

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  372  GYDEVYIFT  380



>ref|XP_008792313.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Phoenix dactylifera]
Length=394

 Score =   234 bits (596),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 143/189 (76%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             I LGF+L+++I+++DN   E+FS  +QASTL+  + +N++G++F+RFP ELL+K+  +C
Sbjct  206  GICLGFELISMIITKDNNFCERFSGEDQASTLEFPDHVNMQGSVFERFPSELLKKLSTDC  265

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            L MQNH +GISP+S Q +  LS+FF +LTTS D + +VYVST Q   YPV   QW PE+N
Sbjct  266  LAMQNHMFGISPKSLQENDALSSFFRILTTSTDANGEVYVSTAQAYNYPVTGFQWHPEKN  325

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW L  IPHSEDAI V+Q +ANYF+SEARKSSN P+   V DNLIYNY+ +Y GK G 
Sbjct  326  AFEWGLPMIPHSEDAIRVTQHIANYFISEARKSSNRPSARKVLDNLIYNYSPTYGGKAGK  385

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  386  GYDEVYIFT  394



>ref|NP_849900.1| gamma-glutamyl hydrolase 1 [Arabidopsis thaliana]
 gb|ABD59075.1| At1g78660 [Arabidopsis thaliana]
 dbj|BAH19882.1| AT1G78660 [Arabidopsis thaliana]
 gb|AEE36134.1| gamma-glutamyl hydrolase 1 [Arabidopsis thaliana]
Length=347

 Score =   232 bits (592),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 142/189 (75%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             I LGF+L++II+S++  ILE+F A + AS+LQ V+ +N +GTLFQRFP ELL+K+  +C
Sbjct  153  GICLGFELMSIIISQNRDILERFDAEDNASSLQFVDNVNNDGTLFQRFPPELLKKLSTDC  212

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQ HK+GI+P +FQA+  LS+FF +LTT +D+++K YVST++ K+YP+   QW PE+N
Sbjct  213  LVMQKHKYGITPANFQANPALSSFFEILTTCIDENSKTYVSTVKAKRYPITGFQWHPEKN  272

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S IPHSEDAI V+Q  A+Y VSEARKS N P    V  NLIYNY  +Y G  G 
Sbjct  273  AFEWGSSAIPHSEDAIQVTQHAASYLVSEARKSLNRPESQKVLSNLIYNYKPTYCGYAGR  332

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  333  GYDEVYIFT  341



>ref|XP_010417472.1| PREDICTED: gamma-glutamyl hydrolase 1-like [Camelina sativa]
Length=347

 Score =   232 bits (591),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 140/189 (74%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             I LGF+L++II+S++  ILE+F A + AS+LQ V+ +N+EGTLFQRFP  LL+KV  +C
Sbjct  153  GICLGFELMSIIISQNRDILERFDAEDNASSLQFVDNVNLEGTLFQRFPPPLLKKVSSDC  212

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQ HK+GI+P +FQ +  LS+FF +LTT +D+++K YVST++ K+YP+   QW PE+N
Sbjct  213  LVMQKHKYGITPANFQGNPALSSFFEILTTCIDENSKTYVSTVKAKRYPITGFQWHPEKN  272

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S IPHSEDAI V+Q  ANY VSEARKS N      V  NLIYNY  +Y G  G 
Sbjct  273  AFEWGSSAIPHSEDAIQVTQHAANYLVSEARKSLNRAPPKKVLSNLIYNYKPTYCGYAGR  332

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  333  GYDEVYIFT  341



>ref|XP_003596308.1| Gamma-glutamylhydrolase [Medicago truncatula]
 gb|AES66559.1| gamma-glutamylhydrolase [Medicago truncatula]
Length=340

 Score =   231 bits (590),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 140/188 (74%), Gaps = 0/188 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             + LGF+L+++IVSEDN ILE+FSA +QAS+LQ VE   +EG++FQRFP +LL+K+  +C
Sbjct  152  GVCLGFELISMIVSEDNDILEEFSARSQASSLQFVENTKIEGSVFQRFPPDLLKKLSTDC  211

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH++GISP    ++  LS+FF +LT   D+D+KVYVST++ + YPV   QW PE+N
Sbjct  212  LVMQNHRYGISPGKLLSNQKLSSFFEILTICSDEDDKVYVSTVRSRNYPVTGFQWHPEKN  271

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW    IPH+EDAI  +Q +AN+ VSEARKS N P   DV DNLIYNY  +Y G  G 
Sbjct  272  AFEWGPKSIPHTEDAIRTTQYIANFLVSEARKSLNRPVAQDVLDNLIYNYRPTYCGYAGK  331

Query  152  GFVEVYIF  129
            G+ EVYIF
Sbjct  332  GYDEVYIF  339



>ref|XP_009106586.1| PREDICTED: gamma-glutamyl hydrolase 2 [Brassica rapa]
Length=344

 Score =   231 bits (590),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 141/189 (75%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+S++  I EK  A N AS+LQ V  ++ +GT+FQRFP ELL+K+  +C
Sbjct  150  AICLGFELLTMIISQNTDIFEKVDAKNAASSLQFVGNVSTQGTVFQRFPPELLKKLTTDC  209

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH++GISP++F+ +  LS FF ++TT LD + K YVST+Q KKYPV   QW PE+N
Sbjct  210  LVMQNHQFGISPDNFEGNIALSRFFKIVTTCLDGNRKAYVSTVQSKKYPVTGFQWHPEKN  269

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S+IPHSEDA+ V+Q  ANY VSEARKS N P+   V  NLIYN+  +Y G +G 
Sbjct  270  AFEWGSSKIPHSEDAVHVTQLTANYLVSEARKSQNRPSPEKVLSNLIYNFKPTYCGYEGR  329

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  330  GYDEVYIFT  338



>ref|XP_010472701.1| PREDICTED: gamma-glutamyl hydrolase 1 [Camelina sativa]
Length=347

 Score =   231 bits (590),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 140/189 (74%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             I LGF+L++II+S++  ILE+F A + AS+LQ V+ +N+EGTLFQRFP  LL+KV  +C
Sbjct  153  GICLGFELMSIIISQNRDILERFDAEDNASSLQFVDNVNLEGTLFQRFPPPLLKKVSTDC  212

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQ HK+GI+P +FQ +  LS+FF +LTT +D+++K YVST++ K+YP+   QW PE+N
Sbjct  213  LVMQKHKYGITPANFQGNPALSSFFEILTTCIDENSKTYVSTVKAKRYPITGFQWHPEKN  272

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S IPHSEDAI V+Q  ANY VSEARKS N      V  NLIYNY  +Y G  G 
Sbjct  273  AFEWGSSAIPHSEDAIQVTQHAANYLVSEARKSLNRAPPKKVLSNLIYNYKPTYCGYAGR  332

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  333  GYDEVYIFT  341



>gb|KEH38596.1| gamma-glutamylhydrolase [Medicago truncatula]
Length=340

 Score =   231 bits (590),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 140/188 (74%), Gaps = 0/188 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            A  LGF+L+T+IVSEDN ILE F+A NQAS+LQ VE +N++ ++FQRFP +LL+K+  +C
Sbjct  152  ATCLGFELITMIVSEDNDILEDFAAENQASSLQFVENVNIKESVFQRFPPDLLKKLSTDC  211

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            +VMQNH++GISP     +  LS+FF +LTTS D+D+KVYVST++ + YPV   QW PE+N
Sbjct  212  IVMQNHQYGISPVKLLGNQKLSSFFEILTTSNDQDDKVYVSTVRSRNYPVTGFQWHPEKN  271

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW    IPH+EDAI  +Q  ANY VSEARKS N P   ++ DNLIYNY  +Y G  G 
Sbjct  272  AFEWGSPSIPHTEDAIRTTQYAANYLVSEARKSLNRPVAQELLDNLIYNYRPTYCGYAGK  331

Query  152  GFVEVYIF  129
            GF EVYIF
Sbjct  332  GFDEVYIF  339



>gb|AFK48342.1| unknown [Medicago truncatula]
Length=340

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 140/188 (74%), Gaps = 0/188 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             + LGF+L+++IVSEDN ILE+FSA +QAS+LQ VE   +EG++FQRFP +LL+K+  +C
Sbjct  152  GVCLGFELISMIVSEDNDILEEFSARSQASSLQFVENTKIEGSVFQRFPPDLLKKLSTDC  211

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH++GISP    ++  LS+FF +LT   D+D+KVYVST++ + YPV   QW PE+N
Sbjct  212  LVMQNHRYGISPGKLLSNQKLSSFFEILTICSDEDDKVYVSTVRSRNYPVTGFQWHPEKN  271

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW    IPH+EDAI  +Q +AN+ VSEARKS N P   DV DNLIYNY  +Y G  G 
Sbjct  272  AFEWGPKSIPHTEDAIRTTQYIANFLVSEARKSLNRPVAQDVLDNLIYNYRPTYCGYVGK  331

Query  152  GFVEVYIF  129
            G+ EVYIF
Sbjct  332  GYDEVYIF  339



>ref|XP_010324181.1| PREDICTED: gamma-glutamylhydrolase 3 isoform X1 [Solanum lycopersicum]
Length=307

 Score =   230 bits (586),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 136/173 (79%), Gaps = 0/173 (0%)
 Frame = -2

Query  647  DNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESF  468
            DN ILEKFS SNQA+ L  VE +N+E T+F RFP  L++K+ +ECLV+Q+HK+G+SPE F
Sbjct  127  DNNILEKFSVSNQATKLHFVETVNIEDTIFGRFPPTLVKKLSKECLVLQSHKYGLSPEKF  186

Query  467  QADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIPHSEDA  288
            QA+ DLS+FF +LTTS D  NKVYVST++ + YP+ A+QW PE++AFEW  S IPHSEDA
Sbjct  187  QANDDLSSFFIMLTTSTDTRNKVYVSTLKAENYPITALQWHPEKSAFEWGSSAIPHSEDA  246

Query  287  ILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            + V+Q VANYFVSEARKSSN P    V DNLIYNY  +YSGK G G+ EVY+F
Sbjct  247  VQVTQLVANYFVSEARKSSNKPEAQKVLDNLIYNYEPTYSGKIGIGYDEVYVF  299



>ref|NP_001185429.1| gamma-glutamyl hydrolase 2 [Arabidopsis thaliana]
 gb|AEE36138.1| gamma-glutamyl hydrolase 2 [Arabidopsis thaliana]
Length=333

 Score =   231 bits (588),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 135/179 (75%), Gaps = 0/179 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+S++  I EK  A N AS+LQ VE +N++GT+FQRFP ELL+K+G +C
Sbjct  153  AICLGFELLTMIISQNRDIFEKMDARNSASSLQFVENVNIQGTIFQRFPPELLKKLGTDC  212

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH++GISP+SF+ +  LSNFF ++TT +D + KVYVST+Q  KYPV   QW PE+N
Sbjct  213  LVMQNHRFGISPQSFEGNIALSNFFKIVTTCVDDNGKVYVSTVQSTKYPVTGFQWHPEKN  272

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDG  156
            AFEW  S+IPHSEDAI V+Q  AN+ VSEARKS N P    V  NLIYNY  +Y G  G
Sbjct  273  AFEWGSSKIPHSEDAIQVTQHAANHLVSEARKSLNRPESKKVLSNLIYNYKPTYCGYAG  331



>ref|XP_010429696.1| PREDICTED: gamma-glutamyl hydrolase 1-like [Camelina sativa]
Length=347

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 140/189 (74%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             I LGF+L++II+S++  ILE+F A + AS+LQ V+ +N+EGTLFQRFP  LL+K+  +C
Sbjct  153  GICLGFELMSIIISQNRDILERFDAEDNASSLQFVDNVNLEGTLFQRFPPPLLKKLSTDC  212

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQ HK+GI+P +FQ +  LS+FF +LTT +D+++K YVST++ K+YP+   QW PE+N
Sbjct  213  LVMQKHKYGITPANFQGNPALSSFFEILTTCIDENSKTYVSTVKAKRYPITGFQWHPEKN  272

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S IPHSEDAI V+Q  ANY VSEARKS N      V  NLIYNY  +Y G  G 
Sbjct  273  AFEWGSSAIPHSEDAIQVTQHAANYLVSEARKSLNRAPPKKVLSNLIYNYKPTYCGYAGR  332

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  333  GYDEVYIFT  341



>ref|XP_004146022.1| PREDICTED: gamma-glutamyl hydrolase-like [Cucumis sativus]
 gb|KGN55057.1| hypothetical protein Csa_4G626100 [Cucumis sativus]
Length=375

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 143/189 (76%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             + LGF++L++I+S++  ILE F+AS  ASTLQ V+ +N++GT+FQRFP+ LL K+  +C
Sbjct  187  GVCLGFEILSMIISKNRNILEPFNASYMASTLQFVDNVNIQGTVFQRFPHYLLEKLSTDC  246

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            +V QNH +GISPE+F  + +L+ FF +LTTS DKDNKVYVS++Q   YPV A QW PE+N
Sbjct  247  IVFQNHYFGISPETFAQNEELTKFFQILTTSSDKDNKVYVSSVQAWHYPVTAFQWHPEKN  306

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S IPH+E A+ V+Q VANY VSEARKS N P    V +NLIYNY+ ++ GK G 
Sbjct  307  AFEWGYSVIPHTEHAVEVTQHVANYLVSEARKSLNKPPAQKVIENLIYNYSPTFGGKAGK  366

Query  152  GFVEVYIFS  126
            GF EVYIF+
Sbjct  367  GFDEVYIFA  375



>gb|KFK42249.1| hypothetical protein AALP_AA2G230600 [Arabis alpina]
Length=326

 Score =   229 bits (585),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 141/189 (75%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             I LGF+L++II+S++  ILE+F A + AS+LQ VE +N++GTLFQ FP ELL+K+  +C
Sbjct  132  GICLGFELMSIIISQNRDILERFDAEDNASSLQFVENVNIQGTLFQSFPQELLKKISTDC  191

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQ HK+GI+PE+F+ +  LS+FF ++TT +D+++K YVST++ KKYP+   QW PE+N
Sbjct  192  LVMQKHKYGITPENFRGNPALSSFFEIITTCVDENSKTYVSTVKAKKYPITGFQWHPEKN  251

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S IPHSEDAI V+   A+Y VSEAR S N P+   V  NLIYNY  +Y G  G 
Sbjct  252  AFEWGSSAIPHSEDAIQVTLHAASYLVSEARMSKNKPDCKKVLSNLIYNYKPTYCGYAGR  311

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  312  GYDEVYIFT  320



>ref|XP_007021917.1| Gamma-glutamyl hydrolase 1 isoform 2 [Theobroma cacao]
 gb|EOY13442.1| Gamma-glutamyl hydrolase 1 isoform 2 [Theobroma cacao]
Length=358

 Score =   230 bits (587),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -2

Query  650  EDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPES  471
            +D  ILE FSA++QAS+LQ V+ +N+EGT+FQRFP +LL+K+G +CLVMQNH +GISPE 
Sbjct  178  KDRNILESFSAADQASSLQFVKNINIEGTVFQRFPPDLLKKLGADCLVMQNHHYGISPER  237

Query  470  FQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIPHSED  291
             + + +LS+FF +LTTS D +N+VYVST+Q   YPV A QW PE+NAFEW  + IPHSED
Sbjct  238  LRNNPNLSSFFKILTTSTDDNNEVYVSTVQAHGYPVTAFQWHPEKNAFEWGSTMIPHSED  297

Query  290  AILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
            AI V+Q VAN+ +SEARKS N P    V DNLIYNY+ +Y GK G GF EVYIF+
Sbjct  298  AIQVTQHVANFLISEARKSLNRPPPRKVLDNLIYNYSPTYCGKAGKGFDEVYIFT  352



>gb|KFK42250.1| hypothetical protein AALP_AA2G230700 [Arabis alpina]
Length=336

 Score =   229 bits (585),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 137/189 (72%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             I LGF+L+++IVS++  ILE F + N AS+LQ  E +N++GT+FQRFP ELL K+  +C
Sbjct  148  GICLGFELISMIVSQNRDILENFDSENSASSLQFFENVNIQGTVFQRFPPELLTKLSTDC  207

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            L MQNH +GISP  FQ++  LS+FF ++TT +D  NK YVST++  KYP+   QW PE+N
Sbjct  208  LTMQNHYFGISPARFQSNPGLSSFFEIVTTCIDGKNKTYVSTVKATKYPITGFQWHPEKN  267

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S+IPHSEDAI V+Q  A+Y VSEARKS N PN   V  NLIYNY  +Y G  G 
Sbjct  268  AFEWGSSKIPHSEDAIQVTQQAASYLVSEARKSKNRPNSKQVLSNLIYNYKPTYCGYAGR  327

Query  152  GFVEVYIFS  126
            G+ EVYIF+
Sbjct  328  GYDEVYIFT  336



>gb|AFK41094.1| unknown [Medicago truncatula]
Length=340

 Score =   229 bits (584),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 139/188 (74%), Gaps = 0/188 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            A  LGF+L+T+IVSEDN  LE F+A NQAS+LQ VE +N++ ++FQRFP +LL+K+  +C
Sbjct  152  ATCLGFELITMIVSEDNDTLEDFAAENQASSLQFVENVNIKESVFQRFPPDLLKKLSTDC  211

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            +VMQNH++GISP     +  LS+FF +LTTS D+D+KVYVST++ + YPV   QW PE+N
Sbjct  212  IVMQNHQYGISPVKLLGNQKLSSFFEILTTSNDQDDKVYVSTVRSRNYPVTGFQWHPEKN  271

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW    IPH+EDAI  +Q  ANY VSEARKS N P   ++ DNLIYNY  +Y G  G 
Sbjct  272  AFEWGSPSIPHTEDAIRTTQYAANYLVSEARKSLNRPVAQELLDNLIYNYRPTYCGYAGK  331

Query  152  GFVEVYIF  129
            GF EVYIF
Sbjct  332  GFDEVYIF  339



>gb|KHN36904.1| Gamma-glutamyl hydrolase [Glycine soja]
Length=181

 Score =   223 bits (569),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 135/179 (75%), Gaps = 0/179 (0%)
 Frame = -2

Query  662  IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
            +I+S+DN ILE+FSASNQASTLQ VE  N+  ++FQRFP ELL K+  +CLVMQNH++GI
Sbjct  1    MIISQDNNILEEFSASNQASTLQFVENANIGESVFQRFPPELLGKMSTDCLVMQNHRYGI  60

Query  482  SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
            SP     +  LS+FF +LTT  D+D+KVYVST++ + YPV   QW PE+NAFEW    IP
Sbjct  61   SPGKLLNNPKLSSFFEILTTCTDEDDKVYVSTVRSRNYPVTGFQWHPEKNAFEWGSPRIP  120

Query  302  HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
            H+EDAI ++Q VAN+ VSEARKS N P   ++ DNLIYNY+ +Y GK G G+ EVYIF+
Sbjct  121  HTEDAIQITQYVANFLVSEARKSLNRPVAQELLDNLIYNYSPTYCGKAGKGYDEVYIFA  179



>ref|XP_004166066.1| PREDICTED: LOW QUALITY PROTEIN: gamma-glutamyl hydrolase-like 
[Cucumis sativus]
Length=433

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 143/189 (76%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             + LGF++L++I+S++  ILE F+AS  ASTLQ V+ +N++GT+FQRFP+ LL K+  +C
Sbjct  245  GVCLGFEILSMIISKNRNILEPFNASYMASTLQFVDNVNIQGTVFQRFPHYLLEKLSTDC  304

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            +V QNH +GISPE+F  + +L+ FF +LTTS DKDNKVYVS++Q   YPV A QW PE+N
Sbjct  305  IVFQNHYFGISPETFAQNEELTKFFXILTTSSDKDNKVYVSSVQAWHYPVTAFQWHPEKN  364

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW  S IPH+E A+ V+Q VANY VSEARKS N P    V +NLIYNY+ ++ GK G 
Sbjct  365  AFEWGYSVIPHTEHAVEVTQHVANYLVSEARKSLNKPPAQKVIENLIYNYSPTFGGKAGK  424

Query  152  GFVEVYIFS  126
            GF EVYIF+
Sbjct  425  GFDEVYIFA  433



>ref|XP_009406770.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=355

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 137/189 (72%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+L+++I+S D  I E+F   NQASTL   +   ++G++F+RFP ELL K+  EC
Sbjct  167  AICLGFELVSMIISNDCDICERFKGENQASTLYFPDYAEIKGSVFERFPLELLWKLSTEC  226

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            L MQNHK+G+SP+  Q +  LS+FF +LTTS D++ K YVST Q   YPV   QW PE+N
Sbjct  227  LAMQNHKYGLSPKRLQDNVALSSFFRILTTSKDENGKDYVSTAQAYNYPVTGFQWHPEKN  286

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW LS IPHSEDA+ V+Q VANY +SEARKSSN P    V DNLIYNY+ +Y GK G 
Sbjct  287  AFEWGLSMIPHSEDAVRVTQHVANYLISEARKSSNRPPTEKVLDNLIYNYSPTYCGKAGR  346

Query  152  GFVEVYIFS  126
            G+ EVYIFS
Sbjct  347  GYDEVYIFS  355



>ref|XP_009406768.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=376

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 137/189 (72%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+L+++I+S D  I E+F   NQASTL   +   ++G++F+RFP ELL K+  EC
Sbjct  188  AICLGFELVSMIISNDCDICERFKGENQASTLYFPDYAEIKGSVFERFPLELLWKLSTEC  247

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            L MQNHK+G+SP+  Q +  LS+FF +LTTS D++ K YVST Q   YPV   QW PE+N
Sbjct  248  LAMQNHKYGLSPKRLQDNVALSSFFRILTTSKDENGKDYVSTAQAYNYPVTGFQWHPEKN  307

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW LS IPHSEDA+ V+Q VANY +SEARKSSN P    V DNLIYNY+ +Y GK G 
Sbjct  308  AFEWGLSMIPHSEDAVRVTQHVANYLISEARKSSNRPPTEKVLDNLIYNYSPTYCGKAGR  367

Query  152  GFVEVYIFS  126
            G+ EVYIFS
Sbjct  368  GYDEVYIFS  376



>ref|XP_009406769.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=376

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 137/189 (72%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+L+++I+S D  I E+F   NQASTL   +   ++G++F+RFP ELL K+  EC
Sbjct  188  AICLGFELVSMIISNDCDICERFKGENQASTLYFPDYAEIKGSVFERFPLELLWKLSTEC  247

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            L MQNHK+G+SP+  Q +  LS+FF +LTTS D++ + YVST Q   YPV   QW PE+N
Sbjct  248  LAMQNHKYGLSPKRLQDNVALSSFFRILTTSKDENVQDYVSTAQAYNYPVTGFQWHPEKN  307

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            AFEW LS IPHSEDA+ V+Q VANY +SEARKSSN P    V DNLIYNY+ +Y GK G 
Sbjct  308  AFEWGLSMIPHSEDAVRVTQHVANYLISEARKSSNRPPTEKVLDNLIYNYSPTYCGKAGR  367

Query  152  GFVEVYIFS  126
            G+ EVYIFS
Sbjct  368  GYDEVYIFS  376



>ref|XP_003568092.2| PREDICTED: gamma-glutamyl hydrolase 2-like [Brachypodium distachyon]
Length=352

 Score =   225 bits (573),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 140/186 (75%), Gaps = 0/186 (0%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+L+++IVS+DN ILE FSASNQASTLQ     ++EG++F+RF  +L++K+   CLVM
Sbjct  167  LGFELISMIVSKDNNILESFSASNQASTLQFPNYSSLEGSVFERFHPDLIKKLSTSCLVM  226

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
            QNHK+GISP+  + +  LS+FF +LTTS D++ +VYVST+Q +KYP+   QW PE+  FE
Sbjct  227  QNHKYGISPKRLRENGALSSFFRILTTSPDENGEVYVSTVQAQKYPITCTQWHPEKAIFE  286

