BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF013J02

Length=692
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009789076.1|  PREDICTED: DELLA protein GAI1-like                 291   4e-91   Nicotiana sylvestris
emb|CDP00805.1|  unnamed protein product                                280   7e-89   Coffea canephora [robusta coffee]
gb|AFN25699.1|  RGA-1                                                   272   7e-89   Pyrus pyrifolia [sha li]
ref|XP_011070609.1|  PREDICTED: DELLA protein GAI1                      284   1e-88   Sesamum indicum [beniseed]
gb|AFN25702.1|  RGL2-2                                                  268   1e-87   Pyrus pyrifolia [sha li]
ref|XP_007225630.1|  hypothetical protein PRUPE_ppa005944mg             276   3e-87   
ref|XP_002312450.2|  hypothetical protein POPTR_0008s13090g             281   4e-87   
gb|KDP38079.1|  hypothetical protein JCGZ_04722                         281   7e-87   Jatropha curcas
gb|AEX97109.1|  spur-type DELLA protein                                 281   8e-87   Malus domestica [apple tree]
gb|ADH53778.1|  GAI2                                                    280   2e-86   Malus domestica [apple tree]
gb|ACL68359.1|  DELLA protein                                           280   2e-86   Malus baccata var. xiaojinensis
gb|AAY56752.1|  DELLA protein                                           280   2e-86   Malus domestica [apple tree]
gb|ADW85805.1|  DELLA protein                                           280   2e-86   Malus domestica [apple tree]
gb|AHB17744.1|  GA repressor DELLA                                      277   3e-86   Actinidia deliciosa [Chinese gooseberry]
ref|XP_004298516.1|  PREDICTED: DELLA protein GAIP                      279   3e-86   Fragaria vesca subsp. vesca
ref|XP_008221422.1|  PREDICTED: DELLA protein GAIP-B                    279   4e-86   Prunus mume [ume]
ref|XP_002314799.2|  hypothetical protein POPTR_0010s12080g             278   5e-86   Populus trichocarpa [western balsam poplar]
ref|XP_011023720.1|  PREDICTED: DELLA protein GAIP-B-like               278   7e-86   Populus euphratica
gb|AAY56751.1|  DELLA protein                                           279   7e-86   Malus domestica [apple tree]
gb|ACL68360.1|  DELLA protein                                           278   8e-86   Malus domestica [apple tree]
gb|ABL61270.1|  GAI1                                                    278   9e-86   Malus hupehensis
gb|AGK07287.1|  GAI1                                                    278   1e-85   Rosa hybrid cultivar
ref|XP_002527794.1|  DELLA protein GAIP-B, putative                     277   1e-85   
ref|XP_010264458.1|  PREDICTED: DELLA protein GAI1                      277   1e-85   Nelumbo nucifera [Indian lotus]
gb|AHB17742.1|  GA repressor DELLA                                      276   1e-85   Actinidia deliciosa [Chinese gooseberry]
gb|AFP58844.1|  DELLA domain GRAS family transcription factor GAI       276   2e-85   Populus tomentosa [Chinese white poplar]
ref|XP_009351505.1|  PREDICTED: DELLA protein GAI-like                  277   3e-85   Pyrus x bretschneideri [bai li]
gb|ADA84480.1|  GRAS                                                    274   3e-85   Antirrhinum majus [garden snapdragon]
ref|XP_009349514.1|  PREDICTED: DELLA protein GAI-like                  276   4e-85   
ref|XP_011038614.1|  PREDICTED: DELLA protein GAIP                      276   5e-85   Populus euphratica
gb|EYU30084.1|  hypothetical protein MIMGU_mgv1a027121mg                275   7e-85   Erythranthe guttata [common monkey flower]
ref|XP_004504565.1|  PREDICTED: DELLA protein GAI1-like                 273   1e-84   Cicer arietinum [garbanzo]
gb|ABI34432.1|  CRY                                                     273   1e-84   Pisum sativum [garden pea]
gb|AEK06229.1|  GAI1                                                    274   1e-84   Vitis vinifera
ref|XP_009603475.1|  PREDICTED: DELLA protein GAI1-like                 274   1e-84   Nicotiana tomentosiformis
ref|XP_002284648.1|  PREDICTED: DELLA protein GAI1                      274   1e-84   Vitis vinifera
gb|AFJ23219.1|  DELLA protein                                           275   1e-84   Pyrus betulifolia
gb|EPS61323.1|  hypothetical protein M569_13471                         273   2e-84   Genlisea aurea
gb|AFJ23220.1|  DELLA protein                                           275   2e-84   Pyrus x bretschneideri [bai li]
ref|XP_010274729.1|  PREDICTED: DELLA protein GAI1-like                 273   4e-84   Nelumbo nucifera [Indian lotus]
ref|XP_007045197.1|  GRAS family transcription factor family protein    273   4e-84   
gb|ADH53781.1|  GAI2                                                    272   5e-84   Malus baccata var. xiaojinensis
dbj|BAG71200.1|  DELLA 1                                                272   6e-84   Lactuca sativa [cultivated lettuce]
gb|ADH53779.1|  GAI1                                                    272   7e-84   Malus domestica [apple tree]
ref|XP_008467128.1|  PREDICTED: DELLA protein GAIP-B                    271   2e-83   Cucumis melo [Oriental melon]
gb|ABG26370.1|  DELLA protein GAI                                       272   2e-83   Gossypium barbadense [Egyptian cotton]
ref|XP_004166672.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    270   3e-83   
ref|XP_004150593.1|  PREDICTED: DELLA protein GAIP-B-like               270   3e-83   Cucumis sativus [cucumbers]
emb|CAN59753.1|  hypothetical protein VITISV_036639                     270   4e-83   Vitis vinifera
gb|KJB15415.1|  hypothetical protein B456_002G177000                    271   5e-83   Gossypium raimondii
ref|XP_008362563.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    264   7e-83   
ref|XP_002266267.1|  PREDICTED: DELLA protein GAI-like                  270   8e-83   Vitis vinifera
ref|XP_006384166.1|  hypothetical protein POPTR_0004s08890g             265   9e-83   
ref|XP_010527787.1|  PREDICTED: DELLA protein GAI-like                  270   1e-82   Tarenaya hassleriana [spider flower]
ref|XP_006307228.1|  hypothetical protein CARUB_v10008833mg             268   1e-82   Capsella rubella
gb|ADH53780.1|  GAI1                                                    268   1e-82   Malus domestica [apple tree]
gb|ACM47244.1|  putative gibberellin signaling DELLA protein            268   1e-82   Sinningia speciosa [Brazilian gloxinia]
ref|XP_006383329.1|  hypothetical protein POPTR_0005s14540g             270   2e-82   Populus trichocarpa [western balsam poplar]
ref|XP_010066602.1|  PREDICTED: DELLA protein GAIP-B-like               270   2e-82   Eucalyptus grandis [rose gum]
gb|AAY28970.1|  GIA/RGA-like gibberellin response modulator             267   2e-82   Gossypium hirsutum [American cotton]
gb|AEE69074.2|  GAI-like protein                                        269   2e-82   Juglans regia
gb|KJB08563.1|  hypothetical protein B456_001G089400                    267   2e-82   Gossypium raimondii
ref|XP_010496659.1|  PREDICTED: DELLA protein GAI                       266   4e-82   Camelina sativa [gold-of-pleasure]
ref|XP_011021384.1|  PREDICTED: DELLA protein GAI-like                  268   5e-82   Populus euphratica
ref|XP_006416958.1|  hypothetical protein EUTSA_v10007323mg             266   6e-82   Eutrema salsugineum [saltwater cress]
gb|ACR58455.1|  GAI/RGA protein                                         268   6e-82   Gossypium hirsutum [American cotton]
ref|XP_008343058.1|  PREDICTED: DELLA protein GAI-like                  267   8e-82   
ref|XP_010459010.1|  PREDICTED: DELLA protein GAI-like                  266   8e-82   Camelina sativa [gold-of-pleasure]
gb|AEX97111.1|  spur-type DELLA protein                                 267   8e-82   Malus domestica [apple tree]
gb|AAY56750.1|  DELLA protein                                           267   9e-82   Malus domestica [apple tree]
ref|XP_003531153.1|  PREDICTED: DELLA protein GAI1-like                 265   9e-82   Glycine max [soybeans]
ref|XP_009334448.1|  PREDICTED: DELLA protein GAI-like                  266   1e-81   Pyrus x bretschneideri [bai li]
ref|XP_008229195.1|  PREDICTED: DELLA protein GAI                       266   1e-81   
ref|XP_007214956.1|  hypothetical protein PRUPE_ppa003206mg             266   1e-81   Prunus persica
gb|AHB17743.1|  GA repressor DELLA                                      265   1e-81   Actinidia deliciosa [Chinese gooseberry]
gb|AHX57850.1|  DELLA                                                   266   1e-81   Prunus mume [ume]
gb|EYU33133.1|  hypothetical protein MIMGU_mgv1a027125mg                255   2e-81   Erythranthe guttata [common monkey flower]
ref|XP_002305198.1|  hypothetical protein POPTR_0004s08890g             266   3e-81   Populus trichocarpa [western balsam poplar]
emb|CAA72178.1|  RGA2 protein                                           264   3e-81   Arabidopsis thaliana [mouse-ear cress]
emb|CAA75492.1|  GAI                                                    264   3e-81   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172945.1|  DELLA protein GAI                                     264   3e-81   Arabidopsis thaliana [mouse-ear cress]
sp|Q6EI06.1|GAIP_CUCMA  RecName: Full=DELLA protein GAIP; AltName...    265   3e-81   Cucurbita maxima [Boston marrow]
ref|XP_011002785.1|  PREDICTED: DELLA protein GAI                       265   4e-81   Populus euphratica
ref|XP_002890081.1|  hypothetical protein ARALYDRAFT_471680             264   4e-81   
ref|XP_010476569.1|  PREDICTED: DELLA protein GAI-like                  264   4e-81   Camelina sativa [gold-of-pleasure]
sp|Q6EI05.1|GAIPB_CUCMA  RecName: Full=DELLA protein GAIP-B; AltN...    265   4e-81   Cucurbita maxima [Boston marrow]
ref|XP_002534030.1|  DELLA protein GAI, putative                        264   5e-81   Ricinus communis
ref|XP_010681882.1|  PREDICTED: DELLA protein GAI-like                  265   8e-81   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK26113.1|  hypothetical protein AALP_AA8G204400                    262   1e-80   Arabis alpina [alpine rockcress]
ref|XP_006469195.1|  PREDICTED: DELLA protein GAIP-B-like               264   1e-80   Citrus sinensis [apfelsine]
gb|KDO64603.1|  hypothetical protein CISIN_1g043131mg                   264   1e-80   Citrus sinensis [apfelsine]
ref|NP_001240948.1|  DELLA protein GAI 1                                262   2e-80   Glycine max [soybeans]
ref|XP_006430617.1|  hypothetical protein CICLE_v10011367mg             263   2e-80   Citrus clementina [clementine]
dbj|BAF62636.1|  DELLA protein                                          261   3e-80   Phaseolus vulgaris [French bean]
ref|XP_007156503.1|  hypothetical protein PHAVU_003G291500g             261   3e-80   Phaseolus vulgaris [French bean]
emb|CDP01615.1|  unnamed protein product                                261   3e-80   Coffea canephora [robusta coffee]
gb|AAT08645.1|  GAI-like protein                                        251   4e-80   Hyacinthus orientalis [common hyacinth]
gb|ACY74341.1|  putative DELLA protein                                  261   5e-80   Artemisia annua [sweet Annie]
ref|XP_010553798.1|  PREDICTED: DELLA protein GAI-like                  263   6e-80   Tarenaya hassleriana [spider flower]
ref|XP_010101954.1|  hypothetical protein L484_011971                   259   7e-80   
ref|XP_006482132.1|  PREDICTED: DELLA protein GAI-like                  261   7e-80   Citrus sinensis [apfelsine]
gb|KDP33167.1|  hypothetical protein JCGZ_13432                         260   1e-79   Jatropha curcas
ref|XP_010032696.1|  PREDICTED: DELLA protein GAI                       262   1e-79   Eucalyptus grandis [rose gum]
dbj|BAG71201.1|  DELLA 2                                                261   2e-79   Lactuca sativa [cultivated lettuce]
ref|XP_006448223.1|  hypothetical protein CICLE_v10017466mg             260   3e-79   Citrus clementina [clementine]
gb|EYU25601.1|  hypothetical protein MIMGU_mgv1a003589mg                259   3e-79   Erythranthe guttata [common monkey flower]
ref|XP_006826893.1|  hypothetical protein AMTR_s00010p00148880          259   4e-79   Amborella trichopoda
gb|AHB17746.1|  GA repressor DELLA                                      259   6e-79   Actinidia deliciosa [Chinese gooseberry]
gb|KFK33379.1|  rga1 protein                                            259   6e-79   Arabis alpina [alpine rockcress]
gb|ABI30654.1|  putative gibberellin signaling DELLA protein LA         259   7e-79   Pisum sativum [garden pea]
ref|XP_009779843.1|  PREDICTED: DELLA protein GAI-like isoform X4       258   1e-78   Nicotiana sylvestris
ref|XP_009370101.1|  PREDICTED: DELLA protein GAI-like                  258   1e-78   
gb|AEX97110.1|  spur-type DELLA protein                                 258   3e-78   Malus domestica [apple tree]
ref|XP_008460522.1|  PREDICTED: DELLA protein GAI-like                  258   3e-78   Cucumis melo [Oriental melon]
gb|ABS50250.1|  DELLA protein                                           257   3e-78   Malus hupehensis
gb|AAY56749.1|  DELLA protein                                           257   3e-78   Malus domestica [apple tree]
gb|ABO61516.1|  GAI1                                                    256   3e-78   Glycine max [soybeans]
ref|XP_010554410.1|  PREDICTED: DELLA protein GAI-like                  258   3e-78   Tarenaya hassleriana [spider flower]
ref|XP_003552980.1|  PREDICTED: DELLA protein GAI-like                  257   4e-78   Glycine max [soybeans]
ref|XP_006395878.1|  hypothetical protein EUTSA_v10005482mg             258   4e-78   Eutrema salsugineum [saltwater cress]
ref|XP_007163387.1|  hypothetical protein PHAVU_001G230500g             257   4e-78   Phaseolus vulgaris [French bean]
dbj|BAF62637.1|  DELLA protein                                          257   5e-78   Phaseolus vulgaris [French bean]
gb|ACN33960.1|  unknown                                                 253   8e-78   Zea mays [maize]
gb|EYU45810.1|  hypothetical protein MIMGU_mgv1a003644mg                256   1e-77   Erythranthe guttata [common monkey flower]
gb|ACN36682.1|  unknown                                                 252   1e-77   Zea mays [maize]
ref|XP_010551797.1|  PREDICTED: DELLA protein RGL1-like                 255   1e-77   Tarenaya hassleriana [spider flower]
gb|AFD62413.1|  reduced height-2                                        256   2e-77   Eragrostis tef [tef]
ref|XP_004155733.1|  PREDICTED: DELLA protein GAI-like                  256   2e-77   
ref|XP_008381346.1|  PREDICTED: DELLA protein GAI                       255   2e-77   
sp|Q5BN22.1|RGA2_BRACM  RecName: Full=DELLA protein RGA2; AltName...    255   2e-77   Brassica rapa
gb|AFA35960.1|  ELLA domain GRAS family transcription factor            254   2e-77   Nicotiana attenuata
gb|EYU30908.1|  hypothetical protein MIMGU_mgv1a024641mg                254   2e-77   Erythranthe guttata [common monkey flower]
ref|XP_009796771.1|  PREDICTED: DELLA protein GAI-like                  254   3e-77   Nicotiana sylvestris
gb|AFD62385.1|  reduced height-1                                        256   3e-77   Eragrostis tef [tef]
emb|CDY36236.1|  BnaC07g20900D                                          254   3e-77   Brassica napus [oilseed rape]
ref|XP_009779842.1|  PREDICTED: DELLA protein GAI-like isoform X3       254   4e-77   Nicotiana sylvestris
dbj|BAG16380.1|  GRAS family transcription factor                       254   5e-77   Brassica rapa var. perviridis [kabuna]
ref|XP_009779840.1|  PREDICTED: DELLA protein GAI-like isoform X1       254   5e-77   Nicotiana sylvestris
gb|AFD62419.1|  reduced height-2                                        255   6e-77   Eragrostis tef [tef]
gb|AFD62396.1|  reduced height-2                                        255   6e-77   Eragrostis tef [tef]
gb|AFD62391.1|  reduced height-2                                        255   6e-77   Eragrostis tef [tef]
gb|AFD62360.1|  reduced height-1                                        254   7e-77   Eragrostis tef [tef]
gb|AFD62384.1|  reduced height-1                                        254   7e-77   Eragrostis tef [tef]
ref|XP_010424927.1|  PREDICTED: DELLA protein RGA-like                  254   8e-77   Camelina sativa [gold-of-pleasure]
gb|AFD62369.1|  reduced height-1                                        254   9e-77   Eragrostis tef [tef]
gb|ACL53794.1|  unknown                                                 254   9e-77   Zea mays [maize]
ref|XP_010513881.1|  PREDICTED: DELLA protein RGA isoform X1            254   1e-76   
dbj|BAG16374.1|  GRAS family transcription factor                       253   1e-76   Brassica oleracea var. italica [asparagus broccoli]
sp|Q84TQ7.1|GAI_GOSHI  RecName: Full=DELLA protein GAI; AltName: ...    252   2e-76   Gossypium hirsutum [American cotton]
sp|Q9ST48.1|DWRF8_MAIZE  RecName: Full=DELLA protein DWARF8; Shor...    254   2e-76   Zea mays [maize]
tpg|DAA50918.1|  TPA: dwarf plant8                                      253   2e-76   
