BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF013J06

Length=721
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFY26882.1|  catalase                                                359   4e-123   Ipomoea batatas [batate]
gb|ADB03784.1|  catalase                                                360   4e-119   Ipomoea batatas [batate]
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          360   5e-119   Ipomoea batatas [batate]
emb|CAB56850.1|  catalase                                               290   2e-92    Prunus persica
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      292   2e-92    Nicotiana tomentosiformis
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 290   9e-92    Eucalyptus grandis [rose gum]
gb|ABY19573.1|  catalase                                                282   2e-91    Manihot esculenta [manioc]
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                289   3e-91    Citrus sinensis [apfelsine]
gb|AIX10947.1|  putative catalase                                       289   3e-91    Gardenia jasminoides
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 289   3e-91    Elaeis guineensis
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 289   4e-91    Prunus mume [ume]
gb|AAX84671.1|  catalase CAT2                                           281   4e-91    Manihot esculenta [manioc]
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             288   5e-91    Citrus clementina [clementine]
gb|AGC65520.1|  catalase                                                288   6e-91    Eriobotrya japonica [loquat]
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      288   8e-91    Eucalyptus grandis [rose gum]
dbj|BAF91369.1|  catalase                                               288   1e-90    Capsicum annuum
gb|ABR15776.1|  catalase                                                281   1e-90    Litchi
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             287   2e-90    Prunus persica
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      286   3e-90    Nicotiana sylvestris
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    286   5e-90    Capsicum annuum
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      285   8e-90    Prunus mume [ume]
emb|CAD42909.1|  catalase                                               285   9e-90    Prunus persica
gb|AAA57551.1|  catalase                                                281   1e-89    Nicotiana sylvestris
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         285   1e-89    Tarenaya hassleriana [spider flower]
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          285   2e-89    Avicennia marina
emb|CAD42908.1|  catalase                                               285   2e-89    Prunus persica
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             285   2e-89    Prunus persica
gb|AAB88173.1|  catalase                                                278   2e-89    Glycine max [soybeans]
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      284   2e-89    Elaeis guineensis
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 284   2e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002306976.2|  catalase family protein                            284   3e-89    
gb|KJB57963.1|  hypothetical protein B456_009G187600                    284   3e-89    Gossypium raimondii
ref|NP_001289779.1|  catalase isozyme 1                                 284   4e-89    Nelumbo nucifera [Indian lotus]
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          283   5e-89    Solanum melongena [aubergine]
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      283   7e-89    Nicotiana tomentosiformis
emb|CDP07287.1|  unnamed protein product                                283   7e-89    Coffea canephora [robusta coffee]
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      283   8e-89    
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      283   9e-89    Populus euphratica
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      283   9e-89    
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 283   1e-88    Nicotiana tomentosiformis
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      282   1e-88    Phoenix dactylifera
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    282   1e-88    Nicotiana tabacum [American tobacco]
ref|NP_001268098.1|  catalase                                           282   1e-88    Vitis vinifera
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      282   1e-88    Nicotiana sylvestris
gb|KJB14249.1|  hypothetical protein B456_002G115900                    278   1e-88    Gossypium raimondii
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 282   1e-88    Vitis vinifera
ref|XP_010061175.1|  PREDICTED: catalase-like                           282   2e-88    Eucalyptus grandis [rose gum]
emb|CAI43948.1|  catalase                                               281   3e-88    Populus deltoides
gb|AAM97542.1|  catalase 3                                              281   3e-88    Capsicum annuum
gb|AEQ30070.1|  catalase                                                281   3e-88    Litchi chinensis [litchi]
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      281   3e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      281   4e-88    Nelumbo nucifera [Indian lotus]
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               281   4e-88    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 281   4e-88    Nicotiana sylvestris
ref|XP_002301920.1|  catalase family protein                            281   5e-88    Populus trichocarpa [western balsam poplar]
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 281   5e-88    Populus euphratica
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           281   6e-88    
gb|ACJ11733.1|  catalase                                                281   6e-88    Gossypium hirsutum [American cotton]
ref|XP_010498496.1|  PREDICTED: catalase-3                              281   6e-88    Camelina sativa [gold-of-pleasure]
ref|XP_009110221.1|  PREDICTED: catalase-3                              280   7e-88    Brassica rapa
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           280   7e-88    Sesamum indicum [beniseed]
gb|ACJ76836.3|  catalase                                                280   7e-88    Dimocarpus longan [longan]
dbj|BAC79443.1|  catalase                                               280   7e-88    Acacia ampliceps
ref|NP_001031072.3|  catalase 3                                         276   8e-88    Arabidopsis thaliana [mouse-ear cress]
gb|AIS20825.1|  CAT                                                     280   9e-88    Pyrus x bretschneideri [bai li]
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 280   9e-88    Phoenix dactylifera
gb|ADC95629.1|  catalase                                                280   1e-87    Bruguiera gymnorhiza [Burma mangrove]
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               280   1e-87    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AAD50974.1|AF170272_1  catalase CAT1                                 280   1e-87    Manihot esculenta [manioc]
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      280   1e-87    
gb|AHF27428.1|  catalase                                                275   1e-87    Cucurbita moschata [ayote]
emb|CDY33636.1|  BnaC08g19360D                                          279   2e-87    Brassica napus [oilseed rape]
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         279   2e-87    Brassica rapa
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             279   2e-87    Phaseolus vulgaris [French bean]
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     282   2e-87    Eucalyptus grandis [rose gum]
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          279   2e-87    Soldanella alpina
emb|CDY29519.1|  BnaA06g14510D                                          279   2e-87    Brassica napus [oilseed rape]
emb|CDY31488.1|  BnaC05g15970D                                          280   2e-87    Brassica napus [oilseed rape]
gb|KHG25152.1|  Catalase isozyme 1                                      279   2e-87    Gossypium arboreum [tree cotton]
gb|AGV54297.1|  peroxisomal catalase                                    279   2e-87    Phaseolus vulgaris [French bean]
ref|NP_001237571.1|  catalase-4                                         279   2e-87    Glycine max [soybeans]
gb|AJE26131.1|  catalase                                                279   3e-87    Salix matsudana [tortured willow]
ref|XP_009149539.1|  PREDICTED: catalase-3                              280   3e-87    Brassica rapa
ref|NP_001240021.1|  catalase                                           278   4e-87    Glycine max [soybeans]
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     279   4e-87    Sesamum indicum [beniseed]
emb|CAC04509.1|  catalase                                               271   4e-87    Digitalis lanata [Grecian foxglove]
gb|AGE15298.2|  catalase 1                                              278   4e-87    Eriobotrya japonica [loquat]
dbj|BAH20307.1|  AT1G20620                                              277   5e-87    Arabidopsis thaliana [mouse-ear cress]
gb|ACJ73906.1|  CAT2                                                    272   6e-87    Solanum nigrum
gb|ABM47415.1|  catalase                                                278   6e-87    Prunus avium [gean]
gb|AAC48918.1|  salicylic acid binding catalase                         278   6e-87    Nicotiana tabacum [American tobacco]
emb|CDY01364.1|  BnaA07g11370D                                          280   6e-87    
emb|CDP07288.1|  unnamed protein product                                278   7e-87    Coffea canephora [robusta coffee]
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          278   8e-87    Amborella trichopoda
gb|KJB14250.1|  hypothetical protein B456_002G115900                    278   9e-87    Gossypium raimondii
ref|NP_564120.1|  catalase 3                                            277   1e-86    Arabidopsis thaliana [mouse-ear cress]
gb|AAF19965.1|AF207906_1  catalase 1                                    277   1e-86    Zantedeschia aethiopica [arum-lily]
ref|NP_001291326.1|  catalase isozyme 1                                 277   1e-86    Sesamum indicum [beniseed]
emb|CDY31878.1|  BnaC07g15280D                                          277   1e-86    Brassica napus [oilseed rape]
gb|AAM65021.1|  unknown                                                 277   1e-86    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001234827.1|  catalase isozyme 1                                 277   1e-86    Solanum lycopersicum
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    277   1e-86    Arabis alpina [alpine rockcress]
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             277   1e-86    Phaseolus vulgaris [French bean]
ref|XP_007018034.1|  Catalase 2                                         277   2e-86    
gb|AET97564.1|  catalase                                                277   2e-86    Ziziphus jujuba [Chinese jujube]
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      276   2e-86    Solanum lycopersicum
dbj|BAJ33995.1|  unnamed protein product                                276   2e-86    Eutrema halophilum
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             276   2e-86    Eutrema salsugineum [saltwater cress]
ref|XP_010530333.1|  PREDICTED: catalase-2                              276   2e-86    Tarenaya hassleriana [spider flower]
gb|ACV30589.1|  catalase                                                266   2e-86    Carica papaya [mamon]
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      276   3e-86    Cucumis melo [Oriental melon]
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      276   3e-86    Citrus sinensis [apfelsine]
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      276   4e-86    Vitis vinifera
gb|AAR84578.1|  catalase 1a                                             276   4e-86    Lotus japonicus
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             276   4e-86    Citrus clementina [clementine]
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          276   4e-86 
ref|NP_001237556.1|  catalase-1/2                                       276   5e-86    Glycine max [soybeans]
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             276   5e-86    Capsella rubella
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      276   6e-86    
dbj|BAQ21275.1|  catalase                                               275   6e-86    Citrus tamurana
emb|CCP37650.1|  catalase-1                                             275   7e-86    Nicotiana tabacum [American tobacco]
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          275   7e-86    Amborella trichopoda
gb|AFU48609.1|  catalase 1                                              275   8e-86    Nicotiana benthamiana
gb|AFU90822.1|  catalase                                                275   8e-86    Populus tomentosa [Chinese white poplar]
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               275   8e-86    Ricinus communis
gb|ACL27272.1|  catalase                                                275   9e-86    Nicotiana benthamiana
gb|AIA61608.1|  catalase                                                275   9e-86    Gynostemma pentaphyllum [jiaogulan]
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               275   9e-86    Gossypium hirsutum [American cotton]
gb|AFU90823.1|  catalase                                                273   1e-85    Populus x beijingensis
gb|ABC01913.1|  catalase isozyme 1-like protein                         275   1e-85    Solanum tuberosum [potatoes]
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               275   1e-85    Cucurbita pepo
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              275   1e-85    
gb|AAB62892.1|  catalase-1                                              275   1e-85    Nicotiana glutinosa
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             274   1e-85    
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 275   1e-85    Solanum tuberosum [potatoes]
gb|AAB71764.1|  catalase 1                                              274   1e-85    Nicotiana tabacum [American tobacco]
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              274   1e-85    Cicer arietinum [garbanzo]
gb|AAD30292.1|AF139539_1  catalase 3                                    274   2e-85    Raphanus sativus
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          274   2e-85    Vigna radiata var. radiata [golden gram]
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               274   2e-85    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             274   2e-85    Populus trichocarpa [western balsam poplar]
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             274   2e-85    
gb|ACV92695.1|  catalase                                                274   2e-85    Brassica oleracea
prf||2104177A  catalase                                                 274   2e-85 
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          274   2e-85    Helianthus annuus
emb|CDX76313.1|  BnaA08g10870D                                          273   2e-85    
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      274   2e-85    
gb|AAD30291.2|AF139538_1  catalase 2                                    274   2e-85    Raphanus sativus
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         274   2e-85    Tarenaya hassleriana [spider flower]
ref|NP_001235974.1|  catalase-3                                         274   2e-85    Glycine max [soybeans]
emb|CAA64220.1|  catalase                                               274   2e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      274   3e-85    Phoenix dactylifera
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       274   3e-85    Cucumis sativus [cucumbers]
gb|AAF71742.1|AF248491_1  catalase                                      273   3e-85    Raphanus sativus
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             273   3e-85    Capsella rubella
gb|AAB86582.2|  catalase                                                273   3e-85    Raphanus sativus
gb|ACJ73905.1|  CAT1                                                    263   3e-85    Solanum nigrum
gb|AAD37788.1|AF149283_1  catalase 1                                    271   3e-85    Phaseolus vulgaris [French bean]
prf||1906388A  catalase                                                 273   3e-85 
ref|NP_001274863.1|  catalase isozyme 1                                 273   3e-85    Solanum tuberosum [potatoes]
emb|CAA45564.1|  catalase                                               273   3e-85    Arabidopsis thaliana [mouse-ear cress]
ref|NP_195235.1|  catalase 2                                            273   3e-85    Arabidopsis thaliana [mouse-ear cress]
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               273   3e-85    Solanum tuberosum [potatoes]
gb|AAK96854.1|  catalase                                                273   4e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011022275.1|  PREDICTED: catalase-like                           273   4e-85    Populus euphratica
gb|AAD17935.1|  catalase                                                273   4e-85    Brassica juncea [brown mustard]
emb|CDY40645.1|  BnaA03g53180D                                          273   5e-85    Brassica napus [oilseed rape]
gb|AAC49807.1|  catalase 3                                              273   5e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009106100.1|  PREDICTED: catalase-2                              273   5e-85    Brassica rapa
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      273   5e-85    Elaeis guineensis
gb|AAR97905.1|  catalase                                                273   6e-85    Solanum tuberosum [potatoes]
emb|CAA85470.1|  catalase                                               273   6e-85    Solanum tuberosum [potatoes]
gb|KFK30147.1|  catalase                                                273   6e-85    Arabis alpina [alpine rockcress]
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              273   6e-85    Populus euphratica
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               273   7e-85    Solanum tuberosum [potatoes]
ref|XP_009138342.1|  PREDICTED: catalase-2                              273   7e-85    Brassica rapa
gb|AAD17936.1|  catalase                                                272   8e-85    Brassica juncea [brown mustard]
gb|ACA50528.1|  putative catalase 2                                     272   9e-85    Brassica napus [oilseed rape]
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      272   9e-85    Nicotiana sylvestris
gb|ACJ22771.1|  catalase 1                                              272   9e-85    Jatropha curcas
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              273   9e-85    Populus euphratica
emb|CDY17510.1|  BnaC03g65530D                                          272   1e-84    Brassica napus [oilseed rape]
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               272   1e-84    Gossypium hirsutum [American cotton]
gb|KHG12976.1|  Catalase isozyme 2                                      272   1e-84    Gossypium arboreum [tree cotton]
ref|NP_001048861.1|  Os03g0131200                                       272   1e-84    
gb|AFW69584.1|  catalase1                                               268   1e-84    
dbj|BAA34205.1|  catalase                                               272   1e-84    Oryza sativa Japonica Group [Japonica rice]
emb|CDY52649.1|  BnaAnng11640D                                          271   1e-84    Brassica napus [oilseed rape]
emb|CDX72514.1|  BnaC07g45360D                                          271   1e-84    
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      272   1e-84    Nicotiana tomentosiformis
ref|XP_010094556.1|  Catalase isozyme 1                                 272   1e-84    Morus notabilis
gb|AAR14052.2|  catalase                                                271   2e-84    Solanum tuberosum [potatoes]
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 271   2e-84    Cucumis melo [Oriental melon]
emb|CDP01803.1|  unnamed protein product                                271   2e-84    Coffea canephora [robusta coffee]
gb|ADZ45555.1|  catalase                                                271   2e-84    Vigna radiata [mung bean]
gb|ABQ44283.1|  catalase                                                266   2e-84    Saccharum hybrid cultivar NCo 376
ref|NP_001234186.1|  catalase isozyme 2                                 271   3e-84    
ref|XP_010692544.1|  PREDICTED: catalase-like                           271   3e-84    Beta vulgaris subsp. vulgaris [field beet]
gb|AAG43363.1|AF151368_1  catalase                                      271   3e-84    Hevea brasiliensis [jebe]
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         271   4e-84    Camelina sativa [gold-of-pleasure]
ref|XP_010437527.1|  PREDICTED: catalase-2                              271   4e-84    Camelina sativa [gold-of-pleasure]
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         271   4e-84    Tarenaya hassleriana [spider flower]
gb|AAO17721.1|  catalase                                                270   5e-84    Hypericum perforatum
dbj|BAJ87148.1|  predicted protein                                      264   6e-84    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                270   6e-84    Erythranthe guttata [common monkey flower]
gb|AAY59707.1|  catalase                                                270   7e-84    Oryza sativa Indica Group [Indian rice]
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      270   7e-84    Solanum tuberosum [potatoes]
gb|ADZ45556.1|  catalase                                                270   8e-84    Vigna radiata [mung bean]
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 270   8e-84    Tarenaya hassleriana [spider flower]
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    270   8e-84    Oryza sativa Indica Group [Indian rice]
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 270   8e-84    Oryza brachyantha
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         270   1e-83    Oryza brachyantha
gb|AAC19397.1|  leaf catalase                                           270   1e-83    Mesembryanthemum crystallinum
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         270   1e-83    Jatropha curcas
gb|ACB11496.1|  catalase                                                269   1e-83    Pinus sylvestris [Scotch pine]
gb|AIU99479.1|  catalase                                                269   1e-83    Saccharum arundinaceum
ref|XP_007046520.1|  Catalase 2                                         269   2e-83    Theobroma cacao [chocolate]
dbj|BAA05494.1|  catalase                                               269   2e-83    Oryza sativa Japonica Group [Japonica rice]
dbj|BAA34204.1|  catalase                                               269   2e-83    Oryza sativa Japonica Group [Japonica rice]
gb|AHF21552.1|  catalase                                                269   2e-83    Hylocereus undatus [dragon fruit]
ref|NP_001058635.1|  Os06g0727200                                       269   2e-83    
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         268   3e-83    Camelina sativa [gold-of-pleasure]
emb|CAA42720.1|  catalase-1                                             268   3e-83    Zea mays [maize]
gb|AAM97541.1|  catalase 2                                              268   3e-83    Capsicum annuum
ref|NP_001241808.1|  catalase isozyme B                                 268   3e-83    Zea mays [maize]
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               268   3e-83    Ricinus communis
gb|KJB17473.1|  hypothetical protein B456_003G002800                    268   4e-83    Gossypium raimondii
gb|ABK24453.1|  unknown                                                 268   4e-83    Picea sitchensis
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              268   5e-83    
gb|AIM43584.1|  catalase                                                268   6e-83    Saccharum hybrid cultivar Yacheng05-179
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       265   6e-83    Cucumis sativus [cucumbers]
gb|AIU99485.1|  catalase                                                268   6e-83    Saccharum spontaneum [fodder cane]
gb|AFR53082.1|  CAT                                                     268   7e-83    Anthurium andraeanum [flamingo-lily]
gb|AIU99488.1|  catalase                                                267   8e-83    Saccharum hybrid cultivar ROC22
gb|AAD17933.1|  catalase                                                267   8e-83    Brassica juncea [brown mustard]
gb|AIU99484.1|  catalase                                                267   8e-83    Saccharum arundinaceum
gb|AIU99481.1|  catalase                                                267   8e-83    Saccharum spontaneum [fodder cane]
gb|AAL00886.1|  catalase                                                261   9e-83    Suaeda salsa
gb|KEH36312.1|  catalase heme-binding enzyme                            267   1e-82    Medicago truncatula
ref|XP_003558892.1|  PREDICTED: catalase-1                              267   1e-82    Brachypodium distachyon [annual false brome]
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      267   1e-82    Brachypodium distachyon [annual false brome]
gb|AFN81243.1|  catalase 1                                              267   1e-82    Brassica rapa subsp. pekinensis [bai cai]
emb|CAG23920.1|  catalase                                               267   1e-82    Festuca arundinacea [tall fescue]
gb|EPS69543.1|  catalase                                                267   1e-82    Genlisea aurea
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          267   1e-82    
gb|AAC17729.1|  catalase 1                                              264   2e-82    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AHF27430.1|  catalase                                                266   2e-82    Cucurbita moschata [ayote]
gb|AHF27433.1|  catalase                                                266   2e-82    Cucurbita maxima [Boston marrow]
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       266   2e-82    Triticum aestivum [Canadian hard winter wheat]
gb|AAF79625.1|AC027665_26  F5M15.5                                      276   2e-82    Arabidopsis thaliana [mouse-ear cress]
gb|EMT05040.1|  Catalase-1                                              267   3e-82    
gb|AHA50082.1|  catalase                                                266   3e-82    Eleutherococcus senticosus
gb|AAC17731.1|  catalase 1                                              266   3e-82    Arabidopsis thaliana [mouse-ear cress]
gb|AIU99480.1|  catalase                                                266   3e-82    Saccharum spontaneum [fodder cane]
ref|NP_564121.1|  catalase 1                                            266   4e-82    Arabidopsis thaliana [mouse-ear cress]
gb|ACN36234.1|  unknown                                                 261   4e-82    Zea mays [maize]
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         265   4e-82    Setaria italica
gb|ACL35349.1|  catalase                                                265   5e-82    Picea glauca
emb|CDX69111.1|  BnaC01g03420D                                          265   5e-82    
emb|CDP01802.1|  unnamed protein product                                264   8e-82    Coffea canephora [robusta coffee]
gb|AIU99482.1|  catalase                                                265   8e-82    Saccharum hybrid cultivar ROC22
gb|AIU99486.1|  catalase                                                265   8e-82    Saccharum spontaneum [fodder cane]
gb|AAF61732.1|AF243517_1  catalase 2                                    264   1e-81    Helianthus annuus
dbj|BAJ90861.1|  predicted protein                                      264   1e-81    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002890395.1|  F5M15.5                                            274   2e-81    
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               264   2e-81    Hordeum vulgare [barley]
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                264   2e-81    Erythranthe guttata [common monkey flower]
emb|CAE82295.1|  catalase                                               264   2e-81    Homogyne alpina
gb|ABB72796.1|  catalase isozyme 1-like protein                         264   2e-81    Solanum tuberosum [potatoes]
ref|NP_001105415.1|  catalase isozyme 1                                 263   2e-81    
ref|XP_002510677.1|  catalase, putative                                 273   2e-81    
dbj|BAJ88747.1|  predicted protein                                      265   3e-81    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIU99487.1|  catalase                                                263   3e-81    Saccharum hybrid cultivar ROC22
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 265   3e-81    
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      263   3e-81    Cucumis melo [Oriental melon]
gb|AIZ77475.1|  catalase                                                263   3e-81    Triticum aestivum [Canadian hard winter wheat]
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    263   3e-81    Arabis alpina [alpine rockcress]
gb|AAF61733.1|AF243518_1  catalase 3                                    263   4e-81    Helianthus annuus
gb|ADU56198.1|  catalase                                                263   4e-81    Musa acuminata AAA Group [Cavendish banana]
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               263   5e-81    
gb|AHF27432.1|  catalase                                                262   5e-81    
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 263   5e-81    
gb|AAC19398.1|  root catalase                                           263   5e-81    
gb|AHF27429.1|  catalase                                                262   5e-81    
gb|AAG61140.2|AF332973_1  catalase 2                                    263   5e-81    
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             263   7e-81    
ref|XP_002521709.1|  catalase, putative                                 262   7e-81    
gb|AIU99483.1|  catalase                                                262   8e-81    
gb|ADM96039.1|  catalase                                                262   8e-81    
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 262   9e-81    
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    262   9e-81    
gb|AIP93616.1|  CAT1                                                    262   1e-80    
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      262   1e-80    
emb|CDY01363.1|  BnaA07g11360D                                          261   1e-80    
ref|XP_009103333.1|  PREDICTED: catalase-1                              261   1e-80    
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               261   1e-80    
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      261   1e-80    
emb|CDY31877.1|  BnaC07g15270D                                          261   1e-80    
gb|AAF61734.1|AF243519_1  catalase 4                                    261   2e-80    
gb|ADU56199.1|  catalase                                                261   2e-80    
ref|XP_010692546.1|  PREDICTED: catalase                                261   3e-80    
tpg|DAA43177.1|  TPA: catalase2                                         260   4e-80    
gb|AAK67359.2|AF390210_1  catalase                                      260   5e-80    
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      260   6e-80    
ref|NP_001105310.1|  catalase isozyme 2                                 259   6e-80    
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               259   7e-80    
prf||1803522A  catalase                                                 259   8e-80 
gb|ABV55108.1|  catalase 2                                              259   1e-79    
gb|ADK25939.1|  catalase                                                251   1e-79    
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             259   1e-79    
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         259   1e-79    
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      259   2e-79    
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             258   3e-79    
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 267   4e-79    
tpg|DAA43178.1|  TPA: catalase2                                         258   5e-79    
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               257   7e-79    
gb|ABY21704.1|  catalase-1 precursor                                    257   7e-79    
dbj|BAH37035.1|  catalase 1                                             257   1e-78    
gb|AHB72694.1|  catalase                                                257   1e-78    
gb|ADN94253.1|  catalase                                                256   1e-78    
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             256   1e-78    
ref|NP_001031073.1|  catalase 3                                         256   1e-78    
gb|AAB07026.1|  catalase 1                                              256   1e-78    
gb|AFD29285.1|  catalase                                                256   2e-78    
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             256   2e-78    
gb|ACH63223.1|  catalase                                                255   5e-78    
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   258   6e-78    
gb|KHG21219.1|  Catalase isozyme 1                                      251   2e-77    
gb|AJF34884.1|  catalase                                                251   2e-76    
gb|ACL81498.1|  catalase                                                250   4e-76    
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            250   5e-76    
emb|CDY31490.1|  BnaC05g15990D                                          248   2e-75    
emb|CDY29518.1|  BnaA06g14520D                                          248   2e-75    
ref|XP_009149540.1|  PREDICTED: catalase-1                              248   2e-75    
dbj|BAH20283.1|  AT1G20620                                              236   3e-75    
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         247   4e-75    
gb|AAZ29552.1|  catalase-C                                              247   7e-75    
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         246   2e-74    
ref|XP_010477308.1|  PREDICTED: catalase-1                              244   4e-74    
gb|AAC17730.1|  catalase 2                                              242   4e-74    
dbj|BAH56915.1|  AT1G20620                                              244   6e-74    
dbj|BAJ92414.1|  predicted protein                                      244   6e-74    
ref|XP_001779509.1|  predicted protein                                  244   8e-74    
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             244   8e-74    
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              243   1e-73    
gb|ADY02963.1|  catalase                                                243   1e-73    
emb|CAH61266.1|  catalase                                               243   2e-73    
gb|EMS51034.1|  Catalase isozyme 2                                      243   2e-73    
gb|AAX88799.1|  catalase                                                243   2e-73    
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               243   2e-73    
gb|ABN71233.2|  catalase                                                243   3e-73    
ref|NP_001045673.1|  Os02g0115700                                       243   3e-73    
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 242   3e-73    
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          243   4e-73    
ref|XP_010105996.1|  Catalase isozyme 1                                 238   5e-73    
gb|AFR42410.1|  catalase                                                230   6e-73    
dbj|BAH19523.1|  AT4G35090                                              241   6e-73    
ref|NP_001031791.1|  catalase 2                                         241   6e-73    
ref|XP_001752315.1|  predicted protein                                  239   4e-72    
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      239   4e-72    
gb|ADQ28492.1|  catalase                                                239   4e-72    
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      239   5e-72    
gb|EMT06167.1|  Catalase isozyme 2                                      243   1e-71    
gb|ABK24449.1|  unknown                                                 238   1e-71    
gb|AFR42412.1|  catalase                                                226   2e-71    
ref|XP_001784759.1|  predicted protein                                  237   3e-71    
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      236   4e-71    
gb|AGI65617.1|  catalase                                                235   1e-70    
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          235   1e-70    
gb|EMS61345.1|  Catalase isozyme 1                                      238   3e-70    
gb|AGT16203.1|  catalase                                                234   7e-70    
emb|CAA43814.1|  catalase                                               233   2e-69    
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           233   2e-69 
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    233   2e-69    
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          232   3e-69    
gb|ABR16304.1|  unknown                                                 231   3e-69    
gb|ABK24543.1|  unknown                                                 231   5e-69    
gb|AII23739.1|  catalase                                                231   7e-69    
ref|XP_005645077.1|  catalase                                           230   2e-68    
dbj|BAD07937.1|  catalase catA-like protein                             215   7e-67    
gb|AGT16188.1|  catalase                                                225   2e-66    
gb|AGT16054.1|  catalase                                                225   2e-66    
gb|AGT15888.1|  catalase                                                225   2e-66    
gb|AGT16310.1|  catalase                                                224   2e-66    
gb|AFW66787.1|  catalase3                                               224   3e-66    
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               224   3e-66    
gb|AHZ13843.1|  catalase                                                223   6e-66    
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              222   1e-65    
gb|ABK41476.1|  catalase                                                222   2e-65    
gb|KIY96954.1|  catalase                                                216   1e-64    
gb|AFW66785.1|  catalase3 isoform 1                                     224   2e-64    
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     216   3e-63    
gb|AEY70510.1|  catalase                                                210   7e-63    
gb|AID50071.1|  catalase                                                204   1e-62    
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      214   2e-62    
gb|EMS35721.1|  Catalase isozyme 1                                      207   4e-62    
ref|NP_001105416.1|  catalase isozyme 3                                 212   2e-61    
ref|XP_002950455.1|  catalase                                           212   2e-61    
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        211   2e-61    
dbj|BAA34714.1|  catalase                                               211   4e-61    
emb|CAA10286.1|  catalase                                               199   5e-61    
ref|XP_011396830.1|  Catalase isozyme 2                                 210   6e-61    
gb|AFW66789.1|  catalase3                                               203   3e-60    
ref|XP_001696763.1|  catalase/peroxidase                                208   3e-60    
emb|CAA73663.1|  catalase                                               205   6e-59    
gb|AFI48111.1|  catalase isozyme B                                      194   6e-59    
gb|AAB70006.1|  catalase                                                205   7e-59    
gb|ABY68162.1|  catalase                                                193   1e-58    
gb|ABY68159.1|  catalase                                                193   1e-58    
gb|ABY68158.1|  catalase                                                193   2e-58    
gb|ABY68164.1|  catalase                                                192   2e-58    
ref|XP_005708279.1|  catalase                                           203   2e-58    
gb|AFW66788.1|  catalase3                                               203   3e-58    
gb|AFI48054.1|  catalase isozyme B                                      192   4e-58    
gb|ABY68160.1|  catalase                                                191   6e-58    
gb|ABY68161.1|  catalase                                                191   8e-58    
gb|AFI48068.1|  catalase isozyme B                                      190   2e-57    
gb|AFI48101.1|  catalase isozyme B                                      190   2e-57    
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             199   6e-57    
pir||A55092  catalase (EC 1.11.1.6) CAT-2 - maize (fragment)            199   8e-57 
gb|AFI48131.1|  catalase isozyme B                                      187   2e-56    
gb|AFI48098.1|  catalase isozyme B                                      187   3e-56    
gb|AFI48130.1|  catalase isozyme B                                      185   2e-55    
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      194   1e-54    
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              194   1e-54    
gb|AAR84577.1|  catalase 1b                                             192   1e-54    
gb|KJB10391.1|  hypothetical protein B456_001G198700                    190   1e-53    
emb|CBI29556.3|  unnamed protein product                                179   3e-53    
gb|ABB88582.1|  catalase                                                187   3e-52    
gb|KJB17474.1|  hypothetical protein B456_003G002800                    186   3e-52    
gb|AFK46618.1|  unknown                                                 171   3e-50    
gb|KDD77132.1|  catalase                                                181   7e-50    
dbj|BAD94702.1|  catalase                                               169   2e-49    
gb|AAO16182.1|  catalase-1                                              169   3e-49    
gb|ABY68163.1|  catalase                                                166   2e-48    
ref|XP_005536240.1|  catalase                                           174   2e-47    
gb|AGS17821.1|  catalase 2                                              167   1e-45    
gb|ABB51561.1|  truncated catalase 2                                    167   3e-45    
gb|AAP57673.1|  catalase                                                162   4e-45    
gb|AFH53187.1|  catalase                                                162   5e-45    
gb|AFH53190.1|  catalase                                                162   5e-45    
gb|AFH53189.1|  catalase                                                162   5e-45    
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             162   3e-43    
emb|CDP22058.1|  unnamed protein product                                153   1e-42    
ref|XP_005712277.1|  unnamed protein product                            160   2e-42    
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 160   3e-42    
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 160   3e-42    
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      159   4e-42    
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             157   3e-41    
gb|ACU23083.1|  unknown                                                 149   2e-40    
gb|AEA86295.1|  putative catalase                                       143   1e-38    
ref|NP_973873.1|  catalase 3                                            149   2e-38    
gb|KJE89728.1|  catalase isozyme 2                                      149   5e-38    
ref|XP_004366029.2|  catalase isozyme 2                                 149   5e-38    
gb|ABS72010.1|  putative catalase                                       139   6e-38    
ref|XP_002963084.1|  hypothetical protein SELMODRAFT_404656             140   1e-37    
gb|KEH36313.1|  catalase heme-binding enzyme                            146   2e-37    
gb|ABS89000.1|  catalase                                                140   2e-37    
gb|AAR25790.1|  catalase                                                137   4e-37    
ref|XP_008365914.1|  PREDICTED: catalase isozyme 3-like                 137   4e-37    
gb|KCW70319.1|  hypothetical protein EUGRSUZ_F03561                     142   1e-36    
ref|XP_008348923.1|  PREDICTED: catalase isozyme 3-like                 135   3e-36    
ref|XP_005644653.1|  catalase-domain-containing protein                 144   4e-36    
gb|AFA36510.1|  catalase                                                137   1e-35    
emb|CAA42026.1|  catalase                                               132   2e-35    
ref|XP_005647994.1|  catalase-domain-containing protein                 133   2e-32    
gb|ADR01107.1|  catalase 3                                              130   7e-32    
gb|ACJ71245.1|  catalase 2                                              130   9e-32    
gb|ACY30463.1|  catalase                                                129   2e-31    
gb|AHB35639.1|  catalase                                                124   3e-31    
gb|ACJ71244.1|  catalase 2                                              127   9e-31    
ref|XP_002980252.1|  hypothetical protein SELMODRAFT_112333             120   1e-30    
gb|KCW68093.1|  hypothetical protein EUGRSUZ_F01775                     127   1e-30    
emb|CDY43951.1|  BnaC04g21590D                                          123   2e-30    
emb|CDY31866.1|  BnaC07g15160D                                          122   3e-30    
ref|WP_032664185.1|  catalase                                           126   6e-30    
ref|WP_032632526.1|  catalase                                           125   8e-30    
gb|KIQ35234.1|  catalase                                                125   1e-29    
ref|WP_043304355.1|  catalase                                           125   1e-29    
ref|WP_004887231.1|  catalase                                           124   2e-29    
ref|WP_032610664.1|  catalase                                           124   2e-29    
ref|WP_043830984.1|  catalase                                           124   3e-29    
ref|WP_026826608.1|  catalase                                           124   3e-29    
gb|AAZ03546.1|  Catalase                                                119   4e-29    
ref|WP_044037961.1|  catalase                                           123   4e-29    
ref|WP_032884665.1|  catalase                                           124   4e-29    
ref|XP_005642928.1|  catalase                                           123   4e-29    
ref|WP_015881004.1|  catalase                                           123   5e-29    
ref|WP_027605312.1|  catalase                                           123   5e-29    
gb|ABN79860.2|  catalase                                                120   7e-29    
gb|EGH29791.1|  catalase                                                119   7e-29    
gb|KGS11078.1|  catalase                                                120   8e-29    
ref|WP_029723487.1|  catalase                                           122   9e-29    
ref|WP_016429054.1|  hypothetical protein                               122   1e-28    
ref|WP_032632922.1|  catalase                                           122   1e-28    
ref|WP_038401366.1|  catalase                                           122   1e-28    
gb|AHG41775.1|  catalase                                                122   1e-28    
ref|WP_032622880.1|  catalase                                           122   1e-28    
ref|WP_022641122.1|  catalase                                           122   1e-28    
ref|WP_043193175.1|  catalase                                           122   2e-28    