Query  323  WALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFV  144
            W    IPHSEDA+ V+Q+ ANYFVS+ARKS N P    V DNLIYNY+ ++SGK    F 
Sbjct  287  WGKPMIPHSEDAVQVTQNFANYFVSQARKSPNRPPADKVLDNLIYNYSPTFSGKTSKSFD  346

Query  143  EVYIFS  126
            EVYIFS
Sbjct  347  EVYIFS  352



>ref|XP_008359366.1| PREDICTED: LOW QUALITY PROTEIN: gamma-glutamyl hydrolase 1-like 
[Malus domestica]
Length=183

 Score =   216 bits (549),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 125/171 (73%), Gaps = 0/171 (0%)
 Frame = -2

Query  638  ILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQAD  459
            ILE FSA + ASTLQ      +EGT+FQRFP +LLRK+  +CLVMQNHK+GISPE    +
Sbjct  6    ILESFSAVDVASTLQFTVNTIIEGTVFQRFPPDLLRKLSTDCLVMQNHKYGISPERLMDN  65

Query  458  ADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIPHSEDAILV  279
             +LS+FF +LTT  D+D+KVYVST     YPV A QW PE+NAFEW L  IPHSEDAI V
Sbjct  66   ENLSSFFKILTTCTDEDDKVYVSTAHAYNYPVTAFQWHPEKNAFEWGLPMIPHSEDAIQV  125

Query  278  SQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
            +Q VAN+ VSEARKS N P    V DNLIYNY+ ++ GK G G+ EVYIF+
Sbjct  126  TQHVANFLVSEARKSLNRPPVGQVLDNLIYNYSPTFCGKAGKGYDEVYIFT  176



>ref|XP_004961495.1| PREDICTED: gamma-glutamyl hydrolase-like [Setaria italica]
Length=346

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 137/186 (74%), Gaps = 1/186 (1%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+L+++IVS+DN ILE F A NQASTLQ     + EGT+FQRF  +L++KV   CLVM
Sbjct  162  LGFELVSMIVSKDNNILEMFDAQNQASTLQF-PSYSFEGTVFQRFDSDLIKKVSTSCLVM  220

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
            QNH++GISP+ F+ + +LS+FF +LTTS D++ KVYVST+Q  KYP+   QW PE+  FE
Sbjct  221  QNHRYGISPKRFRENGELSSFFRILTTSPDENGKVYVSTVQANKYPITCTQWHPEKAIFE  280

Query  323  WALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFV  144
            W    IPHSE+A+ V+Q  AN+F+S+ARKS N P    V DNLIYNY+ ++SGK    F 
Sbjct  281  WRKPMIPHSEEAVQVTQHFANHFISQARKSPNRPPADKVLDNLIYNYSPTFSGKTSKSFE  340

Query  143  EVYIFS  126
            EVYIFS
Sbjct  341  EVYIFS  346



>gb|EYU29531.1| hypothetical protein MIMGU_mgv1a009742mg [Erythranthe guttata]
Length=333

 Score =   219 bits (558),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 140/192 (73%), Gaps = 3/192 (2%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            A+ LGF+LL +IVS+D  ILE+FSA +  STL     +N+ GT F+RFP  LL+K+ +E 
Sbjct  142  AVCLGFELLAMIVSKDKNILEEFSAIDYPSTLMFPRNINLNGTAFERFPPYLLQKMAKEN  201

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            +VM++H++GISPE F  + +LSNFF ++TTS  K+ K+YVST+Q +KYPV   QW PE+N
Sbjct  202  IVMEHHQYGISPEKFHKNKNLSNFFKIVTTSTCKNRKIYVSTVQARKYPVTGFQWHPEKN  261

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            A+EW L  IPHSE AI V+Q+ AN+FV E+RKSSN P+  +V D LIYNY  +Y GK G 
Sbjct  262  AYEWGLPGIPHSESAIQVTQNAANFFVRESRKSSNRPSNGEVLDKLIYNYKPTYCGKAGR  321

Query  152  GFV---EVYIFS  126
            GF    +VYIFS
Sbjct  322  GFESFDQVYIFS  333



>ref|XP_006655488.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Oryza brachyantha]
Length=320

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 140/186 (75%), Gaps = 0/186 (0%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+L+++I+S+DN ILE FSA NQASTLQ     ++EG++F+RF  +L++K+   CLVM
Sbjct  135  LGFELVSMIISKDNNILETFSAENQASTLQFPNYSSLEGSVFERFDPDLIKKLSTSCLVM  194

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
            QNH++GISP++ + +A LS+FF +LTTS D++ +VYVST+Q  KYP+   QW PE+  FE
Sbjct  195  QNHRYGISPKTLRENAALSSFFKILTTSPDENGEVYVSTVQANKYPITCTQWHPEKAIFE  254

Query  323  WALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFV  144
            +    IPHSEDA+ V+Q+ ANYF+S+ARKS N P    V DNLIYNY+ +++GK    F 
Sbjct  255  FGKPMIPHSEDAVQVTQNFANYFISQARKSPNRPPADKVLDNLIYNYSPTFTGKKSKSFD  314

Query  143  EVYIFS  126
            EVYIFS
Sbjct  315  EVYIFS  320



>ref|XP_006833066.1| hypothetical protein AMTR_s00170p00050820, partial [Amborella 
trichopoda]
 gb|ERM98344.1| hypothetical protein AMTR_s00170p00050820, partial [Amborella 
trichopoda]
Length=372

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 134/179 (75%), Gaps = 0/179 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI L F+L++IIVS+D  I E++SA +  STLQ  + + +  T+F+RF  ELL+KV  EC
Sbjct  194  AICLNFELISIIVSQDRSIFERYSALDLPSTLQFKQNIELNNTVFRRFSSELLKKVSTEC  253

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            L+MQ+H++G+SPE+F+++  LSNFF +LTT  DK+ KVYVST Q  +YP+   QW PE+N
Sbjct  254  LIMQSHRFGVSPETFESNHALSNFFKILTTCADKNGKVYVSTTQAYRYPIFGFQWHPEKN  313

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDG  156
            AFEW L  IPHSEDA+ V+Q VAN+F+SEARKSSN P    V DNLIYN++ +Y GK G
Sbjct  314  AFEWGLPNIPHSEDAVQVTQHVANFFISEARKSSNRPPTTRVLDNLIYNHSPTYCGKAG  372



>ref|XP_004489008.1| PREDICTED: gamma-glutamyl hydrolase-like [Cicer arietinum]
Length=327

 Score =   216 bits (549),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 135/179 (75%), Gaps = 0/179 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+L+T+I+S D  ILE+F A +QASTLQ VE  N+EGT+FQRFP +LL+K+  +C
Sbjct  149  AICLGFELITMIISGDKNILEEFKAQDQASTLQFVENANLEGTVFQRFPPDLLKKLSTDC  208

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            L  QNH +G+SP  F A+ +LS+FF +LTTS D+++KVYVSTI+ +KYPV   QW PE+N
Sbjct  209  LARQNHAYGVSPTKFLANQNLSSFFEILTTSNDEEDKVYVSTIRSRKYPVTGFQWHPEKN  268

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDG  156
             F W+   IPH+EDAI  +Q VAN+ VSEARKS   P+  ++ DNLIYNY+ ++ GK G
Sbjct  269  PFGWSSPTIPHTEDAIQTTQYVANFLVSEARKSLTRPDAQELIDNLIYNYSPTFYGKAG  327



>ref|XP_011082781.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Sesamum indicum]
Length=326

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 132/179 (74%), Gaps = 0/179 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LL +IV++D  ILE+F++ +  S L     LN+ GT+F+RFP  LL+K+  +C
Sbjct  148  AICLGFELLAMIVAKDRSILEEFNSKDDPSPLHFKRHLNIHGTVFERFPPLLLKKLTVDC  207

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVM++H+ GISPE F+ + +L +FF +LTTS  KDNK YVST+Q ++YP+ A QW PE+N
Sbjct  208  LVMEHHRHGISPERFRKNKNLKSFFKILTTSTCKDNKTYVSTVQARRYPMTAFQWHPEKN  267

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDG  156
            AFEW   +IPHSEDA+ V+Q+VAN+ V EARKS N P+  DV DNLIY Y  +Y GK G
Sbjct  268  AFEWGSPKIPHSEDAVQVTQNVANFLVREARKSVNRPSSVDVLDNLIYKYKPTYCGKAG  326



>ref|XP_006389966.1| hypothetical protein EUTSA_v10018738mg [Eutrema salsugineum]
 gb|ESQ27252.1| hypothetical protein EUTSA_v10018738mg [Eutrema salsugineum]
Length=371

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 129/171 (75%), Gaps = 0/171 (0%)
 Frame = -2

Query  638  ILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQAD  459
            ILE+F A + AS+LQ VE +N++GTLFQRFP ELL+K+  +CLVMQ HK+GI+P +F+ +
Sbjct  195  ILERFDAEDNASSLQFVENVNIQGTLFQRFPPELLKKLSTDCLVMQKHKYGITPANFRGN  254

Query  458  ADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIPHSEDAILV  279
              LS+FF ++TT +D+++K YVST++ K+YP+   QW PE+NAFEW  S+IPHSEDAI V
Sbjct  255  PALSSFFEIITTCVDENSKTYVSTVKAKRYPITGFQWHPEKNAFEWGSSQIPHSEDAIQV  314

Query  278  SQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
            +Q  A+Y VSEARKS N P    V  NLIYNY  +Y G  G G+ EVY+F+
Sbjct  315  TQHAASYLVSEARKSKNRPESKKVLSNLIYNYKPTYCGYAGRGYDEVYLFT  365



>ref|XP_002441386.1| hypothetical protein SORBIDRAFT_09g025690 [Sorghum bicolor]
 gb|EES19816.1| hypothetical protein SORBIDRAFT_09g025690 [Sorghum bicolor]
Length=342

 Score =   213 bits (542),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 134/186 (72%), Gaps = 1/186 (1%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+L+++IVS+DN ILE F A NQASTLQ      +EG++FQRF   L++KV   CLVM
Sbjct  158  LGFELISMIVSKDNNILETFDAQNQASTLQF-PSYALEGSVFQRFDPALIKKVSTSCLVM  216

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
            QNH++GISP  ++ +  LS+FF +LTTS D++ KVYVST+Q   YP+ + QW PE+  FE
Sbjct  217  QNHRYGISPRRYRENDALSSFFKILTTSPDENGKVYVSTVQAYNYPITSTQWHPEKAIFE  276

Query  323  WALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFV  144
            W    IPHSEDA+ V+Q  AN+F+S+ARKS N P    V DNLIYNY+ ++SGK    F 
Sbjct  277  WRKPMIPHSEDAVQVTQHFANHFISQARKSPNRPPADKVLDNLIYNYSPTFSGKKSKSFE  336

Query  143  EVYIFS  126
            EVYIF+
Sbjct  337  EVYIFA  342



>ref|NP_001056052.1| Os05g0517500 [Oryza sativa Japonica Group]
 gb|AAT01320.1| putative gamma-glutamyl hydrolase [Oryza sativa Japonica Group]
 dbj|BAF17966.1| Os05g0517500 [Oryza sativa Japonica Group]
 dbj|BAG89432.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79535.1| hypothetical protein OsI_20640 [Oryza sativa Indica Group]
 gb|EEE64372.1| hypothetical protein OsJ_19214 [Oryza sativa Japonica Group]
Length=337

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 138/186 (74%), Gaps = 0/186 (0%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+L+++IVS+DN ILE FSA+NQASTLQ     ++EG++F+RF  +L++K+   CLVM
Sbjct  152  LGFELVSMIVSKDNNILESFSATNQASTLQFPNYSSLEGSVFERFDPDLIKKLSTSCLVM  211

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
            QNHK+GISP++ + +  LS+FF +LTTS D++ +VYVST+Q  KYP+   QW PE+  FE
Sbjct  212  QNHKYGISPKTLRENVALSSFFKILTTSPDENGEVYVSTVQANKYPITCTQWHPEKAIFE  271

Query  323  WALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFV  144
            +    IPHSE+A+ V+Q+ ANYF+S+ARKS N P    V DNLIYNY+ ++ GK    F 
Sbjct  272  FGKQMIPHSEEAVQVTQNFANYFISQARKSQNRPPADKVLDNLIYNYSPTFIGKKSKSFD  331

Query  143  EVYIFS  126
             VYIFS
Sbjct  332  VVYIFS  337



>dbj|BAJ93186.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=336

 Score =   212 bits (539),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 136/186 (73%), Gaps = 0/186 (0%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+L+++IVS+DN ILE F AS+QASTLQ     +++G++F+RF  +L+RK+   CLVM
Sbjct  151  LGFELVSMIVSKDNNILESFHASDQASTLQFPNYSSLQGSVFERFHPDLIRKLSTSCLVM  210

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
            QNHK+GISP+  + +  LS+FF +LTTS D++ +VYVST++ +KYP+   QW PE+  FE
Sbjct  211  QNHKYGISPKRLRENDALSSFFKILTTSPDENGEVYVSTVEAQKYPITCTQWHPEKAIFE  270

Query  323  WALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFV  144
            W    IPHSEDA+ V+Q  ANYF+S+ARKS N P    V DNLIYNY  ++SGK    F 
Sbjct  271  WRKPMIPHSEDAVQVTQHFANYFISQARKSPNRPPADKVLDNLIYNYIPTFSGKTSKSFE  330

Query  143  EVYIFS  126
             VY+FS
Sbjct  331  LVYLFS  336



>gb|ACG46729.1| gamma-glutamyl hydrolase precursor [Zea mays]
Length=342

 Score =   211 bits (537),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 134/186 (72%), Gaps = 1/186 (1%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+L+++IVS+DN ILE F A +QASTLQ      +EG++FQRF  +L++KV   CLVM
Sbjct  158  LGFELVSMIVSKDNNILEAFDALDQASTLQF-PSYALEGSVFQRFDTDLIKKVSTNCLVM  216

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
            QNH++GISP  ++ +  LS+FF +LTTS D++ KVYVST+Q   YP+   QW PE+  FE
Sbjct  217  QNHRYGISPRRYRENDALSSFFKILTTSPDENGKVYVSTVQANNYPITCTQWHPEKAIFE  276

Query  323  WALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFV  144
            W    IPHSEDA+ V+Q  AN+F+S+ARKS N P    V DNLIYNY+ +++GK    F 
Sbjct  277  WRKPMIPHSEDAVQVTQHFANHFISQARKSPNRPPADKVLDNLIYNYSPTFTGKKSKSFE  336

Query  143  EVYIFS  126
            EVYIFS
Sbjct  337  EVYIFS  342



>gb|EYU26311.1| hypothetical protein MIMGU_mgv1a022410mg [Erythranthe guttata]
Length=393

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 137/189 (72%), Gaps = 3/189 (2%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+L+T+IVSE   ILE F A N ASTL+++  ++V+ TLFQ FP +LL+K+ +E 
Sbjct  208  AICLGFELITMIVSEKKNILETFDAKNHASTLKIMGNIDVKETLFQSFPPDLLKKLSKER  267

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH++GISP+ F  +  L  FFN+LT + D+  ++YVST+Q  KYPV  VQW PE+N
Sbjct  268  LVMQNHRYGISPKKFVKNDKLRGFFNILTITEDRKKQLYVSTVQAHKYPVTGVQWHPEKN  327

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            A++ +LS  P S+DA+ V++ VAN+FV EAR S N P+   V DNLIYNY+ +Y GK G 
Sbjct  328  AYDQSLSATPRSKDAVKVTKYVANFFVREARMSKNRPSTRKVLDNLIYNYSPTYCGKAGK  387

Query  152  GFVEVYIFS  126
               EVYIFS
Sbjct  388  ---EVYIFS  393



>ref|XP_006593481.1| PREDICTED: gamma-glutamyl hydrolase isoform X1 [Glycine max]
Length=342

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 134/189 (71%), Gaps = 1/189 (1%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            A NLG  L+  IVSE   ILE F+AS+  S+L + +  N +G+LFQRFP +LL ++  +C
Sbjct  153  AFNLGGNLVIRIVSEQTDILEPFTASSLPSSLVLWKEANAKGSLFQRFPSDLLTQLKTDC  212

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LV+ NH++ ISP   Q +  LS+FF +L TS D+D K +VST +G+KYPV    W PE+N
Sbjct  213  LVLHNHRYAISPRKLQYNTKLSDFFEILATSEDRDGKTFVSTARGRKYPVTVNLWQPEKN  272

Query  332  AFEWALS-EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDG  156
            AFEWA S + PH+EDAI V+QS AN+F+SEARKS+N P+   VRDNLIYNY  ++ G  G
Sbjct  273  AFEWATSLKAPHTEDAIRVTQSTANFFISEARKSTNTPDAQKVRDNLIYNYKPTFGGTAG  332

Query  155  SGFVEVYIF  129
             G+ +VY+F
Sbjct  333  KGYDQVYLF  341



>gb|KHN36905.1| Gamma-glutamyl hydrolase [Glycine soja]
Length=346

 Score =   209 bits (531),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 134/189 (71%), Gaps = 1/189 (1%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            A NLG  L+  IVSE   ILE F+AS+  S+L + +  N +G+LFQRFP +LL ++  +C
Sbjct  157  AFNLGGNLVIRIVSEQTDILEPFTASSLPSSLILWKEANAKGSLFQRFPSDLLTQLKTDC  216

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LV+ NH++ ISP   Q +  LS+FF +L TS D+D K +VST +G+KYPV    W PE+N
Sbjct  217  LVLHNHRYAISPRKLQYNTKLSDFFEILATSEDRDGKTFVSTARGRKYPVTVNLWQPEKN  276

Query  332  AFEWALS-EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDG  156
            AFEWA S + PH+EDAI V+QS AN+F+SEARKS+N P+   VRDNLIYNY  ++ G  G
Sbjct  277  AFEWATSLKAPHTEDAIRVTQSTANFFISEARKSTNTPDAQKVRDNLIYNYKPTFGGTAG  336

Query  155  SGFVEVYIF  129
             G+ +VY+F
Sbjct  337  KGYDQVYLF  345



>ref|NP_001235549.1| gamma-glutamyl hydrolase precursor [Glycine max]
 sp|P93164.1|GGH_SOYBN RecName: Full=Gamma-glutamyl hydrolase; AltName: Full=Conjugase; 
AltName: Full=GH; AltName: Full=Gamma-Glu-X carboxypeptidase; 
Flags: Precursor [Glycine max]
 gb|AAB26960.1| gamma glutamyl hydrolase [Glycine max]
Length=342

 Score =   206 bits (524),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 133/189 (70%), Gaps = 1/189 (1%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            A NLG  L+  IVSE   ILE F+AS+  S+L +    N +G+LFQRFP +LL ++  +C
Sbjct  153  AFNLGGNLVIRIVSEQTDILEPFTASSLPSSLVLWNEANAKGSLFQRFPSDLLTQLKTDC  212

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LV+ NH++ ISP   Q +  LS+FF +L TS D+D K +VST +G+KYPV    W PE+N
Sbjct  213  LVLHNHRYAISPRKLQYNTKLSDFFEILATSGDRDGKTFVSTARGRKYPVTVNLWQPEKN  272

Query  332  AFEWALS-EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDG  156
            AFEWA S + PH+EDAI V+QS AN+F+SEARKS+N P+   VRD+LIYNY  ++ G  G
Sbjct  273  AFEWATSLKAPHTEDAIRVTQSTANFFISEARKSTNTPDAQKVRDSLIYNYKPTFGGTAG  332

Query  155  SGFVEVYIF  129
             G+ +VY+F
Sbjct  333  KGYDQVYLF  341



>ref|XP_002441385.1| hypothetical protein SORBIDRAFT_09g025680 [Sorghum bicolor]
 gb|EES19815.1| hypothetical protein SORBIDRAFT_09g025680 [Sorghum bicolor]
Length=344

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 130/186 (70%), Gaps = 3/186 (2%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+L+++IVS+DN ILEKF A NQASTLQ     + EG++FQRF  +L++KV   CLVM
Sbjct  162  LGFELVSMIVSKDNNILEKFDALNQASTLQF-PSYDFEGSVFQRFDPDLIKKVSTSCLVM  220

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
            Q H++GISP   Q    LS+FF +LTTS D++ KVYVST+Q  KYP+   QW PE+  FE
Sbjct  221  QQHRYGISPRRLQEKDALSSFFKILTTSPDENGKVYVSTVQAHKYPITCTQWHPEKAIFE  280

Query  323  WALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFV  144
            W    IPHS+DA+ V+Q  AN+F+S+ARKS N P    V D LIYNY  S +GK    F 
Sbjct  281  WRNPVIPHSKDAVQVTQHFANHFISQARKSPNRPPADKVLDYLIYNY--SPTGKKLKSFE  338

Query  143  EVYIFS  126
            EVY+FS
Sbjct  339  EVYVFS  344



>ref|XP_011460803.1| PREDICTED: gamma-glutamyl hydrolase 2 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=397

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+S++  ILE FSA++ ASTLQ  E +N+EGT+FQRFP +LLRK+  +C
Sbjct  193  AICLGFELLTMIISKNKKILESFSAADMASTLQFTENMNIEGTVFQRFPPDLLRKLSTDC  252

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            +VMQNH +GISPE+ Q + DLS+FF +LTTS D+D+KVYVST+    YPV A QW PE+N
Sbjct  253  IVMQNHHYGISPETLQQNPDLSSFFKILTTSTDEDDKVYVSTVHAYHYPVTAFQWHPEKN  312

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVS  249
            AFEW L  IPHSEDAI V+Q +AN+ VS
Sbjct  313  AFEWGLQMIPHSEDAIQVTQHIANFLVS  340



>ref|XP_006442394.1| hypothetical protein CICLE_v10020872mg [Citrus clementina]
 gb|ESR55634.1| hypothetical protein CICLE_v10020872mg [Citrus clementina]
Length=321

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 116/144 (81%), Gaps = 0/144 (0%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+LLT+I+ +D  ILE F+A++QASTLQ +E  ++EGT+FQRFP +L++K+  +CLVM
Sbjct  163  LGFELLTMIIGKDKNILESFNAADQASTLQFIENTSIEGTVFQRFPPQLIKKLSTDCLVM  222

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
            QNH +GISPE+ + + DLS FF +LTTS D+DNKVYVST+Q   YPV A QW PE+NAFE
Sbjct  223  QNHHYGISPETLRKNLDLSRFFKMLTTSADEDNKVYVSTVQAYDYPVTAFQWHPEKNAFE  282

Query  323  WALSEIPHSEDAILVSQSVANYFV  252
            W  S IPHSEDAI V+Q VANYF+
Sbjct  283  WGSSAIPHSEDAIEVTQHVANYFI  306



>gb|EMT14979.1| Gamma-glutamyl hydrolase [Aegilops tauschii]
Length=279

 Score =   196 bits (497),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 136/206 (66%), Gaps = 20/206 (10%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+L+++IVS+DN ILE F AS+QASTLQ     +++G++F+RF  +L++K+   CLVM
Sbjct  74   LGFELVSMIVSKDNNILESFHASDQASTLQFPNYSSLQGSVFERFHPDLIKKLSTSCLVM  133

Query  503  QNHK--------------------WGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTI  384
            QNHK                    +GISP+  + +  LS+FF +LT S D++ +VYVST+
Sbjct  134  QNHKNNYLYLLVFPNMVYFLNWSKYGISPKRLRENDALSSFFKILTISPDENGEVYVSTV  193

Query  383  QGKKYPVVAVQWAPERNAFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVR  204
            + +KYP+   QW PE+  FEW    IPHSEDA+ V+Q+ ANYF+S+ARKS N P    V 
Sbjct  194  EAQKYPITCTQWHPEKAIFEWRKPMIPHSEDAVQVTQNFANYFISQARKSPNRPPADKVL  253