ref|XP_010109004.1|  hypothetical protein L484_027201                   253   2e-76   
gb|AHB17745.1|  GA repressor DELLA                                      253   2e-76   Actinidia deliciosa [Chinese gooseberry]
ref|XP_009594460.1|  PREDICTED: DELLA protein GAI-like                  252   3e-76   Nicotiana tomentosiformis
ref|XP_009101333.1|  PREDICTED: DELLA protein RGA1                      252   3e-76   Brassica rapa
ref|XP_010502135.1|  PREDICTED: DELLA protein RGA-like                  253   4e-76   Camelina sativa [gold-of-pleasure]
gb|KEH34625.1|  DELLA domain GRAS family transcription factor GAI       251   4e-76   Medicago truncatula
ref|XP_003560731.1|  PREDICTED: DELLA protein SLN1                      252   6e-76   Brachypodium distachyon [annual false brome]
gb|AAZ08572.1|  truncated gibberellic acid-insensitive isoform 1        248   7e-76   Saccharum hybrid cultivar Co 419
gb|ADD71137.1|  DELLA protein                                           251   7e-76   Brassica napus [oilseed rape]
emb|CDY17662.1|  BnaA06g34810D                                          250   1e-75   Brassica napus [oilseed rape]
gb|AFC88481.1|  DELLA protein                                           249   2e-75   Rosa lucieae [memorial rose]
ref|XP_002876760.1|  RGA1 protein                                       250   2e-75   
gb|EPS67815.1|  hypothetical protein M569_06957                         248   3e-75   Genlisea aurea
ref|XP_009590329.1|  PREDICTED: DELLA protein GAI-like                  249   3e-75   Nicotiana tomentosiformis
gb|EMS65108.1|  hypothetical protein TRIUR3_18790                       244   4e-75   Triticum urartu
ref|XP_011097451.1|  PREDICTED: DELLA protein GAI-like                  248   6e-75   Sesamum indicum [beniseed]
ref|XP_002466594.1|  hypothetical protein SORBIDRAFT_01g010660          249   7e-75   Sorghum bicolor [broomcorn]
gb|AAZ08571.1|  gibberellic acid-insensitive                            249   8e-75   Saccharum hybrid cultivar Co 419
ref|NP_178266.1|  DELLA protein RGA                                     248   9e-75   Arabidopsis thaliana [mouse-ear cress]
emb|CAA75493.1|  GRS protein                                            248   9e-75   Arabidopsis thaliana [mouse-ear cress]
emb|CAA72177.1|  RGA1 protein                                           248   1e-74   Arabidopsis thaliana [mouse-ear cress]
gb|AAK97709.1|  At2g01570/F2I9.19                                       248   1e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011099949.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    248   1e-74   Sesamum indicum [beniseed]
ref|XP_004503135.1|  PREDICTED: DELLA protein GAI-like                  248   2e-74   Cicer arietinum [garbanzo]
ref|XP_010916517.1|  PREDICTED: DELLA protein SLR1 isoform X1           249   2e-74   
gb|EEE59780.1|  hypothetical protein OsJ_12286                          248   4e-74   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004140302.1|  PREDICTED: DELLA protein GAI-like                  247   4e-74   
gb|AFD62376.1|  reduced height-1                                        248   4e-74   Eragrostis tef [tef]
ref|XP_006650473.1|  PREDICTED: DELLA protein SLR1-like                 247   5e-74   Oryza brachyantha
emb|CBX87014.1|  DELLA protein                                          246   5e-74   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001234365.1|  DELLA protein GAI                                  246   6e-74   Solanum lycopersicum
ref|XP_004982031.1|  PREDICTED: DELLA protein DWARF8-like               247   7e-74   
gb|AHK61037.1|  DELLA protein                                           247   7e-74   Psathyrostachys huashanica
ref|XP_010528540.1|  PREDICTED: DELLA protein RGL1                      245   8e-74   Tarenaya hassleriana [spider flower]
emb|CBW30283.1|  RHT-A1 protein                                         246   9e-74   Triticum aestivum [Canadian hard winter wheat]
gb|ADM32428.1|  DELLA protein Rht-A1                                    246   9e-74   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006364643.1|  PREDICTED: DELLA protein GAI-like                  246   1e-73   
gb|AEI25530.1|  gibberellic acid insensitive protein                    246   1e-73   Solanum tuberosum [potatoes]
emb|CCD31540.1|  Reduced height-1 protein                               246   1e-73   Triticum aestivum [Canadian hard winter wheat]
gb|AGG68464.1|  DELLA protein                                           246   1e-73   Triticum aestivum [Canadian hard winter wheat]
gb|AEV92816.1|  DELLA protein                                           247   1e-73   Triticum aestivum [Canadian hard winter wheat]
gb|AGG68491.1|  DELLA protein                                           246   1e-73   Triticum aestivum [Canadian hard winter wheat]
emb|CBW30285.1|  RHT-B1 protein                                         246   1e-73   Triticum aestivum [Canadian hard winter wheat]
gb|AGG68490.1|  DELLA protein                                           246   1e-73   Triticum aestivum [Canadian hard winter wheat]
emb|CBW30286.1|  RHT-B1 protein                                         246   1e-73   Triticum aestivum [Canadian hard winter wheat]
gb|AEV92815.1|  DELLA protein                                           246   1e-73   Triticum aestivum [Canadian hard winter wheat]
emb|CBW30287.1|  RHT-B1 protein                                         246   1e-73   Triticum aestivum [Canadian hard winter wheat]
gb|ADO60988.1|  DELLA protein 2                                         233   2e-73   Helianthus annuus
sp|Q8W127.1|SLN1_HORVU  RecName: Full=DELLA protein SLN1; AltName...    246   2e-73   Hordeum vulgare [barley]
gb|AAX07462.1|  gibberellic acid-insensitive                            246   2e-73   Oryza sativa Indica Group [Indian rice]
gb|AGO59331.1|  DELLA protein                                           246   2e-73   Triticum turgidum subsp. durum
gb|ABI84226.1|  dwarf plant9                                            246   2e-73   Zea mays [maize]
ref|NP_001051032.1|  Os03g0707600                                       246   2e-73   
gb|EAY91579.1|  hypothetical protein OsI_13213                          246   2e-73   Oryza sativa Indica Group [Indian rice]
ref|XP_002884379.1|  hypothetical protein ARALYDRAFT_477591             244   2e-73   
gb|AGG68462.1|  DELLA protein                                           245   3e-73   Triticum aestivum [Canadian hard winter wheat]
emb|CBI84063.1|  DELLA protein RHT1                                     244   3e-73   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009413642.1|  PREDICTED: DELLA protein SLR1-like                 244   5e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006400288.1|  hypothetical protein EUTSA_v100155351mg            240   7e-73   
ref|XP_009390245.1|  PREDICTED: DELLA protein SLR1-like                 243   2e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008644580.1|  PREDICTED: DELLA protein DWARF8-like               243   2e-72   
ref|XP_009380281.1|  PREDICTED: DELLA protein SLN1-like                 241   6e-72   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY55037.1|  BnaCnng28010D                                          239   8e-72   Brassica napus [oilseed rape]
ref|XP_003538395.1|  PREDICTED: DELLA protein GAI1                      241   9e-72   Glycine max [soybeans]
ref|XP_008809806.1|  PREDICTED: DELLA protein SLR1                      241   1e-71   Phoenix dactylifera
ref|XP_006408301.1|  hypothetical protein EUTSA_v10020431mg             239   2e-71   Eutrema salsugineum [saltwater cress]
gb|EPS58722.1|  hypothetical protein M569_16090                         237   4e-71   Genlisea aurea
ref|NP_186995.1|  DELLA protein RGL2                                    238   4e-71   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC42642.1|  putative RGA1                                          238   4e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008782281.1|  PREDICTED: DELLA protein SLR1-like                 240   5e-71   Phoenix dactylifera
ref|NP_176809.1|  DELLA protein RGL1                                    236   7e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302161.1|  hypothetical protein CARUB_v10020171mg             236   8e-71   Capsella rubella
ref|XP_010420475.1|  PREDICTED: DELLA protein RGL3                      236   1e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010453948.1|  PREDICTED: DELLA protein RGL3-like                 236   1e-70   Camelina sativa [gold-of-pleasure]
emb|CDY70426.1|  BnaCnng68300D                                          236   1e-70   Brassica napus [oilseed rape]
gb|AGA16543.1|  DELLA protein RGL2                                      236   1e-70   Sisymbrium officinale
ref|XP_008457015.1|  PREDICTED: DELLA protein GAI-like                  237   1e-70   Cucumis melo [Oriental melon]
gb|AFC88482.1|  DELLA protein                                           237   2e-70   Rosa lucieae [memorial rose]
ref|XP_010492705.1|  PREDICTED: DELLA protein RGL3-like                 236   2e-70   
ref|NP_197251.1|  DELLA protein RGL3                                    235   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009127484.1|  PREDICTED: DELLA protein RGL1                      235   2e-70   Brassica rapa
gb|KFK38060.1|  hypothetical protein AALP_AA3G064800                    236   3e-70   Arabis alpina [alpine rockcress]
gb|AFN25700.1|  RGA-2                                                   223   3e-70   Pyrus pyrifolia [sha li]
ref|XP_010926472.1|  PREDICTED: DELLA protein SLR1-like                 238   3e-70   Elaeis guineensis
ref|XP_002887024.1|  hypothetical protein ARALYDRAFT_475738             234   4e-70   
ref|XP_002873832.1|  hypothetical protein ARALYDRAFT_488615             234   4e-70   
ref|XP_010511563.1|  PREDICTED: DELLA protein RGL1-like                 234   4e-70   Camelina sativa [gold-of-pleasure]
emb|CAA12242.1|  RGA-like                                               236   1e-69   Arabidopsis thaliana [mouse-ear cress]
gb|KFK41051.1|  hypothetical protein AALP_AA2G079000                    233   1e-69   Arabis alpina [alpine rockcress]
ref|XP_009130367.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    234   1e-69   Brassica rapa
gb|ADP02183.1|  Rht-D1b                                                 234   2e-69   Triticum aestivum [Canadian hard winter wheat]
gb|AAM15897.1|AF492580_1  GIA/RGA-like gibberellin response modul...    221   2e-69   Anisocarpus madioides
ref|XP_010470510.1|  PREDICTED: DELLA protein RGL1 isoform X1           233   2e-69   
gb|AGG68478.1|  DELLA protein                                           235   2e-69   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006391387.1|  hypothetical protein EUTSA_v10018436mg             232   3e-69   Eutrema salsugineum [saltwater cress]
ref|XP_006299072.1|  hypothetical protein CARUB_v10015212mg             233   3e-69   Capsella rubella
emb|CBW30290.1|  RHT-D1 protein                                         234   4e-69   Triticum aestivum [Canadian hard winter wheat]
gb|AGG68476.1|  DELLA protein                                           234   4e-69   Triticum aestivum [Canadian hard winter wheat]
emb|CBW30289.1|  RHT-D1 protein                                         234   4e-69   Triticum aestivum [Canadian hard winter wheat]
emb|CBW30288.1|  RHT-D1 protein                                         234   4e-69   Triticum aestivum [Canadian hard winter wheat]
gb|ADP02199.1|  Rht-D1a                                                 234   4e-69   Aegilops tauschii
sp|Q9ST59.1|RHT1_WHEAT  RecName: Full=DELLA protein RHT-1; AltNam...    234   4e-69   Triticum aestivum [Canadian hard winter wheat]
emb|CBW30291.1|  RHT-D1 protein                                         234   4e-69   Triticum aestivum [Canadian hard winter wheat]
gb|KFK25966.1|  hypothetical protein AALP_AA8G186200                    231   5e-69   Arabis alpina [alpine rockcress]
gb|AFN25701.1|  RGL2-1                                                  220   5e-69   Pyrus pyrifolia [sha li]
ref|XP_010415179.1|  PREDICTED: DELLA protein RGL1-like                 231   5e-69   Camelina sativa [gold-of-pleasure]
emb|CDY16915.1|  BnaC09g40420D                                          231   8e-69   Brassica napus [oilseed rape]
ref|XP_009107522.1|  PREDICTED: DELLA protein RGL3                      231   8e-69   Brassica rapa
ref|XP_006289966.1|  hypothetical protein CARUB_v10003592mg             231   8e-69   Capsella rubella
emb|CDY38434.1|  BnaA10g17240D                                          231   9e-69   Brassica napus [oilseed rape]
emb|CCG14222.1|  gibberellin DELLA protein                              231   3e-68   Cucumis sativus [cucumbers]
gb|AAM15895.1|AF492578_1  GIA/RGA-like gibberellin response modul...    230   4e-68   Calycadenia multiglandulosa
ref|XP_010549753.1|  PREDICTED: DELLA protein RGL2 isoform X1           230   4e-68   Tarenaya hassleriana [spider flower]
ref|XP_004145854.1|  PREDICTED: DELLA protein GAI-like                  230   4e-68   Cucumis sativus [cucumbers]
ref|XP_010463795.1|  PREDICTED: DELLA protein RGL2-like                 228   3e-67   Camelina sativa [gold-of-pleasure]
ref|XP_007141902.1|  hypothetical protein PHAVU_008G235500g             227   4e-67   Phaseolus vulgaris [French bean]
ref|XP_010558681.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    226   8e-67   Tarenaya hassleriana [spider flower]
ref|XP_009409625.1|  PREDICTED: DELLA protein SLR1-like                 228   1e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010510814.1|  PREDICTED: DELLA protein RGL2 isoform X1           226   1e-66   
ref|XP_010510942.1|  PREDICTED: DELLA protein RGL2 isoform X3           226   1e-66   
ref|XP_009114228.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    226   2e-66   Brassica rapa
gb|AAM15889.1|AF492571_1  GIA/RGA-like gibberellin response modul...    225   3e-66   Argyroxiphium sandwicense subsp. macrocephalum
gb|AAM15885.1|  GIA/RGA-like gibberellin response modulator             225   3e-66   Dubautia raillardioides
gb|AAM15884.1|AF492566_1  GIA/RGA-like gibberellin response modul...    225   3e-66   Dubautia menziesii
gb|AAM15883.1|AF492565_1  GIA/RGA-like gibberellin response modul...    225   3e-66   Dubautia ciliolata subsp. glutinosa
gb|AAM15881.1|AF492563_1  GIA/RGA-like gibberellin response modul...    225   3e-66   Dubautia arborea
gb|AAM15880.1|AF492562_1  GIA/RGA-like gibberellin response modul...    225   3e-66   Dubautia arborea
gb|AAM15882.1|AF492564_1  GIA/RGA-like gibberellin response modul...    224   4e-66   Dubautia ciliolata subsp. glutinosa
gb|AAM15890.1|AF492572_1  GIA/RGA-like gibberellin response modul...    224   4e-66   
gb|AAM15900.1|AF492583_1  GIA/RGA-like gibberellin response modul...    224   6e-66   
gb|AAM15901.1|AF492584_1  GIA/RGA-like gibberellin response modul...    224   6e-66   
gb|AAM15891.1|AF492573_1  GIA/RGA-like gibberellin response modul...    223   2e-65   
gb|AAM15906.1|AF492589_1  GIA/RGA-like gibberellin response modul...    223   2e-65   
gb|AAM15888.1|AF492570_1  GIA/RGA-like gibberellin response modul...    223   2e-65   
gb|ABL97942.1|  GAI-like protein 1                                      214   3e-65   
gb|AAM15907.1|AF492590_1  GIA/RGA-like gibberellin response modul...    222   3e-65   
gb|AAM15903.1|AF492586_1  GIA/RGA-like gibberellin response modul...    222   3e-65   
gb|AAM15886.1|AF492568_1  GIA/RGA-like gibberellin response modul...    222   3e-65   
gb|AAM15899.1|AF492582_1  GIA/RGA-like gibberellin response modul...    222   3e-65   
gb|AAM15904.1|AF492587_1  GIA/RGA-like gibberellin response modul...    222   3e-65   
gb|AAM15898.1|AF492581_1  GIA/RGA-like gibberellin response modul...    222   4e-65   
gb|AAM78198.1|  putative RGA1 protein                                   209   8e-65   
gb|AAM15892.1|AF492575_1  GIA/RGA-like gibberellin response modul...    221   9e-65   
gb|ABL97900.1|  GAI-like protein 1                                      213   9e-65   
gb|ABL97941.1|  GAI-like protein 1                                      220   1e-64   
gb|AAM78197.1|  putative RGA1 protein                                   208   2e-64   
ref|XP_007033025.1|  GRAS family transcription factor family protein    223   2e-64   
gb|AAM78194.1|  putative RGA1 protein                                   207   5e-64   
gb|ABL97899.1|  GAI-like protein 1                                      212   6e-64   
gb|AAM15893.1|AF492576_1  GIA/RGA-like gibberellin response modul...    219   7e-64   
gb|AAM15905.1|AF492588_1  GIA/RGA-like gibberellin response modul...    218   1e-63   
ref|XP_006292324.1|  hypothetical protein CARUB_v10018534mg             220   2e-63   
gb|AET82136.1|  hypothetical protein                                    206   2e-63   
gb|ABL97939.1|  GAI-like protein 1                                      209   2e-63   