>gb|AFY26882.1| catalase, partial [Ipomoea batatas]
Length=173

 Score =   359 bits (921),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 168/173 (97%), Positives = 173/173 (100%), Gaps = 0/173 (0%)
 Frame = -2

Query  717  EMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDG  538
            EM+AMDPAHIVPGIYFSDDKMLQAR+FAYADTHRHRLGPNYMLLPVNAPKCA+HNNSYDG
Sbjct  1    EMLAMDPAHIVPGIYFSDDKMLQARVFAYADTHRHRLGPNYMLLPVNAPKCAHHNNSYDG  60

Query  537  YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWA  358
            YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTG+RDKCVIEKENNFKQPGDRYRSWA
Sbjct  61   YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGQRDKCVIEKENNFKQPGDRYRSWA  120

Query  357  PDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            PDRQDRFINRWVK+LSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM
Sbjct  121  PDRQDRFINRWVKALSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  173



>gb|ADB03784.1| catalase [Ipomoea batatas]
Length=492

 Score =   360 bits (925),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 169/174 (97%), Positives = 174/174 (100%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NEM+AMDPAHIVPGIYFSDDKMLQAR+FAYADTHRHRLGPNYMLLPVNAPKCA+HNNSYD
Sbjct  319  NEMLAMDPAHIVPGIYFSDDKMLQARVFAYADTHRHRLGPNYMLLPVNAPKCAHHNNSYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTG+RDKCVIEKENNFKQPGDRYRSW
Sbjct  379  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGQRDKCVIEKENNFKQPGDRYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQDRFINRWVK+LSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM
Sbjct  439  APDRQDRFINRWVKALSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  492



>sp|P07145.1|CATA_IPOBA RecName: Full=Catalase [Ipomoea batatas]
 emb|CAA29063.1| unnamed protein product [Ipomoea batatas]
Length=492

 Score =   360 bits (925),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 169/174 (97%), Positives = 174/174 (100%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NEM+AMDPAHIVPGIYFSDDKMLQAR+FAYADTHRHRLGPNYMLLPVNAPKCA+HNNSYD
Sbjct  319  NEMLAMDPAHIVPGIYFSDDKMLQARVFAYADTHRHRLGPNYMLLPVNAPKCAHHNNSYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTG+RDKCVIEKENNFKQPGDRYRSW
Sbjct  379  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGQRDKCVIEKENNFKQPGDRYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQDRFINRWVK+LSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM
Sbjct  439  APDRQDRFINRWVKALSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  492



>emb|CAB56850.1| catalase [Prunus persica]
Length=423

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +PAH+VPGIY+SDDKMLQ RIFAY+DT RHRLGPNY+ LPVNAPKC +HNN ++
Sbjct  250  NEQLAFNPAHVVPGIYYSDDKMLQTRIFAYSDTQRHRLGPNYLQLPVNAPKCPHHNNHHE  309

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+ D  R+AER+P P  I++G+R+KCVIEKENNFKQPG+RYRSW
Sbjct  310  GFMNFMHRDEEVNYFPSRHDPVRHAERYPIPSNILSGKREKCVIEKENNFKQPGERYRSW  369