Query  203  DNLIYNYNTSYSGKDGSGFVEVYIFS  126
            DNLIYNY  ++SGK    F  VY+FS
Sbjct  254  DNLIYNYIPTFSGKTSKSFELVYLFS  279



>ref|XP_007149561.1| hypothetical protein PHAVU_005G080600g [Phaseolus vulgaris]
 gb|ESW21555.1| hypothetical protein PHAVU_005G080600g [Phaseolus vulgaris]
Length=346

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 128/178 (72%), Gaps = 1/178 (1%)
 Frame = -2

Query  659  IVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGIS  480
            IV++   +LE F+AS+  S LQ+    N EG+L+QRFP +LL  +  E LV+ NHK+ I+
Sbjct  168  IVADQGDVLETFNASSLLSYLQLWSSANDEGSLYQRFPSDLLSLLSIETLVLHNHKYAIT  227

Query  479  PESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS-EIP  303
            P   Q + +L NFF++L TS D+D+K++V+T +GK YPV    W PE+NAFEWA S + P
Sbjct  228  PRKLQYNRNLGNFFDILATSTDRDDKIFVTTARGKNYPVTVNLWQPEKNAFEWATSLKAP  287

Query  302  HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            H+E+A+ V+QS AN+FVSEARKSSN PN  +VRDNLIYNY  +Y G  G G+ +VY+F
Sbjct  288  HTENAVRVTQSTANFFVSEARKSSNKPNAQEVRDNLIYNYQPTYGGAAGKGYDQVYLF  345



>gb|ABK22567.1| unknown [Picea sitchensis]
Length=334

 Score =   194 bits (494),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 130/189 (69%), Gaps = 0/189 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            A+ LGF++L++IVS+D  ILE+F A+N  STL          ++F+ F   +L K+  E 
Sbjct  146  AVCLGFEILSMIVSKDLNILERFDAANHPSTLFFESDAAKNTSIFKWFQPHILSKMSSEP  205

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            L+ QNH +GISPE   A++ LS+FF +LTTS DK+NK YVSTI+  KYPV AVQW PE+N
Sbjct  206  LLFQNHMFGISPERMSANSGLSSFFKILTTSCDKNNKTYVSTIEAYKYPVTAVQWHPEKN  265

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
             FEW +  IPHS DAI V+QSVAN+ +SEARKSS+        + LIYNY  +YSGK G 
Sbjct  266  TFEWEIPTIPHSADAIQVTQSVANFVISEARKSSHRATFQQEEEYLIYNYFPAYSGKVGG  325

Query  152  GFVEVYIFS  126
             F +VY+F+
Sbjct  326  SFDQVYLFT  334



>gb|KGN55059.1| hypothetical protein Csa_4G627100 [Cucumis sativus]
Length=355

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 131/188 (70%), Gaps = 0/188 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             I+LGFQ+++ +VS+   I+  F+AS   S L+  +  N+ GT+F+R P  L  +  E+C
Sbjct  167  GISLGFQIISAMVSQRYGIIVPFNASRFPSALKFNDFANIRGTVFERVPLSLRIRATEDC  226

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            +  ++H +GISPE+F+ D  LS+FF +LTTS+DKDNKVYVST   + YP+   QW PE+N
Sbjct  227  ITWEDHGYGISPETFEQDERLSDFFQILTTSVDKDNKVYVSTANARNYPITIFQWNPEKN  286

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            ++EW +S IPH+E AI ++  +A++ VSEAR+S+N P +  V + LIYNY   Y+GK G 
Sbjct  287  SYEWGISSIPHTEYAIELTHHIAHHLVSEARRSTNQPPKEKVLEKLIYNYTPIYNGKAGK  346

Query  152  GFVEVYIF  129
            G+ +VY+F
Sbjct  347  GYDQVYLF  354



>ref|XP_006302530.1| hypothetical protein CARUB_v10020631mg [Capsella rubella]
 gb|EOA35428.1| hypothetical protein CARUB_v10020631mg [Capsella rubella]
Length=302

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 116/147 (79%), Gaps = 0/147 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             I LGF+L++II+S++  ILE+F A + AS+LQ V+ +N++GTLFQRFP +LL+K+  +C
Sbjct  155  GICLGFELMSIIISQNRDILERFDAEDNASSLQFVDNVNLDGTLFQRFPPQLLKKLSTDC  214

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQ HK+GI+P +FQ +  LS+FF +LTT +D+++K YVST++ KKYP+   QW PE+N
Sbjct  215  LVMQKHKYGITPANFQGNPALSSFFEILTTCIDENSKTYVSTVKAKKYPITGFQWHPEKN  274

Query  332  AFEWALSEIPHSEDAILVSQSVANYFV  252
            AFEW  SEIPHSEDAI V+Q  A+Y V
Sbjct  275  AFEWGSSEIPHSEDAIQVTQHAASYLV  301



>gb|EYU26304.1| hypothetical protein MIMGU_mgv1a019206mg, partial [Erythranthe 
guttata]
Length=330

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 110/147 (75%), Gaps = 3/147 (2%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT++VSE   ILEKF A NQA+TL   + ++V G LFQRFP  L  K+  +C
Sbjct  187  AICLGFELLTMVVSEKKNILEKFDALNQATTL---DNIDVNGNLFQRFPEVLRNKLSTKC  243

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH +GISP  F+ D  L +FF +L TS DK  K YVST+Q +KYPV AVQW PE+N
Sbjct  244  LVMQNHSYGISPAKFRRDKRLDSFFKILATSRDKKGKDYVSTVQARKYPVTAVQWHPEKN  303

Query  332  AFEWALSEIPHSEDAILVSQSVANYFV  252
            AFEW LSEIPHSEDA+ V+Q VAN+FV
Sbjct  304  AFEWGLSEIPHSEDAVQVTQHVANFFV  330



>gb|EYU26310.1| hypothetical protein MIMGU_mgv1a022815mg [Erythranthe guttata]
Length=333

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 123/189 (65%), Gaps = 11/189 (6%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LL ++VSE+  ILEKF A NQASTL+  + +N+ GTLFQ FP +LL K+  +C
Sbjct  156  AICLGFELLAMVVSENKNILEKFDAKNQASTLKFTKNINLNGTLFQSFPPDLLEKLSTKC  215

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            L  QNH +GISPE F+    L  FF +LTTS DK NK YVST+Q  KYPV AVQW PE+ 
Sbjct  216  LAKQNHSYGISPEKFRKTKSLRRFFKILTTSADKKNKDYVSTVQAHKYPVTAVQWHPEKI  275

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            A++  LS        + VS+ VAN+FV EAR S N P+   V+ NLI N   +  G  G 
Sbjct  276  AYDSGLS--------VQVSKQVANFFVREARMSKNRPSSRKVQANLIRNCRHTIRGNAGK  327

Query  152  GFVEVYIFS  126
               EVYIFS
Sbjct  328  ---EVYIFS  333



>ref|XP_001772336.1| predicted protein [Physcomitrella patens]
 gb|EDQ62807.1| predicted protein [Physcomitrella patens]
Length=304

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 133/191 (70%), Gaps = 2/191 (1%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             + LGF+LL+IIVS+++ ILE+F A N    L  V       ++FQ  P  ++ ++ ++ 
Sbjct  114  GVCLGFELLSIIVSKNHYILERFEAENNPGPLLFVGDSAKHQSMFQWIPLRIIDELNDQK  173

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            L MQNHKWG+SPE + +  +L+NFF +LT + D + K+YVST++ +KYP++ VQW PE+N
Sbjct  174  LAMQNHKWGLSPEKWISTPELNNFFQILTVTPDLNEKLYVSTVEARKYPILGVQWHPEKN  233

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVP-NEPDVRDNLIYNYNTSYSGKDG  156
            A+EW +  IPHS DAI V+QSVANY ++EARKSS+ P +  + +  LIYNY+  Y+ KDG
Sbjct  234  AYEWGVDNIPHSADAIGVTQSVANYLIAEARKSSHKPASYEEEQAFLIYNYDPVYTSKDG  293

Query  155  SG-FVEVYIFS  126
             G F + Y+F+
Sbjct  294  KGVFDQAYVFN  304



>ref|XP_004146090.1| PREDICTED: gamma-glutamyl hydrolase-like [Cucumis sativus]
Length=362

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 126/179 (70%), Gaps = 0/179 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             I+LGFQ+++ +VS+ N I+E F+A+   S L+  +  N+ GT+ QR P  L  +  ++C
Sbjct  184  GISLGFQIISAMVSQRNDIIETFNATRFPSALKFNDFANIRGTVIQRVPLSLRIRTTKDC  243

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            +  +NHK+GISPE+F+ D  LS+FF +LTTS+DK+NKVYVST   + YP+   QW PE+N
Sbjct  244  ITWENHKYGISPETFEQDERLSDFFQILTTSVDKNNKVYVSTANARNYPITIFQWNPEKN  303

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDG  156
            ++EW +S IPH+E AI ++  +A++ VSEAR+S+N P +  V + LIYNY   Y+GK G
Sbjct  304  SYEWGISSIPHTEYAIELTHHIAHHLVSEARRSTNQPPKEKVLEKLIYNYTPIYNGKAG  362



>ref|XP_002441384.1| hypothetical protein SORBIDRAFT_09g025670 [Sorghum bicolor]
 gb|EES19814.1| hypothetical protein SORBIDRAFT_09g025670 [Sorghum bicolor]
Length=388

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 121/182 (66%), Gaps = 10/182 (5%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQ----------RFPYELL  534
            LGF+L+++IVS+DN ILE F A NQ STLQ      ++G++FQ          RF  EL+
Sbjct  205  LGFELISMIVSKDNNILESFHALNQTSTLQFPNYSFLKGSVFQSLTTEMIEIHRFNPELI  264

Query  533  RKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAV  354
            +K+  +CLVMQNH +GISP+  Q +  LS+FF +LTTS D++ KVYVST+Q + YP++  
Sbjct  265  KKLSTDCLVMQNHGYGISPKRLQENVALSSFFKILTTSPDENGKVYVSTVQAQNYPIICT  324

Query  353  QWAPERNAFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTS  174
            QW PE+  FEW     PHSEDA+ V+Q  ANYFVS+ARKS N      V +NLI NY+  
Sbjct  325  QWHPEKAIFEWGEPMNPHSEDAVQVTQHFANYFVSQARKSLNRAPADKVLNNLIDNYSPR  384

Query  173  YS  168
            + 
Sbjct  385  FG  386



>ref|XP_002984712.1| hypothetical protein SELMODRAFT_423816 [Selaginella moellendorffii]
 gb|EFJ14357.1| hypothetical protein SELMODRAFT_423816 [Selaginella moellendorffii]
Length=330

 Score =   174 bits (442),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 125/186 (67%), Gaps = 1/186 (1%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LG +LL +IVS ++ IL+ ++A   A  L  V       ++F  FP ++L KV  E L M
Sbjct  144  LGLELLAVIVSGNHSILDDYNAHKAAGELNFVGDWAKGRSMFTWFPKDILDKVEHEKLAM  203

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
            QNH  G+SP++++    L +FF+VLTT+ D + K+Y+STI+G+KYPV +VQW PE+NAFE
Sbjct  204  QNHVKGLSPQTWRDTQSLRDFFDVLTTTPDLNGKIYISTIEGRKYPVTSVQWHPEKNAFE  263

Query  323  WALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSG-F  147
            W    IPHS DA+ ++QS A++FVSEA KSS+  +  +    LIYNY+  YSG+DG G F
Sbjct  264  WGYEGIPHSPDAVRITQSAASFFVSEALKSSHTASWEEEEQLLIYNYSPIYSGRDGKGHF  323

Query  146  VEVYIF  129
             + Y+F
Sbjct  324  DQSYVF  329



>ref|XP_006442390.1| hypothetical protein CICLE_v10022857mg [Citrus clementina]
 gb|ESR55630.1| hypothetical protein CICLE_v10022857mg [Citrus clementina]
Length=127

 Score =   168 bits (425),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = -2

Query  506  MQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAF  327
            MQ H +GISPE  Q + DLS FF +LTTS D  NKVYVST+Q   YP    QW PE+NAF
Sbjct  1    MQKHIYGISPERMQENLDLSKFFRILTTSEDIYNKVYVSTVQAYNYPFTGFQWHPEKNAF  60

Query  326  EWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGF  147
            EW  S +PHSEDAILV+Q VAN+FVSEARKS N P    V DNLIYNY+  Y GKDG G+
Sbjct  61   EWGFSGVPHSEDAILVTQHVANFFVSEARKSLNRPPARKVLDNLIYNYSPIYCGKDGRGY  120

Query  146  VEVYIFS  126
             EVYIF+
Sbjct  121  DEVYIFT  127



>ref|XP_002978801.1| hypothetical protein SELMODRAFT_177157 [Selaginella moellendorffii]
 gb|EFJ20248.1| hypothetical protein SELMODRAFT_177157 [Selaginella moellendorffii]
Length=330

 Score =   174 bits (441),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 125/186 (67%), Gaps = 1/186 (1%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LG +LL +IVS ++ IL+ ++A   A  L  V       ++F  FP ++L KV  E L M
Sbjct  144  LGLELLAVIVSGNHSILDDYNAHKAAGELNFVGDWAKGRSMFTWFPKDILDKVEHEKLAM  203

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
            QNH  G+SP++++    L +FF+VLTT+ D + K+Y+STI+G+KYPV +VQW PE+NAFE
Sbjct  204  QNHIKGLSPQAWRDTQRLRDFFDVLTTTPDLNGKIYISTIEGRKYPVTSVQWHPEKNAFE  263

Query  323  WALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSG-F  147
            W    IPHS DA+ ++QS A++FVSEA KSS+  +  +    LIYNY+  YSG+DG G F
Sbjct  264  WGYEGIPHSPDAVRITQSAASFFVSEALKSSHTASWEEEEQLLIYNYSPIYSGRDGKGHF  323

Query  146  VEVYIF  129
             + Y+F
Sbjct  324  DQSYVF  329



>ref|XP_001782403.1| predicted protein [Physcomitrella patens]
 gb|EDQ52797.1| predicted protein, partial [Physcomitrella patens]
Length=294

 Score =   171 bits (432),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 124/181 (69%), Gaps = 2/181 (1%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNI-ILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEE  516
             + LGF+LL++IVS+ N  ILE F A N    L  V        +F+  P  ++ ++ E+
Sbjct  114  GVCLGFELLSVIVSKQNHDILEPFHAENNPGPLLFVGDSAKHEGMFKWIPLNIIDELYEQ  173

Query  515  CLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPER  336
             L MQNHKWG+SPE + +  +L++FF +LT + D + K+YVST++ ++YP++ VQW PE+
Sbjct  174  KLTMQNHKWGLSPEKWISTPELNDFFQILTVTPDLNEKLYVSTVEAREYPILGVQWHPEK  233

Query  335  NAFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNE-PDVRDNLIYNYNTSYSGKD  159
            NAFEW +  IPHS DAI ++QSVAN+ ++EARKS++ P+   + +D LIYN+   Y+GK+
Sbjct  234  NAFEWGIDNIPHSADAIRITQSVANFLIAEARKSTHTPSSFKEEQDFLIYNHAPVYTGKE  293

Query  158  G  156
            G
Sbjct  294  G  294



>dbj|BAJ98663.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=313

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+L+++IVS+DN ILE F AS+QASTLQ     +++G++F+RF  +L+RK+   CLVM
Sbjct  151  LGFELVSMIVSKDNNILESFHASDQASTLQFPNYSSLQGSVFERFHPDLIRKLSTSCLVM  210

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
            QNHK+GISP+  + +  LS+FF +LTTS D++ +VYVST++ +KYP+   QW PE+  FE
Sbjct  211  QNHKYGISPKRLRENDALSSFFKILTTSPDENGEVYVSTVEAQKYPITCTQWHPEKAIFE  270

Query  323  WALSEIPHSEDAILVSQSVANYFV  252
            W    IPHSEDA+ V+Q  ANYF+
Sbjct  271  WRKPMIPHSEDAVQVTQHFANYFI  294



>ref|XP_006442406.1| hypothetical protein CICLE_v10020608mg [Citrus clementina]
 gb|ESR55646.1| hypothetical protein CICLE_v10020608mg [Citrus clementina]
Length=328

 Score =   164 bits (416),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LL++IVSED  ILE F  +NQASTLQ V+ +N+EGTLFQRFP ELL+K+  +C
Sbjct  192  AICLGFELLSMIVSEDRNILETFDGANQASTLQFVKNINIEGTLFQRFPPELLKKLSTDC  251

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPE  339
            LVMQNH +GISPE  QA+ +L+ FF +LTTS+D+ NKVYVST+Q   YPV A QW PE
Sbjct  252  LVMQNHHYGISPERMQANQELAKFFKILTTSMDEYNKVYVSTVQAYNYPVTAFQWHPE  309



>ref|XP_003596309.1| Gamma-glutamyl hydrolase [Medicago truncatula]
Length=127

 Score =   155 bits (393),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 89/126 (71%), Gaps = 0/126 (0%)
 Frame = -2

Query  506  MQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAF  327
            MQNH++GISP     +  LS+FF +LTTS D+D+KVYVST++ + YPV   QW PE+NAF
Sbjct  1    MQNHQYGISPVKLLGNQKLSSFFEILTTSNDQDDKVYVSTVRSRNYPVTGFQWHPEKNAF  60

Query  326  EWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGF  147
            EW    IPH+EDAI  +Q  ANY VSEARKS N P   ++ DNLIYNY  +Y G  G GF
Sbjct  61   EWGSPSIPHTEDAIRTTQYAANYLVSEARKSLNRPVAQELLDNLIYNYRPTYCGYAGKGF  120

Query  146  VEVYIF  129
             EVYIF
Sbjct  121  DEVYIF  126



>gb|KGN55060.1| hypothetical protein Csa_4G627110 [Cucumis sativus]
Length=348

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 118/188 (63%), Gaps = 24/188 (13%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             I+LGFQ+++ +VS+ N I+E F+A+   S L+  +  N+ GT                 
Sbjct  184  GISLGFQIISAMVSQRNDIIETFNATRFPSALKFNDFANIRGT-----------------  226

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
                   +GISPE+F+ D  LS+FF +LTTS+DK+NKVYVST   + YP+   QW PE+N
Sbjct  227  -------YGISPETFEQDERLSDFFQILTTSVDKNNKVYVSTANARNYPITIFQWNPEKN  279

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            ++EW +S IPH+E AI ++  VA++ VSEAR+S N P    V + LIYNY+  Y+GK G 
Sbjct  280  SYEWGISTIPHTEYAIELTHHVAHHLVSEARRSINQPPAEKVLEKLIYNYSPIYNGKAGK  339

Query  152  GFVEVYIF  129
            G+ +VY+F
Sbjct  340  GYDQVYLF  347



>ref|XP_006370106.1| hypothetical protein POPTR_0001s39540g [Populus trichocarpa]
 gb|ERP66675.1| hypothetical protein POPTR_0001s39540g [Populus trichocarpa]
Length=322

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF++LT+I+SEDN ILE ++A++QASTLQ +E +++EGT+FQRFP  LL+K+  +C
Sbjct  197  AICLGFEILTMIISEDNQILETYNATDQASTLQFMENISIEGTVFQRFPPVLLKKLSTDC  256

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPE  339
            LVMQNH +GISP+ FQ +  LS+FF +LT S D+DN+VYVST+Q + YPV A QW PE
Sbjct  257  LVMQNHHYGISPQRFQGNEHLSSFFEILTNSADEDNQVYVSTVQARNYPVTAFQWHPE  314



>ref|XP_006494682.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006494684.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Citrus 
sinensis]
Length=278

 Score =   157 bits (396),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+LLT+I+S+D  ILE F+A++QASTLQ +E  ++EGT+FQRFP +L++K+  +CLVM
Sbjct  163  LGFELLTMIISKDKNILESFNAADQASTLQFMENTSIEGTVFQRFPPKLIKKLSTDCLVM  222

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPE  339
            QNH +GISPE+ Q + DLS FF +LTTS D+DNKVYVST+Q   YPV A QW PE
Sbjct  223  QNHHYGISPETLQKNLDLSRFFKMLTTSADEDNKVYVSTVQAYDYPVTAFQWHPE  277



>gb|KDO42395.1| hypothetical protein CISIN_1g023716mg [Citrus sinensis]
Length=278

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+LLT+I+S+D  ILE F+A++QASTLQ +E  ++EGT+FQRFP +L++K+  +CLVM
Sbjct  163  LGFELLTMIISKDKNILESFNAADQASTLQFMENTSIEGTVFQRFPPKLIKKLSTDCLVM  222

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPE  339
            QNH +GISPE+ + + DLS FF +LTTS D+DNKVYVST+Q   YPV A QW PE
Sbjct  223  QNHHYGISPETLRKNLDLSRFFKMLTTSADEDNKVYVSTVQAYDYPVTAFQWHPE  277



>ref|XP_010242158.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X2 [Nelumbo 
nucifera]
Length=313

 Score =   153 bits (387),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LL++I+S+D+ ILE+F+A +QASTLQ  E  N+ GT+FQRFP ELL+K+  +C
Sbjct  196  AICLGFELLSMIISKDDGILERFNALDQASTLQFTEKSNIGGTVFQRFPPELLKKLTTDC  255

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPE  339
            LVMQ+H++G+SPE FQ +  LS+FF +LTTS D+D KVYVST+Q   YPV A QW PE
Sbjct  256  LVMQHHQYGVSPERFQENPLLSSFFRILTTSKDEDGKVYVSTVQAYNYPVSAFQWHPE  313



>ref|XP_005645555.1| class I glutamine amidotransferase-like protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21011.1| class I glutamine amidotransferase-like protein [Coccomyxa subellipsoidea 
C-169]
Length=345

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 118/194 (61%), Gaps = 9/194 (5%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+ L +IVS D   L KF + + AS L + E    + T F  FP E+LR + E+ L M
Sbjct  140  LGFEALAVIVSGDGRALTKFDSYDNASPLVLTEDGKNDSTFFGAFPPEVLRGLQEQPLAM  199

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
            +NH  G++  +++    L +FF V + S D+ + VY+ST++ +KYP+ A QW PE+N+FE
Sbjct  200  ENHGKGLAMSTYEGSERLKDFFVVTSLSSDRRHAVYISTMEARKYPITATQWHPEKNSFE  259

Query  323  WALS-EIPHSEDAILVSQSVANYFVSEARKSSNVP-NEPDVRDNLIYNYNTSYSGKDGSG  150
            WA   +IPHS  A+ V+ + A Y V +ARK+++ P ++ +  D LIYNY T+Y+GK   G
Sbjct  260  WARKLQIPHSSSAVEVTHAAAKYLVDQARKNTHSPASQQEEEDILIYNYPTTYTGKGDPG  319

Query  149  -------FVEVYIF  129
                   F E Y F
Sbjct  320  HPGKESDFDECYFF  333



>gb|EMS68709.1| Gamma-glutamyl hydrolase [Triticum urartu]
Length=340

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 123/209 (59%), Gaps = 36/209 (17%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV-EGT---------LFQR--FPYE  540
            LGF+L+++IVS++ I+L      N  S L  +  L V  GT         L+++  F  +
Sbjct  54   LGFELVSMIVSKEKIVL----VPNLCSFLIFLYQLKVCMGTCKDHVSCPGLYKKIIFHPD  109

Query  539  LLRKVGEECLVMQNHK--------------------WGISPESFQADADLSNFFNVLTTS  420
            L++K+   CLVMQNHK                    +GISP+  + +  LS+FF +LT S
Sbjct  110  LIKKLSTSCLVMQNHKNNYLYLLVFPNMVYFLNWSKYGISPKRLRENDALSSFFKILTIS  169