gb|AEW07596.1|  hypothetical protein 0_6323_02                          206   2e-63   
gb|ABL97898.1|  GAI-like protein 1                                      213   3e-63   
gb|ABL97872.1|  GAI-like protein 1                                      209   5e-63   
gb|ABL97887.1|  GAI-like protein 1                                      207   6e-63   
gb|AHW42471.1|  DPL                                                     219   6e-63   
gb|ABL97914.1|  GAI-like protein 1                                      208   7e-63   
dbj|BAP05438.1|  GAI1-like E3 ubiquitin ligase protein                  216   8e-63   
gb|ABL97902.1|  GAI-like protein 1                                      213   2e-62   
gb|ABL97843.1|  GAI-like protein 1                                      207   3e-62   
gb|AJC52500.1|  SCL14                                                   202   3e-62   
gb|ABL97901.1|  GAI-like protein 1                                      213   4e-62   
gb|ABL97864.1|  GAI-like protein 1                                      205   9e-62   
gb|ABL97862.1|  GAI-like protein 1                                      212   1e-61   
gb|ABL97861.1|  GAI-like protein 1                                      212   1e-61   
gb|ABL97869.1|  GAI-like protein 1                                      211   2e-61   
gb|ABL97874.1|  GAI-like protein 1                                      211   2e-61   
gb|ABL97873.1|  GAI-like protein 1                                      211   2e-61   
gb|ABL97860.1|  GAI-like protein 1                                      212   2e-61   
gb|ABL97845.1|  GAI-like protein 1                                      211   3e-61   
gb|ABL97842.1|  GAI-like protein 1                                      211   3e-61   
gb|ABL97844.1|  GAI-like protein 1                                      211   3e-61   
gb|ABL97930.1|  GAI-like protein 1                                      211   3e-61   
gb|ABL97934.1|  GAI-like protein 1                                      211   3e-61   
gb|ABL97852.1|  GAI-like protein 1                                      211   4e-61   
gb|ABL97928.1|  GAI-like protein 1                                      211   4e-61   
gb|ABL97938.1|  GAI-like protein 1                                      211   4e-61   
gb|ABL97909.1|  GAI-like protein 1                                      211   4e-61   
gb|ABL97903.1|  GAI-like protein 1                                      210   5e-61   
gb|ABL97931.1|  GAI-like protein 1                                      209   5e-61   
gb|ABL97886.1|  GAI-like protein 1                                      210   6e-61   
gb|ABL97857.1|  GAI-like protein 1                                      210   7e-61   
gb|ACV52013.1|  GAI/RGA-like 3-a                                        211   8e-61   
gb|ACV52014.1|  GAI/RGA-like 3-b                                        211   8e-61   
gb|ABL97897.1|  GAI-like protein 1                                      209   9e-61   
gb|ABL97840.1|  GAI-like protein 1                                      209   9e-61   
gb|ABL97879.1|  GAI-like protein 1                                      209   1e-60   
gb|AHB17748.1|  GA repressor DELLA                                      209   2e-60   
gb|ABL97854.1|  GAI-like protein 1                                      208   2e-60   
gb|ABL97856.1|  GAI-like protein 1                                      201   3e-60   
gb|KJB54121.1|  hypothetical protein B456_009G021700                    209   3e-60   
gb|ABL97940.1|  GAI-like protein 1                                      208   3e-60   
gb|ABL97882.1|  GAI-like protein 1                                      208   3e-60   
gb|ABL97912.1|  GAI-like protein 1                                      208   3e-60   
gb|AAY56754.1|  DELLA protein                                           209   3e-60   
ref|XP_008343960.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    209   3e-60   
gb|ABL97841.1|  GAI-like protein 1                                      208   4e-60   
gb|ABL97932.1|  GAI-like protein 1                                      207   4e-60   
gb|ABL97870.1|  GAI-like protein 1                                      208   4e-60   
gb|ABL97880.1|  GAI-like protein 1                                      208   4e-60   
ref|XP_009371410.1|  PREDICTED: DELLA protein GAI-like                  209   4e-60   
gb|ABL97871.1|  GAI-like protein 1                                      201   5e-60   
gb|ABL97933.1|  GAI-like protein 1                                      207   5e-60   
ref|XP_004287380.1|  PREDICTED: DELLA protein GAI-like                  208   6e-60   
gb|ABL97839.1|  GAI-like protein 1                                      207   1e-59   
gb|ABL97885.1|  GAI-like protein 1                                      200   1e-59   
gb|ABL97936.1|  GAI-like protein 1                                      206   2e-59   
gb|ABL97849.1|  GAI-like protein 1                                      206   2e-59   
gb|ABL97884.1|  GAI-like protein 1                                      206   2e-59   
gb|ADQ47622.1|  GAI-like protein 1                                      199   3e-59   
gb|ABL97910.1|  GAI-like protein 1                                      206   3e-59   
gb|ABL97877.1|  GAI-like protein 1                                      205   3e-59   
gb|AHW42470.1|  RGA                                                     207   4e-59   
ref|XP_008390123.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    209   5e-59   
gb|ABL97876.1|  GAI-like protein 1                                      205   5e-59   
gb|ABL97846.1|  GAI-like protein 1                                      205   6e-59   
gb|ABL97935.1|  GAI-like protein 1                                      204   8e-59   
gb|KDP32341.1|  hypothetical protein JCGZ_13266                         206   8e-59   
gb|ABL97937.1|  GAI-like protein 1                                      204   8e-59   
gb|ABL97881.1|  GAI-like protein 1                                      201   8e-59   
gb|ABL97850.1|  GAI-like protein 1                                      197   1e-58   
ref|XP_002960248.1|  GRAS-family protein                                207   1e-58   
gb|ABL97865.1|  GAI-like protein 1                                      197   1e-58   
ref|XP_007203631.1|  hypothetical protein PRUPE_ppa003975mg             205   1e-58   
gb|ABL97913.1|  GAI-like protein 1                                      204   1e-58   
gb|ABL97858.1|  GAI-like protein 1                                      201   2e-58   
gb|ABL97859.1|  GAI-like protein 1                                      203   2e-58   
gb|ADQ47646.1|  GAI-like protein 1                                      200   2e-58   
ref|XP_004507626.1|  PREDICTED: DELLA protein RHT-1-like                203   3e-58   
gb|AAY56753.1|  DELLA protein                                           204   3e-58   
gb|ABL97908.1|  GAI-like protein 1                                      202   3e-58   
gb|ABL97878.1|  GAI-like protein 1                                      203   3e-58   
gb|ABL97926.1|  GAI-like protein 1                                      203   3e-58   
gb|ABL97925.1|  GAI-like protein 1                                      203   4e-58   
gb|AEX97112.1|  spur-type DELLA protein                                 203   4e-58   
ref|XP_008337344.1|  PREDICTED: DELLA protein GAI-like                  203   5e-58   
gb|AHB17747.1|  GA repressor DELLA                                      203   5e-58   
ref|XP_002529354.1|  DELLA protein GAI1, putative                       203   6e-58   
gb|ABL97911.1|  GAI-like protein 1                                      201   7e-58   
gb|ACR58457.1|  GAI/RGA-like protein                                    203   7e-58   
gb|ABL97922.1|  GAI-like protein 1                                      202   1e-57   
gb|ADQ47643.1|  GAI-like protein 1                                      198   1e-57   
gb|AGV54403.1|  DELLA protein DWARF8-like protein                       201   1e-57   
gb|ABL97868.1|  GAI-like protein 1                                      201   1e-57   
gb|ADQ47645.1|  GAI-like protein 1                                      198   1e-57   
ref|XP_003524001.1|  PREDICTED: DELLA protein DWARF8-like               201   1e-57   
ref|XP_003528281.1|  PREDICTED: DELLA protein SLR1-like                 201   1e-57   
ref|XP_007144131.1|  hypothetical protein PHAVU_007G131200g             201   1e-57   
gb|ADQ47621.1|  GAI-like protein 1                                      200   1e-57   
gb|ADQ47625.1|  GAI-like protein 1                                      200   2e-57   
gb|ADQ47629.1|  GAI-like protein 1                                      200   2e-57   
gb|ABL97924.1|  GAI-like protein 1                                      201   2e-57   
ref|XP_007013315.1|  GAI/RGA-like protein                               202   2e-57   
gb|ADQ47632.1|  GAI-like protein 1                                      200   2e-57   
gb|ADQ47631.1|  GAI-like protein 1                                      200   2e-57   
gb|ABL97894.1|  GAI-like protein 1                                      200   2e-57   
gb|ADQ47633.1|  GAI-like protein 1                                      200   2e-57   
gb|ADQ47626.1|  GAI-like protein 1                                      200   2e-57   
gb|ADQ47627.1|  GAI-like protein 1                                      200   3e-57   
gb|ADQ47616.1|  GAI-like protein 1                                      200   3e-57   
gb|ADQ47623.1|  GAI-like protein 1                                      200   3e-57   
gb|ADQ47617.1|  GAI-like protein 1                                      200   3e-57   
gb|ADQ47636.1|  GAI-like protein 1                                      200   3e-57   
gb|ADQ47635.1|  GAI-like protein 1                                      200   3e-57   
gb|ADQ47620.1|  GAI-like protein 1                                      200   3e-57   
gb|ADQ47615.1|  GAI-like protein 1                                      199   4e-57   
gb|ABU63411.1|  DELLA protein                                           201   4e-57   
gb|ADQ47644.1|  GAI-like protein 1                                      197   4e-57   
ref|XP_010249953.1|  PREDICTED: DELLA protein SLR1-like                 201   6e-57   
gb|ABL97867.1|  GAI-like protein 1                                      199   9e-57   
gb|ABL97863.1|  GAI-like protein 1                                      199   1e-56   
gb|ABL97920.1|  GAI-like protein 1                                      191   1e-56   
ref|XP_006589312.1|  PREDICTED: DELLA protein RGA-like                  198   1e-56   
gb|ADQ47618.1|  GAI-like protein 1                                      198   2e-56   
gb|ACR58456.1|  GAI/RGA-like protein                                    199   2e-56   
gb|ABL97929.1|  GAI-like protein 1                                      197   3e-56   
ref|XP_010925126.1|  PREDICTED: DELLA protein DWARF8-like               199   3e-56   
ref|XP_006475770.1|  PREDICTED: DELLA protein GAI-like                  198   4e-56   
ref|XP_006451026.1|  hypothetical protein CICLE_v10010825mg             198   4e-56   
ref|XP_003556343.1|  PREDICTED: DELLA protein GAI1-like                 196   6e-56   
gb|ABL97915.1|  GAI-like protein 1                                      197   7e-56   
gb|ABL97893.1|  GAI-like protein 1                                      196   7e-56   
ref|XP_010254273.1|  PREDICTED: DELLA protein GAI-like                  197   1e-55   
gb|ABL97918.1|  GAI-like protein 1                                      195   2e-55   
gb|ABL97927.1|  GAI-like protein 1                                      195   3e-55   
ref|XP_002284952.1|  PREDICTED: DELLA protein SLR1-like                 196   3e-55   
ref|XP_010049952.1|  PREDICTED: DELLA protein GAI-like                  196   3e-55   
gb|ABL97923.1|  GAI-like protein 1                                      195   4e-55   
ref|XP_008463334.1|  PREDICTED: DELLA protein SLR1-like                 195   6e-55   
gb|ABL97866.1|  GAI-like protein 1                                      194   6e-55   
emb|CCG14223.1|  gibberellin DELLA protein                              195   6e-55   
ref|XP_004161044.1|  PREDICTED: DELLA protein GAI-like                  195   7e-55   
dbj|BAQ20609.1|  GRAS-family protein 1                                  197   8e-55   
ref|XP_004146291.1|  PREDICTED: DELLA protein GAI-like                  194   1e-54   
gb|KJB64828.1|  hypothetical protein B456_010G067000                    193   1e-54   
ref|XP_001754090.1|  GAI1-like E3 ubiquitin ligase protein              194   1e-54   
gb|ABL97917.1|  GAI-like protein 1                                      193   2e-54   
gb|ACV52015.1|  GAI/RGA-like 4-a                                        193   2e-54   
emb|CBI28139.3|  unnamed protein product                                195   4e-54   
gb|ADQ47647.1|  GAI-like protein 1                                      189   4e-54   
gb|ADQ47613.1|  GAI-like protein 1                                      191   6e-54   
ref|XP_010916867.1|  PREDICTED: DELLA protein GAI-like                  193   9e-54   
gb|ABU63412.1|  DELLA protein                                           192   9e-54   
gb|ADO61620.1|  DELLA protein 2                                         181   1e-53   
gb|ADO61566.1|  DELLA protein 2                                         181   1e-53   
gb|ADO61532.1|  DELLA protein 2                                         181   1e-53   
ref|XP_008809331.1|  PREDICTED: DELLA protein RHT-1-like                192   1e-53   
gb|ADQ47611.1|  GAI-like protein 1                                      189   3e-53   
ref|XP_001774314.1|  AtGAI1 GRAS E3 ubiquitin ligase protein            190   7e-53   
ref|XP_008777332.1|  PREDICTED: DELLA protein GAI-like                  189   1e-52   
ref|XP_004249633.2|  PREDICTED: DELLA protein GAI-like                  188   2e-52   
ref|XP_006349517.1|  PREDICTED: DELLA protein GAI-like                  186   2e-52   
gb|ADQ47607.1|  GAI-like protein 1                                      187   2e-52   
gb|ADQ47608.1|  GAI-like protein 1                                      187   2e-52   
gb|ADO61535.1|  DELLA protein 2                                         177   2e-52   
gb|ADQ47648.1|  GAI-like protein 1                                      183   5e-52   
gb|ABL97853.1|  GAI-like protein 1                                      186   5e-52   
gb|ADQ47637.1|  GAI-like protein 1                                      185   7e-52   
ref|XP_009407441.1|  PREDICTED: DELLA protein GAI-like                  186   2e-51   
ref|XP_010688103.1|  PREDICTED: DELLA protein GAI1-like                 183   6e-51   
ref|XP_008242703.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    182   3e-50   
emb|CAN67929.1|  hypothetical protein VITISV_007904                     181   2e-49   
gb|EMT30471.1|  hypothetical protein F775_03572                         169   4e-49   
gb|ABL97904.1|  GAI-like protein 1                                      172   3e-47   
emb|CDM83536.1|  unnamed protein product                                174   4e-47   
gb|AAL10319.1|  DWARF8                                                  174   5e-47   
gb|AAL10303.1|  DWARF8                                                  174   6e-47   
gb|AAL10328.1|  DWARF8                                                  174   6e-47   
gb|AAL10382.1|  DWARF8                                                  174   6e-47   
gb|AAL10379.1|  DWARF8                                                  174   6e-47   
dbj|BAQ20610.1|  GRAS-family protein 2                                  176   6e-47   
gb|AAL10366.1|  DWARF8                                                  174   6e-47   
emb|CDY64837.1|  BnaC09g52270D                                          173   1e-46   
gb|AAL10325.1|  DWARF8                                                  172   2e-46   
gb|AAL10318.1|  DWARF8                                                  172   3e-46   
gb|AAL10302.1|  DWARF8                                                  172   3e-46   
gb|AAL10304.1|  DWARF8                                                  172   3e-46   
gb|AAL10348.1|  DWARF8                                                  172   3e-46   
gb|AAL10307.1|  DWARF8                                                  172   3e-46   
gb|AAL10331.1|  DWARF8                                                  172   3e-46   
gb|AAL10361.1|  DWARF8                                                  172   3e-46   
gb|AAL10376.1|  DWARF8                                                  172   4e-46   
gb|AAL10335.1|  DWARF8                                                  171   6e-46   
dbj|BAJ93346.1|  predicted protein                                      170   1e-45   
gb|AAR31213.1|  GAI protein                                             169   1e-45   
dbj|BAH01283.1|  unnamed protein product                                169   1e-45   