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI+RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  370  APDRQERFIHRWVDALSDPRVTHEIRSVWISYWSQADKSLGQKLASRLNVRPSI  423



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   292 bits (747),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+FD  R+AE++P PLR++TG+RDKC++EKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPLRVLTGKRDKCIVEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLNIRPTM
Sbjct  439  APDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKIASRLNIRPTM  492



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   290 bits (743),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +PA +VPGIY+S+DK+LQARIFAY+DTHR+RLGPNY+ LPVNAPKCA+HNN +D
Sbjct  319  NEQLAFNPAFVVPGIYYSNDKLLQARIFAYSDTHRYRLGPNYLQLPVNAPKCAHHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MN +HRDEE++YFPSKFD  R+AER+P P +IVTG+R+K +IEKENNFKQPG+RYRSW
Sbjct  379  GFMNIMHRDEEINYFPSKFDPVRHAERYPIPSQIVTGKREKVIIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFINRW+K+L+EPRVTHE RS WISY TQAD+SLGQK+ASRL+ RP+M
Sbjct  439  APDRQERFINRWIKALTEPRVTHEHRSIWISYWTQADKSLGQKLASRLSARPSM  492



>gb|ABY19573.1| catalase [Manihot esculenta]
Length=261

 Score =   282 bits (721),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NEM+A DP H+VPGI++S+DK+ Q R FAYADT RHRLGPNY +LPVNAPKC YHNN YD
Sbjct  88   NEMLAFDPGHVVPGIHYSNDKLFQLRTFAYADTQRHRLGPNYKMLPVNAPKCNYHNNHYD  147

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEVDYFPS++D  R+AER P P  I++GRR+KCVIEKENNFKQPGDRYRSW
Sbjct  148  GFMNFMHRDEEVDYFPSRYDPVRHAERTPLPHAIISGRREKCVIEKENNFKQPGDRYRSW  207

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQ+RF+ R V +LS+PR+THEIRS W+SY +Q D+SLGQK+ASRLN+RP  
Sbjct  208  TPDRQERFLCRLVNALSDPRITHEIRSIWVSYWSQCDKSLGQKLASRLNVRPNF  261



>ref|XP_006473789.1| PREDICTED: catalase-like isoform X1 [Citrus sinensis]
Length=477

 Score =   289 bits (739),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NEM+A +P  +VPGIY+S+DKMLQ RIFAY DT RHRLGPNY++LPVNAPKC + NN YD
Sbjct  304  NEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYD  363

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEVDYFPS++D TR+AER+P P  ++TGRR+K  IEKENNFKQPG+RYRSW
Sbjct  364  GFMNFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSW  423

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RF+NRW+K+L +PRVTHE+RS W+SY +QADRSLGQK+ASRLN+RP++
Sbjct  424  APDRQERFLNRWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKLASRLNVRPSI  477



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +PAH+VPGIY+S+DK+LQ RIFAY+DTHRHRLGPNY+ LPVNAPKCA+HNN YD
Sbjct  319  NEQLAFNPAHVVPGIYYSEDKLLQGRIFAYSDTHRHRLGPNYLQLPVNAPKCAHHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            GYMN +HRDEE+DYFPS++D  R+AER P P R++TGRR++ VIEKENNFKQP +RYRSW
Sbjct  379  GYMNIMHRDEEIDYFPSRYDPVRHAERHPIPTRVLTGRRERRVIEKENNFKQPVERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RF+ RWV +LS+PR+THEIRS WISY +QAD+SLGQK+A RLN+RPTM
Sbjct  439  APDRQERFVRRWVDALSDPRLTHEIRSIWISYWSQADKSLGQKIAFRLNVRPTM  492



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGPNY++LP NAPKCA+HNN +D
Sbjct  319  NEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLMLPANAPKCAHHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AERFP P RI+TGRR+KCVI KENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAERFPIPFRILTGRREKCVIHKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RWV++LS+PRVT+EIR+ WISY +Q DRSLGQK+A+RLN++P+M
Sbjct  439  APDRQERFICRWVEALSDPRVTYEIRTIWISYWSQCDRSLGQKIATRLNVKPSM  492



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   289 bits (739),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +PAH+VPG+Y+SDDKMLQ RIFAY+DT RHRLGPNY+ LPVNAPKC +HNN ++
Sbjct  319  NEQLAFNPAHVVPGVYYSDDKMLQTRIFAYSDTQRHRLGPNYLQLPVNAPKCPHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AER+P P  I+ G+R+KCVIEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAERYPIPSNILYGKREKCVIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  APDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAX84671.1| catalase CAT2, partial [Manihot esculenta]
Length=270

 Score =   281 bits (720),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NEM+A DP H+VPGI++S+DK+ Q R FAYADT RHRLGPNY +LPVNAPKC YHNN YD
Sbjct  97   NEMLAFDPGHVVPGIHYSNDKLFQLRTFAYADTQRHRLGPNYKMLPVNAPKCNYHNNHYD  156

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEVDYFPS++D  R+AER P P  I++GRR+KCVIEKENNFKQPGDRYRSW
Sbjct  157  GFMNFMHRDEEVDYFPSRYDPVRHAERTPLPHAIISGRREKCVIEKENNFKQPGDRYRSW  216

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQ+RF+ R V +LS+PR+THEIRS W+SY +Q D+SLGQK+ASRLN+RP  
Sbjct  217  TPDRQERFLCRLVNALSDPRITHEIRSIWVSYWSQCDKSLGQKLASRLNVRPNF  270



>ref|XP_006435361.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
 ref|XP_006473790.1| PREDICTED: catalase-like isoform X2 [Citrus sinensis]
 gb|ESR48601.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
Length=493

 Score =   288 bits (738),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NEM+A +P  +VPGIY+S+DKMLQ RIFAY DT RHRLGPNY++LPVNAPKC + NN YD
Sbjct  320  NEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYD  379

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEVDYFPS++D TR+AER+P P  ++TGRR+K  IEKENNFKQPG+RYRSW
Sbjct  380  GFMNFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSW  439

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RF+NRW+K+L +PRVTHE+RS W+SY +QADRSLGQK+ASRLN+RP++
Sbjct  440  APDRQERFLNRWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKLASRLNVRPSI  493



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   288 bits (737),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +PA +VPG+Y+S+DKMLQ R+FAY+DT RHRLGPNY+ LPVNAPKCA+HNN YD
Sbjct  319  NEQLAFNPAFVVPGVYYSNDKMLQTRLFAYSDTQRHRLGPNYLQLPVNAPKCAHHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEVDYFPS++   R+AE FP P  I+TG+RDKCVIEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVDYFPSRYQPARHAETFPIPSNIITGKRDKCVIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RF++RWV  LSEPRVT+EIRS WISY +QADRS GQK+A+RLN+RP++
Sbjct  439  APDRQERFLHRWVDVLSEPRVTYEIRSIWISYWSQADRSFGQKLATRLNVRPSI  492



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   288 bits (737),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +PA +VPGIYFS+DK+LQARIFAY+DTHR+RLGPNY+ LPVNAPKCA+HNN +D
Sbjct  319  NEQLAFNPAFVVPGIYFSNDKLLQARIFAYSDTHRYRLGPNYLQLPVNAPKCAHHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEE++YFPSKFD  R+AER+P P +IVTG+R++ +IEKENNFKQ G+RYRSW
Sbjct  379  GFMNFMHRDEEINYFPSKFDPVRHAERYPIPSQIVTGKRERVIIEKENNFKQAGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFINRW+K+LSEPRVTHE RS WISY TQAD+S+GQK+AS L+ RP+M
Sbjct  439  APDRQERFINRWIKALSEPRVTHEHRSIWISYWTQADKSIGQKLASSLSARPSM  492



>dbj|BAF91369.1| catalase [Capsicum annuum]
Length=492

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKCA+HNN  D
Sbjct  319  NEQLAFNPGHIVPGVYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNHRD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEVDY PS+FD  R AE++P P  ++TGRR+KCVI KENNFKQ G+RYRSW
Sbjct  379  GAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVIPKENNFKQAGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  439  APDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>gb|ABR15776.1| catalase [Litchi chinensis]
Length=291

 Score =   281 bits (719),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +P  +VPGIY+SDDKMLQ RIFAY DT RHRLGPNY++LPVNAPKC +HNN YD
Sbjct  118  NEQLAFNPGLVVPGIYYSDDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHHNNHYD  177

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEVDYFPSKF N  NAE+FP P RI +G+R+K  IEKENNFK PGDRYRSW
Sbjct  178  GFMNFMHRDEEVDYFPSKFTNVANAEKFPIPGRICSGKREKACIEKENNFKLPGDRYRSW  237

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI R V  LS+PRVT EIRS W+SY +QAD+SLGQK+ASRLN+RP +
Sbjct  238  APDRQERFIKRVVDGLSDPRVTFEIRSIWVSYWSQADKSLGQKIASRLNVRPNI  291



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   287 bits (734),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +PAH+VPGIY+SDDKMLQ RIFAY+DT RHRLGPNY+ LPVNAPKC +HNN ++
Sbjct  319  NEQLAFNPAHVVPGIYYSDDKMLQTRIFAYSDTQRHRLGPNYLQLPVNAPKCPHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+ D  R+AER+P P  I++G+R+KCVIEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRHDPVRHAERYPIPSNILSGKREKCVIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ SRLN+RP++
Sbjct  439  APDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLLSRLNVRPSI  492



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG+RDKC+IEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRFDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD++LGQK+ASRLN+RPTM
Sbjct  439  APDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKTLGQKIASRLNVRPTM  492



>sp|Q9M5L6.1|CATA_CAPAN RecName: Full=Catalase; AltName: Full=CaCat1 [Capsicum annuum]
 gb|AAF34718.1|AF227952_1 catalase [Capsicum annuum]
Length=492

 Score =   286 bits (732),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKCA+HNN  D
Sbjct  319  NEQLAFNPGHIVPGVYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNHRD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEVDY PS+FD  R AE++P P  ++TGRR+KCVI KENNFKQ G+RYRSW
Sbjct  379  GAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVIPKENNFKQAGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQDR+IN+WV+SLS+PR THEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  439  APDRQDRYINKWVESLSDPRATHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   285 bits (730),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LPVNAPKC++HNN ++
Sbjct  319  NEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  RNAERFP P  I++G+R+KC+IEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRNAERFPIPPNILSGKREKCIIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  APDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   285 bits (730),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +PAH+VPGIY+SDDK+LQ RIFAY+DT RHRLGPNY+ LPVNAPKC +HNN ++
Sbjct  319  NEQLAFNPAHVVPGIYYSDDKVLQTRIFAYSDTQRHRLGPNYLQLPVNAPKCPHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+ D  R+AER+P P  I++G+R+KCVIEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRHDPVRHAERYPIPSNILSGKREKCVIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ SRLN+RP++
Sbjct  439  APDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLLSRLNVRPSI  492



>gb|AAA57551.1| catalase, partial [Nicotiana sylvestris]
Length=383

 Score =   281 bits (720),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKCA+HNN  D
Sbjct  210  NEQLAFNPGHIVPGLYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNHRD  269

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEVDY PS+FD  R+AE++P P R++TGRR+ CVIEKENNFKQ G+RYRSW
Sbjct  270  GAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSW  329

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQDR++++WV+ LS+PRVT+EIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  330  EPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTLKPTM  383



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE VA  PA +VPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ LPVNAPKC +HNN +D
Sbjct  319  NEQVAFCPALVVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCVHHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+FD  R+AERFP+P  I +GRR+KC+IEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRFDPVRHAERFPSPPAICSGRREKCIIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RF+ RWV++LS+ R THEIRS WISY +QAD+SLGQK+ASRLN+RP+ 
Sbjct  439  APDRQERFLKRWVEALSDKRCTHEIRSIWISYWSQADKSLGQKLASRLNVRPSF  492



>sp|Q9AXH0.1|CATA_AVIMR RecName: Full=Catalase [Avicennia marina]
 gb|AAK06839.1|AF328861_1 catalase [Avicennia marina]
 gb|AAP13538.1| catalase [Avicennia marina]
Length=492

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NEM+A  P  IVPGI FS+DKMLQ RIFAY DT RHRLGPNY+LLPVNAPKCAYHNN YD
Sbjct  319  NEMLAFSPHMIVPGINFSNDKMLQTRIFAYGDTQRHRLGPNYLLLPVNAPKCAYHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEVDYFPSK+D TR+AER P P  ++TGRRD+ VIEKE+NFKQ GDRYRSW
Sbjct  379  GFMNFMHRDEEVDYFPSKYDPTRHAERHPIPNAVITGRRDRRVIEKEDNFKQAGDRYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RF+ RWV +LS+PR+T EIRS W+SY +QAD+S GQK+ASRLN+RPTM
Sbjct  439  APDRQERFLRRWVDALSDPRLTLEIRSIWVSYWSQADKSFGQKLASRLNVRPTM  492



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LPVNAPKC++HNN ++
Sbjct  319  NEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AERFP P  I++G+R+KC+IEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAERFPIPPNILSGKREKCIIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI+RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  APDRQERFIHRWVDALSDPRVTHEIRSVWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LPVNAPKC++HNN ++
Sbjct  319  NEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AERFP P  I++G+R+KC+IEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAERFPIPPNILSGKREKCIIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI+RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  APDRQERFIHRWVDALSDPRVTHEIRSVWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAB88173.1| catalase, partial [Glycine max]
Length=308

 Score =   278 bits (712),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  135  NEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHE  194

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE FP P  I +GRR+KC IEKENNFKQPG+RYRSW
Sbjct  195  GFMNFIHRDEEVNYFPSRYDPVRHAETFPIPPAICSGRREKCGIEKENNFKQPGERYRSW  254

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQDRF  RWV +LS+PRVTHEIRS WISY +QADRSLGQK+ASRL++RP +
Sbjct  255  APDRQDRFNRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASRLSMRPNI  308



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGPNY++LP NAPKCA+HNN +D
Sbjct  319  NEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLMLPANAPKCAHHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AERFP P RI+TGRR+KCVI KENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAERFPIPSRILTGRREKCVIHKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P+RQ+RFI RWV++LS+PRVTHEI+S WISY +Q D+SLGQK+A+RLN++P M
Sbjct  439  DPNRQERFIRRWVEALSDPRVTHEIQSIWISYWSQCDKSLGQKIATRLNVKPCM  492



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY++LPVNAPKCA+HNN +D
Sbjct  319  NEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLMLPVNAPKCAHHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AERFP P  +VTGRR+K +I KENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAERFPIPSSVVTGRREKSIINKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RF++RWV +LS+PRVTHEIR  WISY +Q D+SLGQK+A+RLN++PTM
Sbjct  439  APDRQERFVHRWVDALSDPRVTHEIRDIWISYWSQCDKSLGQKIATRLNVKPTM  492



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   284 bits (726),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+ D +R+AERFP P  + +GRR+KC+IEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRHDPSRHAERFPIPSAVCSGRREKCIIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RF+ RWV +LSEPRVTHE+RS WISY +QAD+SLGQK+AS LN+RP++
Sbjct  439  APDRQERFVRRWVDALSEPRVTHEVRSIWISYWSQADKSLGQKLASHLNVRPSV  492



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   284 bits (726),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPGIY+SDDK+LQ R+F+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIVVPGIYYSDDKLLQTRVFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEE++YFPS++D +R+AERFP P  + TG+R+KC+IEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEINYFPSRYDPSRHAERFPIPPALCTGKREKCIIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFINRWV ++S+PRVTHEIRS WI+Y +QAD+SLGQK+ASRLN+RP++
Sbjct  439  APDRQERFINRWVDAMSDPRVTHEIRSIWITYWSQADKSLGQKLASRLNVRPSI  492



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   284 bits (726),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P  +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+LLP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPGIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HR+EEV+YFPS++D  R+AER+P P +I TG+R+KCVIEKENNFKQPG+RYRSW
Sbjct  379  GFMNFLHREEEVNYFPSRYDPVRHAERYPIPPQICTGKREKCVIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RW+ +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN++P+M
Sbjct  439  APDRQERFIKRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVKPSM  492



>sp|P55311.1|CATA_SOLME RecName: Full=Catalase [Solanum melongena]
 emb|CAA50644.1| catalase [Solanum melongena]
Length=492

 Score =   283 bits (725),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKCA+HNN  D
Sbjct  319  NEQLAFNPGHIVPGVYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNHRD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEVDY PS+FD  R AE++P P  ++TGRR+KCVI KENNFKQ G+RYR+W
Sbjct  379  GAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVIPKENNFKQAGERYRTW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  439  EPDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLLVKPTM  492



>ref|XP_009590727.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
Length=492

 Score =   283 bits (724),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKCA+HNN  D
Sbjct  319  NEQLAFNPGHIVPGVYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNHRD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEVDY PS+FD  R+AE++P P R++TGRR+ CVIEKENNFKQ G+RYRSW
Sbjct  379  GAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQDR++++WV+ LS+PRVT+EIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  439  EPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   283 bits (724),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA+HNN +D
Sbjct  319  NEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AER P P  +++G+RDKCVI+KENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAERHPIPPPVLSGKRDKCVIQKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RWV +LS+ RVTHEIRS WISY +QAD+SLGQK+A+RLN+RPTM
Sbjct  439  APDRQERFICRWVDALSDARVTHEIRSIWISYWSQADKSLGQKIATRLNVRPTM  492



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   283 bits (723),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LPVNAPKC++HNN ++
Sbjct  319  NEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE FP P  I TG+R+KCVIEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPARHAETFPIPSNICTGKREKCVIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RF++RWV  LSEPRVTHEIRS WISY +QADRS GQK+ASRLN+RP++
Sbjct  439  APDRQERFLHRWVDVLSEPRVTHEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   283 bits (723),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+ D +R+AERFP P  + +GRR+KC+IEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRHDPSRHAERFPIPSAVCSGRREKCIIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RF+ RWV +LSEPRVTHE+RS WISY +QAD+SLGQK+AS LN+RP++
Sbjct  439  APDRQERFVCRWVDALSEPRVTHEVRSIWISYWSQADKSLGQKLASHLNVRPSI  492



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   283 bits (723),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LPVNAPKC++HNN ++
Sbjct  319  NEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE FP P  I TG+R+KCVIEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPARHAETFPIPSNICTGKREKCVIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RF++RWV  LSEPRVTHEIRS WISY +QADRS GQK+ASRLN+RP++
Sbjct  439  APDRQERFLHRWVDVLSEPRVTHEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ RIF+Y+DT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEV+YFPS+FD  R+AE++P P RI+TG+RD+C+IEKENNFKQPG+RYRSW
Sbjct  379  GVMNFMHRDEEVNYFPSRFDPCRHAEQYPIPPRILTGKRDRCIIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            +PDRQ+RFI RW+ +LS+PRVTHEI + WISY +QAD+SLG+K+ASRLN+RPTM
Sbjct  439  SPDRQERFICRWINALSDPRVTHEIHTIWISYWSQADKSLGEKIASRLNVRPTM  492



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGPNY++LP NAPKCA+HNN +D
Sbjct  319  NEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLMLPANAPKCAHHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE FP P  ++TGRR+KCVI KENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAETFPIPSCVLTGRREKCVIHKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ RFI RWV++LS+PRVT+EIRS WISY +Q DRSLGQK+A+RLN++P+M
Sbjct  439  APDRQGRFICRWVEALSDPRVTYEIRSIWISYWSQCDRSLGQKIATRLNVKPSM  492