Query  419  LDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIPHSEDAILVSQSVANYFVSEAR  240
             D++ +VYVST++ +KYP+   QW PE+  FEW    IPHSEDA+ V+Q+ ANYF+S+AR
Sbjct  170  PDENGEVYVSTVEAQKYPITCTQWHPEKAIFEWRKPMIPHSEDAVQVTQNFANYFISQAR  229

Query  239  KSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            KS N P    V DNLIYNY  ++SGK  +
Sbjct  230  KSPNRPPADKVLDNLIYNYIPTFSGKTST  258



>ref|XP_006301184.1| hypothetical protein CARUB_v10021583mg, partial [Capsella rubella]
 gb|EOA34082.1| hypothetical protein CARUB_v10021583mg, partial [Capsella rubella]
Length=276

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+S++  I EK  A N AS+LQ +E +N++GT+F+RFP EL  K+  +C
Sbjct  159  AICLGFELLTMIISQNRDIFEKVDARNCASSLQFIENVNIKGTVFERFPPELFNKLSTDC  218

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPE  339
            LVMQNH++GISPESF+    LSNFFN++TT  D  NK YVST++ K+YPV   QW PE
Sbjct  219  LVMQNHQYGISPESFERTIALSNFFNIVTTCTDNHNKAYVSTVKSKQYPVTGFQWHPE  276



>ref|XP_002978799.1| hypothetical protein SELMODRAFT_109437, partial [Selaginella 
moellendorffii]
 gb|EFJ20246.1| hypothetical protein SELMODRAFT_109437, partial [Selaginella 
moellendorffii]
Length=194

 Score =   145 bits (366),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 99/145 (68%), Gaps = 0/145 (0%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LG +LL +IVS ++ IL+ ++A   A  L  V     E ++F  FP ++L KV  E L M
Sbjct  48   LGLELLAVIVSGNHSILDDYNAHKAAGELNFVGDWAKERSMFTWFPKDILDKVEHEKLAM  107

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
            QNH  G+SP++++    L +FF+VLTT+ D + K+Y+S I+G+KYPV +VQW PE+NAFE
Sbjct  108  QNHMKGLSPQTWRDTQSLRDFFDVLTTTPDLNGKIYISRIEGRKYPVTSVQWHPEKNAFE  167

Query  323  WALSEIPHSEDAILVSQSVANYFVS  249
            W    IPHS DA+ ++QS A++FVS
Sbjct  168  WGYEGIPHSPDAVRITQSAASFFVS  192



>ref|XP_004998304.1| gamma-glutamyl hydrolase [Salpingoeca rosetta]
 gb|EGD76129.1| gamma-glutamyl hydrolase [Salpingoeca rosetta]
Length=332

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 117/186 (63%), Gaps = 2/186 (1%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGFQ++++ +  ++++   F + +    L     ++    +F+    EL+  +  + L M
Sbjct  146  LGFQMVSVFIGGNSVLGHHFDSEDLPLPLNFTSHISTS-KIFKSARPELITALRNQPLTM  204

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
             NH+ G++P +F  +A+L++FFNV++T++D+    +VSTI+GK  P  A QW PE+N+FE
Sbjct  205  NNHEGGVTPITFANNANLTSFFNVISTNVDRKGNPFVSTIEGKHMPFYATQWHPEKNSFE  264

Query  323  WALSE-IPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGF  147
            W  SE IPHS  AI   Q  + +FV+EARKS++      +R ++IYNYN  ++GKDGSGF
Sbjct  265  WTASEAIPHSALAIETCQLTSTFFVNEARKSNHAYPPEQLRKDIIYNYNPVFTGKDGSGF  324

Query  146  VEVYIF  129
             + Y +
Sbjct  325  EQCYFW  330



>ref|XP_010248393.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X2 [Nelumbo 
nucifera]
Length=292

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI L F+LLT+I+S+D  ILE+F+A NQASTLQ  E   +EGT+FQRF  ELL+K+  +C
Sbjct  158  AICLSFELLTMIISKDVNILERFNALNQASTLQFTENSIIEGTVFQRFSPELLKKLTTDC  217

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPE  339
            +VM+NH++GIS E FQ +  LS+FF +LTTS D+D KVYVST++   YPV A QW PE
Sbjct  218  IVMENHQYGISLERFQKNPSLSSFFRILTTSKDRDGKVYVSTVKSHNYPVSAFQWHPE  275



>ref|XP_004172076.1| PREDICTED: gamma-glutamyl hydrolase-like [Cucumis sativus]
Length=320

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 90/122 (74%), Gaps = 0/122 (0%)
 Frame = -2

Query  494  KWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWAL  315
            ++GISPE+F+ D  LS+FF +LTTS+DK+NKVYVST   + YP+   QW PE+N++EW +
Sbjct  198  QYGISPETFEQDERLSDFFQILTTSVDKNNKVYVSTANARNYPITIFQWNPEKNSYEWGI  257

Query  314  SEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVY  135
            S IPH+E AI ++  VA++ VSEAR+S N P +  V + LIYNY   Y+GK G G+ +VY
Sbjct  258  SSIPHTEYAIELTHHVAHHLVSEARRSINQPPKEKVLEKLIYNYTPLYNGKAGKGYDQVY  317

Query  134  IF  129
            +F
Sbjct  318  LF  319



>ref|XP_001626371.1| predicted protein [Nematostella vectensis]
 gb|EDO34271.1| predicted protein [Nematostella vectensis]
Length=314

 Score =   143 bits (360),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 116/187 (62%), Gaps = 4/187 (2%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+LLT+I S+D + L +  A N    L   EG      LF   P  L++ V    + +
Sbjct  128  LGFELLTVITSDDKVALSRVDAENLPLPLNFSEGFR-GSRLFADAPDGLIKAVQTSNITL  186

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
             NH + ++P  F  +  LS+F+ VL+T++D+  K ++ST++G KYPV  VQW PE+N FE
Sbjct  187  NNHHYALAPGDFGKNDALSSFYKVLSTNVDRKGKEFISTVEGIKYPVYGVQWHPEKNQFE  246

Query  323  WALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSG  150
            W+  E IPHS++AI + Q +AN+ V++AR +  + P+  +    LIYNYN++++GK  S 
Sbjct  247  WSRREDIPHSKEAIQIGQYMANFLVNQARMNDHHFPSTSEEDAALIYNYNSTFTGKH-SN  305

Query  149  FVEVYIF  129
            F++ Y F
Sbjct  306  FMQCYYF  312



>gb|AES66561.2| class I glutamine amidotransferase [Medicago truncatula]
Length=261

 Score =   139 bits (350),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 107/179 (60%), Gaps = 26/179 (15%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+L+++I+SED  ILE+F A NQASTLQ VE  ++EGT+F+RFP ELL+K+  +C
Sbjct  109  AICLGFELISVIISEDKNILEEFKAKNQASTLQFVENASIEGTVFERFPPELLKKLSTDC  168

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH       +      +S+FF +LTT  D+++KVYVST++ + YPV   QW PE  
Sbjct  169  LVMQNHVV-----TRHIPNKVSSFFEILTTCNDEEDKVYVSTVRSRNYPVTGFQWHPE--  221

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDG  156
                             V + V   +  EARKS N P   ++ DNLIYN    +  K G
Sbjct  222  -----------------VIKKVL--YTIEARKSLNRPVAQELYDNLIYNIVQLFMQKKG  261



>ref|XP_006477850.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X3 [Citrus 
sinensis]
Length=302

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+L+++I+S+D  ILE+F+ ++QASTL+ ++   +EGT+FQRF  ELL+K+  +C
Sbjct  183  AICLGFELISMIISKDRNILERFNGADQASTLKFIKNSKIEGTVFQRFVPELLKKLSTDC  242

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPE  339
            LVMQ H +GISPE  Q + DLS FF +LTTS D  NKVYVST+Q   YP    QW PE
Sbjct  243  LVMQKHIYGISPERMQENLDLSKFFRILTTSEDIYNKVYVSTVQAYNYPFTGFQWHPE  300



>ref|XP_006477849.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X2 [Citrus 
sinensis]
Length=339

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+L+++I+S+D  ILE+F+ ++QASTL+ ++   +EGT+FQRF  ELL+K+  +C
Sbjct  183  AICLGFELISMIISKDRNILERFNGADQASTLKFIKNSKIEGTVFQRFVPELLKKLSTDC  242

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPE  339
            LVMQ H +GISPE  Q + DLS FF +LTTS D  NKVYVST+Q   YP    QW PE
Sbjct  243  LVMQKHIYGISPERMQENLDLSKFFRILTTSEDIYNKVYVSTVQAYNYPFTGFQWHPE  300



>ref|XP_011406499.1| PREDICTED: gamma-glutamyl hydrolase A-like [Amphimedon queenslandica]
Length=288

 Score =   136 bits (343),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 111/187 (59%), Gaps = 3/187 (2%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGFQLL ++ S  N IL  F + + +  L   +  N    LF  +  E +  +  E + M
Sbjct  103  LGFQLLCVLQSGTNHILSSFDSEDYSIPLNFTDAANA-SRLFSMYTPEGMGWLSSEPITM  161

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
             NH++G+SP+SF++ + L+ F+ +L+T+ D+    ++S+I+   YP   VQW PE+N FE
Sbjct  162  NNHQYGVSPDSFKSMSSLTEFYTILSTNFDRKGSEFISSIEAIHYPFYGVQWHPEKNTFE  221

Query  323  WALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSG  150
            W  +E I HS  A+ ++Q+ AN+ VSEARKS  +  +E    D+LIYNY  +Y+GK    
Sbjct  222  WTTAESINHSYHAVSIAQTAANFLVSEARKSDHHFTSEEKEMDSLIYNYEPTYTGKVSHS  281

Query  149  FVEVYIF  129
            F + Y F
Sbjct  282  FEQEYEF  288



>ref|XP_003391262.1| PREDICTED: gamma-glutamyl hydrolase A-like, partial [Amphimedon 
queenslandica]
Length=268

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 111/187 (59%), Gaps = 3/187 (2%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGFQLL ++ S  N IL  F + + +  L   +  N    LF  +  E +  +  E + M
Sbjct  83   LGFQLLCVLQSGTNHILSSFDSEDYSIPLNFTDAANA-SRLFSMYTPEGMDWLSSEPITM  141

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
             NH++G+SP+SF++ + L+ F+ VL+T+ D+    ++S+I+   YP   VQW PE+N FE
Sbjct  142  NNHQYGVSPDSFKSMSSLTEFYTVLSTNFDRKGSEFISSIEAIHYPFYGVQWHPEKNIFE  201

Query  323  WALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSG  150
            W  +E I HS  A+ ++Q+ AN+ VSEARK+  +  +E    D+LIYNY  +Y+GK    
Sbjct  202  WTTAESINHSYHAVSIAQTAANFLVSEARKNEHHFTSEEKEMDSLIYNYEPTYTGKVSHS  261

Query  149  FVEVYIF  129
            F + Y F
Sbjct  262  FEQEYEF  268



>ref|XP_006442396.1| hypothetical protein CICLE_v10021719mg [Citrus clementina]
 gb|ESR55636.1| hypothetical protein CICLE_v10021719mg [Citrus clementina]
Length=265

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LL++IVSED  ILE F  +NQASTLQ V+ +N+EGTLFQRFP ELL+K+  +C
Sbjct  166  AICLGFELLSMIVSEDRNILETFDGANQASTLQFVKNINIEGTLFQRFPPELLKKLSTDC  225

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKV  399
            LVMQNH +GISPE  QA+ +L+ FF +LTTS+D+ NKV
Sbjct  226  LVMQNHHYGISPERMQANQELAKFFKILTTSMDEYNKV  263



>ref|XP_006442405.1| hypothetical protein CICLE_v10020608mg [Citrus clementina]
 gb|ESR55645.1| hypothetical protein CICLE_v10020608mg [Citrus clementina]
Length=291

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LL++IVSED  ILE F  +NQASTLQ V+ +N+EGTLFQRFP ELL+K+  +C
Sbjct  192  AICLGFELLSMIVSEDRNILETFDGANQASTLQFVKNINIEGTLFQRFPPELLKKLSTDC  251

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKV  399
            LVMQNH +GISPE  QA+ +L+ FF +LTTS+D+ NKV
Sbjct  252  LVMQNHHYGISPERMQANQELAKFFKILTTSMDEYNKV  289



>gb|KDD74766.1| hypothetical protein H632_c1088p1, partial [Helicosporidium sp. 
ATCC 50920]
Length=323

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 109/175 (62%), Gaps = 3/175 (2%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+ L +  S ++ IL  F A +  S L   + L  +   F   P ++ + +  +   M
Sbjct  150  LGFEALAVAASRNHSILTHFDAEDLPSALFPTD-LAQKSDFFSVLPKKVYKNLITKPYAM  208

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
            +NH+ G++  +   +  L + F+VLT S+D+  ++YVST++ KKYP+ A QW PE+NAFE
Sbjct  209  ENHENGVAWTAVDENPGLKDMFDVLTLSVDRGGRIYVSTMEAKKYPISATQWHPEKNAFE  268

Query  323  WALSE-IPHSEDAILVSQSVANYFVSEARKSSNVP-NEPDVRDNLIYNYNTSYSG  165
            W   + IPH  DAI+V+Q +ANYFV+EARK+ + P NE D    +IYN+ +S++G
Sbjct  269  WNREKHIPHDPDAIVVTQEIANYFVNEARKNFHAPDNEEDENKMVIYNFRSSFTG  323



>ref|XP_001696183.1| gamma-glutamyl hydrolase [Chlamydomonas reinhardtii]
 gb|EDP08160.1| gamma-glutamyl hydrolase [Chlamydomonas reinhardtii]
Length=379

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 110/195 (56%), Gaps = 14/195 (7%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LG + L++I+S +  IL  F A +  + L        +  L +  P +++  +  + + M
Sbjct  176  LGMETLSVILSANYTILSPFDAEDAPAPLLYTADAK-DSHLLRSLPADVVENLQNKPIAM  234

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
            +NH  G+S  +   + DL  FF VL+ SLDK    Y+ST++G+KYP  A QW PE+NA+E
Sbjct  235  ENHGMGLSMTALVENPDLGKFFKVLSLSLDKSGAAYISTLEGRKYPFTATQWHPEKNAYE  294

Query  323  WALS-EIPHSEDAILVSQSVANYFVSEAR----KSSNVPNEPDVRDNLIYNYNTSYSGKD  159
            W     IPH+ DAI +SQ VAN+FVSEAR    K+ N+  E DV   LIYN+   ++G+ 
Sbjct  295  WTPHLHIPHTTDAIRMSQEVANFFVSEARRNLHKAKNILEEDDV---LIYNWKPEFTGRH  351

Query  158  G-----SGFVEVYIF  129
                    F + Y+F
Sbjct  352  AYVGQEKDFEQAYMF  366



>ref|XP_003596310.1| Gamma-glutamyl hydrolase [Medicago truncatula]
Length=247

 Score =   130 bits (326),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 101/179 (56%), Gaps = 40/179 (22%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+L+++I+SED  ILE+F A NQASTLQ VE  ++EGT+F+RFP ELL+K+  +C
Sbjct  109  AICLGFELISVIISEDKNILEEFKAKNQASTLQFVENASIEGTVFERFPPELLKKLSTDC  168

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            LVMQNH                    +LTT  D+++KVYVST++ + YPV   QW PE  
Sbjct  169  LVMQNHV-------------------ILTTCNDEEDKVYVSTVRSRNYPVTGFQWHPE--  207

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDG  156
                             V + V   +  EARKS N P   ++ DNLIYN    +  K G
Sbjct  208  -----------------VIKKVL--YTIEARKSLNRPVAQELYDNLIYNIVQLFMQKKG  247



>ref|XP_007021919.1| Gamma-glutamyl hydrolase 1 isoform 4 [Theobroma cacao]
 gb|EOY13444.1| Gamma-glutamyl hydrolase 1 isoform 4 [Theobroma cacao]
Length=291

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+SED  ILE FSA++QAS+LQ V+ +N+EGT+FQRFP +LL+K+G +C
Sbjct  194  AICLGFELLTMIISEDRNILESFSAADQASSLQFVKNINIEGTVFQRFPPDLLKKLGADC  253

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKV  399
            LVMQNH +GISPE  + + +LS+FF +LTTS D +N+ 
Sbjct  254  LVMQNHHYGISPERLRNNPNLSSFFKILTTSTDDNNEC  291



>ref|XP_007021918.1| Gamma-glutamyl hydrolase 1 isoform 3 [Theobroma cacao]
 gb|EOY13443.1| Gamma-glutamyl hydrolase 1 isoform 3 [Theobroma cacao]
Length=292

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+LLT+I+SED  ILE FSA++QAS+LQ V+ +N+EGT+FQRFP +LL+K+G +C
Sbjct  194  AICLGFELLTMIISEDRNILESFSAADQASSLQFVKNINIEGTVFQRFPPDLLKKLGADC  253

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNK  402
            LVMQNH +GISPE  + + +LS+FF +LTTS D +N+
Sbjct  254  LVMQNHHYGISPERLRNNPNLSSFFKILTTSTDDNNE  290



>ref|XP_006494683.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X2 [Citrus 
sinensis]
 ref|XP_006494685.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X2 [Citrus 
sinensis]
Length=263

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+LLT+I+S+D  ILE F+A++QASTLQ +E  ++EGT+FQRFP +L++K+  +CLVM
Sbjct  163  LGFELLTMIISKDKNILESFNAADQASTLQFMENTSIEGTVFQRFPPKLIKKLSTDCLVM  222

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTI  384
            QNH +GISPE+ Q + DLS FF +LTTS D+DNK    TI
Sbjct  223  QNHHYGISPETLQKNLDLSRFFKMLTTSADEDNKCKPMTI  262



>ref|NP_998487.1| gamma-glutamyl hydrolase precursor [Danio rerio]
 pdb|4L7Q|C Chain C, Crystal Structure Of Gamma Glutamyl Hydrolase (wild-type) 
From Zebrafish
 pdb|4L7Q|D Chain D, Crystal Structure Of Gamma Glutamyl Hydrolase (wild-type) 
From Zebrafish
 pdb|4L7Q|A Chain A, Crystal Structure Of Gamma Glutamyl Hydrolase (wild-type) 
From Zebrafish
 pdb|4L7Q|B Chain B, Crystal Structure Of Gamma Glutamyl Hydrolase (wild-type) 
From Zebrafish
 pdb|4L7Q|E Chain E, Crystal Structure Of Gamma Glutamyl Hydrolase (wild-type) 
From Zebrafish
 pdb|4L7Q|F Chain F, Crystal Structure Of Gamma Glutamyl Hydrolase (wild-type) 
From Zebrafish
 gb|AAH66746.1| Gamma-glutamyl hydrolase (conjugase, folylpolygammaglutamyl hydrolase) 
[Danio rerio]
 gb|ACK43089.1| gamma-glutamyl hydrolase [Danio rerio]
Length=312

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 113/187 (60%), Gaps = 7/187 (4%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGT-LFQRFPYELLRKVGEECLV  507
            LGF+LLT++ S + ++L   + S  A  L   E  +V+G+ LF+ FP EL++ +  E L 
Sbjct  130  LGFELLTLLTSGE-LLLSHTNTSGIALPLDFTE--DVKGSRLFKEFPEELMKSLATEPLT  186

Query  506  MQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAF  327
              +H+W I+ E+F A+  L  F+ VL+T+ D  NK +VST++   +P+ A QW PE+NAF
Sbjct  187  ENSHQWSITTENFTANKKLKKFYRVLSTNTDGYNK-FVSTMEAYDFPIYATQWHPEKNAF  245

Query  326  EWALSEIPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSG  150
            EW    IPH+  AI  +  +AN+FV+EARK+  +  +  +    LIYNY   Y+G   S 
Sbjct  246  EWTRPYIPHTPSAIKTTFYMANFFVNEARKNLHSFASTEEEEKALIYNYKPEYTGIQ-SA  304

Query  149  FVEVYIF  129
            F + Y F
Sbjct  305  FEQTYFF  311



>pdb|4L8F|C Chain C, Crystal Structure Of Gamma-glutamyl Hydrolase (c108a) 
Complex With Mtx
 pdb|4L8F|D Chain D, Crystal Structure Of Gamma-glutamyl Hydrolase (c108a) 
Complex With Mtx
 pdb|4L8F|B Chain B, Crystal Structure Of Gamma-glutamyl Hydrolase (c108a) 
Complex With Mtx
 pdb|4L8F|A Chain A, Crystal Structure Of Gamma-glutamyl Hydrolase (c108a) 
Complex With Mtx
 pdb|4L8Y|C Chain C, Crystal Structure Of Gamma-glutamyl Hydrolase (c108a) 
From Zebrafish
 pdb|4L8Y|D Chain D, Crystal Structure Of Gamma-glutamyl Hydrolase (c108a) 
From Zebrafish
 pdb|4L8Y|A Chain A, Crystal Structure Of Gamma-glutamyl Hydrolase (c108a) 
From Zebrafish
 pdb|4L8Y|B Chain B, Crystal Structure Of Gamma-glutamyl Hydrolase (c108a) 
From Zebrafish
Length=312

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 113/187 (60%), Gaps = 7/187 (4%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGT-LFQRFPYELLRKVGEECLV  507
            LGF+LLT++ S + ++L   + S  A  L   E  +V+G+ LF+ FP EL++ +  E L 
Sbjct  130  LGFELLTLLTSGE-LLLSHTNTSGIALPLDFTE--DVKGSRLFKEFPEELMKSLATEPLT  186

Query  506  MQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAF  327
              +H+W I+ E+F A+  L  F+ VL+T+ D  NK +VST++   +P+ A QW PE+NAF
Sbjct  187  ENSHQWSITTENFTANKKLKKFYRVLSTNTDGYNK-FVSTMEAYDFPIYATQWHPEKNAF  245

Query  326  EWALSEIPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSG  150
            EW    IPH+  AI  +  +AN+FV+EARK+  +  +  +    LIYNY   Y+G   S 
Sbjct  246  EWTRPYIPHTPSAIKTTFYMANFFVNEARKNLHSFASTEEEEKALIYNYKPEYTGIQ-SA  304

Query  149  FVEVYIF  129
            F + Y F
Sbjct  305  FEQTYFF  311



>pdb|4L8W|D Chain D, Crystal Structure Of Gamma Glutamyl Hydrolase (h218n) 
From Zebrafish Complex With Mtx Polyglutamate
 pdb|4L8W|I Chain I, Crystal Structure Of Gamma Glutamyl Hydrolase (h218n) 
From Zebrafish Complex With Mtx Polyglutamate
 pdb|4L8W|B Chain B, Crystal Structure Of Gamma Glutamyl Hydrolase (h218n) 
From Zebrafish Complex With Mtx Polyglutamate
 pdb|4L8W|E Chain E, Crystal Structure Of Gamma Glutamyl Hydrolase (h218n) 
From Zebrafish Complex With Mtx Polyglutamate
 pdb|4L8W|G Chain G, Crystal Structure Of Gamma Glutamyl Hydrolase (h218n) 
From Zebrafish Complex With Mtx Polyglutamate
 pdb|4L8W|K Chain K, Crystal Structure Of Gamma Glutamyl Hydrolase (h218n) 
From Zebrafish Complex With Mtx Polyglutamate
 pdb|4L95|E Chain E, Crystal Structure Of Gamma Glutamyl Hydrolase (h218n) 
From Zebrafish
 pdb|4L95|F Chain F, Crystal Structure Of Gamma Glutamyl Hydrolase (h218n) 
From Zebrafish
 pdb|4L95|C Chain C, Crystal Structure Of Gamma Glutamyl Hydrolase (h218n) 
From Zebrafish
 pdb|4L95|G Chain G, Crystal Structure Of Gamma Glutamyl Hydrolase (h218n) 
From Zebrafish
 pdb|4L95|K Chain K, Crystal Structure Of Gamma Glutamyl Hydrolase (h218n) 
From Zebrafish
 pdb|4L95|M Chain M, Crystal Structure Of Gamma Glutamyl Hydrolase (h218n) 
From Zebrafish
Length=312