>ref|XP_009789076.1| PREDICTED: DELLA protein GAI1-like [Nicotiana sylvestris]
Length=587

 Score =   291 bits (745),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 147/163 (90%), Gaps = 1/163 (1%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAAS-EG  495
            PG  EKVLS V+D+KPEI T+VEQEANHNGPVFMDRFTESLHYYSTLFDSLEGC +  E 
Sbjct  425  PGGIEKVLSFVKDLKPEIFTIVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCGSGGEL  484

Query  494  GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYK  315
            G V DQDK+MSEVYLGRQICN+V+CEGVDRVERHETLAQWRTRF SAGF  VHLGSNA+K
Sbjct  485  GPVSDQDKLMSEVYLGRQICNLVSCEGVDRVERHETLAQWRTRFNSAGFEPVHLGSNAFK  544

Query  314  QASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            QASMLLALFAGG GY+VEEN+G L LGWHTRPLIATSAWKL+S
Sbjct  545  QASMLLALFAGGGGYKVEENNGCLMLGWHTRPLIATSAWKLSS  587



>emb|CDP00805.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   280 bits (716),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 146/161 (91%), Gaps = 3/161 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLS V+++KPEI+TVVEQEANHNGPVF+DRFTESLHYYSTLFDSLEGC +    
Sbjct  248  PGAIEKVLSAVKELKPEILTVVEQEANHNGPVFLDRFTESLHYYSTLFDSLEGCGSG---  304

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
               + DKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRF SAGF AVHLGSNA+KQ
Sbjct  305  GGGNGDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFGSAGFEAVHLGSNAFKQ  364

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  189
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAWKL+
Sbjct  365  ASMLLALFAGGDGYRVEENNGSLMLGWHTRPLIATSAWKLS  405



>gb|AFN25699.1| RGA-1, partial [Pyrus pyrifolia]
Length=171

 Score =   272 bits (695),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 137/159 (86%), Gaps = 7/159 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG A S   
Sbjct  11   PGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEGSANS---  67

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                +DKVMSEVYLG+QICNVVACEGVDRVERHE L QWR RF SA F  VHLGSNA+KQ
Sbjct  68   ----RDKVMSEVYLGKQICNVVACEGVDRVERHEKLTQWRARFGSADFVPVHLGSNAFKQ  123

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  195
            ASMLLALFAGGDGYRVEENDG + L WHTRPLIATSAWK
Sbjct  124  ASMLLALFAGGDGYRVEENDGCMMLAWHTRPLIATSAWK  162



>ref|XP_011070609.1| PREDICTED: DELLA protein GAI1 [Sesamum indicum]
Length=569

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 145/164 (88%), Gaps = 3/164 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL VV+++KPEI+TVVEQEANHNG VF+DRFTESLHYYSTLFDSLE C     G
Sbjct  406  PGAIEKVLKVVRELKPEILTVVEQEANHNGNVFLDRFTESLHYYSTLFDSLESCGGGSNG  465

Query  491  A---VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNA  321
            +   V DQDKVMSEVYLGRQICNVVACEG DRVERHETLAQWR+RF SAGF  VHLGSNA
Sbjct  466  SDGVVSDQDKVMSEVYLGRQICNVVACEGADRVERHETLAQWRSRFGSAGFVPVHLGSNA  525

Query  320  YKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  189
            YKQASMLLALFAGGDGYRV+EN+G L LGWHTRPLIATSAWKL+
Sbjct  526  YKQASMLLALFAGGDGYRVDENNGCLMLGWHTRPLIATSAWKLS  569



>gb|AFN25702.1| RGL2-2, partial [Pyrus pyrifolia]
Length=158

 Score =   268 bits (685),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 136/156 (87%), Gaps = 7/156 (4%)
 Frame = -1

Query  653  VLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGAVCDQD  474
            VLSVV+ MKPEI+TVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG A S       QD
Sbjct  1    VLSVVKQMKPEILTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEGSANS-------QD  53

Query  473  KVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQASMLLA  294
            KVMSEVYLG+QICNVVACEG+DRVERHETL QWR RF SA F  VHLGSNA+KQASMLLA
Sbjct  54   KVMSEVYLGKQICNVVACEGLDRVERHETLTQWRARFDSADFVPVHLGSNAFKQASMLLA  113

Query  293  LFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            LFAGGDGYRVEENDG L LGWHTRPLIATSAWK +S
Sbjct  114  LFAGGDGYRVEENDGCLMLGWHTRPLIATSAWKASS  149



>ref|XP_007225630.1| hypothetical protein PRUPE_ppa005944mg [Prunus persica]
 gb|EMJ26829.1| hypothetical protein PRUPE_ppa005944mg [Prunus persica]
Length=436

 Score =   276 bits (707),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 138/159 (87%), Gaps = 7/159 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG       
Sbjct  276  PGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEG-------  328

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            +V  QDK MSE+YLG+QICNVVACEGVDRVERHETL QWRTR  S GF  VHLGSNA+KQ
Sbjct  329  SVNSQDKAMSELYLGKQICNVVACEGVDRVERHETLTQWRTRLDSGGFVPVHLGSNAFKQ  388

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  195
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAWK
Sbjct  389  ASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWK  427



>ref|XP_002312450.2| hypothetical protein POPTR_0008s13090g [Populus trichocarpa]
 gb|EEE89817.2| hypothetical protein POPTR_0008s13090g [Populus trichocarpa]
Length=600

 Score =   281 bits (719),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 143/162 (88%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ MKPEIVTVVEQEANHNGP+F+DRFTESLHYYSTLFDSLEG       
Sbjct  438  PGAIEKVLSVVKQMKPEIVTVVEQEANHNGPIFLDRFTESLHYYSTLFDSLEG-------  490

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            +V  QDK+MSEVYLG+QICNVVACEG DRVERHETL QWRTR  SAGF+ VHLGSNA+KQ
Sbjct  491  SVSTQDKIMSEVYLGKQICNVVACEGPDRVERHETLTQWRTRLGSAGFAPVHLGSNAFKQ  550

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L +
Sbjct  551  ASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWRLNT  592



>gb|KDP38079.1| hypothetical protein JCGZ_04722 [Jatropha curcas]
Length=623

 Score =   281 bits (719),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 144/162 (89%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ MKPEIVT+VEQEANHNGPVF+DRFTESLHYYSTLFDSLEG A++   
Sbjct  468  PGAIEKVLSVVKQMKPEIVTIVEQEANHNGPVFLDRFTESLHYYSTLFDSLEGSAST---  524

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICNVVACEG DRVERHETL QWRTR  S+GF  VHLGSNA+KQ
Sbjct  525  ----QDKVMSEVYLGKQICNVVACEGADRVERHETLTQWRTRLGSSGFVPVHLGSNAFKQ  580

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G LTLGWHTRPLIATSAW++ +
Sbjct  581  ASMLLALFAGGDGYRVEENNGCLTLGWHTRPLIATSAWRVVN  622



>gb|AEX97109.1| spur-type DELLA protein [Malus domestica]
Length=635

 Score =   281 bits (719),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 141/162 (87%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ MKPEI+TVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG A S   
Sbjct  475  PGAIEKVLSVVKQMKPEILTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEGSANS---  531

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICNVVACEG+DRVERHETL QWR RF SA F  VHLGSNA+KQ
Sbjct  532  ----QDKVMSEVYLGKQICNVVACEGLDRVERHETLTQWRARFDSADFVPVHLGSNAFKQ  587

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAWK +S
Sbjct  588  ASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWKPSS  629



>gb|ADH53778.1| GAI2 [Malus domestica]
Length=636

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 141/162 (87%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG A S   
Sbjct  476  PGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEGSANS---  532

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                +DKVMSEVYLG+QICNVVACEGVDRVERHETLAQWR RF SA F  VHLGSNA+KQ
Sbjct  533  ----RDKVMSEVYLGKQICNVVACEGVDRVERHETLAQWRARFGSADFVPVHLGSNAFKQ  588

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEENDG + L WHTRPLIATSAWK +S
Sbjct  589  ASMLLALFAGGDGYRVEENDGCMMLAWHTRPLIATSAWKPSS  630



>gb|ACL68359.1| DELLA protein [Malus baccata var. xiaojinensis]
Length=636

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 141/162 (87%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG A S   
Sbjct  476  PGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEGSANS---  532

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                +DKVMSEVYLG+QICNVVACEGVDRVERHETLAQWR RF SA F  VHLGSNA+KQ
Sbjct  533  ----RDKVMSEVYLGKQICNVVACEGVDRVERHETLAQWRARFGSADFVPVHLGSNAFKQ  588

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEENDG + L WHTRPLIATSAWK +S
Sbjct  589  ASMLLALFAGGDGYRVEENDGCMMLAWHTRPLIATSAWKPSS  630



>gb|AAY56752.1| DELLA protein [Malus domestica]
Length=635

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 139/159 (87%), Gaps = 7/159 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ MKPEI+TVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG A S   
Sbjct  475  PGAIEKVLSVVKQMKPEILTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEGSANS---  531

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICNVVACEG+DRVERHETL QWR RF SA F  VHLGSNA+KQ
Sbjct  532  ----QDKVMSEVYLGKQICNVVACEGLDRVERHETLTQWRARFDSADFVPVHLGSNAFKQ  587

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  195
            ASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAWK
Sbjct  588  ASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWK  626



>gb|ADW85805.1| DELLA protein [Malus domestica]
Length=635

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 139/159 (87%), Gaps = 7/159 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ MKPEI+TVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG A S   
Sbjct  475  PGAIEKVLSVVKQMKPEILTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEGSANS---  531

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICNVVACEG+DRVERHETL QWR RF SA F  VHLGSNA+KQ
Sbjct  532  ----QDKVMSEVYLGKQICNVVACEGLDRVERHETLTQWRARFDSADFVPVHLGSNAFKQ  587