>sp|P49319.2|CATA1_TOBAC RecName: Full=Catalase isozyme 1; AltName: Full=Salicylic acid-binding 
protein; Short=SABP [Nicotiana tabacum]
 gb|AAA57552.1| catalase [Nicotiana tabacum]
Length=492

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKCA+HNN  D
Sbjct  319  NEQLAFNPGHIVPGLYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNHRD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEVDY PS+FD  R+AE++P P R++TGRR+ CVIEKENNFKQ G+RYRSW
Sbjct  379  GAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQDR++++WV+ LS+PRVT+EIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  439  EPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTLKPTM  492



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NEM+A +PA +VPGIY+++DKMLQ RIFAY+DT RHRLGPNY+ LPVNAPKCA+HNN +D
Sbjct  319  NEMLAFNPALVVPGIYYTNDKMLQGRIFAYSDTQRHRLGPNYLQLPVNAPKCAFHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEVDYFPS+FD  R+AE FP P  I  G+R+K VIEKENNFKQPG+RYRS+
Sbjct  379  GSMNFMHRDEEVDYFPSRFDPVRHAETFPIPSTICHGKREKVVIEKENNFKQPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  205
            APDRQ+RFINRWV++LS+PRVT+EIRS WISY +QADRSLGQK+ASRLN++P
Sbjct  439  APDRQERFINRWVETLSDPRVTYEIRSIWISYWSQADRSLGQKLASRLNVKP  490



>ref|XP_009792372.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKCA+HNN  D
Sbjct  319  NEQLAFNPGHIVPGLYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNHRD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEVDY PS+FD  R+AE++P P R++TGRR+ CVIEKENNFKQ G+RYRSW
Sbjct  379  GAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQDR++++WV+ LS+PRVT+EIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  439  EPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTLKPTM  492



>gb|KJB14249.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=344

 Score =   278 bits (710),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  171  NEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHE  230

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEE++YFPS++D  R+AE FP P  + TGRR+KC+IEKENNFKQPG+RYRSW
Sbjct  231  GFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSW  290

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            A DRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+S+GQK+ASRLN+RP++
Sbjct  291  AADRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSVGQKLASRLNVRPSI  344



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NEM+A +PA +VPGIY+++DKMLQ RIFAY+DT RHRLGPNY+ LPVNAPKCA+HNN +D
Sbjct  319  NEMLAFNPALVVPGIYYTNDKMLQGRIFAYSDTQRHRLGPNYLQLPVNAPKCAFHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEVDYFPS+FD  R+AE FP P  I  G+R+K VIEKENNFKQPG+RYRS+
Sbjct  379  GSMNFMHRDEEVDYFPSRFDPVRHAETFPIPSTICHGKREKVVIEKENNFKQPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  205
            APDRQ+RFINRWV++LS+PRVT+EIRS WISY +QADRSLGQK+ASRLN++P
Sbjct  439  APDRQERFINRWVETLSDPRVTYEIRSIWISYWSQADRSLGQKLASRLNVKP  490



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPG+Y+SDDK+LQ+RIF+YADT RHRLGPNY+ LPVNAPKC +HNN ++
Sbjct  319  NEQLAFCPAIVVPGVYYSDDKLLQSRIFSYADTQRHRLGPNYLQLPVNAPKCTHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEV+YFPS+FD+ R+AE+FP P  ++ G+RD+C+IEKENNFKQPG+RYRSW
Sbjct  379  GLMNFMHRDEEVNYFPSRFDSVRHAEKFPIPPPVLNGKRDRCMIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RWV++LS+PRVT EIRS WISY TQAD+SLGQK+AS LN+RP+M
Sbjct  439  APDRQERFIGRWVEALSDPRVTQEIRSIWISYWTQADKSLGQKIASCLNVRPSM  492



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   281 bits (720),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R+KC+IEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  APDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   281 bits (720),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPPNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+FD  R+AE++P P R++ G+RD+C+I+KENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPPRVLNGKRDRCIIQKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RWV +LSEPRVTHEIR+ W+SY +QAD+SLGQK+ASRLN++PTM
Sbjct  439  APDRQERFICRWVDALSEPRVTHEIRTIWLSYWSQADKSLGQKLASRLNVKPTM  492



>gb|AEQ30070.1| catalase, partial [Litchi chinensis]
Length=487

 Score =   281 bits (719),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +P  +VPGIY+SDDKMLQ RIFAY DT RHRLGPNY++LPVNAPKC +HNN YD
Sbjct  314  NEQLAFNPGLVVPGIYYSDDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHHNNHYD  373

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEVDYFPSKF N  NAE+FP P RI +G+R+K  IEKENNFK PGDRYRSW
Sbjct  374  GFMNFMHRDEEVDYFPSKFTNVANAEKFPIPGRICSGKREKACIEKENNFKLPGDRYRSW  433

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI R V  LS+PRVT EIRS W+SY +QAD+SLGQK+ASRLN+RP +
Sbjct  434  APDRQERFIKRVVDGLSDPRVTFEIRSIWVSYWSQADKSLGQKIASRLNVRPNI  487



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   281 bits (720),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY++LPVNAPKCA+HNN YD
Sbjct  319  NEQLAFCPALVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLMLPVNAPKCAHHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEVDYFPS++D  R+AERFP P R++TG+R+KC+I KENNFKQPG+RYRS+
Sbjct  379  GFMNFMHRDEEVDYFPSRYDPVRHAERFPIPTRVLTGKREKCMISKENNFKQPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            +PDRQ+RFI RWV++LS+P+VTHEIRS WISY +Q D+SL QK+A+RL+++P+M
Sbjct  439  SPDRQERFIRRWVEALSDPKVTHEIRSIWISYWSQCDKSLSQKLATRLSVKPSM  492



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   281 bits (719),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P  +VPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY++LP NAPKCA+HNN +D
Sbjct  319  NEQLAFCPGVVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLMLPANAPKCAHHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AERFP P RI TG+R+KCVIEKENNFKQPG+RYRS+
Sbjct  379  GFMNFLHRDEEVNYFPSRYDPVRHAERFPIPPRICTGKREKCVIEKENNFKQPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQ+RFI RW  +LS+PRVTHEIRS WISY +QAD+SLGQK+A+RLN++P+M
Sbjct  439  DPDRQERFIKRWFDALSDPRVTHEIRSIWISYWSQADKSLGQKLATRLNVKPSM  492



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   281 bits (719),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPG+Y SDDK+LQ RIF+Y+D  RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFWPAIVVPGVYCSDDKLLQTRIFSYSDAQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+FD  R+AE++P P  ++TG+RDKC+IEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPPCVLTGKRDKCIIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RWV +LS+PRVTHEIRS W SY +QAD++LGQK+ASRLN+RPTM
Sbjct  439  APDRQERFICRWVDALSDPRVTHEIRSIWFSYWSQADKTLGQKIASRLNVRPTM  492



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   281 bits (719),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ RIF+Y+DT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF++RDEEV+YFPS+FD  R+AE++P P RI+TG+RD+C+IEKENNFKQPG+RYRSW
Sbjct  379  GVMNFMYRDEEVNYFPSRFDPCRHAEQYPIPPRILTGKRDRCIIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            +PDRQ+RFI RW+ +LS+PRVTHEIR  WISY +QAD+SLG+K+ASRLN+RPTM
Sbjct  439  SPDRQERFICRWINALSDPRVTHEIRIIWISYWSQADKSLGEKIASRLNVRPTM  492



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   281 bits (718),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIVVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R+KC+IEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  APDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   281 bits (718),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R+KC+IEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RF+ RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  APDRQERFVCRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   281 bits (718),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D +R+AER+P P  +++G+R K  IEKENNFKQPGDRYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPSRHAERYPIPPVVLSGKRGKICIEKENNFKQPGDRYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RWV++LS+PR+THEIRS W+SY +QAD+SLGQK+ASRLN+RP M
Sbjct  439  APDRQERFIRRWVEALSDPRLTHEIRSIWVSYWSQADKSLGQKLASRLNVRPAM  492



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   281 bits (718),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEE++YFPS++D  R+AE FP P  + TGRR+KC+IEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            A DRQ+RFI RWV++LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  AADRQERFICRWVEALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010498496.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010459748.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010477307.1| PREDICTED: catalase-3 [Camelina sativa]
Length=492

 Score =   281 bits (718),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = -2

Query  717  EMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDG  538
            E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G
Sbjct  320  EQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEG  379

Query  537  YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWA  358
            +MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWA
Sbjct  380  FMNFMHRDEEINYYPSKFDPVRCAEKVPIPTKSYTGIRTKCIIKKENNFKQPGDRYRSWA  439

Query  357  PDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            PDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  440  PDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_009110221.1| PREDICTED: catalase-3 [Brassica rapa]
 gb|AFN81244.1| catalase 2 [Brassica rapa subsp. pekinensis]
 emb|CDX96630.1| BnaA08g21730D [Brassica napus]
Length=492

 Score =   280 bits (717),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
             E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  TEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSW
Sbjct  379  GFMNFMHRDEEINYYPSKFDPVRCAEKVPIPTKSYTGIRTKCIIKKENNFKQPGDRYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  439  APDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   280 bits (717),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D +R+AER+P P  +++G+R K  IEKENNFKQPGDRYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPSRHAERYPIPPVVLSGKRGKICIEKENNFKQPGDRYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RWV++LS+PR+THEIRS W+SY +QAD+SLGQK+AS LN+RPTM
Sbjct  439  APDRQERFIRRWVEALSDPRLTHEIRSIWVSYWSQADKSLGQKLASHLNVRPTM  492



>gb|ACJ76836.3| catalase [Dimocarpus longan]
Length=492

 Score =   280 bits (717),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +P  +VPGIY+SDDKMLQ RIFAY DT RHRLGPNY++LPVNAPKC +HNN YD
Sbjct  319  NEQLAFNPGLVVPGIYYSDDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEVDYFPSKF N  NAE+FP P RI +G+R+K  IEKENNFK PGDRYRSW
Sbjct  379  GFMNFMHRDEEVDYFPSKFTNVANAEKFPIPSRICSGKREKACIEKENNFKLPGDRYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI R V  LS+PRVT E+RS W+SY +QAD+SLGQK+ASRLN+RP +
Sbjct  439  APDRQERFIKRVVDGLSDPRVTFELRSIWVSYWSQADKSLGQKIASRLNVRPNI  492



>dbj|BAC79443.1| catalase [Acacia ampliceps]
Length=492

 Score =   280 bits (717),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P+ +VPGIYFSDDK+LQARIFAY DT RHR+GPNY+ LPVNAPKCA+HNN YD
Sbjct  319  NEQLAFSPSLVVPGIYFSDDKVLQARIFAYGDTQRHRIGPNYLQLPVNAPKCAHHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEVDYFPS++D  R+AE+FP P   + GRRD+ +IEKENNFKQPGD YR+W
Sbjct  379  GTMNFMHRDEEVDYFPSRYDTARHAEKFPIPPVNLIGRRDRRIIEKENNFKQPGDLYRTW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RW+  LS+P+VTHE+RS WISYL+QADRSLGQKVAS LN+RP++
Sbjct  439  APDRQERFIRRWIGVLSDPKVTHEVRSIWISYLSQADRSLGQKVASHLNMRPSI  492



>ref|NP_001031072.3| catalase 3 [Arabidopsis thaliana]
 gb|AEE29996.1| catalase 3 [Arabidopsis thaliana]
Length=377

 Score =   276 bits (707),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  717  EMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDG  538
            E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G
Sbjct  205  EQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEG  264

Query  537  YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWA  358
            +MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R KCVI+KENNFKQ GDRYRSWA
Sbjct  265  FMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWA  324

Query  357  PDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            PDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  325  PDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  377



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   280 bits (716),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LPVNAPKC++HNN ++
Sbjct  319  NEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE FP P  I TG+R+KCVIEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPARHAETFPIPSNICTGKREKCVIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RF++RWV +LS+PRVT+EIRS WISY +QADRS GQK+ASRLN+RP++
Sbjct  439  APDRQERFLHRWVDALSDPRVTYEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   280 bits (716),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPGI++SDDK+LQ RIF+YADT RHRLGPNY++LP NAPKCA+HNN +D
Sbjct  319  NEQLAFCPAIVVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPANAPKCAHHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AER P P RI+TGRR+KCVI+KENNFKQPG+RYRSW
Sbjct  379  GFMNFLHRDEEVNYFPSRYDPVRHAERCPIPSRILTGRREKCVIQKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQ RFI RWV++LS+PRVTHEI+S WISY +Q D+SLG+K+A+RLN++P+M
Sbjct  439  DPDRQGRFIRRWVEALSDPRVTHEIQSIWISYWSQCDKSLGRKIATRLNVKPSM  492



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA+HNN +D
Sbjct  319  NEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+Y PS+FD  R+AERFP P  + TGRR+KC+IEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYLPSRFDPVRHAERFPIPPAVCTGRREKCIIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RF +RWV++LS+PRVTHEI S WISY TQ D+ LGQK+A+RLN+RP++
Sbjct  439  APDRQERFTHRWVEALSDPRVTHEICSIWISYWTQCDKFLGQKLATRLNVRPSI  492



>sp|P49316.1|CATA2_NICPL RecName: Full=Catalase isozyme 2 [Nicotiana plumbaginifolia]
 emb|CAA85425.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKCA+HNN  D
Sbjct  319  NEQLAFNPGHIVPGLYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNHRD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEVDY PS+FD  R+AE++P P R++ GRR+ CVIEKENNFKQ G+RYRSW
Sbjct  379  GAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLNGRREMCVIEKENNFKQAGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQDR++++WV+ LS+PRVT+EIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  439  EPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKVASRLTLKPTM  492



>gb|AAD50974.1|AF170272_1 catalase CAT1 [Manihot esculenta]
Length=492

 Score =   280 bits (715),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NEM+A DP HIVPGI++S+DK+ Q R FAYADT RHRLGPNY +LPVNAPKCAYHNN YD
Sbjct  319  NEMLAFDPGHIVPGIHYSNDKLFQLRTFAYADTQRHRLGPNYKMLPVNAPKCAYHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEVDYFPS++D  R+AER P P  I +GRR+KCVIEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVDYFPSRYDPVRHAERSPIPNAICSGRREKCVIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RF+ R V +LSEPR+T EIRS W+SY ++ D SLGQK+ASRLN+RP +
Sbjct  439  APDRQERFLCRLVNALSEPRITFEIRSIWVSYWSKCDASLGQKLASRLNVRPNI  492



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   280 bits (715),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LPVNAPKC++HNN ++
Sbjct  319  NEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE FP P  I TG+R+KCVIEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAETFPIPSNICTGKREKCVIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RF++RWV +LS+PRVT+EIRS WISY +QADRS GQK+ASRLN+RP++
Sbjct  439  APDRQERFLHRWVDALSDPRVTYEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>gb|AHF27428.1| catalase, partial [Cucurbita moschata]
 gb|AHF27431.1| catalase, partial [Cucurbita maxima]
Length=344

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  171  NEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHE  230

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+FD +R+AER+P P  + +G+R++C+IEKENNFK+PG+RYRSW
Sbjct  231  GFMNFMHRDEEVNYFPSRFDPSRHAERYPHPPAVCSGKRERCIIEKENNFKEPGERYRSW  290

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQ+RF+ RWV +LS+ RVTHEIRS WISY +QADRSLGQK+AS LN+RP++
Sbjct  291  TPDRQERFVRRWVDALSDTRVTHEIRSIWISYWSQADRSLGQKLASHLNVRPSI  344



>emb|CDY33636.1| BnaC08g19360D [Brassica napus]
Length=492

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = -2

Query  717  EMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDG  538
            E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G
Sbjct  320  EQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEG  379

Query  537  YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWA  358
            +MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWA
Sbjct  380  FMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWA  439

Query  357  PDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            PDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  440  PDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_009103334.1| PREDICTED: catalase-3-like [Brassica rapa]
 gb|AAB53101.2| catalase [Brassica napus]
 gb|AET08935.1| catalase [Brassica napus]
Length=492

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = -2

Query  717  EMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDG  538
            E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G
Sbjct  320  EQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEG  379

Query  537  YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWA  358
            +MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWA
Sbjct  380  FMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWA  439

Query  357  PDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            PDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  440  PDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D+ R+AE FP P  I +GRR+KC IEKENNFKQ G+R+RSW
Sbjct  379  GFMNFIHRDEEVNYFPSRYDSVRHAESFPIPPAICSGRREKCGIEKENNFKQAGERFRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQDRFI RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS LN+RP +
Sbjct  439  APDRQDRFIRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLNMRPNI  492



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPG+Y+SDDK+LQ+RIF+YADT RHRLGPNY+ LPVNAPKC +HNN ++
Sbjct  411  NEQLAFCPAIVVPGVYYSDDKLLQSRIFSYADTQRHRLGPNYLQLPVNAPKCTHHNNHHE  470

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEV+YFPS+FD+ R+AE+FP P  ++ G+RD+C+IEKENNFKQPG+RYRSW
Sbjct  471  GLMNFMHRDEEVNYFPSRFDSVRHAEKFPIPPPVLNGKRDRCMIEKENNFKQPGERYRSW  530

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RWV++LS+PRVT EIRS WISY TQAD+SLGQK+AS LN+RP+M
Sbjct  531  APDRQERFIGRWVEALSDPRVTQEIRSIWISYWTQADKSLGQKIASCLNVRPSM  584



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPALIVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPPNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEV+YFPS+FD  R+AER P P  ++TG+RD+C+IEKENNFKQPG+RYR++
Sbjct  379  GLMNFMHRDEEVNYFPSRFDPVRHAERHPIPPPVLTGKRDRCMIEKENNFKQPGERYRTF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RF+ RWV +LS+PRVTHEIRS WISY TQAD+SLGQK+ASRLN+RPTM
Sbjct  439  APDRQERFVCRWVDALSDPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  492



>emb|CDY29519.1| BnaA06g14510D [Brassica napus]
Length=492

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = -2

Query  717  EMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDG  538
            E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G
Sbjct  320  EQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEG  379

Query  537  YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWA  358
            +MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWA
Sbjct  380  FMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWA  439

Query  357  PDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            PDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  440  PDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>emb|CDY31488.1| BnaC05g15970D [Brassica napus]
Length=500

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = -2

Query  717  EMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDG  538
            E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G
Sbjct  328  EQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEG  387

Query  537  YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWA  358
            +MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWA
Sbjct  388  FMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWA  447

Query  357  PDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            PDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  448  PDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  500



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEE++YFPS++D  R+AE FP P  + TGRR+KC+IEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            A DRQ+RFI RWV++ S+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  AADRQERFICRWVEAFSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D+ R+AE FP P  I +GRR+KC IEKENNFKQ G+R+RSW
Sbjct  379  GFMNFIHRDEEVNYFPSRYDSVRHAESFPIPPAICSGRREKCGIEKENNFKQAGERFRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQDRFI RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS LN+RP +
Sbjct  439  APDRQDRFIRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLNMRPNI  492



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AERFP P  I +GRR+KC IEKENNFKQPG+RYRSW
Sbjct  379  GFMNFIHRDEEVNYFPSRYDPVRHAERFPIPPAICSGRREKCGIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQDRF  RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS L+ RP +
Sbjct  439  APDRQDRFARRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLSTRPNI  492



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   279 bits (713),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R+KC+IEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RWV +LS+PR THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  APDRQERFICRWVDALSDPRATHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_009149539.1| PREDICTED: catalase-3 [Brassica rapa]
Length=543

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
             E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  370  TEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHE  429

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSW
Sbjct  430  GFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSW  489