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 113/187 (60%), Gaps = 7/187 (4%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGT-LFQRFPYELLRKVGEECLV  507
            LGF+LLT++ S + ++L   + S  A  L   E  +V+G+ LF+ FP EL++ +  E L 
Sbjct  130  LGFELLTLLTSGE-LLLSHTNTSGIALPLDFTE--DVKGSRLFKEFPEELMKSLATEPLT  186

Query  506  MQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAF  327
              +H+W I+ E+F A+  L  F+ VL+T+ D  NK +VST++   +P+ A QW PE+NAF
Sbjct  187  ENSHQWSITTENFTANKKLKKFYRVLSTNTDGYNK-FVSTMEAYDFPIYATQWNPEKNAF  245

Query  326  EWALSEIPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSG  150
            EW    IPH+  AI  +  +AN+FV+EARK+  +  +  +    LIYNY   Y+G   S 
Sbjct  246  EWTRPYIPHTPSAIKTTFYMANFFVNEARKNLHSFASTEEEEKALIYNYKPEYTGIQ-SA  304

Query  149  FVEVYIF  129
            F + Y F
Sbjct  305  FEQTYFF  311



>ref|XP_005852047.1| hypothetical protein CHLNCDRAFT_133025 [Chlorella variabilis]
 gb|EFN59945.1| hypothetical protein CHLNCDRAFT_133025 [Chlorella variabilis]
Length=386

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 108/177 (61%), Gaps = 3/177 (2%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVE-GLNVEGTLFQRFPYELLRKVGEECLV  507
            LGF+ L II S ++ IL +F + N  S L + +   + +   F   P ++++ +      
Sbjct  154  LGFETLAIIASGNHSILSEFDSENLPSPLFLTDTATSGKSRFFSALPEQVVQHLQTRPYA  213

Query  506  MQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAF  327
            M+NH  G++  + + +  L +FF+VL+ S+D+   VYVST++  +YP+   QW PE+NAF
Sbjct  214  MENHAHGLAWTAVEENPRLKDFFDVLSLSVDRAGAVYVSTVEAHRYPITGTQWHPEKNAF  273

Query  326  EWAL-SEIPHSEDAILVSQSVANYFVSEARKSSNVP-NEPDVRDNLIYNYNTSYSGK  162
            EW    +IPH  DAI ++Q VAN+ V EAR++ + P ++ +  D LIYN+  SY+GK
Sbjct  274  EWTPDKDIPHHPDAIEITQEVANFIVGEARRNFHAPSSQEEEEDLLIYNWAPSYTGK  330



>ref|XP_011395864.1| Gamma-glutamyl hydrolase A [Auxenochlorella protothecoides]
 gb|KFM22997.1| Gamma-glutamyl hydrolase A [Auxenochlorella protothecoides]
Length=360

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 108/176 (61%), Gaps = 3/176 (2%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+ L +I S+++ IL +F A N  S L   +    +   F   P+++   +  +   M
Sbjct  151  LGFETLAVIASKNHSILSEFDAENLPSPLFPTDKAE-KSEFFSVLPHKVYENLLTKPYAM  209

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
            +NH  G++  +   +  L +FF+VLT S+D+  + YVST++   YP+ A QW PE+NA+E
Sbjct  210  ENHVNGLAWTAIAENPTLVDFFDVLTLSIDRGGRTYVSTMEAIDYPITATQWHPEKNAYE  269

Query  323  WAL-SEIPHSEDAILVSQSVANYFVSEARKSS-NVPNEPDVRDNLIYNYNTSYSGK  162
            W L  +IPH+ +AI+++Q V N+FV+ AR++  N+ N  D  D LIYN++  Y+GK
Sbjct  270  WTLDKDIPHNPEAIVITQEVGNFFVNRARRNQHNIANHDDEVDLLIYNFDLVYTGK  325



>ref|XP_007231125.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X2 [Astyanax 
mexicanus]
Length=310

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 112/186 (60%), Gaps = 5/186 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+ LT++ SE  ++L   + S  A  L     LN +  +F+ FP  L+  +  E L  
Sbjct  128  LGFEQLTLLTSEK-LLLSHTNTSGVALPLNFTSELN-KSRMFKDFPAHLMTSLANEPLTE  185

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
             +HKW I+ +SF+ +  L  F+ +L+T+ D   K +VST++   YPV   QW PE+NAFE
Sbjct  186  NSHKWSITTKSFKGNEKLKKFYRILSTNTD-GQKEFVSTVEAYDYPVYGTQWHPEKNAFE  244

Query  323  WALSEIPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGF  147
            W    IPH+  AI  +  +A++FV+EA+KS  +  ++ + ++ LIYNY+ SY+GK  S F
Sbjct  245  WTRPYIPHTPSAIKTTFYMADFFVNEAKKSLHSFSSQEEEQNALIYNYSPSYTGKT-SIF  303

Query  146  VEVYIF  129
             ++Y F
Sbjct  304  EQIYYF  309



>gb|KDO42396.1| hypothetical protein CISIN_1g023716mg [Citrus sinensis]
Length=263

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+LLT+I+S+D  ILE F+A++QASTLQ +E  ++EGT+FQRFP +L++K+  +CLVM
Sbjct  163  LGFELLTMIISKDKNILESFNAADQASTLQFMENTSIEGTVFQRFPPKLIKKLSTDCLVM  222

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTI  384
            QNH +GISPE+ + + DLS FF +LTTS D+DNK    TI
Sbjct  223  QNHHYGISPETLRKNLDLSRFFKMLTTSADEDNKCKPMTI  262



>ref|XP_006634071.1| PREDICTED: gamma-glutamyl hydrolase-like [Lepisosteus oculatus]
Length=312

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 112/188 (60%), Gaps = 7/188 (4%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+ LT + S   I+L + + ++ A  L   +G   E  LF+ FP ELL  +  E +  
Sbjct  130  LGFEELTYLTS-GKILLVRTNTTSVALPLIFTKGAR-ESRLFKNFPTELLEALATESITE  187

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKV-YVSTIQGKKYPVVAVQWAPERNAF  327
             +H W +S E + +D  L  F+N+LTT  +KD K+ +VST++    P+   QW PE+NAF
Sbjct  188  NSHIWSLSVEKYNSDEKLRKFYNILTT--NKDEKLEFVSTMEAYDVPIYGTQWHPEKNAF  245

Query  326  EWALSEIPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSG  150
            EW    IPHS +A+  +  +A++FV+EARK+  + P+E +    LIYNY   Y G + S 
Sbjct  246  EWTRPYIPHSPNAVKATFYMADFFVNEARKNFHHFPSEEEESKALIYNYIPVYKG-NHSA  304

Query  149  FVEVYIFS  126
            F ++YIFS
Sbjct  305  FEQIYIFS  312



>ref|XP_007231124.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X1 [Astyanax 
mexicanus]
Length=310

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 114/187 (61%), Gaps = 5/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+ LT++ SE  ++L   + S  A  L     ++ +  +F+ FP +L+  +  E L  
Sbjct  128  LGFEQLTLLTSE-KLLLSHTNTSGVALPLNFTSEVS-DSRMFKDFPKDLMTSLANEPLTE  185

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
             +H+W I+ ESF+ +  L+ F+ +L+T+ D   K +VST++   YPV   QW PE+N FE
Sbjct  186  NSHQWSITTESFKGNEKLNKFYRILSTNTD-GQKEFVSTVEAYDYPVYGTQWHPEKNTFE  244

Query  323  WALSEIPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGF  147
            W    IPH+  AI  +  +A++FV+EA+KS  +  ++ + +D LIYNY+ SY+GK  S F
Sbjct  245  WTRPYIPHTPSAIKTTFYMADFFVNEAKKSLHSFSSQEEEQDALIYNYSPSYTGKM-SAF  303

Query  146  VEVYIFS  126
             ++Y F+
Sbjct  304  EQIYYFA  310



>gb|AAH87532.1| LOC496099 protein, partial [Xenopus laevis]
Length=319

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 113/187 (60%), Gaps = 5/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            +GFQ+LT   +  ++ L   SA N +  L + + +     +F R P +LLR + +E +  
Sbjct  136  MGFQILTAFTAGADL-LSATSAENISLPLNLTDEV-ASSRMFLRAPPDLLRVLSQERVTA  193

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              H +G++PE+F+A+  LS+FF VL+T+ D +   ++STI+ + YP+  VQW PE N F+
Sbjct  194  NFHHFGLTPETFRANKKLSDFFRVLSTNRDINGVEFISTIEARNYPIYGVQWHPEVNRFQ  253

Query  323  WALS-EIPHSEDAILVSQSVANYFVSEARKSSN-VPNEPDVRDNLIYNYNTSYSGKDGSG  150
            W      PHS +AI VSQ +A++FV+EARKS N  P E +    LIYN+   Y+  + SG
Sbjct  254  WRSDFSFPHSANAIWVSQYLADFFVNEARKSQNHFPTEKEENAALIYNWTPIYTA-NISG  312

Query  149  FVEVYIF  129
            + + Y F
Sbjct  313  YEQAYFF  319



>gb|AAI08439.1| LOC496099 protein [Xenopus laevis]
Length=311

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 113/187 (60%), Gaps = 5/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            +GFQ+LT   +  ++ L   SA N +  L + + +     +F R P +LLR + +E +  
Sbjct  128  MGFQILTAFTAGADL-LSATSAENISLPLNLTDEV-ASSRMFLRAPPDLLRVLSQERVTA  185

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              H +G++PE+F+A+  LS+FF VL+T+ D +   ++STI+ + YP+  VQW PE N F+
Sbjct  186  NFHHFGLTPETFRANKKLSDFFRVLSTNRDINGVEFISTIEARNYPIYGVQWHPEVNRFQ  245

Query  323  WALS-EIPHSEDAILVSQSVANYFVSEARKSSN-VPNEPDVRDNLIYNYNTSYSGKDGSG  150
            W      PHS +AI VSQ +A++FV+EARKS N  P E +    LIYN+   Y+  + SG
Sbjct  246  WRSDFSFPHSANAIWVSQYLADFFVNEARKSQNHFPTEKEENAALIYNWTPIYTA-NISG  304

Query  149  FVEVYIF  129
            + + Y F
Sbjct  305  YEQAYFF  311



>emb|CDQ81962.1| unnamed protein product [Oncorhynchus mykiss]
Length=317

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 119/187 (64%), Gaps = 5/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LG QLLT +V+ +N+ L K +A N A  L + +  +    +FQ FP ++++ + +E L  
Sbjct  134  LGMQLLTCLVAGENL-LTKTTAENMALPLNLTKEAH-SSQMFQGFPSDVMKALSQEALTG  191

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              H++G++ ++F+ +  L +FF++L+T+  ++  ++VST++G+ YP   VQW PE N F+
Sbjct  192  NFHQYGVTMKTFKENEKLQSFFSILSTNTAENGAIFVSTMEGRTYPFYGVQWHPEVNRFQ  251

Query  323  WALS-EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRD-NLIYNYNTSYSGKDGSG  150
            W      PHS DA+ V+  +A +FV+E R+S +  ++P+    +LIYNY  +Y+G + +G
Sbjct  252  WDPKLNFPHSSDAVRVASLLAEFFVNEGRRSLHHFDQPEEEAVSLIYNYTPTYAG-NFTG  310

Query  149  FVEVYIF  129
            + ++Y F
Sbjct  311  YEQIYFF  317



>gb|ACI68420.1| Gamma-glutamyl hydrolase precursor [Salmo salar]
Length=317

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 119/187 (64%), Gaps = 5/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LG QLLT +V+ +N+ L K +A N A  L + +  +    +FQ FP ++++ + +E L  
Sbjct  134  LGMQLLTCLVAGENL-LTKTTAENMALPLNLTKEAH-SSQMFQGFPIDVMKALSQEALTG  191

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              H++G++ ++F+ +  L +FF++L+T+  ++  ++VST++G+ YP   VQW PE N F+
Sbjct  192  NFHQYGVTVKTFKENEKLQSFFSILSTNTAENGAIFVSTMEGRTYPFYGVQWHPEVNRFQ  251

Query  323  WALS-EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRD-NLIYNYNTSYSGKDGSG  150
            W      PHS DA+ V+  +A +FV+E R+S +  ++P+    +LIYNY  +Y+G + +G
Sbjct  252  WDPKLNFPHSSDAVRVASLLAEFFVNEGRRSLHHFDQPEEEAVSLIYNYTPTYAG-NFTG  310

Query  149  FVEVYIF  129
            + ++Y F
Sbjct  311  YEQIYFF  317



>ref|XP_005830901.1| hypothetical protein GUITHDRAFT_72685 [Guillardia theta CCMP2712]
 gb|EKX43921.1| hypothetical protein GUITHDRAFT_72685 [Guillardia theta CCMP2712]
Length=334

 Score =   126 bits (317),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 109/188 (58%), Gaps = 4/188 (2%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+LL I+V+    +L+ F+++N  S L   E       LFQ F  +L     ++ + +
Sbjct  133  LGFELLHILVARSGGVLQTFNSTNCRSKLNFTESAR-HSRLFQNFSNDLFEAARKKKIAV  191

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
            ++H +G+SPE+++    L +FF +L+TS D   K+YVS+++   +P+   Q+ PE+  FE
Sbjct  192  EHHMYGVSPEAYKNFPSLQSFFRILSTSADLQGKIYVSSMEAIDFPISGTQFHPEKPVFE  251

Query  323  WALS-EIPHSEDAILVSQSVANYFVSEARKSSNVP--NEPDVRDNLIYNYNTSYSGKDGS  153
            W    EI H   AIL++Q ++N  ++EA+K+S  P    P +   LIYNY+  Y   D  
Sbjct  252  WKTGQEISHDPQAILMAQMLSNALITEAKKNSRPPLSKGPQLNSLLIYNYSPIYISDDSI  311

Query  152  GFVEVYIF  129
             F +VY+F
Sbjct  312  PFEQVYVF  319



>ref|XP_007021920.1| Gamma-glutamyl hydrolase 1, putative [Theobroma cacao]
 gb|EOY13445.1| Gamma-glutamyl hydrolase 1, putative [Theobroma cacao]
Length=187

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 90/173 (52%), Gaps = 52/173 (30%)
 Frame = -2

Query  491  WGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPE---------  339
            +GISP++ Q + +LS+FF +LT++ D++NKVYVST Q   YPV A QW PE         
Sbjct  12   YGISPKTLQDNQNLSSFFKILTST-DENNKVYVSTAQAHDYPVTAFQWHPESRTLIAIQL  70

Query  338  ------------------------------------------RNAFEWALSEIPHSEDAI  285
                                                      +NAFEW    IPHSEDA+
Sbjct  71   ELKLPVFPLRISFCCFPDFQGIIQITYLLLMENRVGVLGDTKKNAFEWGSKMIPHSEDAV  130

Query  284  LVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             V+Q VAN+ +SEARKS N P    V DNLIYNY+ +  GK G G+ +VYIF+
Sbjct  131  QVTQHVANFLISEARKSLNRPPVRKVLDNLIYNYSPACCGKAGKGYDQVYIFT  183



>gb|EYU26306.1| hypothetical protein MIMGU_mgv1a019546mg [Erythranthe guttata]
Length=231

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 94/156 (60%), Gaps = 30/156 (19%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEG--LNVEGTLFQRFPYELLRKVGE  519
            AI LGF+LLT+IVSED  I++KF+A N AS  +V++   +N  G+LFQRFP  L  K+  
Sbjct  94   AICLGFELLTMIVSEDENIMDKFNAKNHASNFKVMKKPDVNGNGSLFQRFPEVLRNKLST  153

Query  518  ECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPE  339
            + LVMQNH       SF+ DA L +FF +L TS DK+ K                     
Sbjct  154  KSLVMQNH-------SFRRDARLDSFFKILATSTDKNGK---------------------  185

Query  338  RNAFEWALSEIPHSEDAILVSQSVANYFVSEARKSS  231
            +NAFEW LS IPHSEDA+ V+Q VA++FV  +  SS
Sbjct  186  KNAFEWGLSGIPHSEDAVHVTQHVADFFVRVSTSSS  221



>ref|XP_006860125.1| PREDICTED: gamma-glutamyl hydrolase [Chrysochloris asiatica]
Length=316

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 112/186 (60%), Gaps = 5/186 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+ LT++VS  N++    + +   S      G    G +F+ FP +LL  +  E L  
Sbjct  134  LGFEELTLLVSGKNLL--TLTETKSKSLPLNFTGGKYSGRMFRNFPADLLLSLSTEPLTA  191

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              HKW +S ++F ++  L +FFNV+TT+   DN  +VS+++G KYPV  VQW PE+  +E
Sbjct  192  NFHKWSLSMKNFTSNKKLKSFFNVITTN-TADNLEFVSSVEGYKYPVYGVQWHPEKPPYE  250

Query  323  WALSEIPHSEDAILVSQSVANYFVSEARKSSN-VPNEPDVRDNLIYNYNTSYSGKDGSGF  147
            W +S I HS +A+  +  +A +FVSEARK+++   ++ + R  LIY ++  YS K  S F
Sbjct  251  WGVSSISHSPNAVKTAFYLAEFFVSEARKNNHRFKSKDEERKALIYQFHPMYSEKF-SSF  309

Query  146  VEVYIF  129
             ++Y+F
Sbjct  310  QQIYLF  315



>ref|XP_003287039.1| hypothetical protein DICPUDRAFT_31892 [Dictyostelium purpureum]
 gb|EGC36406.1| hypothetical protein DICPUDRAFT_31892 [Dictyostelium purpureum]
Length=314

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 110/188 (59%), Gaps = 3/188 (2%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            +GFQ L ++ + +  +L  +++ N    L        E  +    P E+   +  + + M
Sbjct  128  MGFQELALLAAGNFDLLSSYNSENYTVPLNFTAAAK-ESNMLGNAPSEIFEALATQPITM  186

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
             NH++G+SP++F   + ++ FFNVL+T++D+D   ++STI+ K YP+  VQW PE+  FE
Sbjct  187  NNHQFGLSPQTFSDTSAINTFFNVLSTNVDRDGNTFISTIEAKNYPIYGVQWHPEKPIFE  246

Query  323  WALSEIP-HSEDAILVSQSVANYFVSEARKSSNVPNEPDVR-DNLIYNYNTSYSGKDGSG  150
            W   E+  HS  ++L +Q  +N+FV+E RKSS+  ++P V   +LIYNY   YS +    
Sbjct  247  WWDQEVMNHSFMSVLSNQYTSNFFVNECRKSSHSFSDPTVEAQSLIYNYQPQYSYQSVPD  306

Query  149  FVEVYIFS  126
            F ++Y F+
Sbjct  307  FEQIYYFN  314



>ref|XP_007937663.1| PREDICTED: gamma-glutamyl hydrolase [Orycteropus afer afer]
Length=316

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 113/186 (61%), Gaps = 5/186 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+ L+ +VS  N+ L K    N++  L    G  ++G +FQ FP +LL  +  E L  
Sbjct  134  LGFEELSFLVSGKNL-LTKTETENKSLPLNFT-GATLQGRMFQNFPADLLLSLSTEPLTA  191

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              HKW +S ++F A+  L  FFNV+TT+   D   +VS+++G KYP+  VQW PE++ +E
Sbjct  192  NFHKWSLSIKNFTANERLKTFFNVITTN-TVDKIEFVSSMEGYKYPIYGVQWHPEKSPYE  250

Query  323  WALSEIPHSEDAILVSQSVANYFVSEARKSS-NVPNEPDVRDNLIYNYNTSYSGKDGSGF  147
            W    I HS +A+  +  +A++FVSEARK+S +  +E + R+ LIY ++  ++G   S F
Sbjct  251  WENDYISHSSNAVKTAFYLADFFVSEARKNSHHFESEDEEREALIYQFHPVFTG-SLSSF  309

Query  146  VEVYIF  129
             + YIF
Sbjct  310  QQCYIF  315



>ref|XP_006625568.1| PREDICTED: gamma-glutamyl hydrolase-like [Lepisosteus oculatus]
Length=336

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 114/187 (61%), Gaps = 5/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LG QLLT++V+++N+ L K  A N A  L +         +F+ FP+E L+ + +E L  
Sbjct  153  LGHQLLTVLVAKENL-LTKTPAENLALPLNLTTAAK-SSRVFENFPHETLKALTQEPLTG  210

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              H +G++ E+F+ +  L  FF++L+T++ ++   +VST++GKKYP   VQW PE N FE
Sbjct  211  NFHHYGVTFETFKGNEKLEQFFSILSTNIAENGVKFVSTMEGKKYPFYGVQWHPEVNRFE  270

Query  323  WALS-EIPHSEDAILVSQSVANYFVSEARKSSNVPNEP-DVRDNLIYNYNTSYSGKDGSG  150
            W    + PHS +A+ VS  +A +FV+EARKSS+  + P D    L+YNY   ++    S 
Sbjct  271  WDPKVQYPHSRNAVRVSSLLAEFFVNEARKSSHHFSNPEDEEAALMYNYVPMFTSAFTS-  329

Query  149  FVEVYIF  129
            + +VY F
Sbjct  330  YNQVYFF  336



>ref|XP_007231561.1| PREDICTED: gamma-glutamyl hydrolase-like [Astyanax mexicanus]
Length=319

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 116/187 (62%), Gaps = 5/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            +GFQLLT++V+E+N+ L K  A N +  L +    +    +F+ FP EL++ + EE L  
Sbjct  136  MGFQLLTVLVAEENL-LSKTVAENISLPLNLTSEAS-SSRMFEDFPAELIKALTEEALTG  193

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              H +G++ + F+ +  LS+F+++L+T+  ++  ++VST++GKKYP   VQW PE N F+
Sbjct  194  NFHHYGVTEQVFKGNQKLSSFYSMLSTNKAENGVIFVSTMEGKKYPFYGVQWHPEVNRFQ  253

Query  323  WA-LSEIPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSG  150
            W+ L + PHS +A+ V+  +A +FV+E RKS  +     +    LIYNYN  Y   + + 
Sbjct  254  WSPLYDFPHSRNAVRVASLLAEFFVNEGRKSLHHFTQVQEENRALIYNYNPIYVA-NFTA  312

Query  149  FVEVYIF  129
            + +VY F
Sbjct  313  YEQVYFF  319



>ref|XP_008416492.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X2 [Poecilia 
reticulata]
 ref|XP_008416493.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X2 [Poecilia 
reticulata]
Length=298

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 114/187 (61%), Gaps = 5/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LG QLLT++V+E+N+ L    A N A  L +    +    +FQ F  EL++ + EE L  
Sbjct  115  LGMQLLTVLVAEENL-LSATPARNVALPLNLTTEAH-SSRMFQGFSKELIKALTEEPLTG  172

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              HK+G++ ++FQ +  LS FF++L+T++ ++   +VSTI+GK+YP   VQW PE N F+
Sbjct  173  NFHKYGLTVQTFQENEKLSGFFSLLSTNVAENGAQFVSTIEGKRYPFYGVQWHPEVNRFQ  232

Query  323  WALS-EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRD-NLIYNYNTSYSGKDGSG  150
            W  +   PHS  AI VS  +A +F++E RKS +  + P+  D +LIY +   Y+  + + 
Sbjct  233  WNRNLSFPHSSHAIQVSSQLAEFFINEGRKSFHHFDSPEEEDASLIYKFTPVYT-SNFTA  291

Query  149  FVEVYIF  129
            + +VY F
Sbjct  292  YEQVYFF  298



>ref|XP_005795110.1| PREDICTED: gamma-glutamyl hydrolase-like [Xiphophorus maculatus]
Length=298