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  195
            ASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAWK
Sbjct  588  ASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWK  626



>gb|AHB17744.1| GA repressor DELLA [Actinidia deliciosa]
Length=550

 Score =   277 bits (709),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 143/163 (88%), Gaps = 3/163 (2%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEG--  495
            G  EKVLS V++MKPEIVTVVEQE NHNGPVF+DRFTE+LHYYSTLFDSLEGC   E   
Sbjct  388  GGIEKVLSAVKEMKPEIVTVVEQEVNHNGPVFLDRFTEALHYYSTLFDSLEGCGGGESPS  447

Query  494  -GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAY  318
              AV +QDKVM+E+YLGRQICNVVAC+G DRVERHETLAQWR+RF S+GF  VHLGSNA+
Sbjct  448  PSAVSNQDKVMTEMYLGRQICNVVACDGPDRVERHETLAQWRSRFASSGFEPVHLGSNAF  507

Query  317  KQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  189
            KQASMLLALF GGDGY+VEEN G LTLGWHTRPLIATSAWKL+
Sbjct  508  KQASMLLALFNGGDGYKVEENGGCLTLGWHTRPLIATSAWKLS  550



>ref|XP_004298516.1| PREDICTED: DELLA protein GAIP [Fragaria vesca subsp. vesca]
Length=611

 Score =   279 bits (713),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 142/160 (89%), Gaps = 7/160 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ MKPEIVTVVEQEANHNGPVF++RF ESLHYYSTLFDSLEG       
Sbjct  451  PGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFLNRFNESLHYYSTLFDSLEG-------  503

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            +V  QDK+MSEVYLG+QI NVVACEGV+RVERHETLAQWRTRF  +GF+ VHLGSNA+KQ
Sbjct  504  SVNSQDKMMSEVYLGKQIFNVVACEGVERVERHETLAQWRTRFDKSGFTPVHLGSNAFKQ  563

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            ASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAWKL
Sbjct  564  ASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWKL  603



>ref|XP_008221422.1| PREDICTED: DELLA protein GAIP-B [Prunus mume]
Length=633

 Score =   279 bits (714),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 139/159 (87%), Gaps = 7/159 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG       
Sbjct  473  PGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEG-------  525

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            +V  QDK MSE+YLG+QICNVVACEGVDRVERHETL QWRTR  SAGF  VHLGSNA+KQ
Sbjct  526  SVNSQDKAMSELYLGKQICNVVACEGVDRVERHETLTQWRTRLDSAGFVPVHLGSNAFKQ  585

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  195
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAWK
Sbjct  586  ASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWK  624



>ref|XP_002314799.2| hypothetical protein POPTR_0010s12080g [Populus trichocarpa]
 gb|EEF00970.2| hypothetical protein POPTR_0010s12080g [Populus trichocarpa]
Length=602

 Score =   278 bits (711),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 147/175 (84%), Gaps = 13/175 (7%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA +KVLSVV+ MKPEIVTVVEQEANHNGPVF+DRFTESLHYYSTLFDSLEG       
Sbjct  440  PGAMKKVLSVVKQMKPEIVTVVEQEANHNGPVFLDRFTESLHYYSTLFDSLEG-------  492

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            +V  QDKVMSEVYL +QICNVVACEG  RVERHETL QWRTR  SAGF+ VHLGSNA+KQ
Sbjct  493  SVSTQDKVMSEVYLAKQICNVVACEGSSRVERHETLTQWRTRLSSAGFAPVHLGSNAFKQ  552

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS*LTESDHGAIGGS  147
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW++      ++H  +GG+
Sbjct  553  ASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWRV------NNHHPVGGA  601



>ref|XP_011023720.1| PREDICTED: DELLA protein GAIP-B-like [Populus euphratica]
Length=602

 Score =   278 bits (710),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 142/162 (88%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ MKPEIVTVVEQEANHNGP+F+DRFTESLHYYSTLFDSLEG       
Sbjct  440  PGAIEKVLSVVKQMKPEIVTVVEQEANHNGPIFLDRFTESLHYYSTLFDSLEG-------  492

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            +V  QDK+MSE YLG+QICNVVACEG DRVERHETL QWRTR  SAGF+ VHLGSNA+KQ
Sbjct  493  SVSTQDKMMSEEYLGKQICNVVACEGPDRVERHETLTQWRTRLGSAGFAPVHLGSNAFKQ  552

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L +
Sbjct  553  ASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWRLNT  594



>gb|AAY56751.1| DELLA protein [Malus domestica]
Length=639

 Score =   279 bits (713),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 139/159 (87%), Gaps = 7/159 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG A S   
Sbjct  476  PGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEGSANS---  532

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                +DKVMSEVYLG+QICNVVACEGVDRVERHETLAQWR RF SA F  VHLGSNA+KQ
Sbjct  533  ----RDKVMSEVYLGKQICNVVACEGVDRVERHETLAQWRARFGSADFVPVHLGSNAFKQ  588

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  195
            ASMLLALFAGGDGYRVEENDG + L WHTRPLIATSAWK
Sbjct  589  ASMLLALFAGGDGYRVEENDGCMMLAWHTRPLIATSAWK  627



>gb|ACL68360.1| DELLA protein [Malus domestica]
Length=636

 Score =   278 bits (712),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 139/159 (87%), Gaps = 7/159 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG A S   
Sbjct  476  PGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEGSANS---  532

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                +DKVMSEVYLG+QICNVVACEGVDRVERHETLAQWR RF SA F  VHLGSNA+KQ
Sbjct  533  ----RDKVMSEVYLGKQICNVVACEGVDRVERHETLAQWRARFGSADFVPVHLGSNAFKQ  588

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  195
            ASMLLALFAGGDGYRVEENDG + L WHTRPLIATSAWK
Sbjct  589  ASMLLALFAGGDGYRVEENDGCMMLAWHTRPLIATSAWK  627



>gb|ABL61270.1| GAI1 [Malus hupehensis]
Length=638

 Score =   278 bits (712),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 139/159 (87%), Gaps = 7/159 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG A S   
Sbjct  475  PGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEGSANS---  531

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                +DKVMSEVYLG+QICNVVACEGVDRVERHETLAQWR RF SA F  VHLGSNA+KQ
Sbjct  532  ----RDKVMSEVYLGKQICNVVACEGVDRVERHETLAQWRARFGSADFVPVHLGSNAFKQ  587

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  195
            ASMLLALFAGGDGYRVEENDG + L WHTRPLIATSAWK
Sbjct  588  ASMLLALFAGGDGYRVEENDGCMMLAWHTRPLIATSAWK  626



>gb|AGK07287.1| GAI1 [Rosa hybrid cultivar]
Length=618

 Score =   278 bits (710),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 142/160 (89%), Gaps = 7/160 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA +KVLSVV+ MKPEIVTVVEQEANHNGPVF+DRF ESLHYYSTLFDSLEG       
Sbjct  458  PGAIDKVLSVVKQMKPEIVTVVEQEANHNGPVFLDRFNESLHYYSTLFDSLEG-------  510

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            +V  QDK+MSEVYLG+QI NVVACEG DRVERHETLAQWRTRF ++GF+ VHLGSNA+KQ
Sbjct  511  SVNSQDKMMSEVYLGKQIFNVVACEGPDRVERHETLAQWRTRFDASGFAPVHLGSNAFKQ  570

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            ASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAWKL
Sbjct  571  ASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWKL  610



>ref|XP_002527794.1| DELLA protein GAIP-B, putative [Ricinus communis]
 gb|EEF34604.1| DELLA protein GAIP-B, putative [Ricinus communis]
Length=609

 Score =   277 bits (709),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 142/162 (88%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA +KVLSVV+ MKPEIVT+VEQEANHNGPVF+DRFTESLHYYSTLFDSLEG       
Sbjct  448  PGAIDKVLSVVKQMKPEIVTIVEQEANHNGPVFLDRFTESLHYYSTLFDSLEG-------  500

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            +V  QDKVMSEVYLG+QICNVVACEG DRVERHETL QWRTR   AGF+ VHLGSNA+KQ
Sbjct  501  SVSTQDKVMSEVYLGKQICNVVACEGADRVERHETLTQWRTRLGLAGFAPVHLGSNAFKQ  560

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRV+EN+G L LGWHTRPLIATSAW+L S
Sbjct  561  ASMLLALFAGGDGYRVDENNGCLMLGWHTRPLIATSAWRLAS  602



>ref|XP_010264458.1| PREDICTED: DELLA protein GAI1 [Nelumbo nucifera]
Length=610

 Score =   277 bits (709),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 143/162 (88%), Gaps = 3/162 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLS +++MKP+IVT+VEQEANHNGPVF+DRFTE+LHYYSTLFDSLEGCA S   
Sbjct  442  PGAIEKVLSSIKEMKPKIVTIVEQEANHNGPVFLDRFTEALHYYSTLFDSLEGCAMSPPN  501

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            +   QD+VMSE+YLGRQICNVVACEGVDRVERHE L QWR R  S+GFS VHLG NA+KQ
Sbjct  502  S---QDQVMSELYLGRQICNVVACEGVDRVERHEALTQWRNRLGSSGFSPVHLGFNAFKQ  558

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L S
Sbjct  559  ASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLAS  600



>gb|AHB17742.1| GA repressor DELLA [Actinidia deliciosa]
Length=551

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 143/164 (87%), Gaps = 4/164 (2%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEG--  495
            G  EKVLS V++MKP+IVTVVEQEANHNGPVF+DRFTE+LHYYSTLFDSLEGC    G  
Sbjct  388  GGIEKVLSAVKEMKPQIVTVVEQEANHNGPVFLDRFTEALHYYSTLFDSLEGCGGGSGLP  447

Query  494  --GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNA  321
               AV +QDK M+E+YLGRQICNVVAC+G DRVERHETL+QWRTRF S+GF  VHLGSNA
Sbjct  448  SPSAVSNQDKAMTEMYLGRQICNVVACDGPDRVERHETLSQWRTRFGSSGFEPVHLGSNA  507

Query  320  YKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  189
            +KQASMLLALF GGDGY+VEEN G LTLGWHTRPLIATSAWKL+
Sbjct  508  FKQASMLLALFNGGDGYKVEENGGCLTLGWHTRPLIATSAWKLS  551



>gb|AFP58844.1| DELLA domain GRAS family transcription factor GAI [Populus tomentosa]
Length=603

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 147/175 (84%), Gaps = 13/175 (7%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG  +KVLSVV+ MKPEIVTVVEQEANHNGPVF+DRFTESLHYYSTLFDSLEG A++   
Sbjct  441  PGDMKKVLSVVKQMKPEIVTVVEQEANHNGPVFLDRFTESLHYYSTLFDSLEGSAST---  497

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYL +QICNVVACEG  RVERHETL QWRTR  SAGF+ VHLGSNA+KQ
Sbjct  498  ----QDKVMSEVYLAKQICNVVACEGPSRVERHETLTQWRTRLSSAGFAPVHLGSNAFKQ  553

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS*LTESDHGAIGGS  147
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW++      ++H  +GG+
Sbjct  554  ASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWRV------NNHHPVGGA  602



>ref|XP_009351505.1| PREDICTED: DELLA protein GAI-like [Pyrus x bretschneideri]
Length=634

 Score =   277 bits (708),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 138/159 (87%), Gaps = 7/159 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG A S   
Sbjct  474  PGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEGSANS---  530

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                +DKVMSEVYLG+QICNVVACEGVDRVERHETL QWR RF SA F  VHLGSNA+KQ
Sbjct  531  ----RDKVMSEVYLGKQICNVVACEGVDRVERHETLTQWRARFGSADFVPVHLGSNAFKQ  586

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  195
            ASMLLALFAGGDGYRVEENDG + L WHTRPLIATSAWK
Sbjct  587  ASMLLALFAGGDGYRVEENDGCMMLAWHTRPLIATSAWK  625



>gb|ADA84480.1| GRAS [Antirrhinum majus]
Length=528

 Score =   274 bits (701),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            GA EKVL VV+++KPEI+TVVEQEANHNG  F+DRFTESLHYYSTLFDSLE C     G 
Sbjct  368  GAIEKVLGVVRELKPEILTVVEQEANHNGVAFLDRFTESLHYYSTLFDSLESCGGGVEGG  427

Query  488  V-CDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            V  DQDKVMSEVYLGRQICNVVACEGVDRVERHE+L QWRTRF  AGF  VHLGSNAYKQ
Sbjct  428  VVSDQDKVMSEVYLGRQICNVVACEGVDRVERHESLVQWRTRFNGAGFKPVHLGSNAYKQ  487

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  195
            ASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAW+
Sbjct  488  ASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWR  526



>ref|XP_009349514.1| PREDICTED: DELLA protein GAI-like [Pyrus x bretschneideri]
Length=634

 Score =   276 bits (707),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 138/159 (87%), Gaps = 7/159 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG A S   
Sbjct  474  PGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEGSANS---  530

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                +DKVMSEVYLG+QICNVVACEGVDRVERHETL QWR RF SA F  VHLGSNA+KQ
Sbjct  531  ----RDKVMSEVYLGKQICNVVACEGVDRVERHETLTQWRARFGSADFVPVHLGSNAFKQ  586

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  195
            ASMLLALFAGGDGYRVEENDG + L WHTRPLIATSAWK
Sbjct  587  ASMLLALFAGGDGYRVEENDGCMMLAWHTRPLIATSAWK  625



>ref|XP_011038614.1| PREDICTED: DELLA protein GAIP [Populus euphratica]
Length=602

 Score =   276 bits (705),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 145/175 (83%), Gaps = 13/175 (7%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA  KVLSVV+ MKPEIVTVVEQEANHNGPVF+DRFTESLHYYSTLFDSLEG       
Sbjct  440  PGAMRKVLSVVKQMKPEIVTVVEQEANHNGPVFLDRFTESLHYYSTLFDSLEG-------  492

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            +V  QDKVMSEVYL +QICNVVACEG  RVERHETL QWRTR  SAGF+ VHLGSNA+KQ
Sbjct  493  SVSTQDKVMSEVYLAKQICNVVACEGPSRVERHETLTQWRTRLGSAGFAPVHLGSNAFKQ  552

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS*LTESDHGAIGGS  147
            ASMLLALFAGGDGYRVEEN G L LGWHTRPLIATSAW++      ++H  +GG+
Sbjct  553  ASMLLALFAGGDGYRVEENSGCLMLGWHTRPLIATSAWRV------NNHHPVGGA  601



>gb|EYU30084.1| hypothetical protein MIMGU_mgv1a027121mg [Erythranthe guttata]
Length=588

 Score =   275 bits (703),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 141/161 (88%), Gaps = 6/161 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL VV+++KPEI+TVVEQEANHNG VF+DRFTESLHYYSTLFDSLE        
Sbjct  434  PGAVEKVLQVVRELKPEILTVVEQEANHNGAVFLDRFTESLHYYSTLFDSLEK------E  487

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            AV  QDKVM+EVYLGRQICNVVACEGVDRVERHETLAQWRTRF SAGF  VHLGSNAYKQ
Sbjct  488  AVSVQDKVMTEVYLGRQICNVVACEGVDRVERHETLAQWRTRFDSAGFVPVHLGSNAYKQ  547