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  490  APDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  543



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   278 bits (712),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE FP P  I +GRR+KC IEKENNFKQPG+RYRSW
Sbjct  379  GFMNFIHRDEEVNYFPSRYDPVRHAETFPIPPAICSGRREKCGIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQDRF  RWV +LS+PRVTHEIRS WISY +QADRSLGQK+ASRL++RP +
Sbjct  439  APDRQDRFNRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASRLSMRPNI  492



>ref|XP_011074090.1| PREDICTED: catalase isoform X1 [Sesamum indicum]
Length=513

 Score =   279 bits (713),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NEM+A  P+ IVPGIYFS+DKMLQ RIFAYADT RHR+GPNY+ LPVNAPKC +HNN +D
Sbjct  340  NEMLAFSPSMIVPGIYFSNDKMLQTRIFAYADTQRHRIGPNYLQLPVNAPKCPHHNNHHD  399

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEV+YFPS++D  R+AE+FP P  +++G+R K VIEKENNFKQPGDRYRSW
Sbjct  400  GAMNFMHRDEEVNYFPSRYDPCRHAEKFPIPPVVLSGQRVKTVIEKENNFKQPGDRYRSW  459

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RW+ +LS+PR+T EIRS W+SY TQAD+SLGQK+ASRLN+RP M
Sbjct  460  APDRQERFIRRWIDALSDPRLTAEIRSIWVSYWTQADKSLGQKLASRLNVRPAM  513



>emb|CAC04509.1| catalase [Digitalis lanata]
Length=265

 Score =   271 bits (693),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  92   NEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHE  151

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AERFP P   + G+RD+  IEKENNFKQPG++YRS+
Sbjct  152  GFMNFMHRDEEVNYFPSRYDPCRHAERFPHPPVALNGKRDRICIEKENNFKQPGEKYRSF  211

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQ+RFI RWV +LS+PR+THEIRS W+SY TQAD+SLGQK+ASRLNIRPTM
Sbjct  212  PPDRQERFIKRWVDALSDPRLTHEIRSIWVSYWTQADKSLGQKLASRLNIRPTM  265



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   278 bits (712),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ LPVNAPKC++HNN ++
Sbjct  319  NEQLAFCPAIVVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCSHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++   R+AE FP P  I+TG+RDKCVIEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYQPARHAETFPIPSSIITGKRDKCVIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RF++RWV  LSE RVT+EIRS WISY +QADRS GQK+A+RLN+RP++
Sbjct  439  APDRQERFLHRWVDVLSESRVTYEIRSIWISYWSQADRSFGQKLATRLNVRPSI  492



>dbj|BAH20307.1| AT1G20620 [Arabidopsis thaliana]
Length=458

 Score =   277 bits (709),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
             E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  285  TEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHE  344

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R KCVI+KENNFKQ GDRYRSW
Sbjct  345  GFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSW  404

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  405  APDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  458



>gb|ACJ73906.1| CAT2 [Solanum nigrum]
Length=315

 Score =   272 bits (696),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 146/174 (84%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKCA+HNNS D
Sbjct  142  NEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNSRD  201

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEVDY PS+FD  R AE++P P  ++ G R  CV  KENNFKQ G+RYRSW
Sbjct  202  GAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLNGPRTMCVTPKENNFKQAGERYRSW  261

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQDR+IN+WV+SLS+PRVTHEI S WISYL+QAD+S GQKVASRL ++P M
Sbjct  262  EPDRQDRYINKWVESLSDPRVTHEIPSIWISYLSQADKSCGQKVASRLTVKPPM  315



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   278 bits (711),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +PA +VPGIY+SDDK+LQ RIFAY+DT RHRLGPNYM LPVNAPKC +HNN  D
Sbjct  319  NEQLAFNPAFVVPGIYYSDDKLLQTRIFAYSDTQRHRLGPNYMQLPVNAPKCPHHNNHQD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AERFP P  I+TG+R++ VIEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAERFPIPSNILTGKRERRVIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI R V +LS+PRV+HEIRS WISY +QAD+SLGQK+A+RLN+RP++
Sbjct  439  APDRQERFIRRCVDALSDPRVSHEIRSIWISYWSQADKSLGQKIATRLNVRPSI  492



>gb|AAC48918.1| salicylic acid binding catalase, partial [Nicotiana tabacum]
Length=489

 Score =   278 bits (710),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKCA+HNN  D
Sbjct  316  NEQLAFNPGHIVPGLYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNHRD  375

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEVDY PS+FD  R+AE++P P R++TGRR+ CVIEKENNFKQ G+RYRSW
Sbjct  376  GAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSW  435

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQDR++++WV+ LS+PRVT+EIRS WI  L+QAD+S GQKVASRL ++PTM
Sbjct  436  EPDRQDRYVSKWVEHLSDPRVTYEIRSIWICSLSQADKSCGQKVASRLTLKPTM  489



>emb|CDY01364.1| BnaA07g11370D [Brassica napus]
Length=556

 Score =   280 bits (715),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
             E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  383  TEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHE  442

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSW
Sbjct  443  GFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSW  502

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  503  APDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  556



>emb|CDP07288.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   278 bits (710),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
             E +A +PA +VPGIY+++DK+LQ RIFAY DT RHRLGPNYM LPVNAPKCA+HNN YD
Sbjct  319  TEQLAFNPAFVVPGIYYTEDKLLQTRIFAYGDTQRHRLGPNYMQLPVNAPKCAHHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEVDYFPS+FD  R+A R P P  ++ G+RD+CVI KENNFKQ G+RYRSW
Sbjct  379  GFMNFMHRDEEVDYFPSRFDPVRHAARHPIPSTVLRGKRDRCVIPKENNFKQAGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RWV  LS+ RVTHEIRS WISY +QAD+SLGQK+A+RLN+RPTM
Sbjct  439  APDRQERFICRWVDILSDARVTHEIRSIWISYWSQADKSLGQKMATRLNVRPTM  492



>ref|XP_006828714.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   278 bits (710),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +P  +VPGIY+SDDK LQAR FAY DT RHRLGPNY++LPVNAPKCA+HNN YD
Sbjct  319  NEQLAFNPGIVVPGIYYSDDKFLQARTFAYGDTQRHRLGPNYLMLPVNAPKCAHHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF HRDEEVDYFPS+FD  R+AER P P ++V+G+R++CVIEKENNFKQPGDRYRS+
Sbjct  379  GFMNFAHRDEEVDYFPSRFDPVRHAERCPLPPQLVSGKRERCVIEKENNFKQPGDRYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RF+ R V +LS+ RVTHEIRS WISY +Q D+SLGQK+A+RLNI+P M
Sbjct  439  APDRQERFVKRIVDALSDTRVTHEIRSIWISYWSQCDKSLGQKIATRLNIKPHM  492



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   278 bits (710),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEE++YFPS++D  R+AE FP P  + TGRR+KC+IEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            A DRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+S+GQK+ASRLN+RP++
Sbjct  439  AADRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSVGQKLASRLNVRPSI  492



>ref|NP_564120.1| catalase 3 [Arabidopsis thaliana]
 sp|Q42547.3|CATA3_ARATH RecName: Full=Catalase-3 [Arabidopsis thaliana]
 gb|AAL08303.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AAL24212.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AEE29995.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  717  EMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDG  538
            E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G
Sbjct  320  EQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEG  379

Query  537  YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWA  358
            +MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R KCVI+KENNFKQ GDRYRSWA
Sbjct  380  FMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWA  439

Query  357  PDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            PDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  440  PDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY++LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLMLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE+FP P RI+ G R+KC I+KENNFKQPG++YRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAEQFPIPPRILNGGREKCCIQKENNFKQPGEKYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RW+ +LS+PRVTHEIR+ WI+Y +Q D+ LGQK+ASRLNI+PT+
Sbjct  439  APDRQERFIKRWIDALSDPRVTHEIRTIWITYWSQCDKFLGQKLASRLNIKPTL  492



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D TR++E +P P  +++G+R+K  IEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPTRHSEMYPIPPVVLSGKREKRCIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RWV++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RPTM
Sbjct  439  APDRQERFIRRWVEALSDPRLTHEIRSIWISYWSQADKSLGQKLASRLNVRPTM  492



>emb|CDY31878.1| BnaC07g15280D [Brassica napus]
Length=492

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 149/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  717  EMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDG  538
            E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G
Sbjct  320  EQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEG  379

Query  537  YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWA  358
            +MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWA
Sbjct  380  FMNFMHRDEEINYYPSKFDPVRCAEKAPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWA  439

Query  357  PDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            PDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  440  PDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>gb|AAM65021.1| unknown [Arabidopsis thaliana]
Length=492

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  717  EMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDG  538
            E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G
Sbjct  320  EQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEG  379

Query  537  YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWA  358
            +MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R KCVI+KENNFKQ GDRYRSWA
Sbjct  380  FMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWA  439

Query  357  PDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            PDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  440  PDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|NP_001234827.1| catalase isozyme 1 [Solanum lycopersicum]
 sp|P30264.1|CATA1_SOLLC RecName: Full=Catalase isozyme 1 [Solanum lycopersicum]
 gb|AAA34145.1| catalase [Solanum lycopersicum]
 prf||1909364A catalase
Length=492

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 146/174 (84%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKC +HNN  D
Sbjct  319  NEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCGHHNNHRD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MN  HRDEEVDY PS+FD  R AE++P P  ++ GRR  CVI KENNFKQ G+RYRSW
Sbjct  379  GAMNMTHRDEEVDYLPSRFDPCRPAEQYPIPSCVLNGRRTNCVIPKENNFKQAGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  439  EPDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>gb|KFK44175.1| hypothetical protein AALP_AA1G224300 [Arabis alpina]
Length=492

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  717  EMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDG  538
            E +A +P  + PGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G
Sbjct  320  EQLAFNPGLVPPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEG  379

Query  537  YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWA  358
            +MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KCVI+KENNFKQPGDRYRSWA
Sbjct  380  FMNFMHRDEEINYYPSKFDPVRCAEKVPVPSKSYTGIRTKCVIKKENNFKQPGDRYRSWA  439

Query  357  PDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            PDRQDRFI RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  440  PDRQDRFIKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPG+Y+SDDK+LQ RIF+YAD+ RHRLGPNY+ +P NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADSQRHRLGPNYLQIPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AER P P RI+ G+R+KC+IEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAERIPVPPRILDGKREKCMIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            A DRQ+RF+ RWV +LSEPRVTHEIRS WISY +QADRSLGQK+AS LN++P++
Sbjct  439  ASDRQERFLRRWVDALSEPRVTHEIRSIWISYWSQADRSLGQKIASHLNLKPSI  492



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   277 bits (708),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPPNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEE++YFPS++D  R+AERFP P  + +GRR+KC+IEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEINYFPSRYDPVRHAERFPIPPAVCSGRREKCIIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RWV +LS+PRVTHEIRS WI+Y +QA +SLGQK+ASRLN++P +
Sbjct  439  APDRQERFICRWVDALSDPRVTHEIRSIWITYWSQACKSLGQKLASRLNVKPNI  492



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   277 bits (708),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE+ P P  I  G+R+KC+IEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAEQHPIPSAIFNGKREKCIIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RW+ +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  APDRQERFIRRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPG+Y+SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGVYYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEV+Y PS+ D  R+AE++P P R++TG+R+K +IEKENNFKQPG+ YRSW
Sbjct  379  GLMNFMHRDEEVNYLPSRLDPCRHAEQYPIPPRVLTGKREKVIIEKENNFKQPGEHYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RF+ RWV +LS+PR THEIRS WISY +QAD+SLGQK+ASRLNIRPTM
Sbjct  439  APDRQERFLCRWVDALSDPRATHEIRSIWISYWSQADKSLGQKLASRLNIRPTM  492



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN +D
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            AP+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  APERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN +D
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            AP+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  APERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AER+P P  I +GRR++C+IEKENNFKQPG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAERYPIPPVICSGRRERCIIEKENNFKQPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  TPDRQERFIRRWIEALSDPRITHEIRSIWISYWSQADQSLGQKLASRLNVRPSI  492



>gb|ACV30589.1| catalase [Carica papaya]
Length=170

 Score =   266 bits (679),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  699  PAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVH  520
            PAH+VPGIY+SDDK+LQ RIFAY DT RHRLGPN+M LPVNAPKCA+ NN +DGYMNF+H
Sbjct  3    PAHVVPGIYYSDDKLLQCRIFAYDDTQRHRLGPNFMQLPVNAPKCAHRNNHFDGYMNFMH  62

Query  519  RDEEVDYFPSKFDNTRNAERFPTPLRIVTG-RRDKCVIEKENNFKQPGDRYRSWAPDRQD  343
            RDEEV+Y PSKFD   NAER+P P ++ +  +R+KC+IEK+N+FKQPG+RYR++ PDRQ+
Sbjct  63   RDEEVNYHPSKFDPVTNAERYPIPTKVYSACKREKCIIEKQNDFKQPGERYRTFEPDRQE  122

Query  342  RFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            RFINRWVK+LSEPR+THEIRS WI +L++AD SLG+KVA RLNIRP++
Sbjct  123  RFINRWVKALSEPRITHEIRSIWIDWLSRADESLGRKVAMRLNIRPSI  170



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   276 bits (706),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+FD  R+AER+P P  + TG+R++CVI+KENNFK+PG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRFDPARHAERYPHPPAVCTGKRERCVIQKENNFKEPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQ+RFI RWV +LS+PRVTHEIRS WISY +QADRS+GQK+AS LN+RP++
Sbjct  439  TPDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADRSVGQKLASHLNVRPSI  492



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   276 bits (706),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPGIY+S+DK+LQ RIF+YADT RHRLGPNY+ LPVNAPKCA HNN YD
Sbjct  319  NEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAQHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEE+DYFPS++D  R+AE  PTP  I  GRR+KC+I KENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RWV +LS+PRVTHEIR  WISY +QA +SLGQK+ASRLN+RP +
Sbjct  439  APDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI  492



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   276 bits (705),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AER+P P  I+TGRR+KC+I KENNFKQPG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAERYPIPPAILTGRREKCIIPKENNFKQPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RWV +LS+PRVT+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  APDRQERFIQRWVDALSDPRVTYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   276 bits (705),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPGI +SDDKMLQ RIF+YAD+ RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIVVPGISYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AER+P P  I TG R++C IEKENNFKQPG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAERYPIPPAICTGSRERCAIEKENNFKQPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQDRF+ RWV +LS+PRVTHEIRSTWISY +QADRSLGQK+AS LN+RP++
Sbjct  439  APDRQDRFVRRWVDALSDPRVTHEIRSTWISYWSQADRSLGQKIASHLNLRPSI  492



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   276 bits (705),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPGIY+S+DK+LQ RIF+YADT RHRLGPNY+ LPVNAPKCA HNN YD
Sbjct  319  NEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAQHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEE+DYFPS++D  R+AE  PTP  I  GRR+KC+I KENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RWV +LS+PRVTHEIR  WISY +QA +SLGQK+ASRLN+RP +
Sbjct  439  APDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI  492



>pir||S40265 catalase (EC 1.11.1.6) - eggplant
Length=502

 Score =   276 bits (706),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKCA+HNN  D
Sbjct  319  NEQLAFNPGHIVPGVYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNHRD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEVDY PS+FD  R AE++P P  ++TGRR+KCVI KENNFKQ G+RYR+W
Sbjct  379  GAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVIPKENNFKQAGERYRTW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRL  217
             PDRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL
Sbjct  439  EPDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRL  486



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   276 bits (705),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPG+Y+SDDK+LQ R+F+YADT RHRLGPNY+ LP NAPKCA+HNN +D
Sbjct  319  NEQLAFCPAIIVPGVYYSDDKLLQTRVFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE+ P P RI+ G+R+KC+IEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAEKVPVPPRILGGKREKCMIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
              DRQ+RF+ RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS LN++P++
Sbjct  439  PSDRQERFVRRWVDALSDPRVTHEIRSIWISYWSQADRSLGQKIASHLNLKPSI  492



>ref|XP_006306495.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
 gb|EOA39393.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
Length=492

 Score =   276 bits (705),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 147/173 (85%), Gaps = 0/173 (0%)
 Frame = -2

Query  717  EMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDG  538
            E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G
Sbjct  320  EQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEG  379

Query  537  YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWA  358
            +MNF+HRDEE++Y+PSKFD  R AE+ P P    TG R KCVI+KENNFKQ GDRYRSWA
Sbjct  380  FMNFMHRDEEINYYPSKFDPVRCAEKVPIPTNSYTGIRTKCVIKKENNFKQAGDRYRSWA  439

Query  357  PDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            PDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  440  PDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis]
 ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis]
 ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis]
Length=512

 Score =   276 bits (706),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPGIY+S+DK+LQ RIF+YADT RHRLGPNY+ LPVNAPKCA HNN YD
Sbjct  339  NEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAQHNNHYD  398

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEE+DYFPS++D  R+AE  PTP  I  GRR+KC+I KENNFKQPG+RYRSW
Sbjct  399  GFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSW  458

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RWV +LS+PRVTHEIR  WISY +QA +SLGQK+ASRLN+RP +
Sbjct  459  APDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI  512



>dbj|BAQ21275.1| catalase [Citrus tamurana]
Length=476

 Score =   275 bits (703),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPGIY+S+DK+LQ RIF+YADT RHRLGPNY+ LPVNAPKCA+HNN YD
Sbjct  303  NEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHYD  362

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEE+DYFPS++D  R+AE  PTP  I  GRR+KC+I KENNFKQPG+RYRSW
Sbjct  363  GFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSW  422

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RF+ RWV +LS+PRVTHEIR  WISY +QA +SLGQK+ +RLN+RP++
Sbjct  423  APDRQERFVCRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKLTARLNVRPSI  476



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   275 bits (704),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ LP NAPKCA+HNN YD
Sbjct  319  NEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI+KENNFKQPGDRYRS+
Sbjct  379  GSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGDRYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  TPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   275 bits (704),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY++LP NAPKCA+HNN YD
Sbjct  319  NEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLMLPANAPKCAHHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF HRDEEVDYFPS+FD  R+AE+FP P +I +G+R+KC+IEKENNFKQPG+RYRS+
Sbjct  379  GFMNFAHRDEEVDYFPSRFDPVRHAEKFPMPPQICSGKREKCMIEKENNFKQPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            A DRQ+RFI RWV +LS+PRVTHEI S WISY +Q D+SLGQK+A+ LN++P M
Sbjct  439  AIDRQERFIKRWVDALSDPRVTHEILSIWISYWSQCDKSLGQKLATHLNLKPNM  492



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   275 bits (703),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ LP NAPKCA+HNN YD
Sbjct  318  NEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYD  377

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI+KENNFKQPGDRYRS+
Sbjct  378  GSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGDRYRSF  437

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  438  TPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  491



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   275 bits (703),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  318  NEQLAFCPAIVVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHE  377

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R+KC+IEKENNFKQPG+RYRSW
Sbjct  378  GFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSW  437

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNI  211
            APDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+
Sbjct  438  APDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNV  487



>sp|P49318.1|CATA2_RICCO RecName: Full=Catalase isozyme 2 [Ricinus communis]
 gb|AAB31538.1| catalase 2 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04698.1| catalase CAT2 [Ricinus communis]
Length=492