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 113/187 (60%), Gaps = 5/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LG QLLT++V+E+N+ L    A N+A  L +    +    +FQ F  EL++ + EE L  
Sbjct  115  LGMQLLTVLVAEENL-LSATPARNEALPLNLTTEAH-SSRMFQGFSKELIKALTEEPLTG  172

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              H +G++ E+FQ +  LS FF++L+T++ ++   +VSTI+GK+YP   VQW PE N F+
Sbjct  173  NFHNYGVTVEAFQKNEKLSGFFSLLSTNVAENGAHFVSTIEGKRYPFYGVQWHPEVNRFQ  232

Query  323  WALS-EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRD-NLIYNYNTSYSGKDGSG  150
            W      PHS  A+ +S  +A +F++E RKS +  + P+  D +LIY +   Y+  + + 
Sbjct  233  WNRKLSFPHSSHAVRLSSQIAEFFINEGRKSFHHFDSPEEEDASLIYKFTPVYT-SNFTA  291

Query  149  FVEVYIF  129
            + +VY F
Sbjct  292  YEKVYFF  298



>ref|XP_008416491.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X1 [Poecilia 
reticulata]
Length=321

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 114/187 (61%), Gaps = 5/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LG QLLT++V+E+N+ L    A N A  L +    +    +FQ F  EL++ + EE L  
Sbjct  138  LGMQLLTVLVAEENL-LSATPARNVALPLNLTTEAH-SSRMFQGFSKELIKALTEEPLTG  195

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              HK+G++ ++FQ +  LS FF++L+T++ ++   +VSTI+GK+YP   VQW PE N F+
Sbjct  196  NFHKYGLTVQTFQENEKLSGFFSLLSTNVAENGAQFVSTIEGKRYPFYGVQWHPEVNRFQ  255

Query  323  WALS-EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRD-NLIYNYNTSYSGKDGSG  150
            W  +   PHS  AI VS  +A +F++E RKS +  + P+  D +LIY +   Y+  + + 
Sbjct  256  WNRNLSFPHSSHAIQVSSQLAEFFINEGRKSFHHFDSPEEEDASLIYKFTPVYT-SNFTA  314

Query  149  FVEVYIF  129
            + +VY F
Sbjct  315  YEQVYFF  321



>ref|XP_637673.1| peptidase C26 family protein [Dictyostelium discoideum AX4]
 sp|Q54LN4.1|GGHA_DICDI RecName: Full=Gamma-glutamyl hydrolase A; AltName: Full=Conjugase 
A; AltName: Full=GH A; AltName: Full=Gamma-Glu-X carboxypeptidase 
A; Flags: Precursor [Dictyostelium discoideum]
 gb|EAL64169.1| peptidase C26 family protein [Dictyostelium discoideum AX4]
Length=317

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 109/187 (58%), Gaps = 3/187 (2%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            +GFQ L ++ +++  +L  +++ N    L     L     LF      +++ +  E + M
Sbjct  131  MGFQELALLSADNFNLLSSYNSENYTVPLNFTS-LAAGSRLFSLASSSIMQSLASEPITM  189

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
             NH++G+SP+++Q  + ++ FF+VL+T++D+D   ++STI+ K YP+   QW PE+  FE
Sbjct  190  NNHQFGLSPQTYQQTSSINTFFDVLSTNVDRDGNTFISTIEAKNYPIYGTQWHPEKPIFE  249

Query  323  WALSEIP-HSEDAILVSQSVANYFVSEARKSSNVPNEPDVR-DNLIYNYNTSYSGKDGSG  150
            W   E+  HS D+I+ +Q  +N+FV+E RKS +  ++P V    LIYNY   YS      
Sbjct  250  WWDQEVMNHSFDSIMANQYTSNFFVNECRKSLHSFSDPSVEASTLIYNYTPQYSESTVPD  309

Query  149  FVEVYIF  129
            F ++Y F
Sbjct  310  FEQIYYF  316



>ref|XP_004372622.1| PREDICTED: gamma-glutamyl hydrolase [Trichechus manatus latirostris]
Length=316

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 71/189 (38%), Positives = 112/189 (59%), Gaps = 11/189 (6%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQV---VEGLNVEGTLFQRFPYELLRKVGEEC  513
            LGF+ LT++VSE+N++      S +   L +     G  ++G +F+ FP +LL  +  E 
Sbjct  134  LGFEALTLLVSEENLL-----TSTKTENLSLPLNFTGATLQGRMFRNFPADLLLSLSTEP  188

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            L    HKW +S ++F A+  L  FFNV+TT+   D   +VS+++G KYPV  VQW PE+ 
Sbjct  189  LTANFHKWSLSMKNFTANEKLKTFFNVITTN-TADKIEFVSSVEGYKYPVYGVQWHPEKP  247

Query  332  AFEWALSEIPHSEDAILVSQSVANYFVSEARKSS-NVPNEPDVRDNLIYNYNTSYSGKDG  156
             +EW    I  S +A+  +  +A +FVSEARK++ +  +E + R+ LIY +   Y+G + 
Sbjct  248  PYEWGNDNISRSPNAVKAAFYLAEFFVSEARKNNHHFESEDEEREALIYQFRPIYTG-NF  306

Query  155  SGFVEVYIF  129
            S F + YIF
Sbjct  307  SSFQQSYIF  315



>ref|XP_007231126.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X3 [Astyanax 
mexicanus]
Length=310

 Score =   123 bits (309),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 113/186 (61%), Gaps = 5/186 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+ LT++ SE  ++L   + S  A  L     ++ +  +F+ FP +L+  +  E L  
Sbjct  128  LGFEQLTLLTSE-KLLLSHTNTSGVALPLNFTSEVS-DSRMFKDFPKDLMTSLANEPLTE  185

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
             +H+W I+ ESF+ +  L+ F+ +L+T+ D   K +VST++   YPV   QW PE+N FE
Sbjct  186  NSHQWSITTESFKGNEKLNKFYRILSTNTD-GQKEFVSTVEAYDYPVYGTQWHPEKNTFE  244

Query  323  WALSEIPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGF  147
            W    IPH+  AI  +  +A++FV+EA+KS  +  ++ + ++ LIYNY+ SY+GK  S F
Sbjct  245  WTRPYIPHTPSAIKTTFYMADFFVNEAKKSLHSFSSQEEEQNALIYNYSPSYTGKT-SIF  303

Query  146  VEVYIF  129
             ++Y F
Sbjct  304  EQIYYF  309



>gb|AAC83043.1| Similar to gb|AF067141 gamma-glutamyl hydrolase from Arabidopsis 
thaliana; the beginning of this gene is cut off. ESTs gb|H76503 
and gb|AA712367 come from this gene, partial [Arabidopsis 
thaliana]
Length=98

 Score =   117 bits (293),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = -2

Query  401  VYVSTIQGKKYPVVAVQWAPERNAFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVP  222
             YVST++ K+YP+   QW PE+NAFEW  S IPHSEDAI V+Q  A+Y VSEARKS N P
Sbjct  1    TYVSTVKAKRYPITGFQWHPEKNAFEWGSSAIPHSEDAIQVTQHAASYLVSEARKSLNRP  60

Query  221  NEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
                V  NLIYNY  +Y G  G G+ EVYIF+
Sbjct  61   ESQKVLSNLIYNYKPTYCGYAGRGYDEVYIFT  92



>gb|EFA81874.1| peptidase C26 family protein [Polysphondylium pallidum PN500]
Length=321

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 108/187 (58%), Gaps = 3/187 (2%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            +GFQ L ++  +D  IL  F++ N    + +    +   TLF     E++  +  + + M
Sbjct  129  MGFQQLCMLAGDDFNILTGFNSENYTVPINMTAAAS-SSTLFSLASPEIMSALANQPITM  187

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
             NH +G+SP ++Q ++DL++FF VL+T++D+D   ++STI+ K YP+   QW PE+  FE
Sbjct  188  NNHMYGVSPAAYQQNSDLNSFFEVLSTNVDRDGLTFLSTIEAKNYPIYGTQWHPEKPLFE  247

Query  323  WALSEIP-HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRD-NLIYNYNTSYSGKDGSG  150
            W   E+  HS D+IL +Q  A +FV++AR ++N    P     +LIYN+   YS      
Sbjct  248  WWDEEVMNHSYDSILANQYTALFFVNQARNNNNKFTYPAQESTSLIYNFTPVYSFDIAPD  307

Query  149  FVEVYIF  129
            F +VY F
Sbjct  308  FEQVYYF  314



>ref|XP_007894923.1| PREDICTED: gamma-glutamyl hydrolase [Callorhinchus milii]
Length=318

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 113/186 (61%), Gaps = 5/186 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+ LT   S +N+ L   + SN    L   +  + +  +F++FP +LL+ + EE L  
Sbjct  134  LGFEELTFTTSGENL-LTLTNTSNLTLPLTFTKE-SRDSRMFKKFPKDLLQALAEEPLTA  191

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              HKW +S ++F ++A LSN + +LTT+ D     ++ST++ + YP+ AVQW PE+N +E
Sbjct  192  NFHKWSLSVKNFTSNAKLSNSYRILTTNTDSQGLQFISTMEARNYPIYAVQWHPEKNPYE  251

Query  323  WALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSG  150
            W+  E IPHS  A+  +  +A +FV+EARK+  +  NE +    LI+NY + Y+G D S 
Sbjct  252  WSKKENIPHSLTAVKAAWYMAEFFVNEARKNLHHFSNETEEAKALIHNYLSIYTG-DISN  310

Query  149  FVEVYI  132
            F ++Y 
Sbjct  311  FQQMYF  316



>ref|XP_002156669.1| PREDICTED: gamma-glutamyl hydrolase A-like [Hydra vulgaris]
Length=319

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 113/190 (59%), Gaps = 6/190 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+ L +I +E   +L  F+A + +  L      +    LF      L + +  E +  
Sbjct  123  LGFETLHVIATESGDVLTNFAAEDISLALNFTPDASTS-RLFSGIDKNLFKALSAENITY  181

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
             +H +GISP+ +   + L +F+ VL+T+ D +   +VS+I+   YP    QW PE+NAFE
Sbjct  182  NHHSYGISPKEYTVRSTLKSFYKVLSTNKDVNGLTFVSSIEAYDYPFYGTQWHPEKNAFE  241

Query  323  WALSE-IPHSEDAILVSQSVANYFVSEARKSSN-VPNEPDVRDNLIYNYNTSYS-GKDG-  156
            ++ +E +PHS +A+ ++Q VAN+FV E+RK+S+  P+    +D LIYNYN  Y+ GK+G 
Sbjct  242  FSQNEQLPHSVNAVRMAQYVANFFVDESRKNSHKFPSAKLEQDYLIYNYNPVYTGGKEGR  301

Query  155  -SGFVEVYIF  129
             + F +VY+F
Sbjct  302  LTNFEQVYLF  311



>gb|ACO09704.1| Gamma-glutamyl hydrolase precursor [Osmerus mordax]
Length=384

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 110/191 (58%), Gaps = 15/191 (8%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV-----EGTLFQRFPYELLRKVGE  519
            LGF+ L  + S +N++       +  +T  V   LN      +G +F+ FP ++L  +  
Sbjct  203  LGFEELAYLTSGENLL-------SHTNTSGVALPLNFTKESRDGRMFKGFPADVLSALAT  255

Query  518  ECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPE  339
            E +   +H+W ++ ESF +  +L NF+ VL+T+ D   + +VST++  K+P+   QW PE
Sbjct  256  EAITENSHQWSLTTESFNSRKELKNFYRVLSTNTDGTTE-FVSTMEAYKFPIYGTQWHPE  314

Query  338  RNAFEWALSEIPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGK  162
            +NAFEW+   IPHS  A+  +  +A++ V+EAR+S     NE + +  LIYNYN  Y+G 
Sbjct  315  KNAFEWSRPYIPHSPAAVKTTFYMADFLVNEARQSFHRFENEEEEKKALIYNYNPVYTGV  374

Query  161  DGSGFVEVYIF  129
              S F ++Y F
Sbjct  375  K-SAFEQIYFF  384



>ref|XP_006487640.1| PREDICTED: gamma-glutamyl hydrolase 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006487641.1| PREDICTED: gamma-glutamyl hydrolase 1-like isoform X2 [Citrus 
sinensis]
 ref|XP_006487642.1| PREDICTED: gamma-glutamyl hydrolase 1-like isoform X3 [Citrus 
sinensis]
Length=97

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = -2

Query  506  MQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAF  327
            MQNH +GISPE  QA+ +L+ FF +LTTS+D+ NKVYV T+Q   YPV A QW  E+NAF
Sbjct  1    MQNHHYGISPERMQANQELAKFFKILTTSVDEYNKVYVLTVQAYNYPVTAFQWHSEKNAF  60

Query  326  EWALSEIPHSEDAILVSQSVANYFV  252
            EW    IPH+EDAI V+Q  AN+F+
Sbjct  61   EWGPKAIPHTEDAIRVTQQAANFFI  85



>gb|KFW02734.1| Gamma-glutamyl hydrolase, partial [Eurypyga helias]
Length=283

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 92/150 (61%), Gaps = 4/150 (3%)
 Frame = -2

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
            +  LF+ FPY++L     E L    H W +S E+F  +  L NF+NVLTT+ D + + ++
Sbjct  135  DSRLFKNFPYDVLHAFATEPLTSNFHMWSLSMENFTKNEKLRNFYNVLTTNTDGEVE-FI  193

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+ +VQW PE+N FEW  S  IPHS  A+  +  VA++F++EARKS    P+
Sbjct  194  STMEAYKYPIYSVQWHPEKNPFEWKNSPGIPHSPSAVRAAYYVADFFINEARKSLHRFPS  253

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY   Y+G   S F ++Y F
Sbjct  254  EEEETKELIYNYTPIYTG-TFSSFQQIYFF  282



>ref|XP_008287386.1| PREDICTED: gamma-glutamyl hydrolase-like [Stegastes partitus]
Length=320

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 114/187 (61%), Gaps = 5/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            +G QLLT++V+E N+ L + +A N A  L +    +    +F  FP EL++ + +E L  
Sbjct  137  MGMQLLTVLVAEKNL-LTRTTAENVALPLNLTTEAH-SSRMFTGFPDELMKALTQEPLTG  194

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              H +G++ ++FQ +  L +FF++L+T++ +    +VSTI+G++YP   VQW PE N F+
Sbjct  195  NFHHYGVTVQNFQENTKLHSFFSLLSTNVAESGAHFVSTIEGRRYPFYGVQWHPEVNRFQ  254

Query  323  WALS-EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVR-DNLIYNYNTSYSGKDGSG  150
            W      PHS  A+ +S  +A +FV+E R+S +  + P+    +LIY+Y   Y+G + +G
Sbjct  255  WDRELNFPHSAHAVQLSSLLAQFFVNEGRRSLHRFDNPEEEASSLIYSYTPVYAG-NFTG  313

Query  149  FVEVYIF  129
            + ++Y F
Sbjct  314  YEQIYFF  320



>ref|XP_010147217.1| PREDICTED: gamma-glutamyl hydrolase, partial [Eurypyga helias]
Length=287

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 92/150 (61%), Gaps = 4/150 (3%)
 Frame = -2

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
            +  LF+ FPY++L     E L    H W +S E+F  +  L NF+NVLTT+ D + + ++
Sbjct  139  DSRLFKNFPYDVLHAFATEPLTSNFHMWSLSMENFTKNEKLRNFYNVLTTNTDGEVE-FI  197

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+ +VQW PE+N FEW  S  IPHS  A+  +  VA++F++EARKS    P+
Sbjct  198  STMEAYKYPIYSVQWHPEKNPFEWKNSPGIPHSPSAVRAAYYVADFFINEARKSLHRFPS  257

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY   Y+G   S F ++Y F
Sbjct  258  EEEETKELIYNYTPIYTGT-FSSFQQIYFF  286



>ref|XP_005009586.1| PREDICTED: gamma-glutamyl hydrolase [Anas platyrhynchos]
Length=393

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 106/187 (57%), Gaps = 6/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LG + LT + S + ++L     +  A  L        +  LF+  P +LLR +  E L  
Sbjct  210  LGHEELTYLTS-NKVLLVNTKTTGLALPLNFTSAAK-DSRLFKNLPKDLLRALANEPLTS  267

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              H+W +S E+F  +  L  F+NVLTT+ D + + Y+ST++  KYP+ +VQW PE++ FE
Sbjct  268  NFHRWSLSMENFTKNEKLHKFYNVLTTNTDGEVE-YISTMEAYKYPIYSVQWHPEKSPFE  326

Query  323  WALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSG  150
            W  S  IPHS  A+  +  +A++FV+EARKS    P+E + R  LIYNY   Y+G   S 
Sbjct  327  WKKSTGIPHSSSAVRAAYYIADFFVNEARKSLHRFPSEDEERKELIYNYTPIYTG-TFSS  385

Query  149  FVEVYIF  129
            F + Y F
Sbjct  386  FQQAYFF  392



>gb|KFR13230.1| Gamma-glutamyl hydrolase, partial [Opisthocomus hoazin]
Length=272

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 89/147 (61%), Gaps = 4/147 (3%)
 Frame = -2

Query  563  LFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTI  384
            LF+ FP +LL     E L    H W +S E+F  +  L NF+NVLTT+ D D   ++ST+
Sbjct  127  LFKNFPDDLLHAFATEPLTSNFHMWSLSMENFTKNEKLHNFYNVLTTNTD-DQVEFISTM  185

Query  383  QGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPD  210
            +  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++F++EARKS  + P+E +
Sbjct  186  EAYKYPIYGVQWHPEKNPFEWKNSPGIPHSPSAVRAAYYIADFFINEARKSLHHFPSEDE  245

Query  209  VRDNLIYNYNTSYSGKDGSGFVEVYIF  129
                LIYNY   Y+G   S F ++Y F
Sbjct  246  ETKELIYNYTPVYTGT-FSSFQQIYFF  271



>ref|XP_419226.4| PREDICTED: gamma-glutamyl hydrolase [Gallus gallus]
Length=439

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 107/187 (57%), Gaps = 6/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LG +LLT + S + +++   + +N  S             LF+  P +LL     E L  
Sbjct  256  LGHELLTYLTSGEILLVN--TKTNGFSLPLNFTSAAKRSRLFKNLPNDLLHAFANEPLTS  313

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              H W IS E+F  +  L NF+N+LTT++D + + ++ST++  KYP+  VQW PE+N+FE
Sbjct  314  NFHVWSISMENFTKNEKLYNFYNILTTNIDNEVE-FISTMEAYKYPIYGVQWHPEKNSFE  372

Query  323  WA-LSEIPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSG  150
            W   S IPHS  AI  +  +A++F++EARKS    P+E +    LIYNY  +Y+G   S 
Sbjct  373  WKNSSGIPHSSSAIRAAHYIADFFINEARKSLHRFPSEGEETKELIYNYTPTYTGTF-SS  431

Query  149  FVEVYIF  129
            F +VY F
Sbjct  432  FQQVYFF  438



>ref|XP_003974928.1| PREDICTED: gamma-glutamyl hydrolase-like [Takifugu rubripes]
Length=320

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 113/190 (59%), Gaps = 11/190 (6%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGT---LFQRFPYELLRKVGEEC  513
            +G QLLT++V+ +N++     ++  A  L +   L  E +   +F+ FP +L+R + +E 
Sbjct  137  MGLQLLTVLVAGENLL-----SNTTAENLALPLNLTAEASSSRMFKGFPDDLMRALAQEP  191

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
            L    H +G++ ++F A+  L +FF++L+T++  +   +VST++GKKYP   VQW PE N
Sbjct  192  LTGNFHHYGVTVKTFLANTKLRSFFSILSTNVAANGAHFVSTMEGKKYPFYGVQWHPEVN  251

Query  332  AFEWALS-EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVR-DNLIYNYNTSYSGKD  159
             F+W      PHS  AI +S  +A +F +E R+S +   +P+    +LIY YN  Y+  +
Sbjct  252  RFQWKSGLSFPHSPHAIQLSSLLAEFFTNEGRRSLHHFEDPEEEASSLIYKYNPVYAA-N  310

Query  158  GSGFVEVYIF  129
             +G+ ++Y F
Sbjct  311  ITGYEQIYFF  320



>ref|NP_034411.2| gamma-glutamyl hydrolase precursor [Mus musculus]
 sp|Q9Z0L8.2|GGH_MOUSE RecName: Full=Gamma-glutamyl hydrolase; AltName: Full=Conjugase; 
AltName: Full=FGPH; AltName: Full=Folylpolyglutamate hydrolase; 
AltName: Full=GH; AltName: Full=Gamma-Glu-x carboxypeptidase; 
Flags: Precursor [Mus musculus]
Length=317

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 111/187 (59%), Gaps = 6/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+ L+++VS +N++    + S +   L   EG   +  +F+ FP ELL  +  E L  
Sbjct  134  LGFEELSVLVSGENLLTSTDTKSKKLP-LNFTEGAR-KSRMFKHFPTELLDSLALENLTA  191

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              HKW +S ++F  +  L  FFN+LTT+ D   + ++S+++G KYPV AVQW PE+ AFE
Sbjct  192  NFHKWSLSVKNFTENEKLKKFFNILTTNTDGKTE-FISSMEGFKYPVYAVQWHPEKAAFE  250

Query  323  WA-LSEIPHSEDAILVSQSVANYFVSEARKSS-NVPNEPDVRDNLIYNYNTSYSGKDGSG  150
            W  L  I H+ +A+  S  +A + VSEARK+S +  N      +LIY +N  Y+G + S 
Sbjct  251  WKNLGGISHAPNAVKTSFYLAEFLVSEARKNSHHFENVVKETASLIYKFNPIYTG-NISS  309

Query  149  FVEVYIF  129
            F + Y+F
Sbjct  310  FQQAYMF  316



>gb|AAI24119.1| LOC553228 protein [Danio rerio]
Length=331

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 110/188 (59%), Gaps = 7/188 (4%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVV-EGLNVEGTLFQRFPYELLRKVGEECLV  507
            LGFQLLT++V+ +N+ L K +A N    L    E L+    +F  FP EL R + EE L 
Sbjct  148  LGFQLLTVLVAGENL-LSKTTAENVTYPLNFSSEALS--SRMFSSFPSELRRALSEEPLT  204

Query  506  MQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAF  327
               H +G++ E+F ++  L+  F+V++TS+ ++   +VSTI+G+KYP   VQW PE N F
Sbjct  205  ADFHHYGVTKEAFMSNEKLTGLFSVISTSIAQNGVEFVSTIEGRKYPFYGVQWHPEVNRF  264

Query  326  EW-ALSEIPHSEDAILVSQSVANYFVSEARKSSN-VPNEPDVRDNLIYNYNTSYSGKDGS  153
            +W      PHS +A+ VS  +A +FV+E R+S++   +  +    LIYN N  Y  K  S
Sbjct  265  QWNPHYSFPHSSNAVHVSSLLAQFFVNEGRRSTHRFSDAAEESAALIYNCNPVYVEKI-S  323

Query  152  GFVEVYIF  129
             + + Y F
Sbjct  324  AYEQSYFF  331



>ref|XP_009936040.1| PREDICTED: gamma-glutamyl hydrolase [Opisthocomus hoazin]
Length=295

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 89/147 (61%), Gaps = 4/147 (3%)
 Frame = -2

Query  563  LFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTI  384
            LF+ FP +LL     E L    H W +S E+F  +  L NF+NVLTT+ D D   ++ST+
Sbjct  150  LFKNFPDDLLHAFATEPLTSNFHMWSLSMENFTKNEKLHNFYNVLTTNTD-DQVEFISTM  208

Query  383  QGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPD  210
            +  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++F++EARKS  + P+E +
Sbjct  209  EAYKYPIYGVQWHPEKNPFEWKNSPGIPHSPSAVRAAYYIADFFINEARKSLHHFPSEDE  268