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  189
            ASMLLALFAGGDGY VEEN G L LGWHTRPLIATSAWKL+
Sbjct  548  ASMLLALFAGGDGYMVEENGGCLMLGWHTRPLIATSAWKLS  588



>ref|XP_004504565.1| PREDICTED: DELLA protein GAI1-like [Cicer arietinum]
Length=537

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 140/162 (86%), Gaps = 6/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKV SV++ ++PEIVTVVEQEANHNGP F+DRFTESLHYYSTLFDSLEG +     
Sbjct  375  PGALEKVFSVIRQIRPEIVTVVEQEANHNGPAFLDRFTESLHYYSTLFDSLEGSS-----  429

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
             V  Q+K MSE+YLG+QICNVVACEG DRVERHETL QWR RF SAGFS VHLGSNA+KQ
Sbjct  430  -VEQQEKAMSEMYLGKQICNVVACEGTDRVERHETLNQWRNRFGSAGFSPVHLGSNAFKQ  488

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGY+VEENDG L LGWHTRPLIATSAWKL +
Sbjct  489  ASMLLALFAGGDGYKVEENDGCLMLGWHTRPLIATSAWKLAA  530



>gb|ABI34432.1| CRY [Pisum sativum]
Length=532

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 138/162 (85%), Gaps = 6/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKV SV++ ++PEIVTVVEQEANHNGP F+DRFTESLHYYSTLFDSLE        
Sbjct  370  PGALEKVFSVIRQIRPEIVTVVEQEANHNGPAFLDRFTESLHYYSTLFDSLESSL-----  424

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
             V  QDK MSEVYLG+QICNVVACEG DRVERHETL QWR RF SAGFS VHLGSNA+KQ
Sbjct  425  -VEPQDKAMSEVYLGKQICNVVACEGTDRVERHETLNQWRNRFGSAGFSPVHLGSNAFKQ  483

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGY+VEENDG L LGWHTRPLIATSAWKL +
Sbjct  484  ASMLLALFAGGDGYKVEENDGCLMLGWHTRPLIATSAWKLAA  525



>gb|AEK06229.1| GAI1 [Vitis vinifera]
Length=590

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 142/162 (88%), Gaps = 3/162 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG  E+VLS V+DMKP+IVT+VEQEANHNGPVF+DRFTESLHYYSTLFDSLEGC  S   
Sbjct  420  PGGIERVLSAVKDMKPDIVTIVEQEANHNGPVFLDRFTESLHYYSTLFDSLEGCGVS---  476

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
             V  QDK+MSEVYLG+QICNVVACEG +RVERHETLAQWR R  SAGF  V+LGSNA+KQ
Sbjct  477  PVNTQDKLMSEVYLGQQICNVVACEGPERVERHETLAQWRARLGSAGFDPVNLGSNAFKQ  536

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L +
Sbjct  537  ASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLAN  578



>ref|XP_009603475.1| PREDICTED: DELLA protein GAI1-like [Nicotiana tomentosiformis]
Length=563

 Score =   274 bits (700),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG  EKVLS V+D+KPEI T+VEQEANHNGPVFMDRFTESLHYYSTLFDSLEGC      
Sbjct  401  PGGIEKVLSFVKDLKPEIFTIVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCGGGGEL  460

Query  491  -AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYK  315
              V DQDK+MSEVYLGRQICN+V+CEGVDRVERHETLAQWRTRF SAGF  V LGSNA+K
Sbjct  461  GPVSDQDKLMSEVYLGRQICNLVSCEGVDRVERHETLAQWRTRFNSAGFEPVLLGSNAFK  520

Query  314  QASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            QASMLLALFAGG GYRVEEN+G L LGWHTRPLIATSAWKL+S
Sbjct  521  QASMLLALFAGGGGYRVEENNGCLMLGWHTRPLIATSAWKLSS  563



>ref|XP_002284648.1| PREDICTED: DELLA protein GAI1 [Vitis vinifera]
 sp|Q8S4W7.1|GAI1_VITVI RecName: Full=DELLA protein GAI1; AltName: Full=Gibberellic acid-insensitive 
mutant protein 1; AltName: Full=VvGAI1 [Vitis 
vinifera]
 gb|AAM19210.1|AF378125_1 GAI-like protein 1 [Vitis vinifera]
Length=590

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 142/162 (88%), Gaps = 3/162 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG  E+VLS V+DMKP+IVT+VEQEANHNGPVF+DRFTESLHYYSTLFDSLEGC  S   
Sbjct  420  PGGIERVLSAVKDMKPDIVTIVEQEANHNGPVFLDRFTESLHYYSTLFDSLEGCGVS---  476

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
             V  QDK+MSEVYLG+QICNVVACEG +RVERHETLAQWR R  SAGF  V+LGSNA+KQ
Sbjct  477  PVNTQDKLMSEVYLGQQICNVVACEGPERVERHETLAQWRARLGSAGFDPVNLGSNAFKQ  536

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L +
Sbjct  537  ASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLAN  578



>gb|AFJ23219.1| DELLA protein [Pyrus betulifolia]
Length=634

 Score =   275 bits (704),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 137/159 (86%), Gaps = 7/159 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF E LHYYSTLFDSLEG A S   
Sbjct  474  PGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNEPLHYYSTLFDSLEGSANS---  530

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                +DKVMSEVYLG+QICNVVACEGVDRVERHETL QWR RF SA F  VHLGSNA+KQ
Sbjct  531  ----RDKVMSEVYLGKQICNVVACEGVDRVERHETLTQWRARFGSADFVPVHLGSNAFKQ  586

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  195
            ASMLLALFAGGDGYRVEENDG + L WHTRPLIATSAWK
Sbjct  587  ASMLLALFAGGDGYRVEENDGCMMLAWHTRPLIATSAWK  625



>gb|EPS61323.1| hypothetical protein M569_13471, partial [Genlisea aurea]
Length=549

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA E+V+ +V+ +KPEI+TVVEQEANHNG  F+DRFTE+LHYYSTLFDSLE C     G
Sbjct  390  PGAVERVMDLVRGLKPEILTVVEQEANHNGSFFLDRFTEALHYYSTLFDSLESCCGGSDG  449

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            AV  +DK+MSEVYLGRQICNVVACEG DRVERHETLAQWR+RF S+GF  VHLGSN YKQ
Sbjct  450  AVSGEDKLMSEVYLGRQICNVVACEGADRVERHETLAQWRSRFSSSGFKPVHLGSNVYKQ  509

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            A +LLA+FAGGDGYRVEEN G LTLGWHTRPLIATSAWKL
Sbjct  510  AILLLAVFAGGDGYRVEENKGCLTLGWHTRPLIATSAWKL  549



>gb|AFJ23220.1| DELLA protein [Pyrus x bretschneideri]
Length=634

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 137/159 (86%), Gaps = 7/159 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG A S   
Sbjct  474  PGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEGSANS---  530

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                +DKVMSEVYLG+QICNVVACEGVDRVERHE L QWR RF SA F  VHLGSNA+KQ
Sbjct  531  ----RDKVMSEVYLGKQICNVVACEGVDRVERHEKLTQWRARFGSADFVPVHLGSNAFKQ  586

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  195
            ASMLLALFAGGDGYRVEENDG + L WHTRPLIATSAWK
Sbjct  587  ASMLLALFAGGDGYRVEENDGCMMLAWHTRPLIATSAWK  625



>ref|XP_010274729.1| PREDICTED: DELLA protein GAI1-like [Nelumbo nucifera]
Length=602

 Score =   273 bits (699),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 143/162 (88%), Gaps = 3/162 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLS +++MKP+IVT+VEQEANHNGPVF+DRFTE+LHYYSTLFDSLEGC  S   
Sbjct  441  PGAIEKVLSSIKEMKPKIVTIVEQEANHNGPVFLDRFTEALHYYSTLFDSLEGCGMSPPN  500

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            +   QD+VMS VYLG+QICNVVACEGV+RVERHETL QWR R  S+GF+ VHLGSNA+KQ
Sbjct  501  S---QDQVMSGVYLGQQICNVVACEGVERVERHETLTQWRNRLASSGFAPVHLGSNAFKQ  557

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L +
Sbjct  558  ASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLAA  599



>ref|XP_007045197.1| GRAS family transcription factor family protein [Theobroma cacao]
 gb|EOY01029.1| GRAS family transcription factor family protein [Theobroma cacao]
Length=615

 Score =   273 bits (699),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 142/162 (88%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA +KVLSVV+ MKPEIVT+VEQEANHNGPVF+DRFTESLHYYSTLFDSLEG       
Sbjct  454  PGAIDKVLSVVKQMKPEIVTIVEQEANHNGPVFLDRFTESLHYYSTLFDSLEG-------  506

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            +V  QDKVMSEVYLG+QICNVVACEGVDRVERHE LA WR R  +AGF++VHLGSNA+KQ
Sbjct  507  SVSSQDKVMSEVYLGKQICNVVACEGVDRVERHEKLAHWRNRLGTAGFASVHLGSNAFKQ  566

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGY VEEN+G L LGWH+RPLIATSAWKL +
Sbjct  567  ASMLLALFAGGDGYGVEENNGCLMLGWHSRPLIATSAWKLAN  608



>gb|ADH53781.1| GAI2 [Malus baccata var. xiaojinensis]
Length=570

 Score =   272 bits (696),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 136/157 (87%), Gaps = 7/157 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ MKPEI+TVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG A S   
Sbjct  421  PGAIEKVLSVVKQMKPEILTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEGSANS---  477

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICNVVACEG+DRVERHETL QWR RF SA F  VHLGSNA+KQ
Sbjct  478  ----QDKVMSEVYLGKQICNVVACEGLDRVERHETLTQWRARFDSADFVPVHLGSNAFKQ  533

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSA  201
            A MLLALFAGGDGYRVEENDG L LGWHTRPLIATSA
Sbjct  534  AGMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSA  570



>dbj|BAG71200.1| DELLA 1 [Lactuca sativa]
Length=569

 Score =   272 bits (695),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 142/167 (85%), Gaps = 7/167 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLS V++MKPEI+TVVEQEANHNGPVF++RFTESLHYYSTLFDSLE      G 
Sbjct  402  PGAVEKVLSAVKEMKPEILTVVEQEANHNGPVFLERFTESLHYYSTLFDSLESSGNGGGV  461

Query  491  -------AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  333
                   A  +QDK+MSEVYLG+QICNVVACEG DRVERH+TL+QW+TRF+S GF  VHL
Sbjct  462  VEGGGIPAASNQDKIMSEVYLGKQICNVVACEGPDRVERHQTLSQWKTRFESGGFEVVHL  521

Query  332  GSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            GSNAYKQASMLLALFAGGDGYRVEEN+G L LGWHTRPLI TSAWKL
Sbjct  522  GSNAYKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLITTSAWKL  568



>gb|ADH53779.1| GAI1 [Malus domestica]
Length=570

 Score =   272 bits (695),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 136/157 (87%), Gaps = 7/157 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG  EKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG A S   
Sbjct  421  PGVIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEGSANS---  477

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                +DKVMSEVYLG+QICNVVACEGVDRVERHETLAQWR RF SA F  VHLGSNA+KQ
Sbjct  478  ----RDKVMSEVYLGKQICNVVACEGVDRVERHETLAQWRARFGSADFVPVHLGSNAFKQ  533

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSA  201
            ASMLLALFAGGDGYRVEENDG + L WHTRPLIATSA
Sbjct  534  ASMLLALFAGGDGYRVEENDGCMMLAWHTRPLIATSA  570



>ref|XP_008467128.1| PREDICTED: DELLA protein GAIP-B [Cucumis melo]
Length=586

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 138/160 (86%), Gaps = 7/160 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ MKPEI+TVVEQEANHNGPVF+DRFTESLHYYSTLFDSLEG       
Sbjct  426  PGALEKVLSVVKQMKPEIMTVVEQEANHNGPVFVDRFTESLHYYSTLFDSLEGSP-----  480

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
               +QDK+MSE+YLG+QICNVVACEG DRVERHETL QW+TR  SAGF  +HLGSNA+KQ
Sbjct  481  --NNQDKIMSEMYLGKQICNVVACEGADRVERHETLTQWQTRLSSAGFEPIHLGSNAFKQ  538

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            ASMLLALF  G+GYRVEEN+G L LGWHTRPLIATSAWKL
Sbjct  539  ASMLLALFGSGEGYRVEENNGSLMLGWHTRPLIATSAWKL  578



>gb|ABG26370.1| DELLA protein GAI [Gossypium barbadense]
Length=616

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 140/162 (86%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA +KV SVV+ MKPE+VT+VEQEANHNGPVF+DRFTESLH+YSTLFDSLEG       
Sbjct  455  PGAIDKVFSVVKQMKPELVTIVEQEANHNGPVFLDRFTESLHFYSTLFDSLEG-------  507

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            +V  QDKVMSEVYLG+QICNVVACEGVDR+ERHE+L QWR R  +AGFS VHLGSNA+KQ
Sbjct  508  SVSSQDKVMSEVYLGKQICNVVACEGVDRIERHESLTQWRNRLSTAGFSPVHLGSNAFKQ  567

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGY VEEN+G L LGWH RPLI TSAWKLT+
Sbjct  568  ASMLLALFAGGDGYGVEENNGCLMLGWHNRPLITTSAWKLTN  609



>ref|XP_004166672.1| PREDICTED: LOW QUALITY PROTEIN: DELLA protein GAIP-B-like [Cucumis 
sativus]
Length=586

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 138/160 (86%), Gaps = 7/160 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ MKPEI+TVVEQEANHNGPVF+DRFTESLHYYSTLFDSLEG       
Sbjct  426  PGALEKVLSVVKQMKPEIMTVVEQEANHNGPVFVDRFTESLHYYSTLFDSLEGSP-----  480

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
               +QDK+MSE+YLG+QICNVVACEG DRVERHETL QW+TR  SAGF  +HLGSNA+KQ
Sbjct  481  --NNQDKIMSEMYLGKQICNVVACEGADRVERHETLTQWQTRLSSAGFEPIHLGSNAFKQ  538

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            ASMLLALF  G+GYRVEEN+G L LGWHTRPLIATSAWK+
Sbjct  539  ASMLLALFGSGEGYRVEENNGSLMLGWHTRPLIATSAWKI  578



>ref|XP_004150593.1| PREDICTED: DELLA protein GAIP-B-like [Cucumis sativus]
 emb|CBX88046.1| gibberellin DELLA protein, partial [Cucumis sativus]
 gb|KGN51488.1| DELLA protein GAIP-B [Cucumis sativus]
Length=586

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 138/160 (86%), Gaps = 7/160 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ MKPEI+TVVEQEANHNGPVF+DRFTESLHYYSTLFDSLEG       
Sbjct  426  PGALEKVLSVVKQMKPEIMTVVEQEANHNGPVFVDRFTESLHYYSTLFDSLEGSP-----  480

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
               +QDK+MSE+YLG+QICNVVACEG DRVERHETL QW+TR  SAGF  +HLGSNA+KQ
Sbjct  481  --NNQDKIMSEMYLGKQICNVVACEGADRVERHETLTQWQTRLSSAGFEPIHLGSNAFKQ  538