 Score =   275 bits (703),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NEM+A +PAH+VPG+Y+S+DK+ Q R+FAY+DT RHRLG NY+ LPVNAPKC YHNN YD
Sbjct  319  NEMLAFNPAHVVPGVYYSNDKLFQLRLFAYSDTQRHRLGTNYLQLPVNAPKCPYHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEVDYF S++D  R+AE+ P P  I +GRR+KCVIEKE+NF+QPGDRYRSW
Sbjct  379  GFMNFMHRDEEVDYFQSRYDPVRHAEKVPIPNAICSGRREKCVIEKEDNFRQPGDRYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RF+ R V +LSEPR+THEIRS W+S+ TQ D+SLGQK+ASRLN+RP +
Sbjct  439  APDRQERFLCRLVNALSEPRITHEIRSIWVSWWTQCDKSLGQKLASRLNVRPNI  492



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   275 bits (703),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ LP NAPKCA+HNN YD
Sbjct  319  NEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI+KENNFKQPGDRYRS+
Sbjct  379  GSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGDRYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  TPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   275 bits (703),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPG+Y+SDDK+LQ R+F+Y+DT RHRLGPNY+ LP NAPKC++HNN ++
Sbjct  319  NEQLAFCPAIIVPGVYYSDDKLLQTRVFSYSDTQRHRLGPNYLQLPANAPKCSHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AER+P P  + TG+R++CVI+KENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPARHAERYPHPPAVCTGKRERCVIDKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RWV +LS+PRVTHEIRS WISY +QADRS+GQK+AS LN+RP++
Sbjct  439  APDRQERFIRRWVNALSDPRVTHEIRSIWISYWSQADRSVGQKLASHLNMRPSI  492



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   275 bits (703),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEE++YFPS++D  R+AE FP P  + TGRR+KC+IEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            A DRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+S+GQK+AS LN+RP++
Sbjct  439  AADRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSVGQKLASLLNVRPSI  492



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  277  NEQLAFCPAIVVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHE  336

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R++C+IEKENNFKQPG+RYRSW
Sbjct  337  GFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKRERCIIEKENNFKQPGERYRSW  396

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNI  211
            APDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+
Sbjct  397  APDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKLASRLNV  446



>gb|ABC01913.1| catalase isozyme 1-like protein [Solanum tuberosum]
Length=492

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 145/174 (83%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKC +HNN  D
Sbjct  319  NEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCGHHNNHRD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MN  HRDEEVDY PS+FD  R AE++P P  ++ GRR  CVI KENNFKQ G+RYRSW
Sbjct  379  GAMNMTHRDEEVDYLPSRFDPCRPAEQYPIPACVLNGRRTNCVIPKENNFKQAGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
              DRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  439  ESDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+FD +R+AER+P P  + +G+R++C+IEKENNFK+PG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRFDPSRHAERYPHPPAVCSGKRERCIIEKENNFKEPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQ+RF+ RWV +LS+ RVTHEIRS WISY +QADRSLGQK+AS LN+RP++
Sbjct  439  TPDRQERFVRRWVDALSDTRVTHEIRSIWISYWSQADRSLGQKLASHLNVRPSI  492



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  320  NEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHE  379

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+ D  R+AERFPTP   ++G+R++C+  KENNFKQPG+RYR+W
Sbjct  380  GFMNFIHRDEEVNYFPSRHDPVRHAERFPTPPAALSGKRERCIRPKENNFKQPGERYRTW  439

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQDRF  RW+++LS+PRVTHE+RS WISY +QADRSLGQK+AS LN+RP++
Sbjct  440  APDRQDRFARRWIEALSDPRVTHEVRSIWISYWSQADRSLGQKIASHLNMRPSI  493



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ LP NAPKCA+HNN YD
Sbjct  319  NEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI KENNFKQPG+RYRS+
Sbjct  379  GSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVILKENNFKQPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQ+RFI RWV++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  TPDRQERFIRRWVEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   274 bits (701),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  317  NEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHE  376

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+FD  R+AER+P P  I TG+R+KC+IEKENNFKQPG+RYRS+
Sbjct  377  GFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSF  436

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            +PDR++RF+ RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+AS LN+RP++
Sbjct  437  SPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPSI  490



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPG+Y+SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGVYYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+ D  R+AE++P P R++TG+R+K +IEKENNFKQPG+ YRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRLDPCRHAEQYPIPPRVLTGKREKVIIEKENNFKQPGEHYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            AP RQ+RF+ RWV +LS+ R THEIRS WISY +QAD+SLGQK+ASRLNIRPTM
Sbjct  439  APGRQERFVCRWVDALSDLRATHEIRSIWISYWSQADKSLGQKLASRLNIRPTM  492



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   274 bits (701),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ LP NAPKCA+HNN YD
Sbjct  319  NEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI+KENNFKQPGDRYRS+
Sbjct  379  GSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGDRYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQ+RFI RWV++LS+PR+T+EIR+ WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  TPDRQERFIRRWVEALSDPRITYEIRTIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   274 bits (701),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+ D  R+AERFPTP   ++G+R++C+  KENNFKQPG+RYR+W
Sbjct  379  GFMNFIHRDEEVNYFPSRHDPVRHAERFPTPPAALSGKRERCIRPKENNFKQPGERYRTW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQDRF  RW+++LS+PRVTHE+RS WISY +QADRSLGQK+AS LN+RP++
Sbjct  439  APDRQDRFARRWIEALSDPRVTHEVRSIWISYWSQADRSLGQKIASHLNMRPSI  492



>gb|AAD30292.1|AF139539_1 catalase 3 [Raphanus sativus]
Length=492

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  717  EMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDG  538
            E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G
Sbjct  320  EQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEG  379

Query  537  YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWA  358
            +MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KC+I+KENNFKQ GDRYRSWA
Sbjct  380  FMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQAGDRYRSWA  439

Query  357  PDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            PDRQDRF+ RWV+ LSEPR+THEIRS WISY +QAD SLGQK+ASRLN+RP++
Sbjct  440  PDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADASLGQKLASRLNVRPSI  492



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+LLP NAPK A+HNN ++
Sbjct  319  NEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLLLPANAPKSAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE+FP P  + +GRR+K  IEKENNFKQ G+R+RSW
Sbjct  379  GFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPPAVFSGRREKIAIEKENNFKQAGERFRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQDRFI RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS LN+RP +
Sbjct  439  APDRQDRFIRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLNMRPNI  492



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ LP NAPKCA+HNN YD
Sbjct  312  NEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYD  371

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI+KENNFKQPG+RYRS+
Sbjct  372  GSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGERYRSF  431

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  432  TPDRQERFIRRWVETLSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  485



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+FD  R+AER+P P  I TG+R+KC+IEKENNFKQPG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            +PDR++RF+ RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+AS LN+RP++
Sbjct  439  SPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPSI  492



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  TPERQERFIQRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  TPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>prf||2104177A catalase
Length=492

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA+HNN YD
Sbjct  319  NEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEE+DYFPS++D  R+AE++P P   ++G+RDKCVIEKENNFKQPG+RYRS+
Sbjct  379  GFMNFMHRDEEIDYFPSRYDPARHAEQYPIPPVRLSGKRDKCVIEKENNFKQPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  205
            +PDRQ+RFINR V  LS+PRVTHE+RS W+SY +QAD+SLGQK+ASRLN++P
Sbjct  439  SPDRQERFINRVVGGLSDPRVTHEVRSIWVSYWSQADKSLGQKIASRLNVKP  490



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA+HNN YD
Sbjct  319  NEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEE+DYFPS++D  R+AE++P P   ++G+RDKCVIEKENNFKQPG+RYRS+
Sbjct  379  GFMNFMHRDEEIDYFPSRYDPARHAEQYPIPPVRLSGKRDKCVIEKENNFKQPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  205
            +PDRQ+RFINR V  LS+PRVTHE+RS W+SY +QAD+SLGQK+ASRLN++P
Sbjct  439  SPDRQERFINRVVGGLSDPRVTHEVRSIWVSYWSQADKSLGQKIASRLNVKP  490



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  304  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHE  363

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+
Sbjct  364  GFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSF  423

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD++LGQK+ASRLN+RP++
Sbjct  424  TPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKLASRLNVRPSI  477



>ref|XP_010934843.1| PREDICTED: catalase isozyme 2 [Elaeis guineensis]
 gb|AFS65099.1| catalase 2 [Elaeis guineensis]
Length=492

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P  +VPGIY+SDDKMLQ R+FAYADT R+RLGPNY++LPVNAPKCA+HNN +D
Sbjct  319  NEQLAFGPGLVVPGIYYSDDKMLQCRVFAYADTQRYRLGPNYLMLPVNAPKCAFHNNQFD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+ R+EEVDYFPS+ D  R+AERFP P R+VTG+R+K VI K+N+FKQPG+RYRSW
Sbjct  379  GLMNFMQRNEEVDYFPSRHDPLRHAERFPIPSRVVTGKREKIVIPKQNDFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RF+ RW +SL  P+V+HE+RS WI+YLTQ D SLGQKVA+RLN++P+M
Sbjct  439  APDRQERFVRRWAESLGHPKVSHELRSIWITYLTQCDVSLGQKVANRLNVKPSM  492



>gb|AAD30291.2|AF139538_1 catalase 2 [Raphanus sativus]
Length=492

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  717  EMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDG  538
            E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G
Sbjct  320  EQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEG  379

Query  537  YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWA  358
            +MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R KCVI+KENNFKQ GDRYRSWA
Sbjct  380  FMNFMHRDEEINYYPSKFDPVRCAEKVPIPSKSYTGIRTKCVIKKENNFKQAGDRYRSWA  439

Query  357  PDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            PDRQDRF+ RWV+ LSE R+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  440  PDRQDRFVKRWVEILSELRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_010536468.1| PREDICTED: catalase-3-like [Tarenaya hassleriana]
Length=492

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = -2

Query  717  EMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDG  538
            EM+A +P  +VPGIY+S DK+LQARIFAY DT R+RLGPNY+ LPVNAPKCA+HNN +DG
Sbjct  320  EMLAFNPGLVVPGIYYSQDKLLQARIFAYGDTQRYRLGPNYLQLPVNAPKCAHHNNHHDG  379

Query  537  YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWA  358
            +MNF+HRDEEV+YFPS+FD+ R+A ++P P  I +G R KCVIEKENNFKQPGDRYRSWA
Sbjct  380  FMNFMHRDEEVNYFPSRFDSVRHAAKYPIPSAICSGERVKCVIEKENNFKQPGDRYRSWA  439

Query  357  PDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            PDRQ+R+ NRWV++LS+ RVT EIR  WISYL+Q+D+SLG KVA+RLN+RP+ 
Sbjct  440  PDRQERYANRWVEALSDARVTDEIRGIWISYLSQSDKSLGMKVANRLNVRPSF  492



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ LP N+PKCA+HNN +D
Sbjct  319  NEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANSPKCAHHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AER P P R + G+R+KC+IEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAERVPVPPRTLGGKREKCMIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
              DRQ+RF+ RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS LN++P++
Sbjct  439  PSDRQERFVRRWVDALSDPRVTHEIRSIWISYWSQADRSLGQKIASHLNLKPSI  492



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYR++
Sbjct  379  GFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRTF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  TPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_008791900.1| PREDICTED: catalase isozyme 2 [Phoenix dactylifera]
Length=492

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P  +VPGIY+SDDKMLQ R+FAYADT R+RLGPNY++LPVNAPKCA+HNN +D
Sbjct  319  NEQLAFGPGLVVPGIYYSDDKMLQCRVFAYADTQRYRLGPNYLMLPVNAPKCAFHNNQFD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+ R+EEVDYFPS+ D  R+AERFP P R+VTG+R+K VI K+N+FKQPG+RYRSW
Sbjct  379  GLMNFMQRNEEVDYFPSRHDPLRHAERFPIPSRVVTGKREKTVIPKQNDFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RF+ RW +SL  P+V+HE+RS WI+YLTQ D SLGQKVA+RLN++P+M
Sbjct  439  APDRQERFVRRWAESLGHPKVSHELRSIWITYLTQCDVSLGQKVANRLNVKPSM  492



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AER+P P  + TG+R++CVI+KENNFK+PG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPARHAERYPHPPAVCTGKRERCVIQKENNFKEPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQ+RFI RWV +LS+PRVTHEIRS WI+Y +QADRS+GQK+AS LN+RP++
Sbjct  439  TPDRQERFIRRWVDALSDPRVTHEIRSIWITYWSQADRSVGQKLASHLNVRPSI  492



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  TPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  PPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  318  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHE  377

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYRS+
Sbjct  378  GFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSF  437

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  438  TPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  491



>gb|ACJ73905.1| CAT1 [Solanum nigrum]
Length=168

 Score =   263 bits (671),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = -2

Query  699  PAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVH  520
            P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ LP NAPKCA+HNN YDG MNF+H
Sbjct  2    PSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMH  61

Query  519  RDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDR  340
            RDEE+DYFPS++D  R+AE +P P ++ +G+R+KC+I+KENNFKQ G+RYR++ PDRQ+R
Sbjct  62   RDEEIDYFPSRYDQVRHAEIYPIPSKVCSGKREKCIIQKENNFKQAGERYRTFTPDRQER  121

Query  339  FINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            F+ RWV+ LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  122  FVRRWVEPLSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  168



>gb|AAD37788.1|AF149283_1 catalase 1 [Phaseolus vulgaris]
Length=428

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPG+Y+SDDK+LQ RIF+YAD+ RHRLGPNY+ +P NAPKCA+HNN ++
Sbjct  260  NEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADSQRHRLGPNYLQIPANAPKCAHHNNHHE  319

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AER P P RI+ G+R+KC+IEKENNFKQPG+RYRSW
Sbjct  320  GFMNFMHRDEEVNYFPSRYDPVRHAERIPVPPRILDGKREKCMIEKENNFKQPGERYRSW  379

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLN  214
            A DRQ+RF+ RWV +LSEPRVTHEIRS WISY +QADRSLGQK+AS LN
Sbjct  380  ASDRQERFLRRWVDALSEPRVTHEIRSIWISYWSQADRSLGQKIASHLN  428



>prf||1906388A catalase
Length=492

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYR++
Sbjct  379  GFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  TPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|NP_001274863.1| catalase isozyme 1 [Solanum tuberosum]
 gb|ABY21246.1| catalase isozyme [Solanum tuberosum]
Length=492

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 145/174 (83%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKC +HNN  D
Sbjct  319  NEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCGHHNNHRD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MN  HRDEEVDYFPS+FD  R AE++P P  ++ GRR  CVI KENN KQ G+RYRSW
Sbjct  379  GAMNMTHRDEEVDYFPSRFDPCRPAEQYPIPACVLNGRRTNCVIPKENNSKQAGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
              DRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  439  ESDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYR++
Sbjct  379  GFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  TPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYR++
Sbjct  379  GFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  TPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>sp|P49284.1|CATA1_SOLTU RecName: Full=Catalase isozyme 1 [Solanum tuberosum]
 gb|AAA80650.1| catalase [Solanum tuberosum]
Length=492

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 145/174 (83%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKC +HNN  D
Sbjct  319  NEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCGHHNNHRD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MN  HRDEEVDYFPS+FD  R AE++P P  ++ GRR  CVI KENN KQ G+RYRSW
Sbjct  379  GAMNMTHRDEEVDYFPSRFDPCRPAEQYPIPACVLNGRRTNCVIPKENNSKQAGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
              DRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  439  ESDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   273 bits (699),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYR++
Sbjct  379  GFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  TPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_011022275.1| PREDICTED: catalase-like [Populus euphratica]
Length=476

 Score =   273 bits (697),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  303  NEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHE  362

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+FD  R+AER+P P  I TG+R+KC+IEKENNFKQPG+RYRS+
Sbjct  363  GFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSF  422

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            +PDR++RF+ RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+AS LN+RP +
Sbjct  423  SPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPGI  476



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   273 bits (698),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD++LGQK+ASRLN+RP++
Sbjct  439  TPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKLASRLNVRPSI  492



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score =   273 bits (698),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  312  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHE  371

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYRS+
Sbjct  372  GFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSF  431

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP +
Sbjct  432  TPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPNI  485



>gb|AAC49807.1| catalase 3 [Arabidopsis thaliana]
 gb|AAC17732.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   273 bits (698),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 146/173 (84%), Gaps = 0/173 (0%)
 Frame = -2

Query  717  EMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDG  538
            E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G
Sbjct  320  EQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEG  379

Query  537  YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWA  358
            +MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R KCVI+KENNFKQ GDRYRSWA
Sbjct  380  FMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWA  439

Query  357  PDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            PDRQDRF+ RWV+ LSEPR+THEIR  W SY  +ADRSLGQK+ASRLN+RP++
Sbjct  440  PDRQDRFVKRWVEILSEPRLTHEIRGIWTSYWLKADRSLGQKLASRLNVRPSI  492



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   273 bits (698),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGIY+SDDK+LQ R+F+YADT RHRLGPNY+ LPVN+PKC++HNN ++
Sbjct  319  NEQLAFCPAIIVPGIYYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNSPKCSHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP +
Sbjct  439  TPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPNI  492



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   273 bits (698),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPGI++SDDK+LQ R+F+YADT RHRLGPNY++LPVNAPKCA+HNN +D
Sbjct  319  NEQLAFCPAIVVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AERFP P R++TG+R+KCVI KENNFKQPG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAERFPLPPRVLTGKREKCVIGKENNFKQPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQ+RF++RWV++LS+ RVTHEIR  WI+Y +Q D+SLGQK+A+RLN+RP+M
Sbjct  439  DPARQERFVHRWVEALSDTRVTHEIRGIWITYWSQCDKSLGQKLATRLNMRPSM  492



>gb|AAR97905.1| catalase [Solanum tuberosum]
Length=492

 Score =   273 bits (697),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 144/174 (83%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKC +HNN  D
Sbjct  319  NEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCGHHNNHRD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MN  HRDEEVDY PS+FD  R AE++P P  ++ GRR  CVI KENNFKQ G+RYRSW
Sbjct  379  GAMNMTHRDEEVDYLPSRFDPCRPAEQYPIPACVLNGRRTNCVIPKENNFKQAGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
              DRQDR+I +WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  439  ESDRQDRYITKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>emb|CAA85470.1| catalase [Solanum tuberosum]
Length=491

 Score =   273 bits (697),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 144/174 (83%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKC +HNN  D
Sbjct  318  NEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCGHHNNHRD  377

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MN  HRDEEVDY PS+FD  R AE++P P  ++ GRR  CVI KENNFKQ G+RYRSW
Sbjct  378  GAMNMTHRDEEVDYLPSRFDPCRPAEQYPIPACVLNGRRTNCVIPKENNFKQAGERYRSW  437

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
              DRQDR+I +WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  438  ESDRQDRYITKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  491



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   273 bits (697),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++P P  + +G+R++CVIEKENNFK+PG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRYDTVRHAEKYPAPPAVCSGKRERCVIEKENNFKEPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  PPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   273 bits (697),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+FD  R+AER+P P  I TG+R+KC+IEKENNFKQPG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            +PDR++RF+ RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+AS LN+RP +
Sbjct  439  SPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPGI  492



>sp|P55312.1|CATA2_SOLTU RecName: Full=Catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   273 bits (697),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 144/174 (83%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GPNYM LPVNAPKC +HNN  D
Sbjct  319  NEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCGHHNNHRD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MN  HRDEEVDY PS+FD  R AE++P P  ++ GRR  CVI KENNFKQ G+RYRSW
Sbjct  379  GAMNMTHRDEEVDYLPSRFDPCRPAEQYPIPACVLNGRRTNCVIPKENNFKQAGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
              DRQDR+I +WV+SLS+PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  439  ESDRQDRYITKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   273 bits (697),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP +
Sbjct  439  TPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPNI  492