Query  209  VRDNLIYNYNTSYSGKDGSGFVEVYIF  129
                LIYNY   Y+G   S F ++Y F
Sbjct  269  ETKELIYNYTPVYTGT-FSSFQQIYFF  294



>ref|XP_009584845.1| PREDICTED: gamma-glutamyl hydrolase, partial [Fulmarus glacialis]
Length=286

 Score =   117 bits (294),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 104/187 (56%), Gaps = 6/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LG + LT + S + ++L        A  L        +  LF+ FP ++L     E L  
Sbjct  103  LGHEELTYLTSGE-VLLVNTKTDGFALPLNFTSAAK-DSRLFKNFPDDVLYAFATEPLTS  160

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              HKW +S E+F  +  L NF+NVLTT+ D D   ++ST++  KYP+  VQW PE+N FE
Sbjct  161  NFHKWSLSMENFTKNEKLRNFYNVLTTNTD-DEVEFISTMEAYKYPIYGVQWHPEKNPFE  219

Query  323  WALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSG  150
            W  S  IPHS  A+  +  +A++F++EARKS  + P+E +    LIYNY   Y+G   S 
Sbjct  220  WKNSPGIPHSPSAVRAAYYIADFFINEARKSLHHFPSEDEETKELIYNYTPIYTGA-FSS  278

Query  149  FVEVYIF  129
            F ++Y F
Sbjct  279  FQQIYFF  285



>gb|KFV98034.1| Gamma-glutamyl hydrolase, partial [Fulmarus glacialis]
Length=282

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 104/187 (56%), Gaps = 6/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LG + LT + S + ++L        A  L        +  LF+ FP ++L     E L  
Sbjct  99   LGHEELTYLTSGE-VLLVNTKTDGFALPLNFTSAAK-DSRLFKNFPDDVLYAFATEPLTS  156

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              HKW +S E+F  +  L NF+NVLTT+ D D   ++ST++  KYP+  VQW PE+N FE
Sbjct  157  NFHKWSLSMENFTKNEKLRNFYNVLTTNTD-DEVEFISTMEAYKYPIYGVQWHPEKNPFE  215

Query  323  WALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSG  150
            W  S  IPHS  A+  +  +A++F++EARKS  + P+E +    LIYNY   Y+G   S 
Sbjct  216  WKNSPGIPHSPSAVRAAYYIADFFINEARKSLHHFPSEDEETKELIYNYTPIYTGA-FSS  274

Query  149  FVEVYIF  129
            F ++Y F
Sbjct  275  FQQIYFF  281



>ref|XP_005730485.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X2 [Pundamilia 
nyererei]
Length=310

 Score =   118 bits (295),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 103/187 (55%), Gaps = 5/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGT-LFQRFPYELLRKVGEECLV  507
            LGF+ L  + S+ N IL   + S  A  L    G+  E + +F+ FP +L++ +  E L 
Sbjct  127  LGFEQLMYLTSK-NTILAYTNTSGAALPLNFTNGMFSEDSRMFKGFPAQLMKDLASEPLT  185

Query  506  MQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAF  327
            + +HKW +   ++  + +L  F+ VL+ + D  N  +VST++   YP+   QW PE+NAF
Sbjct  186  VNSHKWSLGMLTYNTNEELKKFYKVLSVNTD-GNVEFVSTVEAYDYPIYGTQWHPEKNAF  244

Query  326  EWALSEIPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSG  150
            EW    IPHS  A+  +  +A +FV+EARK+      E      LIYNYN  Y+G   S 
Sbjct  245  EWTRPSIPHSPSAVKTTFYMAEFFVNEARKNFHKFETEEGESKALIYNYNPVYTGTK-SA  303

Query  149  FVEVYIF  129
            F ++Y F
Sbjct  304  FEQIYFF  310



>emb|CDQ59361.1| unnamed protein product [Oncorhynchus mykiss]
Length=307

 Score =   118 bits (295),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 110/186 (59%), Gaps = 5/186 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+ LT + S   ++L   + S  A  L V    + E  +F+ FP E+L  +  E +  
Sbjct  126  LGFEELTYLTS-GKMLLSHTNTSGVALPL-VFTNRSRESRMFKGFPSEVLDALASEPITE  183

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
             +HKW ++   + ++ADL  F+ VLTTS D  N+ +VST++   +P+   QW PE+NAFE
Sbjct  184  NSHKWSLTLAIYNSNADLRKFYKVLTTSSDGINE-FVSTMEAYGFPIYGTQWHPEKNAFE  242

Query  323  WALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDV-RDNLIYNYNTSYSGKDGSGF  147
            W  + IPHS  A+ V+  +A++FV+EARK+ +   + +V +  LIYNYN  Y G   S F
Sbjct  243  WTKTYIPHSPLAVKVTFFMADFFVNEARKNFHKFEDEEVEKRALIYNYNPVYIGIK-SAF  301

Query  146  VEVYIF  129
             ++Y F
Sbjct  302  EQIYYF  307



>gb|KFP45914.1| Gamma-glutamyl hydrolase, partial [Chlamydotis macqueenii]
Length=281

 Score =   117 bits (293),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 88/147 (60%), Gaps = 4/147 (3%)
 Frame = -2

Query  563  LFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTI  384
            LF+ FP ++L     E L    H W +S E+F  +  L NF+NVLTT+ D D   ++ST+
Sbjct  137  LFKNFPDDVLHAFATEPLTSNFHVWSLSMENFTKNERLRNFYNVLTTNTD-DEVEFISTM  195

Query  383  QGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPD  210
            +  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++FV+EARKS    P+E D
Sbjct  196  EAYKYPIYGVQWHPEKNPFEWKNSPGIPHSSSAVRAAYYIADFFVNEARKSLHRFPSEDD  255

Query  209  VRDNLIYNYNTSYSGKDGSGFVEVYIF  129
                LIYNY   Y+G   S F ++Y F
Sbjct  256  ETKELIYNYTPVYTGT-FSSFQQIYFF  281



>ref|XP_010127038.1| PREDICTED: gamma-glutamyl hydrolase, partial [Chlamydotis macqueenii]
Length=286

 Score =   117 bits (293),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 88/147 (60%), Gaps = 4/147 (3%)
 Frame = -2

Query  563  LFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTI  384
            LF+ FP ++L     E L    H W +S E+F  +  L NF+NVLTT+ D D   ++ST+
Sbjct  142  LFKNFPDDVLHAFATEPLTSNFHVWSLSMENFTKNERLRNFYNVLTTNTD-DEVEFISTM  200

Query  383  QGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPD  210
            +  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++FV+EARKS    P+E D
Sbjct  201  EAYKYPIYGVQWHPEKNPFEWKNSPGIPHSSSAVRAAYYIADFFVNEARKSLHRFPSEDD  260

Query  209  VRDNLIYNYNTSYSGKDGSGFVEVYIF  129
                LIYNY   Y+G   S F ++Y F
Sbjct  261  ETKELIYNYTPVYTGT-FSSFQQIYFF  286



>ref|XP_008171736.1| PREDICTED: LOW QUALITY PROTEIN: gamma-glutamyl hydrolase [Chrysemys 
picta bellii]
Length=326

 Score =   118 bits (295),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 111/188 (59%), Gaps = 8/188 (4%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LG Q LT + SE N+++ K    N +  L        +  +FQ FP +LL+K+  E L  
Sbjct  144  LGHQELTYLTSEKNLLV-KTKTENISLPLTFTTAAK-DSRMFQNFPDDLLQKLATEPLTA  201

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKV-YVSTIQGKKYPVVAVQWAPERNAF  327
              HKW +S ++F+ +  L NF+ VLTT  + D K+ + S+++  KYP+  VQW PE++ F
Sbjct  202  HFHKWSLSMKNFRKNEKLHNFYKVLTT--NTDGKIEFASSMEAYKYPIYGVQWHPEKSPF  259

Query  326  EWA-LSEIPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGS  153
            EW  +S IPHS  A+ V+  +A++ V+EARKS  + P++ +  + LIYNY   +S    S
Sbjct  260  EWKNVSGIPHSPSAVKVTYYIADFLVNEARKSLHHFPSKDEETEALIYNYVPVFSSA-FS  318

Query  152  GFVEVYIF  129
             F ++Y F
Sbjct  319  IFQQIYFF  326



>ref|XP_007557581.1| PREDICTED: gamma-glutamyl hydrolase-like [Poecilia formosa]
Length=321

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 113/187 (60%), Gaps = 5/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LG QLLT++V+E+N+ L    A N A  L +    +    +FQ F  EL++ + EE L  
Sbjct  138  LGMQLLTVLVAEENL-LSATPARNVALPLNLTTEAH-SSRMFQGFSKELIKALTEEPLTG  195

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              HK+G++ ++FQ +  LS FF++L+T++ ++   +VSTI+GK+YP   VQW PE N F+
Sbjct  196  NFHKYGLTVQAFQENEKLSGFFSLLSTNVAENGAQFVSTIEGKRYPFYGVQWHPEVNRFQ  255

Query  323  WALS-EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRD-NLIYNYNTSYSGKDGSG  150
            W  +   PHS  AI +S  +A +F++E RKS +  +  +  D +LIY +   Y+  + + 
Sbjct  256  WNRNFSFPHSSYAIQLSSQLAEFFINEGRKSFHHFDSREEEDASLIYKFTPVYT-SNFTA  314

Query  149  FVEVYIF  129
            + +VY F
Sbjct  315  YEQVYFF  321



>ref|XP_005652325.1| class I glutamine amidotransferase-like protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27781.1| class I glutamine amidotransferase-like protein [Coccomyxa subellipsoidea 
C-169]
Length=324

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 101/182 (55%), Gaps = 3/182 (2%)
 Frame = -2

Query  692  AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            AI LGF+ L +I S +  IL  + + + A+ L   E   +    F     E++  +  + 
Sbjct  112  AICLGFETLAVIASGNTSILGSYDSEDTAAPLYFTEKA-LGSRFFGSLRPEIVADLAAKP  170

Query  512  LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
               ++H  G+S  SF AD  L   + VL+ S D + +VY+ST++ KKYP  A QW PE+N
Sbjct  171  YARESHSHGLSLASFDADKVLKEEYEVLSLSTDPEGEVYISTMESKKYPYTATQWHPEKN  230

Query  332  AFEWALS-EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDN-LIYNYNTSYSGKD  159
            AFEW     IPHS+ AI V+ +VA++FV EAR S + P +    DN LIY     ++G+ 
Sbjct  231  AFEWGDKLHIPHSKGAIDVTYAVASFFVDEARGSFHAPRDVIEEDNALIYGARLEFTGRH  290

Query  158  GS  153
             S
Sbjct  291  TS  292



>gb|KFZ55994.1| Gamma-glutamyl hydrolase, partial [Podiceps cristatus]
Length=282

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 88/147 (60%), Gaps = 4/147 (3%)
 Frame = -2

Query  563  LFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTI  384
            LF+ FP ++L     E L    H W +S E+F  +  L NF+NVLTT+ D D   Y+ST+
Sbjct  137  LFKNFPDDVLHAFATEPLTSNFHMWSLSMENFTKNEKLRNFYNVLTTNTD-DEVEYISTM  195

Query  383  QGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPD  210
            +  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++FV+EARKS  + P+E +
Sbjct  196  EAYKYPIYGVQWHPEKNPFEWKNSPGIPHSPSAVKAAYYIADFFVNEARKSLHHFPSEDE  255

Query  209  VRDNLIYNYNTSYSGKDGSGFVEVYIF  129
                LIYNY   Y+G   S F + Y F
Sbjct  256  ETKELIYNYTPIYTGT-FSSFQQTYFF  281



>ref|XP_010016975.1| PREDICTED: gamma-glutamyl hydrolase, partial [Nestor notabilis]
Length=281

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 91/147 (62%), Gaps = 4/147 (3%)
 Frame = -2

Query  563  LFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTI  384
            LF+ FP +LL  +  E L    H W +S E+F  + +L NF+NVLTT+ + D   ++ST+
Sbjct  136  LFKNFPDDLLHALATEPLTSNFHTWSLSLENFTKNEELHNFYNVLTTNTN-DQVEFISTM  194

Query  383  QGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPD  210
            +  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++F++EARKS  + P+E +
Sbjct  195  EAYKYPIYGVQWHPEKNPFEWKSSPGIPHSPSAVRAAYYIADFFINEARKSLHHFPSEAE  254

Query  209  VRDNLIYNYNTSYSGKDGSGFVEVYIF  129
                LIYNY   Y+G   S F ++Y F
Sbjct  255  ETKELIYNYIPLYTGT-FSSFQQIYFF  280



>ref|XP_010071123.1| PREDICTED: gamma-glutamyl hydrolase, partial [Pterocles gutturalis]
Length=265

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 102/187 (55%), Gaps = 6/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LG + LT + S + ++L        A  L      + +  LF   P ++L     E L  
Sbjct  82   LGHEELTYLTSGE-VLLVNTKTDGFALPLNFTSA-SKDSRLFSNLPDDVLHAFATEPLTS  139

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              H W +S E+F  +  L NF+NVLTT+ D D   +VST++  KYP+  VQW PE+N FE
Sbjct  140  NFHMWSLSMENFTKNEKLRNFYNVLTTNTD-DEVEFVSTMEAYKYPIYGVQWHPEKNPFE  198

Query  323  WALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSG  150
            W  S  IPHS  A+  +  +A++F++EARKS  + P+E D    LIYNY   Y+G   S 
Sbjct  199  WKHSPGIPHSPSAVRAAYYIADFFINEARKSLHHFPSEDDETKELIYNYTPVYTGT-FSS  257

Query  149  FVEVYIF  129
            F ++Y F
Sbjct  258  FQQIYFF  264



>gb|KFP82604.1| Gamma-glutamyl hydrolase, partial [Acanthisitta chloris]
Length=288

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 105/187 (56%), Gaps = 6/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LG + LT + S D +++   + +N  S          +  LF+ FP ++L  +  E L  
Sbjct  105  LGHEELTYLTSGDILLVR--TKTNGFSLPLNFTSAAKDSKLFRNFPDDVLHALATEPLTS  162

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              H W +S E+F  +  L +F+NVLTT+ D D   ++ST++  KYP+  +QW PE+N FE
Sbjct  163  NFHMWSLSMENFTTNEKLRDFYNVLTTNTD-DELEFISTMEAYKYPIYGIQWHPEKNPFE  221

Query  323  WALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSG  150
            W  S  IPHS  A+  +  +A++FV+EARKS  + P+E +    LIYNY   Y+G   S 
Sbjct  222  WKDSPGIPHSPAAVRAAYYMADFFVNEARKSLHHFPSEDEETKELIYNYTPVYTGP-FSA  280

Query  149  FVEVYIF  129
            F + Y F
Sbjct  281  FQQTYFF  287



>gb|KFQ53384.1| Gamma-glutamyl hydrolase, partial [Nestor notabilis]
Length=282

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 91/147 (62%), Gaps = 4/147 (3%)
 Frame = -2

Query  563  LFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTI  384
            LF+ FP +LL  +  E L    H W +S E+F  + +L NF+NVLTT+ + D   ++ST+
Sbjct  137  LFKNFPDDLLHALATEPLTSNFHTWSLSLENFTKNEELHNFYNVLTTNTN-DQVEFISTM  195

Query  383  QGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPD  210
            +  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++F++EARKS  + P+E +
Sbjct  196  EAYKYPIYGVQWHPEKNPFEWKSSPGIPHSPSAVRAAYYIADFFINEARKSLHHFPSEAE  255

Query  209  VRDNLIYNYNTSYSGKDGSGFVEVYIF  129
                LIYNY   Y+G   S F ++Y F
Sbjct  256  ETKELIYNYIPLYTGT-FSSFQQIYFF  281



>ref|XP_004912572.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X2 [Xenopus 
(Silurana) tropicalis]
 ref|XP_004912573.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X3 [Xenopus 
(Silurana) tropicalis]
Length=311

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 112/187 (60%), Gaps = 5/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            +GFQ+LT + +  ++ L   +A N +  L + + +     +F   P +LLR + +E +  
Sbjct  128  MGFQILTALTAGADL-LSATAAENISLPLNLTDEV-ASSRMFHHAPPDLLRVLSQERVTA  185

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              H +G++PE+F+A+  LS F+ VL+T+ D +   ++STI+ + +P+  VQW PE N F+
Sbjct  186  NFHHFGLTPETFRANKKLSEFYRVLSTNRDTNGVEFISTIEARNHPIYGVQWHPEVNRFQ  245

Query  323  W-ALSEIPHSEDAILVSQSVANYFVSEARKSSN-VPNEPDVRDNLIYNYNTSYSGKDGSG  150
            W +    PHS +AI  SQ  A++FV+EARKS N   +E +    LIYN+  +Y+  + SG
Sbjct  246  WRSDMSYPHSANAIWTSQYFADFFVNEARKSQNHFLSEEEENAALIYNWTPTYTA-NISG  304

Query  149  FVEVYIF  129
            + + Y F
Sbjct  305  YEQAYFF  311



>ref|XP_009075416.1| PREDICTED: gamma-glutamyl hydrolase, partial [Acanthisitta chloris]
Length=292

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 105/187 (56%), Gaps = 6/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LG + LT + S D +++   + +N  S          +  LF+ FP ++L  +  E L  
Sbjct  109  LGHEELTYLTSGDILLVR--TKTNGFSLPLNFTSAAKDSKLFRNFPDDVLHALATEPLTS  166

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              H W +S E+F  +  L +F+NVLTT+ D D   ++ST++  KYP+  +QW PE+N FE
Sbjct  167  NFHMWSLSMENFTTNEKLRDFYNVLTTNTD-DELEFISTMEAYKYPIYGIQWHPEKNPFE  225

Query  323  WALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSG  150
            W  S  IPHS  A+  +  +A++FV+EARKS  + P+E +    LIYNY   Y+G   S 
Sbjct  226  WKDSPGIPHSPAAVRAAYYMADFFVNEARKSLHHFPSEDEETKELIYNYTPVYTGP-FSA  284

Query  149  FVEVYIF  129
            F + Y F
Sbjct  285  FQQTYFF  291



>ref|XP_005066278.1| PREDICTED: gamma-glutamyl hydrolase [Mesocricetus auratus]
Length=318

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 115/187 (61%), Gaps = 6/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+ LT +VS ++++    + S  A  L   EG+ ++G +FQ FP ELL  +  E L  
Sbjct  135  LGFEALTFLVSGESLLTYTNTVS-VALPLNFTEGV-LQGRMFQNFPAELLVSLALEPLTA  192

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              HKW +S ++F  +  LS FF +LTT+ D  N  ++S+++G KYPV AVQW PE+  +E
Sbjct  193  NFHKWSLSVKNFTENEKLSKFFKILTTNTD-GNIEFISSMEGFKYPVYAVQWHPEKAPYE  251

Query  323  W-ALSEIPHSEDAILVSQSVANYFVSEARKSSN-VPNEPDVRDNLIYNYNTSYSGKDGSG  150
            W  L  I H+ +A+  +  +A++FVSEA K+++   NE +  ++LIY +   Y+G + S 
Sbjct  252  WKGLKGISHAPNAVKTAFYLADFFVSEALKNNHRYENEFEEMESLIYQFYPVYTG-NISS  310

Query  149  FVEVYIF  129
            F + Y+F
Sbjct  311  FQQCYMF  317



>gb|KFV06368.1| Gamma-glutamyl hydrolase, partial [Pterocles gutturalis]
Length=267

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 102/187 (55%), Gaps = 6/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LG + LT + S + ++L        A  L      + +  LF   P ++L     E L  
Sbjct  84   LGHEELTYLTSGE-VLLVNTKTDGFALPLNFTSA-SKDSRLFSNLPDDVLHAFATEPLTS  141

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              H W +S E+F  +  L NF+NVLTT+ D D   +VST++  KYP+  VQW PE+N FE
Sbjct  142  NFHMWSLSMENFTKNEKLRNFYNVLTTNTD-DEVEFVSTMEAYKYPIYGVQWHPEKNPFE  200

Query  323  WALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSG  150
            W  S  IPHS  A+  +  +A++F++EARKS  + P+E D    LIYNY   Y+G   S 
Sbjct  201  WKHSPGIPHSPSAVRAAYYIADFFINEARKSLHHFPSEDDETKELIYNYTPVYTGT-FSS  259

Query  149  FVEVYIF  129
            F ++Y F
Sbjct  260  FQQIYFF  266



>ref|XP_003999883.1| PREDICTED: gamma-glutamyl hydrolase [Felis catus]
Length=318

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 109/197 (55%), Gaps = 25/197 (13%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV---------EGTLFQRFPYELLR  531
            LGF+ L+ ++S + ++           TL   EG+ +         +  +FQ FP +LL 
Sbjct  134  LGFEELSYLISGECLL-----------TLTKTEGVTMPLNFTKGAFQSRMFQNFPADLLM  182

Query  530  KVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQ  351
             +  E L    HKW +S  +F  +  L  FFNVLTT+ D   + ++ST++G KYPV  VQ
Sbjct  183  SLSLEPLTANFHKWSLSMTNFTMNEKLKKFFNVLTTNTDGKTE-FISTMEGYKYPVYGVQ  241

Query  350  WAPERNAFEWA-LSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDN--LIYNYN  180
            W PE+  +EW  L  I H+ +A++ +  +A +FV+EARK+S+   E DV +N  LIY + 
Sbjct  242  WHPEKAPYEWGKLEGISHAPNAVMAAFYLAEFFVAEARKNSH-HFESDVEENKALIYQFR  300

Query  179  TSYSGKDGSGFVEVYIF  129
              Y+G   S F + YIF
Sbjct  301  PVYTGNISSSFQQSYIF  317



>gb|KIZ06309.1| gamma-glutamyl hydrolase [Monoraphidium neglectum]
Length=358

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 96/163 (59%), Gaps = 7/163 (4%)
 Frame = -2

Query  683  LGFQLLTII---VSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
            LG QLL I+   VS +++++E   A  Q STL      N   TL +  P +L+ K+ ++ 
Sbjct  113  LGHQLLHILAANVSRNDLLVET-DAVTQPSTLIFTAAANTSRTL-KDLPSDLVAKLQDDK  170

Query  512  L--VMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPE  339
            L   MQNH++GI P  +Q    L  +FNVLTTS D+    Y+ST++ KKYP    QW PE
Sbjct  171  LNIAMQNHEYGIPPHHYQRWPLLGEWFNVLTTSKDRKGLEYISTVEAKKYPFTGTQWHPE  230

Query  338  RNAFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPD  210
            +   E+ + E+PH+ DA+ V Q  AN FV  AR SS+ P+ P+
Sbjct  231  KPTSEFGMIEVPHTLDAVRVGQHFANRFVDTARYSSHKPSSPE  273



>ref|XP_009632417.1| PREDICTED: gamma-glutamyl hydrolase, partial [Egretta garzetta]
Length=283

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 90/147 (61%), Gaps = 4/147 (3%)
 Frame = -2

Query  563  LFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTI  384
            LF+ FP++LL  +  E L    H W +S E+F  +  L +F+NVLTT+ D D   ++ST+
Sbjct  138  LFKNFPHDLLHALATEPLTSNFHMWSLSLENFTKNEKLRDFYNVLTTNTD-DGVEFISTM  196

Query  383  QGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPD  210
            +  KYP+  VQW PE+  FEW  S  IPHS  A+  +  +A++F++EARKS  + P+E +
Sbjct  197  EAYKYPIYGVQWHPEKTPFEWKNSPGIPHSPSAVRAAYYIADFFINEARKSLHHFPSEDE  256

Query  209  VRDNLIYNYNTSYSGKDGSGFVEVYIF  129
                LIYNY   Y+G   S F ++Y F
Sbjct  257  ETKELIYNYTPIYTGT-FSSFQQIYFF  282