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            ASMLLALF  G+GYRVEEN+G L LGWHTRPLIATSAWK+
Sbjct  539  ASMLLALFGSGEGYRVEENNGSLMLGWHTRPLIATSAWKI  578



>emb|CAN59753.1| hypothetical protein VITISV_036639 [Vitis vinifera]
Length=580

 Score =   270 bits (691),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 141/162 (87%), Gaps = 3/162 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLS ++ MKP+IVTVVEQEA+HNGPVF+DRFTE+LHYYS LFDSLEGC  S   
Sbjct  406  PGAIEKVLSSIKAMKPKIVTVVEQEASHNGPVFLDRFTEALHYYSNLFDSLEGCGVSPPS  465

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            +   QD +MSE+YLGRQICNVVACEG +RVERHETL+QWR+R  SAGF  VHLGSNA+KQ
Sbjct  466  S---QDLMMSEIYLGRQICNVVACEGAERVERHETLSQWRSRMGSAGFDPVHLGSNAFKQ  522

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L S
Sbjct  523  ASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLNS  564



>gb|KJB15415.1| hypothetical protein B456_002G177000 [Gossypium raimondii]
Length=617

 Score =   271 bits (692),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 138/161 (86%), Gaps = 7/161 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            P A +KV SVV+ MKPE+VT+VEQEANHNGPVF+DRFTESLHYYSTLFDSLEG       
Sbjct  456  PAAIDKVFSVVKQMKPELVTIVEQEANHNGPVFLDRFTESLHYYSTLFDSLEG-------  508

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            +V  QDKVMSEVYLG+QICNVVACEGVDR+ERHE+L QWR R  +AGFS VHLGSNA+KQ
Sbjct  509  SVSSQDKVMSEVYLGKQICNVVACEGVDRIERHESLTQWRNRLSTAGFSPVHLGSNAFKQ  568

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  189
            ASMLLALFAGGDGY VEEN+G L LGWH RPLI TSAWKLT
Sbjct  569  ASMLLALFAGGDGYGVEENNGCLMLGWHNRPLITTSAWKLT  609



>ref|XP_008362563.1| PREDICTED: LOW QUALITY PROTEIN: DELLA protein GAI-like [Malus 
domestica]
Length=392

 Score =   264 bits (675),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 138/162 (85%), Gaps = 6/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA +KVLS ++ MKP+IVT+VEQEANHNGPVF+DRFTE+LHYYS LFDSLEG +     
Sbjct  234  PGAVDKVLSSIKAMKPKIVTIVEQEANHNGPVFLDRFTEALHYYSNLFDSLEGSSGP---  290

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD VMSEVYLGRQICNV+ACE  DRVERHETL+QWR+R  SAGF  VHLGSNA+KQ
Sbjct  291  ---SQDLVMSEVYLGRQICNVMACEXGDRVERHETLSQWRSRMDSAGFDPVHLGSNAFKQ  347

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L S
Sbjct  348  ASMLLALFAGGDGYRVEENNGSLMLGWHTRPLIATSAWQLAS  389



>ref|XP_002266267.1| PREDICTED: DELLA protein GAI-like [Vitis vinifera]
Length=613

 Score =   270 bits (691),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 141/162 (87%), Gaps = 3/162 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLS ++ MKP+IVTVVEQEA+HNGPVF+DRFTE+LHYYS LFDSLEGC  S   
Sbjct  439  PGAIEKVLSSIKAMKPKIVTVVEQEASHNGPVFLDRFTEALHYYSNLFDSLEGCGVSPPS  498

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            +   QD +MSE+YLGRQICNVVACEG +RVERHETL+QWR+R  SAGF  VHLGSNA+KQ
Sbjct  499  S---QDLMMSEIYLGRQICNVVACEGAERVERHETLSQWRSRMGSAGFDPVHLGSNAFKQ  555

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L S
Sbjct  556  ASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLNS  597



>ref|XP_006384166.1| hypothetical protein POPTR_0004s08890g [Populus trichocarpa]
 gb|ERP61963.1| hypothetical protein POPTR_0004s08890g [Populus trichocarpa]
Length=431

 Score =   265 bits (677),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 138/162 (85%), Gaps = 4/162 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG  +KVL  ++ M+P+IVT+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG     G 
Sbjct  269  PGGIDKVLESIKAMRPKIVTIVEQEANHNGPVFLDRFTEALHYYSSLFDSLEG----SGL  324

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD VMSE+YLGR ICNVVACEG DRVERHETLAQWRTRF SAGF  VHLGSNA+KQ
Sbjct  325  TPPSQDLVMSELYLGRHICNVVACEGADRVERHETLAQWRTRFDSAGFDPVHLGSNAFKQ  384

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L +
Sbjct  385  ASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLAA  426



>ref|XP_010527787.1| PREDICTED: DELLA protein GAI-like [Tarenaya hassleriana]
Length=609

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 137/159 (86%), Gaps = 7/159 (4%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            GA EKVL VV+ MKPEI TVVEQE+NHN P F+DRF+ESLHYYSTLFDSLEG        
Sbjct  450  GAMEKVLGVVKQMKPEIFTVVEQESNHNSPAFLDRFSESLHYYSTLFDSLEGV-------  502

Query  488  VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQA  309
            V  QDKVMSEVYLG+QICNVVACEG DRVERHETLAQWR+RF SAGFS VHLGSNA+KQA
Sbjct  503  VNSQDKVMSEVYLGKQICNVVACEGPDRVERHETLAQWRSRFGSAGFSPVHLGSNAFKQA  562

Query  308  SMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            SMLLALF GG+GYRVEENDG L LGWHTRPLIATSAWKL
Sbjct  563  SMLLALFNGGEGYRVEENDGCLMLGWHTRPLIATSAWKL  601



>ref|XP_006307228.1| hypothetical protein CARUB_v10008833mg [Capsella rubella]
 gb|EOA40126.1| hypothetical protein CARUB_v10008833mg [Capsella rubella]
Length=528

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 138/162 (85%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL VV  +KPEI TVVEQE+NHN PVF+DRFTESLHYYSTLFDSLEG  +    
Sbjct  373  PGAIEKVLGVVNQIKPEIFTVVEQESNHNSPVFLDRFTESLHYYSTLFDSLEGVPSG---  429

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICNVVAC+G DRVERHETL QWR RF SAGFSA HLGSNA+KQ
Sbjct  430  ----QDKVMSEVYLGKQICNVVACDGPDRVERHETLRQWRNRFGSAGFSAAHLGSNAFKQ  485

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALF GG+GYRVEE+DG L LGWHTRPLIATSAWKL++
Sbjct  486  ASMLLALFNGGEGYRVEESDGCLMLGWHTRPLIATSAWKLST  527



>gb|ADH53780.1| GAI1 [Malus domestica]
Length=570

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 135/157 (86%), Gaps = 7/157 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG A S   
Sbjct  421  PGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEGSANS---  477

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                +DKVMSEVYLG+QICNVVACEGVDRVERHETLAQWR RF SA F  VHLGSNA+KQ
Sbjct  478  ----RDKVMSEVYLGKQICNVVACEGVDRVERHETLAQWRARFGSADFVPVHLGSNAFKQ  533

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSA  201
            ASMLLALFAGGDGYRVE NDG + L WHTRPLI TSA
Sbjct  534  ASMLLALFAGGDGYRVEGNDGCMMLAWHTRPLIVTSA  570



>gb|ACM47244.1| putative gibberellin signaling DELLA protein [Sinningia speciosa]
Length=562

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 136/159 (86%), Gaps = 2/159 (1%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA +KVL+VV+ MKPEI T++EQEANHNG VF+DRF ESLHYYSTLFDSLE C     G
Sbjct  404  PGAIDKVLNVVRQMKPEIFTMIEQEANHNGAVFLDRFNESLHYYSTLFDSLESCGGD--G  461

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
             V DQDKVMSEVYLGRQICNVVA EGVDRVERHETLAQWRTRF S+GF  VHLGSNAYKQ
Sbjct  462  VVSDQDKVMSEVYLGRQICNVVASEGVDRVERHETLAQWRTRFGSSGFQPVHLGSNAYKQ  521

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  195
            AS LL LFAGGD YRVEEN+G L LGW TRPLIATSAWK
Sbjct  522  ASTLLVLFAGGDEYRVEENNGCLMLGWRTRPLIATSAWK  560



>ref|XP_006383329.1| hypothetical protein POPTR_0005s14540g [Populus trichocarpa]
 gb|ERP61126.1| hypothetical protein POPTR_0005s14540g [Populus trichocarpa]
Length=619

 Score =   270 bits (689),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 139/162 (86%), Gaps = 4/162 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG  +KVL  ++ M+P+IVT+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG     G 
Sbjct  445  PGGIDKVLGSIKAMRPKIVTIVEQEANHNGPVFLDRFTEALHYYSSLFDSLEGS----GV  500

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD VMSE+YLGRQICNVVACEG DRVERHETLAQWRTRF SAGF  VHLGSNA+KQ
Sbjct  501  TPTSQDLVMSELYLGRQICNVVACEGADRVERHETLAQWRTRFDSAGFDPVHLGSNAFKQ  560

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L +
Sbjct  561  ASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLAA  602



>ref|XP_010066602.1| PREDICTED: DELLA protein GAIP-B-like [Eucalyptus grandis]
 gb|KCW64558.1| hypothetical protein EUGRSUZ_G02163 [Eucalyptus grandis]
Length=634

 Score =   270 bits (689),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 137/160 (86%), Gaps = 7/160 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL VV+ ++P IVTVVEQEANHNGPVF+DRF ESLHYYSTLFDSLEGCA++   
Sbjct  473  PGAIEKVLGVVRQVRPAIVTVVEQEANHNGPVFVDRFNESLHYYSTLFDSLEGCAST---  529

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDK MSEVYLG+QICNVVACEG DRVERHETLAQWR R   AGF   HLGSNA+KQ
Sbjct  530  ----QDKAMSEVYLGKQICNVVACEGADRVERHETLAQWRARLGGAGFVPAHLGSNAFKQ  585

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            ASMLLALFAGGDGYRVEEN G LTLGWHTRPLIATSAW+L
Sbjct  586  ASMLLALFAGGDGYRVEENGGCLTLGWHTRPLIATSAWRL  625



>gb|AAY28970.1| GIA/RGA-like gibberellin response modulator [Gossypium hirsutum]
Length=548

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 138/160 (86%), Gaps = 4/160 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG  EKV+S ++ MKP+IVTVVEQEANHNGPVF+DRFTE+LHYYSTLFDSLEG     G 
Sbjct  379  PGGIEKVVSSIKAMKPKIVTVVEQEANHNGPVFLDRFTEALHYYSTLFDSLEGS----GV  434

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            A   QD  MSE+YLGRQICNVVACEG+DRVERHE L QWRTR ++AGFS VHLGSNAYKQ
Sbjct  435  APPSQDLAMSELYLGRQICNVVACEGMDRVERHEPLTQWRTRMETAGFSPVHLGSNAYKQ  494

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            ASMLLALFA GDGYRVEEN+G L LGWHTRPLIATSAW+L
Sbjct  495  ASMLLALFASGDGYRVEENNGCLMLGWHTRPLIATSAWRL  534



>gb|AEE69074.2| GAI-like protein [Juglans regia]
Length=613

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 139/159 (87%), Gaps = 7/159 (4%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            GA EKV SVV+ MKP+IVTVVEQEANHNGPVF+DRFTESLHYYST+FDSLEG       +
Sbjct  454  GAIEKVFSVVKQMKPDIVTVVEQEANHNGPVFLDRFTESLHYYSTMFDSLEG-------S  506

Query  488  VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQA  309
            V +QDKVMSEVYLG+QICNVV+CEGVDRVERHET  QWR R  SAGF  VHLGSNA+KQA
Sbjct  507  VSNQDKVMSEVYLGKQICNVVSCEGVDRVERHETSVQWRARLGSAGFEPVHLGSNAFKQA  566

Query  308  SMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            SMLLALFAGG+GYRVEEN+G L LGWHTRPLIATSAW+L
Sbjct  567  SMLLALFAGGEGYRVEENNGCLMLGWHTRPLIATSAWQL  605



>gb|KJB08563.1| hypothetical protein B456_001G089400 [Gossypium raimondii]
Length=548

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 138/160 (86%), Gaps = 4/160 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG  EKV+S ++ MKP+IVTVVEQEANHNGPVF+DRFTE+LHYYSTLFDSLEG     G 
Sbjct  379  PGGIEKVVSSIKAMKPKIVTVVEQEANHNGPVFLDRFTEALHYYSTLFDSLEGS----GV  434

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            A   QD  MSE+YLGRQICNVVACEG+DRVERHE L QWRTR ++AGFS VHLGSNAYKQ
Sbjct  435  APPSQDLAMSELYLGRQICNVVACEGMDRVERHEPLTQWRTRMETAGFSPVHLGSNAYKQ  494

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            ASMLLALFA GDGYRVEEN+G L LGWHTRPLIATSAW+L
Sbjct  495  ASMLLALFASGDGYRVEENNGCLMLGWHTRPLIATSAWRL  534



>ref|XP_010496659.1| PREDICTED: DELLA protein GAI [Camelina sativa]
Length=531

 Score =   266 bits (680),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 139/162 (86%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA +KVL VV  +KPEI TVVEQE+NHN PVF+DRFTESLHYYSTLFDSLEG  +    
Sbjct  376  PGAIDKVLGVVNQIKPEIFTVVEQESNHNSPVFLDRFTESLHYYSTLFDSLEGVPSG---  432

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICNVVAC+G DRVERHETL+QWR RF SAGFSA HLGSNA+KQ
Sbjct  433  ----QDKVMSEVYLGKQICNVVACDGPDRVERHETLSQWRNRFGSAGFSAAHLGSNAFKQ  488

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALF GG+GYRVEE+DG L LGWHTRPLIATSAWKL++
Sbjct  489  ASMLLALFNGGEGYRVEESDGCLMLGWHTRPLIATSAWKLST  530



>ref|XP_011021384.1| PREDICTED: DELLA protein GAI-like [Populus euphratica]
Length=608

 Score =   268 bits (685),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 140/162 (86%), Gaps = 4/162 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG  +KVL  ++ M+P+IVT+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG     G 
Sbjct  445  PGGIDKVLGSIKAMRPKIVTIVEQEANHNGPVFLDRFTEALHYYSSLFDSLEGS----GV  500

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD VMSE+YLGRQICNVVACEG DRVERHETLA+WRTRF SAGF+ VHLGSNA+KQ
Sbjct  501  TPTSQDLVMSELYLGRQICNVVACEGADRVERHETLARWRTRFDSAGFNPVHLGSNAFKQ  560

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L +
Sbjct  561  ASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLAA  602



>ref|XP_006416958.1| hypothetical protein EUTSA_v10007323mg [Eutrema salsugineum]
 dbj|BAJ34426.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ35311.1| hypothetical protein EUTSA_v10007323mg [Eutrema salsugineum]
Length=535

 Score =   266 bits (679),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 139/162 (86%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL VV  +KPEI TVVEQE+NHN PVF+DRFTESLHYYS+LFDSLEG  +S   
Sbjct  375  PGAIEKVLGVVNQIKPEIFTVVEQESNHNSPVFLDRFTESLHYYSSLFDSLEGVPSS---  431