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   272 bits (696),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++PTP  I +G+R++C+IEKENNFK+PG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAICSGKRERCIIEKENNFKEPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+A+RLN+RP++
Sbjct  439  TPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLANRLNVRPSI  492



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   272 bits (696),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++C+IEKENNF+QPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFQQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  205
              DRQ+RF+ R+V++L+EPRVTHEIRS WISY TQAD+SLGQK+ASRLN+RP
Sbjct  439  DADRQERFVKRFVEALAEPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRP  490



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   272 bits (696),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ LP NAPKCA+HNN YD
Sbjct  319  NEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI+KENNFKQ GDRYRS+
Sbjct  379  GSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQAGDRYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  TPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|ACJ22771.1| catalase 1 [Jatropha curcas]
 gb|KDP36790.1| hypothetical protein JCGZ_08081 [Jatropha curcas]
Length=492

 Score =   272 bits (696),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NEM+A +PAH+VPGI++S+DK+ Q R FAY+DT RHRLGPNYM LPVNAPKC +HNN YD
Sbjct  319  NEMLAFNPAHVVPGIHYSNDKLFQLRTFAYSDTQRHRLGPNYMQLPVNAPKCPHHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEE+DYF S++D  R+AER+P P  I++GRR+KCVI KENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEIDYFQSRYDPVRHAERYPIPNAIISGRREKCVIPKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQ+RF+ R V +LS+PR+THEIR  W+SY +Q D+SLGQK+ASRLN+RP +
Sbjct  439  TPDRQERFLCRLVNALSDPRITHEIRGIWVSYWSQCDQSLGQKLASRLNVRPNI  492



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   273 bits (697),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  338  NEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHE  397

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+FD  R+AER+P P  I TG+R+KC+IEKENNFKQPG+RYRS+
Sbjct  398  GFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSF  457

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            +PDR++RF+ RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+AS LN+RP +
Sbjct  458  SPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPGI  511



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  304  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHE  363

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+
Sbjct  364  GFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSF  423

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD++LGQK+AS LN+RP++
Sbjct  424  TPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKLASHLNVRPSI  477



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P+ IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPSLIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE+ P P  +++G+R+KC+I KENNFKQPG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPSTVLSGKREKCIIGKENNFKQPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            + DRQ+RFINRW+ +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  SADRQERFINRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKIASRLNVRPSI  492



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P+ IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPSLIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE+ P P  +++G+R+KC+I KENNFKQPG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPSTVLSGKREKCIIGKENNFKQPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            + DRQ+RFINRW+ +LS+PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  SADRQERFINRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKIASRLNVRPSI  492



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P  IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+LLP NAPKCA+HNN YD
Sbjct  319  NEQLAFCPGIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPPNAPKCAHHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEVDYFPS++D  ++A R+P P   +TGRR+K VI KENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSATLTGRREKVVIAKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQDRFI RW+ +LS+PR+THEIRS W+SY +QADRSLGQK+ASRL+ +P+M
Sbjct  439  DPARQDRFIKRWIDALSDPRLTHEIRSIWLSYWSQADRSLGQKLASRLSAKPSM  492



>gb|AFW69584.1| catalase1 [Zea mays]
Length=353

 Score =   268 bits (684),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA+HNN +D
Sbjct  180  NEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHD  239

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I+KENNFKQ G+RYRS+
Sbjct  240  GFMNFMHRDEEVNYFPSRFDPARHAEKVPIPPRVLTGCREKCIIQKENNFKQAGERYRSF  299

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQDRFI RWV +L++PRVTHE R+ WISY +Q D +LGQK+ASRLN++P+M
Sbjct  300  DPARQDRFIQRWVDALTDPRVTHEHRTIWISYWSQCDAALGQKLASRLNLKPSM  353



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P  IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+LLP NAPKCA+HNN YD
Sbjct  319  NEQLAFCPGIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPPNAPKCAHHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEVDYFPS++D  ++A R+P P   +TGRR+K VI KENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSATLTGRREKVVIAKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQDRFI RW+ +LS+PR+THEIRS W+SY +QADRSLGQK+ASRL+ +P+M
Sbjct  439  DPARQDRFIKRWIDALSDPRLTHEIRSIWLSYWSQADRSLGQKLASRLSAKPSM  492



>emb|CDY52649.1| BnaAnng11640D [Brassica napus]
Length=449

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGIY+SDDK+LQ R+F+YADT RHRLGPNY+ LPVN+PKC++HNN ++
Sbjct  276  NEQLAFCPAIIVPGIYYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNSPKCSHHNNHHE  335

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+
Sbjct  336  GFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSF  395

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P+R +RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP +
Sbjct  396  TPERLERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPNI  449



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  307  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHE  366

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MN +HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+
Sbjct  367  GFMNVMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSF  426

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  427  TPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  480



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ LP NAPKCA+HNN YD
Sbjct  319  NEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+KCVI+KENNF QPG+RYRS+
Sbjct  379  GSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFNQPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  TPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P  +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPGIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HR+EEV+YFPS++D  R+AER+P P  I TGRR++ VI+KENNFKQPG+RYRS+
Sbjct  379  GFMNFMHREEEVNYFPSRYDPVRHAERYPIPSAICTGRRERTVIDKENNFKQPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            +PDRQ+RFI RWV +LS+PRVTHEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  439  SPDRQERFIKRWVNALSDPRVTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>gb|AAR14052.2| catalase [Solanum tuberosum]
Length=475

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ LP NAPKCA+HNN YD
Sbjct  302  NEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYD  361

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEE+DYFPS++D  R+AE +P P  + +G+R+KC+I+KENNFKQPG+RYR++
Sbjct  362  GSMNFMHRDEEIDYFPSRYDQVRHAEVYPIPSTVCSGKREKCIIQKENNFKQPGERYRTF  421

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  422  TPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  475



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LPVNAPKCA+HNN +D
Sbjct  319  NEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+ D   +AER+P P  + TG+R++CVIEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRIDPAHHAERYPQPPAVYTGKRERCVIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIR  208
              DRQ+RF+ RWV +LS+PRVTHEIR+ WISY +QAD+SLGQK+ASRLN++
Sbjct  439  PADRQERFVGRWVDALSDPRVTHEIRNIWISYWSQADKSLGQKLASRLNVK  489



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPGI++SDDK+LQ RIF+YADT RHRLGPNY+ LP NAPKCA+HNN +D
Sbjct  319  NEQLAFCPAIVVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEVDYFPS++D  R+AE  P P  ++TGRR+K +I KENNFKQPG+RYRS+
Sbjct  379  GFMNFMHRDEEVDYFPSRYDPVRHAEMHPIPSAVLTGRREKTIIPKENNFKQPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RWV +LS+PRVT+EIRS WISY +QAD+SLGQK+ASRLNIRP++
Sbjct  439  APDRQERFICRWVDALSDPRVTYEIRSIWISYWSQADKSLGQKLASRLNIRPSI  492



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+LLP NAPK A+HNN ++
Sbjct  319  NEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLLLPANAPKSAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE+FP P  I +GRR+K  IEKENNFKQ G+R+RSW
Sbjct  379  GFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPPAICSGRREKIAIEKENNFKQAGERFRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQDRF  RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS L++RP +
Sbjct  439  APDRQDRFTRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLSMRPNI  492



>gb|ABQ44283.1| catalase [Saccharum hybrid cultivar NCo 376]
Length=339

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 147/174 (84%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P  IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+LLP NAPKCA+HNN YD
Sbjct  166  NEQLAFCPGLIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCAHHNNHYD  225

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEVDYFPS++D  +NA R+P P   +TGRRDK VI KENNFKQPG+RYR+ 
Sbjct  226  GFMNFMHRDEEVDYFPSRYDPAKNAPRYPIPTVHITGRRDKTVIAKENNFKQPGERYRAM  285

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQ+RFI RWV +LS+PR+THEIRS W+S  +QADRSLGQK+ASRL+ +P+M
Sbjct  286  DPARQERFIKRWVDALSDPRLTHEIRSIWLSNWSQADRSLGQKLASRLSAKPSM  339



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ LP NAPKCA+HNN YD
Sbjct  319  NEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEE+DYFPS++D  R+AE +P P  + +G+R+KC+I+KENNFKQPG+RYRS+
Sbjct  379  GSMNFMHRDEEIDYFPSRYDQVRHAEVYPIPSTVCSGKREKCIIQKENNFKQPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQ+RFI RWV++LS+PR+T+EIRS WI+Y +QAD+SLGQK+ASRLN+RP++
Sbjct  439  TPDRQERFIRRWVEALSDPRITYEIRSIWITYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010692544.1| PREDICTED: catalase-like [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 147/174 (84%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A DPAH+VPGIYFS+DKMLQAR FAYADTHR+RLG NY+ LPVNAPKC + N   D
Sbjct  319  NEQLAFDPAHVVPGIYFSNDKMLQARTFAYADTHRYRLGINYLQLPVNAPKCPHTNMHRD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MN VHRDEE+DYFPS+FD  R AERFP P  I+ GRR+K +I KENNFK+PG RYRSW
Sbjct  379  GAMNMVHRDEEIDYFPSRFDPLREAERFPIPTAIIHGRREKQIIPKENNFKEPGVRYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQDRF+ R+VK+LS+PR+T+EIRS W+SYLTQAD+SLG KVASRLNIRPTM
Sbjct  439  DPARQDRFVGRFVKALSDPRLTYEIRSIWVSYLTQADKSLGMKVASRLNIRPTM  492



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P  +VPGI +S+DK+LQ RIF+Y+DT RHRLG NY+ LPVNAPKCA+HNN +D
Sbjct  319  NEQLAFCPGIVVPGISYSEDKLLQTRIFSYSDTQRHRLGSNYLQLPVNAPKCAHHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+ D  R++ERFP P  I +GRRDKCVIEKENNF+QPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRCDPVRHSERFPIPSTICSGRRDKCVIEKENNFEQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RF+NR V  LS+PR+THE+RS WISY TQ DRSLGQK+A RLN+RP++
Sbjct  439  APDRQERFLNRMVGCLSDPRITHELRSIWISYWTQCDRSLGQKLAFRLNVRPSI  492



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN +D
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++P P  + +G+R++CVI KENNFK+PG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRYDQVRHAEKYPAPPAVCSGKRERCVIAKENNFKEPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  PPERQERFICRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN +D
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++P P  + +G+R++CVI KENNFK+PG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRYDQVRHAEKYPAPPAVCSGKRERCVIAKENNFKEPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  PPERQERFICRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P  IVPGI++SDDK+LQ R+F+Y+DT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPGIIVPGIHYSDDKLLQTRVFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AER+P P  + +GRR++C+IEKENNFKQPG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAERYPVPSVVCSGRRERCIIEKENNFKQPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDR++RFI RW+++LS+PR+THEIRS WISY +QAD+SLGQK+ASR+N+RP +
Sbjct  439  TPDRKERFIRRWIEALSDPRITHEIRSIWISYWSQADQSLGQKLASRMNVRPNI  492



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   270 bits (691),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ LPVNAPK A+HNN ++
Sbjct  319  NEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKSAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++P P  ++ GRR+KC+I KENNFKQPG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAEKYPIPPVVLNGRREKCMIAKENNFKQPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            +PDRQ+RF+NRW+ SLS+PRVTHEIR+ W++Y  QAD+SLGQK+ASRLN+RP M
Sbjct  439  SPDRQERFLNRWISSLSDPRVTHEIRAIWVTYWYQADKSLGQKLASRLNVRPNM  492



>dbj|BAJ87148.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   264 bits (675),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA  VPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA+HNN +D
Sbjct  129  NEQLAFCPAVTVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHD  188

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEV+YFPS+FD TR+AE++P P R+++G R+KC+I+KENNFKQ G+RYRS+
Sbjct  189  GLMNFIHRDEEVNYFPSRFDPTRHAEKYPMPPRVLSGCREKCIIDKENNFKQAGERYRSF  248

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQDRF+ RWV +L++ RVTHEI+S W+SY +Q D SLGQK+ASRL I+P M
Sbjct  249  DPARQDRFLQRWVDALTDARVTHEIQSIWVSYWSQCDASLGQKLASRLKIKPNM  302



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   270 bits (691),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P  +VPG+++SDDKMLQ RIF+Y+D+ RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPGLVVPGVHYSDDKMLQTRIFSYSDSQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE+ P P  +++G+RD+C IEKENNFKQPG+RYR++
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPCRHAEKHPIPPVVLSGKRDRCCIEKENNFKQPGERYRTF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            +PDRQ+RFI RWV +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RPTM
Sbjct  439  SPDRQERFIRRWVDALSDPRLTHEIRSIWISYWSQADKSLGQKLASRLNVRPTM  492



>gb|AAY59707.1| catalase [Oryza sativa Indica Group]
Length=492

 Score =   270 bits (690),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCAYHNN +D
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAYHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KCVI+KENNFKQ G+RYRS+
Sbjct  379  GSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVIDKENNFKQAGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQDRF+ RWV +LS+PR+THE+R  WISY +Q D SLGQK+ASRLN++P M
Sbjct  439  DPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   270 bits (690),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ LP NAPKCA+HNN YD
Sbjct  319  NEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEE+DYFPS++D  R+AE +P P  + +G+R+KC+I+KENNFKQPG+RYR++
Sbjct  379  GSMNFMHRDEEIDYFPSRYDQVRHAEVYPIPSTVCSGKREKCIIQKENNFKQPGERYRTF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQ+RFI RWV++LS+PR+T+EIRS WI+Y +QAD+SLGQK+ASRLN+RP++
Sbjct  439  TPDRQERFIRRWVEALSDPRITYEIRSIWITYWSQADKSLGQKLASRLNVRPSI  492



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   270 bits (690),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPG+Y+SDDKMLQ RIF+YAD  RHRLGPNY+LLP NAPK A+HNN ++
Sbjct  319  NEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADPQRHRLGPNYLLLPANAPKSAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE+FP P  I +GRR+K  IEKENNFKQ G+R+RSW
Sbjct  379  GFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPPAICSGRREKIAIEKENNFKQAGERFRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQDRF  RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS L++RP +
Sbjct  439  APDRQDRFTRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKIASHLSMRPNI  492



>ref|XP_010534184.1| PREDICTED: catalase isozyme 3-like [Tarenaya hassleriana]
Length=492

 Score =   270 bits (690),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 149/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  717  EMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDG  538
            EM+A +P  +VPGIY+S DK+LQARIFAY DT R+RLGPNY+ LPVNAPKCA+HNN +DG
Sbjct  320  EMLAFNPGLVVPGIYYSQDKLLQARIFAYGDTQRYRLGPNYLQLPVNAPKCAHHNNHHDG  379

Query  537  YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWA  358
            +MNF+HRDEEV+YFPS+FD+ R+A ++P P  + +G R KCVIEKENNFKQPG+RYRSWA
Sbjct  380  FMNFMHRDEEVNYFPSRFDSVRHAAKYPIPSAVCSGERIKCVIEKENNFKQPGERYRSWA  439

Query  357  PDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            PDRQ+R+  RWV++LS+ RVT EIR  WISYL+Q+D+SLG KVA+RLN+RP+ 
Sbjct  440  PDRQERYAKRWVEALSDARVTDEIRGVWISYLSQSDKSLGMKVANRLNVRPSF  492



>sp|A2YH64.2|CATA2_ORYSI RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Indica 
Group]
 gb|EEC81340.1| hypothetical protein OsI_24526 [Oryza sativa Indica Group]
Length=492

 Score =   270 bits (690),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCAYHNN +D
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAYHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KCVI+KENNFKQ G+RYRS+
Sbjct  379  GSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVIDKENNFKQAGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQDRF+ RWV +LS+PR+THE+R  WISY +Q D SLGQK+ASRLN++P M
Sbjct  439  DPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score =   270 bits (690),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY++LPVNAPKCAYHNN +D
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLMLPVNAPKCAYHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KCVI KENNFKQ G+RYRS+
Sbjct  379  GTMNFMHRDEEVNYFPSRFDAARHAEKVPVPPRVLTGCREKCVINKENNFKQAGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQDRFI RWV +LS+PR+THE+R  WISY +Q D SLGQK+ASRLN++P M
Sbjct  439  DPARQDRFIQRWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P  IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+LLP NAPKCA+HNN YD
Sbjct  319  NEQLAFCPGIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCAHHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEVDYFPS++D  ++A R+P P   +TGRR+K VI KENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSVNLTGRREKTVIPKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQ+RFI RW+ +LS+PR+THEIRS W+SY +QADRSLGQK+ASRL+ +P+M
Sbjct  439  DPARQERFIKRWIDALSDPRLTHEIRSIWLSYWSQADRSLGQKLASRLSAKPSM  492



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P  +VPG+Y+SDDK+LQ RIF+YADT RHRLGPNY+ LPVNAPKCA+HNN YD
Sbjct  319  NEQLAFCPGIVVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRD+EVDYFPS++D  R+AER+P P  ++ G RD+ +I+KENNFKQPG+RYRSW
Sbjct  379  GQMNFMHRDDEVDYFPSRYDPVRHAERYPIPPNVLNGNRDRQIIQKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQ+RFI RWV +LS+PR+THEIR+ WISY +QAD+S+G K+ASRLN+RPTM
Sbjct  439  DPARQERFICRWVDALSDPRITHEIRNIWISYWSQADKSVGMKLASRLNVRPTM  492



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPPNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++P P  ++TGRR+K VI KENNFKQPG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAEKYPIPPPVLTGRREKTVIPKENNFKQPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDR+DRFI RWV++LS+PRVT+EIRS WISY +QAD+SLGQK+AS LN+RPTM
Sbjct  439  TPDRKDRFIRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKIASHLNMRPTM  492



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P  IVPG+Y+++DK+LQ RIF+Y+DT RHRLGPNY++LP NAPKCA+HNN ++
Sbjct  319  NEQLAFGPGLIVPGVYYTEDKLLQTRIFSYSDTQRHRLGPNYLMLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+FD  R+AERFP P    TG+R+KCVIEKENNFKQPG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRFDPVRHAERFPIPSHTHTGKREKCVIEKENNFKQPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            AP+RQ+RF+ RWV +LS+PRVTHEI S WISY +Q D+SLGQK+A+RLN++  M
Sbjct  439  APERQERFVKRWVAALSDPRVTHEICSIWISYWSQCDKSLGQKIAARLNMKANM  492



>gb|AIU99479.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A+ PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA+HNN +D
Sbjct  319  NEQIALCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I+KENNFKQ G+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRFDPARHAEKVPIPSRVLTGCREKCIIQKENNFKQAGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SLGQK+ASRLN++P M
Sbjct  439  DPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P+ IVPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPSIIVPGLYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+FD  R+AE++P P  I +G+R+KC+I+KENNF+QPG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRFDPVRHAEKYPIPTAICSGKREKCIIDKENNFQQPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RFI RWV +LS+PRVT+EIRS WISY ++AD+SLGQK+ASRL++RP++
Sbjct  439  APDRQERFIYRWVDALSDPRVTYEIRSIWISYWSKADKSLGQKLASRLSVRPSI  492