>gb|KFP12067.1| Gamma-glutamyl hydrolase, partial [Egretta garzetta]
Length=282

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 90/147 (61%), Gaps = 4/147 (3%)
 Frame = -2

Query  563  LFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTI  384
            LF+ FP++LL  +  E L    H W +S E+F  +  L +F+NVLTT+ D D   ++ST+
Sbjct  137  LFKNFPHDLLHALATEPLTSNFHMWSLSLENFTKNEKLRDFYNVLTTNTD-DGVEFISTM  195

Query  383  QGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPD  210
            +  KYP+  VQW PE+  FEW  S  IPHS  A+  +  +A++F++EARKS  + P+E +
Sbjct  196  EAYKYPIYGVQWHPEKTPFEWKNSPGIPHSPSAVRAAYYIADFFINEARKSLHHFPSEDE  255

Query  209  VRDNLIYNYNTSYSGKDGSGFVEVYIF  129
                LIYNY   Y+G   S F ++Y F
Sbjct  256  ETKELIYNYTPIYTGT-FSSFQQIYFF  281



>ref|XP_002946185.1| hypothetical protein VOLCADRAFT_102798 [Volvox carteri f. nagariensis]
 gb|EFJ53180.1| hypothetical protein VOLCADRAFT_102798 [Volvox carteri f. nagariensis]
Length=331

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 105/181 (58%), Gaps = 11/181 (6%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LG + L++I+S +  +L +F A +  + L +         L +  P +++  +  + + M
Sbjct  132  LGMETLSVIISSNYTLLGEFDAEDAPAPL-LYTNEAAASHLLRSLPPDVVTDLQNKPIAM  190

Query  503  QNH--KWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNA  330
            +NH    G+S  +F  +  L  FF V++ SLDK    Y+ST++G+ YP  A QW PE+NA
Sbjct  191  ENHMNGGGLSMTAFLENPALGRFFRVVSLSLDKSGAAYISTLEGRNYPFTATQWHPEKNA  250

Query  329  FEWALS-EIPHSEDAILVSQSVANYFVSEARK----SSNVPNEPDVRDNLIYNYNTSYSG  165
            +EW     IPH+ DAI +SQ VAN+FV+EAR+    + N+  E ++   LIYN+   ++G
Sbjct  251  YEWTPHLHIPHTTDAIRMSQEVANFFVAEARRNLHMAKNIIEEDEL---LIYNFKPVFTG  307

Query  164  K  162
            K
Sbjct  308  K  308



>gb|KFZ45669.1| Gamma-glutamyl hydrolase, partial [Caprimulgus carolinensis]
Length=282

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 89/147 (61%), Gaps = 4/147 (3%)
 Frame = -2

Query  563  LFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTI  384
            LF+  P ++LR    E L    H W +S E+F  +  L NF+NVLTT+ D D   ++ST+
Sbjct  137  LFKNLPADVLRAFATEPLTSNFHMWSLSMENFTKNEKLRNFYNVLTTNAD-DEVEFISTM  195

Query  383  QGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPD  210
            +  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A +FV+EARKS  + P+E +
Sbjct  196  EAYKYPIYGVQWHPEKNPFEWKNSPGIPHSPSAVRAAYYIAEFFVNEARKSLHHFPSEDE  255

Query  209  VRDNLIYNYNTSYSGKDGSGFVEVYIF  129
                LIYNY+  Y+G   S F ++Y F
Sbjct  256  ETKELIYNYSPVYTGT-FSSFQQIYFF  281



>gb|EDL05569.1| gamma-glutamyl hydrolase [Mus musculus]
Length=195

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 109/187 (58%), Gaps = 6/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+ L+++VS +N++    + S +   L   EG   +  +F+ FP ELL  +  E L  
Sbjct  12   LGFEELSVLVSGENLLTSTDTKSKKLP-LNFTEGAR-KSRMFKHFPTELLDSLALENLTA  69

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              HKW +S ++F  +  L  FFN+LTT+ D   + ++S+++G KYPV AVQW PE+ AFE
Sbjct  70   NFHKWSLSVKNFTENEKLKKFFNILTTNTDGKTE-FISSMEGFKYPVYAVQWHPEKAAFE  128

Query  323  WA-LSEIPHSEDAILVSQSVANYFVSEARKSS-NVPNEPDVRDNLIYNYNTSYSGKDGSG  150
            W  L  I H+ +A+  S  +A + VSEARK+S +  N      +LIY     Y+G + S 
Sbjct  129  WKNLGGISHAPNAVKTSFYLAEFLVSEARKNSHHFENVVKETASLIYKVYPIYTG-NISS  187

Query  149  FVEVYIF  129
            F + Y+F
Sbjct  188  FQQAYMF  194



>gb|ACI66462.1| Gamma-glutamyl hydrolase precursor [Salmo salar]
Length=309

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 111/186 (60%), Gaps = 5/186 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+ LT + S   ++ +  + S  A  L    G + E  LF+ FP E+L  +  E +  
Sbjct  128  LGFEELTYLTSGKQLLFDT-NTSGVALPLVFTNG-SRESKLFKGFPAEVLDALASEPITE  185

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
             +H+  ++ ES+ ++ADL  F+NVLTT+ D   + +VST++   +P+   QW PE+NAFE
Sbjct  186  NSHELSLTLESYNSNADLRKFYNVLTTNSDGITE-FVSTMEAYGFPIYGTQWHPEKNAFE  244

Query  323  WALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDV-RDNLIYNYNTSYSGKDGSGF  147
            W    IPHS  A+  +  +A++ V+EARK+ +   + +V +  LIYNYN +Y+G + S F
Sbjct  245  WTRPYIPHSPSAVKTTFFMADFMVNEARKNFHKFEDEEVEKRALIYNYNPAYTG-NKSAF  303

Query  146  VEVYIF  129
             ++Y F
Sbjct  304  EQIYYF  309



>ref|XP_010175281.1| PREDICTED: gamma-glutamyl hydrolase, partial [Caprimulgus carolinensis]
Length=286

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 90/150 (60%), Gaps = 4/150 (3%)
 Frame = -2

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
            +  LF+  P ++LR    E L    H W +S E+F  +  L NF+NVLTT+ D D   ++
Sbjct  138  DSRLFKNLPADVLRAFATEPLTSNFHMWSLSMENFTKNEKLRNFYNVLTTNAD-DEVEFI  196

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A +FV+EARKS  + P+
Sbjct  197  STMEAYKYPIYGVQWHPEKNPFEWKNSPGIPHSPSAVRAAYYIAEFFVNEARKSLHHFPS  256

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY+  Y+G   S F ++Y F
Sbjct  257  EDEETKELIYNYSPVYTGT-FSSFQQIYFF  285



>ref|XP_004551883.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X3 [Maylandia 
zebra]
Length=308

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 101/186 (54%), Gaps = 5/186 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+ L  + S+ N IL   + S  A  L    G+     +F+ FP +L++ +  E L +
Sbjct  127  LGFEQLMYLTSK-NTILAYTNTSGAALPLNFTNGM-FYSRMFKGFPAQLMKDLASEPLTV  184

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
             +HKW +   ++  + +L  F+ VL+ + D  N  +VST++   YP+   QW PE+NAFE
Sbjct  185  NSHKWSLGMLTYNTNEELKKFYKVLSVNTD-GNVEFVSTVEAYDYPIYGTQWHPEKNAFE  243

Query  323  WALSEIPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGF  147
            W    IPHS  A+  +  +A +FV+EARK+      E      LIYNYN  Y+G   S F
Sbjct  244  WTRPSIPHSPSAVKTTFYMAEFFVNEARKNFHKFETEEGESKALIYNYNPVYTGTK-SAF  302

Query  146  VEVYIF  129
             ++Y F
Sbjct  303  EQIYFF  308



>ref|XP_002710570.1| PREDICTED: gamma-glutamyl hydrolase [Oryctolagus cuniculus]
Length=318

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 112/187 (60%), Gaps = 6/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+ L+ +VS + ++    + S +   L   EG  ++  +FQ FP ELL  +  E L  
Sbjct  135  LGFEELSYLVSGECLLTLTDTISRKLP-LNFTEG-ALQSRMFQNFPAELLLSLAIEPLTA  192

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              HKW +S ++F ++  L  FFNVLTT+ D   + ++ST++G KYPV  VQW PE+  +E
Sbjct  193  NFHKWSLSVKNFTSNEKLKKFFNVLTTNTDGKTE-FISTLEGYKYPVYGVQWHPEKAPYE  251

Query  323  WA-LSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEP-DVRDNLIYNYNTSYSGKDGSG  150
            WA L  I H+ +A+  +  +A +FVSEA+K+ +  + P + ++ LIY+Y   Y+G   S 
Sbjct  252  WAKLKGISHAPNAVKAAFYLAEFFVSEAQKNHHRFDSPSEEKEALIYHYRPIYTGSI-SS  310

Query  149  FVEVYIF  129
            F + Y+F
Sbjct  311  FQQCYMF  317



>gb|KFO77933.1| Gamma-glutamyl hydrolase, partial [Cuculus canorus]
Length=282

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 103/187 (55%), Gaps = 6/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LG + LT + S + ++L   +    A  L        E  LF+ FP ++L     E L  
Sbjct  99   LGHEELTYLTSGE-VLLVNTNTDGFALPLNFTSAAK-ESRLFKNFPDDVLHAFATEPLTS  156

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              H W +S E+F  +  L NF+NVLTT+ D D   ++ST++  KYP+  VQW PE+N FE
Sbjct  157  NFHVWSLSMENFTKNEKLRNFYNVLTTNTD-DGVEFISTMEAYKYPIYGVQWHPEKNPFE  215

Query  323  WALSE-IPHSEDAILVSQSVANYFVSEARKSSNV-PNEPDVRDNLIYNYNTSYSGKDGSG  150
            W  S  IPHS  A+  +  +A++F++EARKS +  P+E +    LIYNY   Y+G   S 
Sbjct  216  WKNSPGIPHSPSAVRAAYYIADFFINEARKSLHCYPSEEEETKELIYNYTPFYTGT-FSA  274

Query  149  FVEVYIF  129
            F + Y F
Sbjct  275  FQQTYFF  281



>gb|AAH93328.1| LOC553228 protein, partial [Danio rerio]
Length=328

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 109/188 (58%), Gaps = 7/188 (4%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVV-EGLNVEGTLFQRFPYELLRKVGEECLV  507
            LGFQLLT++V+ +N+ L K +A N    L    E L+    +F  FP EL R + EE L 
Sbjct  145  LGFQLLTVLVAGENL-LSKTTAENVTYPLNFSSEALS--SRMFSSFPSELRRALSEEPLT  201

Query  506  MQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAF  327
               H +G++ E+F  +  L+  F+V++T++ ++   +VSTI+G+KYP   VQW PE N F
Sbjct  202  ANFHHYGVTKEAFMNNEKLTGLFSVISTNIAQNGAEFVSTIEGRKYPFYGVQWHPEVNRF  261

Query  326  EW-ALSEIPHSEDAILVSQSVANYFVSEARKSSN-VPNEPDVRDNLIYNYNTSYSGKDGS  153
            +W      PHS +A+ VS  +A +FV+E R+S++   +  +    LIYN N  Y  K  S
Sbjct  262  QWNPHYSFPHSSNAVHVSSLLAQFFVNEGRRSTHQFSDAAEESAALIYNCNPVYVEKI-S  320

Query  152  GFVEVYIF  129
             + + Y F
Sbjct  321  AYEQSYFF  328



>gb|KFV00608.1| Gamma-glutamyl hydrolase, partial [Tauraco erythrolophus]
Length=285

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 88/150 (59%), Gaps = 4/150 (3%)
 Frame = -2

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
            +  LF+ FP ++L     E L    H W +S E+F  +  L  F+NVLTT+ D D   ++
Sbjct  137  DSRLFKNFPDDVLHAFATEPLTSNFHMWSLSMENFTKNEKLRTFYNVLTTNTD-DEVEFI  195

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++FV+EARKS    PN
Sbjct  196  STMEAYKYPIYGVQWHPEKNPFEWKNSPAIPHSPSAVRAAYYIADFFVNEARKSLHRFPN  255

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY   Y+G   S F ++Y F
Sbjct  256  EDEETKELIYNYTPIYTGT-FSSFQQIYFF  284



>ref|XP_005943740.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X2 [Haplochromis 
burtoni]
Length=310

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 102/187 (55%), Gaps = 5/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGT-LFQRFPYELLRKVGEECLV  507
            LGF+ L  + S+ N IL   + S     L    G+  E + +F+ FP +L++ +  E L 
Sbjct  127  LGFEQLMYLTSK-NTILAYTNTSGATLPLNFTNGMFSEDSRMFKGFPAQLMKDLASEPLT  185

Query  506  MQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAF  327
            + +HKW +   ++  + +L  F+ VL+ + D  N  +VST++   YP+   QW PE+NAF
Sbjct  186  VNSHKWSLGMLTYNTNEELKKFYKVLSVNTD-GNVEFVSTVEAYDYPIYGTQWHPEKNAF  244

Query  326  EWALSEIPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSG  150
            EW    IPHS  A+  +  +A +FV+EARK+      E      LIYNYN  Y+G   S 
Sbjct  245  EWTRPSIPHSPSAVKTTFYMAEFFVNEARKNFHKFETEEGESKALIYNYNPVYTGTK-SA  303

Query  149  FVEVYIF  129
            F ++Y F
Sbjct  304  FEQIYFF  310



>ref|XP_008306469.1| PREDICTED: gamma-glutamyl hydrolase-like, partial [Cynoglossus 
semilaevis]
Length=245

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 105/186 (56%), Gaps = 6/186 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGT-LFQRFPYELLRKVGEECLV  507
            LGFQ L+ +VS + I L + ++   A  L   +    +G+ +F  FP EL++++  + L 
Sbjct  64   LGFQALSFMVSSE-IRLTRTNSKGMALPLNFTK--EAKGSRMFSGFPDELIQELASKPLA  120

Query  506  MQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAF  327
            + +HKW ++   F  D  LS F+  +TT+ D+  + YVST++G +YP    QW PE+ AF
Sbjct  121  LHSHKWSVTSRVFYTDHTLSTFYRAITTNWDEKQE-YVSTLEGYRYPFYGTQWHPEKLAF  179

Query  326  EWALSEIPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSG  150
            EW  S IPHS   I +   +A +FV+EARK+  +  +E   R  LI+NY    SG  G  
Sbjct  180  EWNQSSIPHSALGIRIMFYLAEFFVNEARKNFHSFSSEAKERKALIWNYYAVSSGVRGVY  239

Query  149  FVEVYI  132
              + YI
Sbjct  240  VQKYYI  245



>ref|XP_010775082.1| PREDICTED: gamma-glutamyl hydrolase-like [Notothenia coriiceps]
Length=321

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 113/187 (60%), Gaps = 5/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            +G QLLT++V+    +LEK +A N A  L +    N    +F+ FP +L++ + EE L  
Sbjct  138  MGLQLLTVLVA-GKCLLEKTTAENVALPLNLTSEAN-SSKMFEGFPQKLMQALTEEPLTG  195

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              H +G+S ++FQ +  L +FF++L+T++ ++   +VSTI+G+KYP   VQW PE N F+
Sbjct  196  NFHHYGLSVKNFQENEPLRSFFSLLSTNVAENQVHFVSTIEGRKYPFYGVQWHPEVNPFQ  255

Query  323  WALSE-IPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVR-DNLIYNYNTSYSGKDGSG  150
            W      PHS  A+ +S  +A +FV+E R+S +  + P+    +LIYN    Y+G + + 
Sbjct  256  WERKRNFPHSAHAVQLSSLLAQFFVNEGRRSLHQFDNPEEEASSLIYNDTPVYAG-NFTV  314

Query  149  FVEVYIF  129
            + ++Y F
Sbjct  315  YEQIYFF  321



>ref|XP_006880500.1| PREDICTED: gamma-glutamyl hydrolase [Elephantulus edwardii]
Length=319

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/193 (35%), Positives = 110/193 (57%), Gaps = 16/193 (8%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEG-------TLFQRFPYELLRKV  525
            LGF+ LT +VS +N++           T  +   LN  G        +FQ+FP EL+  +
Sbjct  134  LGFEELTYLVSGENLL-------TLTDTEHISLPLNFTGGKDSISSRMFQKFPAELMMAL  186

Query  524  GEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWA  345
              E L    HKW +S ++F  +A L  FF VLTT+ DK  + ++S+++G+KYP+  VQW 
Sbjct  187  SVEPLTANFHKWSLSMKNFTENAKLKEFFKVLTTNSDKKIE-FISSMEGRKYPIYGVQWH  245

Query  344  PERNAFEWALSEIPHSEDAILVSQSVANYFVSEARKSS-NVPNEPDVRDNLIYNYNTSYS  168
            PE+  +EW    I HS +A+  +  +A +FVSEA+K++ +  ++ +  + LIY++  +Y+
Sbjct  246  PEKPPYEWKDDRISHSSNAVKTAFYLAQFFVSEAQKNNHHFDSKVEEEEALIYHFAPNYT  305

Query  167  GKDGSGFVEVYIF  129
            G   S F + Y F
Sbjct  306  GNISSSFQQGYFF  318



>ref|XP_004814095.1| PREDICTED: gamma-glutamyl hydrolase [Mustela putorius furo]
Length=317

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 107/187 (57%), Gaps = 5/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LGF+ L+ +VS    +L           L   +G + +  +FQ FP +LL+ +  E L  
Sbjct  133  LGFEELSYLVSGGKSLLTLTHTDGITMPLNFTKGAS-QSRMFQNFPVDLLKSLSTEPLTA  191

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              HKW +S  +F  + +L NFFNVLTT+ D   + ++ST++G KYPV  VQW PE+  +E
Sbjct  192  NFHKWSLSVTNFTMNEELKNFFNVLTTNTDGKTE-FISTMEGYKYPVYGVQWHPEKAPYE  250

Query  323  WA-LSEIPHSEDAILVSQSVANYFVSEARKSSN-VPNEPDVRDNLIYNYNTSYSGKDGSG  150
            W  L  I H+  A+  +  +A +FV+EARK+S+   +E +  + LIY +   Y+G + S 
Sbjct  251  WGNLEGISHAPHAVKAAFYLAEFFVAEARKNSHQFESEVEENEALIYQFRPVYTG-NISS  309

Query  149  FVEVYIF  129
            F + YIF
Sbjct  310  FQQSYIF  316



>ref|NP_001243151.1| gamma-glutamyl hydrolase precursor [Danio rerio]
Length=317

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 109/188 (58%), Gaps = 7/188 (4%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVV-EGLNVEGTLFQRFPYELLRKVGEECLV  507
            LGFQLLT++V+ +N+ L K +A N    L    E L+    +F  FP EL R + EE L 
Sbjct  134  LGFQLLTVLVAGENL-LSKTTAENVTYPLNFSSEALS--SRMFSSFPSELRRALSEEPLT  190

Query  506  MQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAF  327
               H +G++ E+F  +  L+  F+V++T++ ++   +VSTI+G+KYP   VQW PE N F
Sbjct  191  ANFHHYGVTKEAFMNNEKLTGLFSVISTNIAQNGAEFVSTIEGRKYPFYGVQWHPEVNRF  250

Query  326  EW-ALSEIPHSEDAILVSQSVANYFVSEARKSSN-VPNEPDVRDNLIYNYNTSYSGKDGS  153
            +W      PHS +A+ VS  +A +FV+E R+S++   +  +    LIYN N  Y  K  S
Sbjct  251  QWNPHYSFPHSSNAVHVSSLLAQFFVNEGRRSTHRFSDAAEESAVLIYNCNPVYVEKI-S  309

Query  152  GFVEVYIF  129
             + + Y F
Sbjct  310  AYEQSYFF  317



>ref|XP_005988287.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X2 [Latimeria 
chalumnae]
Length=318

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 106/187 (57%), Gaps = 5/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LG QLLT++ +  N+ L   S  N A  L +         +F  FP EL++ + +E L  
Sbjct  135  LGLQLLTVLTAGKNL-LTNTSTENIALALNLTSSAQ-SSRMFHDFPPELMKALSKEPLTG  192

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              H + I+ ++FQ +  L +F++VL+T+ D     +VST++G KYP+  VQW PE N F 
Sbjct  193  NFHHYSIATQTFQRNIKLRHFYSVLSTNTDMYGVEFVSTMEGIKYPMYGVQWHPEVNRFL  252

Query  323  WALS-EIPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSG  150
            W      PHS  A+ +S  +A++FV+EARKS    P+  + +  LIYNY+  Y G   S 
Sbjct  253  WEKDLAFPHSAKAVQLSSQLADFFVNEARKSFHRFPSAEEEKAALIYNYSPIYVGNICS-  311

Query  149  FVEVYIF  129
            +++VY F
Sbjct  312  YMQVYFF  318



>ref|XP_005288157.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X1 [Chrysemys 
picta bellii]
Length=389

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 109/187 (58%), Gaps = 6/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LG++ LT + S + I+L   +  + A  L        +  +F+ FP +LL+K+  E L  
Sbjct  206  LGYEELTYLTSGE-ILLTWTNTEDFAFPLNFTTAAK-DSRMFKNFPDDLLQKLATESLTA  263

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              H W +S ++F  +A L NF+ VLTT+   D + ++ST++  KYP+  VQW PE+N FE
Sbjct  264  HFHHWSLSVQNFTQNAKLRNFYKVLTTNTHADVE-FISTMEAYKYPIYGVQWHPEKNPFE  322

Query  323  WA-LSEIPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSG  150
            W   S IPHS  A+ V+  VA++ V+EARKS  + PN+ +    LIYNY   ++G   S 
Sbjct  323  WKNSSGIPHSASAMKVAYYVADFLVNEARKSLHHFPNKSEETKALIYNYTPVFTGIF-SP  381

Query  149  FVEVYIF  129
            F +VY F
Sbjct  382  FEQVYFF  388



>ref|XP_009979902.1| PREDICTED: gamma-glutamyl hydrolase, partial [Tauraco erythrolophus]
Length=290

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 88/150 (59%), Gaps = 4/150 (3%)
 Frame = -2

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
            +  LF+ FP ++L     E L    H W +S E+F  +  L  F+NVLTT+ D D   ++
Sbjct  142  DSRLFKNFPDDVLHAFATEPLTSNFHMWSLSMENFTKNEKLRTFYNVLTTNTD-DEVEFI  200

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++FV+EARKS    PN
Sbjct  201  STMEAYKYPIYGVQWHPEKNPFEWKNSPAIPHSPSAVRAAYYIADFFVNEARKSLHRFPN  260

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY   Y+G   S F ++Y F
Sbjct  261  EDEETKELIYNYTPIYTGT-FSSFQQIYFF  289



>gb|KFP55993.1| Gamma-glutamyl hydrolase, partial [Cathartes aura]
Length=282

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 103/187 (55%), Gaps = 6/187 (3%)
 Frame = -2

Query  683  LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
            LG + LT + S + ++L        A  L        +  LF+ FP ++L     E L  
Sbjct  99   LGHEELTYLTSGE-VLLVNTKTEGFALPLNFTSAAK-DSRLFKNFPDDVLHAFATEPLTS  156

Query  503  QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              H W +S E+F  +  L NF+NVLTT+ D D   ++ST++  KYP+  VQW PE+N FE
Sbjct  157  NFHMWSLSMENFTKNDKLRNFYNVLTTNTD-DEVEFISTMEAYKYPIYGVQWHPEKNPFE  215

Query  323  WALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSG  150
            W  S  IPHS  A+  +  +A++F++EARKS  + P+E +    LIYNY   Y+G   S 
Sbjct  216  WKNSPGIPHSPSAVRAAYYIADFFINEARKSLHHFPSEDEETKELIYNYTPIYTGT-FSS  274

Query  149  FVEVYIF  129
            F ++Y F
Sbjct  275  FQQIYFF  281



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1171852487340