>dbj|BAA05494.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCAYHNN +D
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAYHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KCVI+KENNF+Q G+RYRS+
Sbjct  379  GSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVIDKENNFQQAGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQDRF+ RWV +LS+PR+THE+R  WISY +Q D SLGQK+ASRLN++P M
Sbjct  439  DPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>dbj|BAA34204.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCAYHNN +D
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAYHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KCVI+KENNF+Q G+RYRS+
Sbjct  379  GSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVIDKENNFQQAGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQDRF+ RWV +LS+PR+THE+R  WISY +Q D SLGQK+ASRLN++P M
Sbjct  439  DPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AHF21552.1| catalase [Hylocereus undatus]
Length=492

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 144/174 (83%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P  +VPGIY+SDDK+LQ R+FAY D  R+RLG NYM+LPVNAPKCA+HNN YD
Sbjct  319  NEQLAFSPGVVVPGIYYSDDKLLQCRVFAYGDAQRYRLGANYMMLPVNAPKCAHHNNQYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEE+DYFPSKFD  R AE++P   ++ TG+R+K VI KENNFKQPGDRYRSW
Sbjct  379  GVMNFMHRDEEIDYFPSKFDPARQAEKYPILTKVYTGKREKTVIPKENNFKQPGDRYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQ+RF+ RWV  LS+PRVT E+RS W+SYL+Q DRSLG KVA+RLN+RPTM
Sbjct  439  DPARQERFVKRWVDVLSDPRVTLELRSIWVSYLSQCDRSLGMKVATRLNMRPTM  492



>ref|NP_001058635.1| Os06g0727200 [Oryza sativa Japonica Group]
 sp|Q0D9C4.1|CATA2_ORYSJ RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Japonica 
Group]
 dbj|BAD61813.1| catalase [Oryza sativa Japonica Group]
 dbj|BAF20549.1| Os06g0727200 [Oryza sativa Japonica Group]
 gb|EAZ38347.1| hypothetical protein OsJ_22721 [Oryza sativa Japonica Group]
 dbj|BAG91437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94401.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCAYHNN +D
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAYHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KCVI+KENNF+Q G+RYRS+
Sbjct  379  GSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVIDKENNFQQAGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQDRF+ RWV +LS+PR+THE+R  WISY +Q D SLGQK+ASRLN++P M
Sbjct  439  DPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN +D
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++P P  + +G R++CVI KENNFK+PG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAEKYPAPPAVCSGTRERCVIAKENNFKEPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  PPERQERFICRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAA42720.1| catalase-1 [Zea mays]
Length=492

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA+HNN +D
Sbjct  319  NEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I+KENNFKQ G+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRFDPARHAEKVPIPPRVLTGCREKCIIQKENNFKQAGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQDRFI RWV +L++PRVTHE R+ WISY +Q D +LGQK+ASRLN++P+M
Sbjct  439  DPARQDRFIQRWVDALTDPRVTHEHRTIWISYWSQCDAALGQKLASRLNLKPSM  492



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   268 bits (685),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGPNY+ LP NAPKCA+HNN YD
Sbjct  311  NEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYD  370

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEE+DYFPS++D  R+AE +P P  + +G+R+KC+I+KENNF+QPG+RYRS+
Sbjct  371  GSMNFMHRDEEIDYFPSRYDPVRHAENYPIPTTVCSGKREKCIIQKENNFQQPGERYRSF  430

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            + DRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  431  SADRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  484



>ref|NP_001241808.1| catalase isozyme B [Zea mays]
 gb|ACG48924.1| catalase isozyme B [Zea mays]
 gb|ACN25578.1| unknown [Zea mays]
 gb|AFW69583.1| catalase1 [Zea mays]
Length=492

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA+HNN +D
Sbjct  319  NEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I+KENNFKQ G+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRFDPARHAEKVPIPPRVLTGCREKCIIQKENNFKQAGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQDRFI RWV +L++PRVTHE R+ WISY +Q D +LGQK+ASRLN++P+M
Sbjct  439  DPARQDRFIQRWVDALTDPRVTHEHRTIWISYWSQCDAALGQKLASRLNLKPSM  492



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P  +VPG+ +S+DK+LQ RIF+Y+DT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPGIVVPGVSYSEDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+ D  RNAE FP P  I +G+R+KCVIEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRCDPARNAESFPVPSAICSGKREKCVIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQ+RF+NR V  LS+PR+THE+R+ WISY  Q D+SLGQK+A+RLN++P++
Sbjct  439  APDRQERFLNRLVGGLSDPRITHELRTIWISYWIQCDKSLGQKLATRLNVKPSI  492



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   268 bits (685),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P+ IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPSLIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE+ P P  + +G+R+KC+I KENNFKQPG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPSTVYSGKREKCIIGKENNFKQPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            + DRQ+RFINRW+ +LS+ RVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  SADRQERFINRWIDALSDSRVTHEIRSIWISYWSQADKSLGQKIASRLNVRPSI  492



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   268 bits (685),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA +VPGIY+++DK+LQ RIF+Y+DT RHRLGPNY++LP NAPKCA+HNN ++
Sbjct  319  NEQLAFSPALVVPGIYYTEDKLLQTRIFSYSDTQRHRLGPNYLMLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+FD  R+AERFP P    +G R+KCVIEKENNFKQPG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRFDPVRHAERFPIPSHTHSGMREKCVIEKENNFKQPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQ+RF+ RWV +LS+PRVTHEI S WISY +Q+D+SLGQK+A+RLN++  M
Sbjct  439  EPDRQERFVKRWVAALSDPRVTHEICSIWISYWSQSDKSLGQKIAARLNMKANM  492



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   268 bits (685),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 156/178 (88%), Gaps = 4/178 (2%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGGRYRSF  438

Query  360  APD----RQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PD    RQ+RFI RW+++LS+PR+THEIRS WISY +QAD++LGQK+ASRLN+RP++
Sbjct  439  TPDSFDFRQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKLASRLNVRPSI  496



>gb|AIM43584.1| catalase [Saccharum hybrid cultivar Yacheng05-179]
Length=492

 Score =   268 bits (684),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE VA  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA+HNN ++
Sbjct  319  NEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I+KENNFKQ G+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQAGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SLGQK+ASRLN++P M
Sbjct  439  DPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|KGN55500.1| hypothetical protein Csa_4G658600 [Cucumis sativus]
Length=405

 Score =   265 bits (677),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGIY+SDDK+LQ RIF+YADT R+RLGPNY+ LPVNAPKCAYHNN +D
Sbjct  232  NEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRYRLGPNYLQLPVNAPKCAYHNNHHD  291

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+ RDEE++YFPS+ D TR+AER+P P  + TG+R++CVIEKENNFKQPG+RYRSW
Sbjct  292  GFMNFMDRDEEINYFPSRIDPTRHAERYPQPSAVYTGKRERCVIEKENNFKQPGERYRSW  351

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIR  208
              DRQ+RF+ RWV +LS+PRVTHEIR+ WISY +QAD+SLG K+AS  N++
Sbjct  352  PSDRQERFVGRWVDALSDPRVTHEIRNIWISYWSQADKSLGHKLASHFNLK  402



>gb|AIU99485.1| catalase [Saccharum spontaneum]
Length=492

 Score =   268 bits (684),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE VA  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA+HNN ++
Sbjct  319  NEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I+KENNFKQ G+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQAGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SLGQK+ASRLN++P M
Sbjct  439  DPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AFR53082.1| CAT [Anthurium andraeanum]
Length=492

 Score =   268 bits (684),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P  +VPGIY+SDDKMLQ R FAY DT R+RLGPNY++LPVNAPKCA+ N+ YD
Sbjct  319  NEQLAFSPGIVVPGIYYSDDKMLQCRTFAYGDTQRYRLGPNYLMLPVNAPKCAHKNSHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEV+YFPS+ D  R+AER+P   RIVTGRR+KC+IEK+N+FKQPGDRYRSW
Sbjct  379  GLMNFMHRDEEVNYFPSRHDPLRHAERYPINNRIVTGRREKCIIEKQNDFKQPGDRYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            A DRQ+RF+ RWV++L+ P+V+HE+RS W+SYL+++D SLGQKVA+RLN++P+M
Sbjct  439  AHDRQERFVRRWVEALAHPKVSHEVRSIWVSYLSKSDVSLGQKVANRLNMKPSM  492



>gb|AIU99488.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   267 bits (683),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA+HNN ++
Sbjct  319  NEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I+KENNFKQ G+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQAGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SLGQK+ASRLN++P M
Sbjct  439  DPARQDRFIQRWVGALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   267 bits (683),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 157/178 (88%), Gaps = 4/178 (2%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSF  438

Query  360  APD----RQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P+    RQ+RFI RW+++LS+PR+THEIRS WISY +QAD++LGQK+ASRLN+RP++
Sbjct  439  TPESFDFRQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKLASRLNVRPSI  496



>gb|AIU99484.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   267 bits (683),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE VA  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA+HNN ++
Sbjct  319  NEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I+KENNFKQ G+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQAGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SLGQK+ASRLN++P M
Sbjct  439  DPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99481.1| catalase [Saccharum spontaneum]
Length=492

 Score =   267 bits (683),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA+HNN ++
Sbjct  319  NEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+KC+I+KENNFKQ G+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQAGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SLGQK+ASRLN++P M
Sbjct  439  DPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AAL00886.1| catalase [Suaeda salsa]
Length=287

 Score =   261 bits (666),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 145/174 (83%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PAH+VPGIYFS+DKMLQAR FAYADTHR+RLG NY+ LPVNAPKC + NN  D
Sbjct  114  NEQLAFYPAHVVPGIYFSNDKMLQARTFAYADTHRYRLGVNYLQLPVNAPKCPHTNNHRD  173

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G M  +HRDEE+DYFPS+FD  R AER P P  I++GRR+K +I KENNFK+PGDRYRSW
Sbjct  174  GAMTMIHRDEEIDYFPSRFDPVREAERHPIPTAIISGRREKQIIPKENNFKEPGDRYRSW  233

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQ+RF+ R+VK+LS+PR+T+EI S W +YL+QAD+SLG KVASRLN+RPTM
Sbjct  234  DPARQERFVGRFVKALSDPRLTYEICSIWETYLSQADKSLGMKVASRLNVRPTM  287



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 147/174 (84%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPG+Y+SDDKMLQ RIF+YAD+ RHRLGPNY+ LP NAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+ D  R+AE+ P P    +  R+KC I K+NNFKQPG+RYRSW
Sbjct  379  GFMNFIHRDEEVNYFPSRHDPVRHAEKVPIPTANFSACREKCNIPKQNNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            APDRQDRF+ RWV +LS+PRVTHEIRS WISY +QADRSLGQK+AS LN+RP++
Sbjct  439  APDRQDRFLRRWVDALSDPRVTHEIRSIWISYWSQADRSLGQKIASHLNMRPSI  492



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 147/174 (84%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P  IVPGIY+SDDK+LQ RIF+Y+DT RHRLGPNY+LLP NAPKCA+HNN YD
Sbjct  319  NEQLAFCPGIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCAHHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEVDYFPS+FD  ++A R+P P     GRR+K VIEKENNFKQPG+RYRS 
Sbjct  379  GTMNFMHRDEEVDYFPSRFDPAKHAPRYPIPSSTCNGRREKMVIEKENNFKQPGERYRSM  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQ+RFINRW+ +LS+PR+THEI+S W+SY +QADRSLGQK+ASRL+ +P+M
Sbjct  439  DPARQERFINRWIDALSDPRLTHEIKSIWLSYWSQADRSLGQKLASRLSAKPSM  492



>ref|XP_003563243.1| PREDICTED: catalase isozyme 1 [Brachypodium distachyon]
Length=492

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA+HNN ++
Sbjct  319  NEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+FD TR+A+++P P R++TG R+KC+IEKENNFKQ G+RYRS+
Sbjct  379  GFMNFIHRDEEVNYFPSRFDPTRHAQKYPIPTRVLTGCREKCIIEKENNFKQAGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQDRFI RWV +LS+ RVTHEI+  WISY +Q D SLGQK+ SRL  +P M
Sbjct  439  DPARQDRFIQRWVDALSDARVTHEIQGIWISYWSQCDTSLGQKLGSRLKAKPNM  492



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P+RQ+RFI RW+++L +PR+THEIRS WI Y +QAD++ GQK+ASRLN+RP++
Sbjct  439  TPERQERFIRRWIEALFDPRITHEIRSIWIFYWSQADKTFGQKLASRLNVRPSI  492



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P  IVPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+LLP NAPKC++HNN YD
Sbjct  319  NEQLAFCPGIIVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCSHHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEVDYFPS+FD   +A R+P P R + GRR+K VIEKENNFKQPG+RYRS 
Sbjct  379  GLMNFMHRDEEVDYFPSRFDPATDAPRYPIPSRTLNGRREKMVIEKENNFKQPGERYRSM  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQ+RFINRW+ +LS+PR+THEI++ W+SY +QADRSLGQK+A RL+++P+M
Sbjct  439  DPARQERFINRWIDALSDPRLTHEIKAIWLSYWSQADRSLGQKLAGRLSVKPSM  492



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGPNY+ LPVNAPK A+HNN ++
Sbjct  319  NEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKNAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS++D  R+A++ P P    +GRR+K  IEKENNFKQPG+RYRSW
Sbjct  379  GFMNFMHRDEEVNYFPSRYDPVRHADKVPIPSVPFSGRREKVSIEKENNFKQPGERYRSW  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             PDRQ+RFI RWV +LS+PR+T EIRS WISY TQAD+SLGQK+ASRLN+RPTM
Sbjct  439  DPDRQERFIRRWVDALSDPRLTQEIRSIWISYWTQADKSLGQKLASRLNVRPTM  492



>ref|XP_002437631.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
 gb|EER88998.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
Length=492

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA+HNN ++
Sbjct  319  NEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHE  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G+MNF+HRDEEV+YFPS+FD TR+AE+ P P R++TG R+KC+IEKENNFKQ G+R+RS+
Sbjct  379  GFMNFMHRDEEVNYFPSRFDPTRHAEKVPIPSRVLTGCREKCIIEKENNFKQAGERFRSF  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQDRFI RWV +LS+PRVTHE  + WI+Y +Q D SLGQK+ASRLN++P M
Sbjct  439  DPARQDRFIQRWVDALSDPRVTHEHHTIWINYWSQCDASLGQKLASRLNLKPNM  492



>gb|AAC17729.1| catalase 1, partial [Hordeum vulgare subsp. vulgare]
Length=398

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  PA  VPGI++SDDK+LQ RIF+YADT RHRLGPNY++LPVNAPKCA+HNN +D
Sbjct  225  NEQLAFCPAVTVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHD  284

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEV+YFPS+FD TR+AE++P P R+++G R+KC+I+KENNFKQ G+RYRS+
Sbjct  285  GLMNFIHRDEEVNYFPSRFDPTRHAEKYPMPPRVLSGCREKCIIDKENNFKQAGERYRSF  344

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQDRF+ RWV +L++ RVTHEI+S W+SY +Q D SLGQK+ASRL I+P M
Sbjct  345  DPARQDRFLQRWVDALTDARVTHEIQSIWVSYWSQCDASLGQKLASRLKIKPNM  398



>gb|AHF27430.1| catalase [Cucurbita moschata]
Length=492

 Score =   266 bits (681),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NEM+A   + +VPGI++SDDKMLQAR FAYADT RHRLGPNY+ LPVNAPKC +HNN ++
Sbjct  319  NEMLAFSMS-LVPGIHYSDDKMLQARSFAYADTQRHRLGPNYLQLPVNAPKCPHHNNHHE  377

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKE-NNFKQPGDRYRS  364
            G+MNF+HRDEEV+YFPS++D  R+AE+FP P  ++TG+R++CVI KE NNFKQ GDRYRS
Sbjct  378  GFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPPNVLTGKRERCVIPKENNNFKQAGDRYRS  437

Query  363  WAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            WAPDRQDRF+ R+V++LS+PRVTHE+R+ WISY +QADRSLGQK+ASRLN+RP +
Sbjct  438  WAPDRQDRFVKRFVEALSDPRVTHEVRNIWISYWSQADRSLGQKIASRLNVRPNI  492



>gb|AHF27433.1| catalase [Cucurbita maxima]
Length=492

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NEM+A   + +VPGI++SDDKMLQAR FAYADT RHRLGPNY+ LPVNAPKC +HNN ++
Sbjct  319  NEMLAFSMS-LVPGIHYSDDKMLQARSFAYADTQRHRLGPNYLQLPVNAPKCPHHNNHHE  377

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKE-NNFKQPGDRYRS  364
            G+MNF+HRDEEV+YFPS++D  R+AE+FP P  ++TG+R++CVI KE NNFKQ GDRYRS
Sbjct  378  GFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPPNVLTGKRERCVIPKENNNFKQAGDRYRS  437

Query  363  WAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
            WAPDRQDRF+ R+V++LS+PRVTHE+R+ WISY +QADRSLGQK+ASRLN+RP +
Sbjct  438  WAPDRQDRFVKRFVEALSDPRVTHEVRNIWISYWSQADRSLGQKIASRLNVRPNI  492



>sp|Q43206.1|CATA1_WHEAT RecName: Full=Catalase-1 [Triticum aestivum]
 dbj|BAA13068.1| catalase [Triticum aestivum]
 gb|ADF83496.1| catalase [Triticum aestivum]
Length=492

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720  NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
            NE +A  P  IVPG+Y+SDDK+LQ RIF+Y+DT RHRLGPNY+LLP NAPKC++HNN YD
Sbjct  319  NEQLAFCPGIIVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCSHHNNHYD  378

Query  540  GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
            G MNF+HRDEEVDYFPS+FD  ++A R+P P R + GRR+K VIEKENNFKQPG+RYRS 
Sbjct  379  GLMNFMHRDEEVDYFPSRFDPAKHAPRYPIPSRTLNGRREKMVIEKENNFKQPGERYRSM  438

Query  360  APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
             P RQ+RFINRW+ +LS+PR+THEI++ W+SY +QAD+SLGQK+ASRL+ +P+M
Sbjct  439  DPARQERFINRWIDALSDPRLTHEIKAIWLSYWSQADKSLGQKLASRLSSKPSM  492



>gb|AAF79625.1|AC027665_26 F5M15.5 [Arabidopsis thaliana]
 gb|AAF80611.1|AC069251_4 F2D10.11 [Arabidopsis thaliana]
Length=1013

 Score =   276 bits (707),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = -2

Query  717  EMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDG  538
            E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G
Sbjct  359  EQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEG  418

Query  537  YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWA  358
            +MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R KCVI+KENNFKQ GDRYRSWA
Sbjct  419  FMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWA  478

Query  357  PDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  202
            PDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSLGQK+ASRLN+RP+
Sbjct  479  PDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPS  530


 Score =   266 bits (679),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  720   NEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYD  541
             NE +A  PA +VPGI++SDDK+LQ RIF+YAD+ RHRLGPNY+ LPVNAPKCA+HNN +D
Sbjct  840   NEQIAFCPALVVPGIHYSDDKLLQTRIFSYADSQRHRLGPNYLQLPVNAPKCAHHNNHHD  899

Query  540   GYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSW  361
             G+MNF+HRDEEV+YFPS+ D  R+AE++PT   + +G R+KC I KENNFKQPG+RYRSW
Sbjct  900   GFMNFMHRDEEVNYFPSRLDPVRHAEKYPTTPIVCSGNREKCFIGKENNFKQPGERYRSW  959

Query  360   APDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  199
               DRQ+RF+ R+V++LSEPRVTHEIRS WISY +QAD+SLGQK+A+RLN+RP  
Sbjct  960   DSDRQERFVKRFVEALSEPRVTHEIRSIWISYWSQADKSLGQKLATRLNVRPNF  1013



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1273595176425