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICNVVAC+G DRVERHETL+QWR RF SAGFSA H+GSNA+KQ
Sbjct  432  ----QDKVMSEVYLGKQICNVVACDGPDRVERHETLSQWRNRFGSAGFSAAHIGSNAFKQ  487

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALF  G+GYRVEE+DG L LGWHTRPLIATSAWKL++
Sbjct  488  ASMLLALFNSGEGYRVEESDGCLMLGWHTRPLIATSAWKLST  529



>gb|ACR58455.1| GAI/RGA protein [Gossypium hirsutum]
Length=616

 Score =   268 bits (685),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 139/162 (86%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA +KV SVV+ MKPE+VT+VEQEANHNGPVF+DRFTESLH+YSTLFDSLEG       
Sbjct  455  PGAIDKVFSVVKQMKPELVTIVEQEANHNGPVFLDRFTESLHFYSTLFDSLEG-------  507

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            +V  QDKVMSEVYLG+QICNVVACEGVDR+E HE+L QWR R  +AGFS VHLGSNA+KQ
Sbjct  508  SVSSQDKVMSEVYLGKQICNVVACEGVDRIEGHESLTQWRNRLSTAGFSPVHLGSNAFKQ  567

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGY VEEN+G L LGWH RPLI TSAWKLT+
Sbjct  568  ASMLLALFAGGDGYGVEENNGCLMLGWHNRPLIITSAWKLTN  609



>ref|XP_008343058.1| PREDICTED: DELLA protein GAI-like [Malus domestica]
Length=584

 Score =   267 bits (682),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 138/162 (85%), Gaps = 6/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA +KVLS ++ MKP+IVT+VEQEANHNGPVF+DRFTE+LHYYS LFDSLEG +     
Sbjct  426  PGAVDKVLSSIKAMKPKIVTIVEQEANHNGPVFLDRFTEALHYYSNLFDSLEGSSGPS--  483

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD VMSEVYLGRQICNV+ACEG DRVERHETL+QWR R  SAGF  VHLGSNA+KQ
Sbjct  484  ----QDLVMSEVYLGRQICNVMACEGGDRVERHETLSQWRGRMDSAGFDPVHLGSNAFKQ  539

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L S
Sbjct  540  ASMLLALFAGGDGYRVEENNGSLMLGWHTRPLIATSAWQLAS  581



>ref|XP_010459010.1| PREDICTED: DELLA protein GAI-like [Camelina sativa]
Length=535

 Score =   266 bits (679),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 139/162 (86%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA +KVL VV  +KPEI TVVEQE+NHN PVF+DRFTESLHYYSTLFDSLEG     GG
Sbjct  380  PGAIDKVLGVVNQIKPEIFTVVEQESNHNSPVFLDRFTESLHYYSTLFDSLEGVP---GG  436

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICNVVAC+G DRVERHETL+QWR RF SAGFSA HLGSNA+KQ
Sbjct  437  ----QDKVMSEVYLGKQICNVVACDGPDRVERHETLSQWRNRFGSAGFSAAHLGSNAFKQ  492

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALF GG+GYRVEE+DG L LGWHTRPLIATSAWKL +
Sbjct  493  ASMLLALFNGGEGYRVEESDGCLMLGWHTRPLIATSAWKLAT  534



>gb|AEX97111.1| spur-type DELLA protein [Malus domestica]
Length=584

 Score =   267 bits (682),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 138/162 (85%), Gaps = 6/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA +KVLS ++ MKP+IVT+VEQEANHNGPVF+DRFTE+LHYYS LFDSLEG +     
Sbjct  426  PGAVDKVLSSIKAMKPKIVTIVEQEANHNGPVFLDRFTEALHYYSNLFDSLEGSSGPS--  483

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD VMSEVYLGRQICNV+ACEG DRVERHETL+QWR R  SAGF  VHLGSNA+KQ
Sbjct  484  ----QDLVMSEVYLGRQICNVMACEGGDRVERHETLSQWRGRMDSAGFDPVHLGSNAFKQ  539

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L S
Sbjct  540  ASMLLALFAGGDGYRVEENNGSLMLGWHTRPLIATSAWQLAS  581



>gb|AAY56750.1| DELLA protein [Malus domestica]
Length=584

 Score =   267 bits (682),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 138/162 (85%), Gaps = 6/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA +KVLS ++ MKP+IVT+VEQEANHNGPVF+DRFTE+LHYYS LFDSLEG +     
Sbjct  426  PGAVDKVLSSIKAMKPKIVTIVEQEANHNGPVFLDRFTEALHYYSNLFDSLEGSSGPS--  483

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD VMSEVYLGRQICNV+ACEG DRVERHETL+QWR R  SAGF  VHLGSNA+KQ
Sbjct  484  ----QDLVMSEVYLGRQICNVMACEGGDRVERHETLSQWRGRMDSAGFDPVHLGSNAFKQ  539

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L S
Sbjct  540  ASMLLALFAGGDGYRVEENNGSLMLGWHTRPLIATSAWQLAS  581



>ref|XP_003531153.1| PREDICTED: DELLA protein GAI1-like [Glycine max]
Length=517

 Score =   265 bits (677),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 138/162 (85%), Gaps = 6/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ ++PEIVTVVEQEANHN   F+DRFTESLHYYSTLFDSLEG       
Sbjct  360  PGAVEKVLSVVRQIRPEIVTVVEQEANHNRLSFVDRFTESLHYYSTLFDSLEGSP-----  414

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
             V   DK MSEVYLG+QICNVVACEG+DRVERHETL QWR RF S GFS+VHLGSNAYKQ
Sbjct  415  -VNPNDKAMSEVYLGKQICNVVACEGMDRVERHETLNQWRNRFVSTGFSSVHLGSNAYKQ  473

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L +
Sbjct  474  ASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLAA  515



>ref|XP_009334448.1| PREDICTED: DELLA protein GAI-like [Pyrus x bretschneideri]
Length=584

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 138/162 (85%), Gaps = 6/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA +KVLS ++ MKP+IVT+VEQEANHNGPVF+DRFTE+LHYYS LFDSLEG +     
Sbjct  426  PGAVDKVLSSIKAMKPKIVTIVEQEANHNGPVFLDRFTEALHYYSNLFDSLEGSSGPS--  483

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD VMSEVYLGRQICNV+ACEG DRVERHETL+QWR R  SAGF  VHLGSNA+KQ
Sbjct  484  ----QDLVMSEVYLGRQICNVMACEGGDRVERHETLSQWRGRMDSAGFDPVHLGSNAFKQ  539

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L S
Sbjct  540  ASMLLALFAGGDGYRVEENNGSLMLGWHTRPLIATSAWQLAS  581



>ref|XP_008229195.1| PREDICTED: DELLA protein GAI [Prunus mume]
Length=597

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 136/162 (84%), Gaps = 6/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLS ++ MKP+IVT+VEQEANHNGP+F+DRF E+LHYYS LFDSLEG +     
Sbjct  436  PGAVEKVLSSIKAMKPKIVTIVEQEANHNGPIFLDRFNEALHYYSNLFDSLEGSSGPS--  493

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD VMSEVYLGRQICNVVACEG DRVERHETL QWR R  SAGF  VHLGSNA+KQ
Sbjct  494  ----QDLVMSEVYLGRQICNVVACEGQDRVERHETLTQWRGRMDSAGFDLVHLGSNAFKQ  549

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L S
Sbjct  550  ASMLLALFAGGDGYRVEENNGSLMLGWHTRPLIATSAWQLAS  591



>ref|XP_007214956.1| hypothetical protein PRUPE_ppa003206mg [Prunus persica]
 gb|EMJ16155.1| hypothetical protein PRUPE_ppa003206mg [Prunus persica]
Length=593

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 137/162 (85%), Gaps = 6/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLS ++ MKP+IVT+VEQEANHNGP+F+DRF E+LHYYS LFDSLEG +     
Sbjct  432  PGAVEKVLSSIKAMKPKIVTIVEQEANHNGPIFLDRFNEALHYYSNLFDSLEGSSGPS--  489

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD VMSEVYLGRQICNVVACEG DRVERHETL+QWR R  SAGF  VHLGSNA+KQ
Sbjct  490  ----QDLVMSEVYLGRQICNVVACEGQDRVERHETLSQWRGRMDSAGFDLVHLGSNAFKQ  545

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L S
Sbjct  546  ASMLLALFAGGDGYRVEENNGSLMLGWHTRPLIATSAWQLAS  587



>gb|AHB17743.1| GA repressor DELLA [Actinidia deliciosa]
Length=550

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 140/163 (86%), Gaps = 3/163 (2%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG-  492
            G  EKVLS V++MKPEIVTVVEQE NHNGPVF+DRFTE+LHYYSTLFDSLEGC       
Sbjct  388  GGIEKVLSAVKEMKPEIVTVVEQEVNHNGPVFLDRFTEALHYYSTLFDSLEGCGGGGSPS  447

Query  491  --AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAY  318
              AV +QDKVM+E+YLGRQICNVVAC+G DRVERHETLAQWR RF SAGF  V LGSNA+
Sbjct  448  PSAVSNQDKVMTEMYLGRQICNVVACDGPDRVERHETLAQWRNRFASAGFEPVPLGSNAF  507

Query  317  KQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  189
            KQASMLLALF GGDGY+VEEN G LTLGWHTRPLIATSAWKL+
Sbjct  508  KQASMLLALFNGGDGYKVEENGGCLTLGWHTRPLIATSAWKLS  550



>gb|AHX57850.1| DELLA [Prunus mume]
Length=597

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 136/162 (84%), Gaps = 6/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLS ++ MKP+IVT+VEQEANHNGP+F+DRF E+LHYYS LFDSLEG +     
Sbjct  436  PGAVEKVLSSIKAMKPKIVTIVEQEANHNGPIFLDRFNEALHYYSNLFDSLEGSSGPS--  493

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD VMSEVYLGRQICNVVACEG DRVERHETL QWR R  SAGF  VHLGSNA+KQ
Sbjct  494  ----QDLVMSEVYLGRQICNVVACEGQDRVERHETLTQWRGRMDSAGFDLVHLGSNAFKQ  549

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L S
Sbjct  550  ASMLLALFAGGDGYRVEENNGSLMLGWHTRPLIATSAWQLAS  591



>gb|EYU33133.1| hypothetical protein MIMGU_mgv1a027125mg [Erythranthe guttata]
Length=249

 Score =   255 bits (652),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 135/160 (84%), Gaps = 1/160 (1%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG-  492
            GA EKVL  V+++KP I+TVVEQEANHNG VF+DRF ESLHYYSTL+DSLE C    G  
Sbjct  83   GAIEKVLKFVRELKPAILTVVEQEANHNGAVFLDRFNESLHYYSTLYDSLESCGGGGGDG  142

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            AV DQDKVMSEVYLGRQICNVVACEGV+RVERHETL QWR R   AGF  V+LGSNAYKQ
Sbjct  143  AVSDQDKVMSEVYLGRQICNVVACEGVERVERHETLGQWRARLGWAGFGPVNLGSNAYKQ  202

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            ASMLLALFAGG GY VEEN+G L LGWHTRPLIATSAWK+
Sbjct  203  ASMLLALFAGGGGYVVEENNGCLMLGWHTRPLIATSAWKI  242



>ref|XP_002305198.1| hypothetical protein POPTR_0004s08890g [Populus trichocarpa]
 gb|EEE85709.1| hypothetical protein POPTR_0004s08890g [Populus trichocarpa]
Length=607

 Score =   266 bits (680),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 138/162 (85%), Gaps = 4/162 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG  +KVL  ++ M+P+IVT+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG     G 
Sbjct  445  PGGIDKVLESIKAMRPKIVTIVEQEANHNGPVFLDRFTEALHYYSSLFDSLEGS----GL  500

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD VMSE+YLGR ICNVVACEG DRVERHETLAQWRTRF SAGF  VHLGSNA+KQ
Sbjct  501  TPPSQDLVMSELYLGRHICNVVACEGADRVERHETLAQWRTRFDSAGFDPVHLGSNAFKQ  560

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L +
Sbjct  561  ASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLAA  602



>emb|CAA72178.1| RGA2 protein [Arabidopsis thaliana]
Length=532

 Score =   264 bits (674),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 139/162 (86%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA +KVL VV  +KPEI TVVEQE+NHN P+F+DRFTESLHYYSTLFDSLEG  +    
Sbjct  377  PGAIDKVLGVVNQIKPEIFTVVEQESNHNSPIFLDRFTESLHYYSTLFDSLEGVPSG---  433

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICNVVAC+G DRVERHETL+QWR RF SAGF+A H+GSNA+KQ
Sbjct  434  ----QDKVMSEVYLGKQICNVVACDGPDRVERHETLSQWRNRFGSAGFAAAHIGSNAFKQ  489

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALF GG+GYRVEE+DG L LGWHTRPLIATSAWKL++
Sbjct  490  ASMLLALFNGGEGYRVEESDGCLMLGWHTRPLIATSAWKLST  531



>emb|CAA75492.1| GAI [Arabidopsis thaliana]
Length=532

 Score =   264 bits (674),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 139/162 (86%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA +KVL VV  +KPEI TVVEQE+NHN P+F+DRFTESLHYYSTLFDSLEG  +    
Sbjct  377  PGAIDKVLGVVNQIKPEIFTVVEQESNHNSPIFLDRFTESLHYYSTLFDSLEGVPSG---  433

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICNVVAC+G DRVERHETL+QWR RF SAGF+A H+GSNA+KQ
Sbjct  434  ----QDKVMSEVYLGKQICNVVACDGPDRVERHETLSQWRNRFGSAGFAAAHIGSNAFKQ  489

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALF GG+GYRVEE+DG L LGWHTRPLIATSAWKL++
Sbjct  490  ASMLLALFNGGEGYRVEESDGCLMLGWHTRPLIATSAWKLST  531



>ref|NP_172945.1| DELLA protein GAI [Arabidopsis thaliana]
 sp|Q9LQT8.1|GAI_ARATH RecName: Full=DELLA protein GAI; AltName: Full=GRAS family protein 
3; Short=AtGRAS-3; AltName: Full=Gibberellic acid-insensitive 
mutant protein; AltName: Full=Restoration of growth 
on ammonia protein 2 [Arabidopsis thaliana]
 gb|AAF79228.1|AC006917_13 F10B6.34 [Arabidopsis thaliana]
 gb|AAL25607.1| At1g14920/F10B6_15 [Arabidopsis thaliana]
 gb|AAM98266.1| At1g14920/F10B6_15 [Arabidopsis thaliana]
 gb|AEE29242.1| DELLA protein GAI [Arabidopsis thaliana]
Length=533

 Score =   264 bits (674),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 139/162 (86%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA +KVL VV  +KPEI TVVEQE+NHN P+F+DRFTESLHYYSTLFDSLEG  +    
Sbjct  378  PGAIDKVLGVVNQIKPEIFTVVEQESNHNSPIFLDRFTESLHYYSTLFDSLEGVPSG---  434

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICNVVAC+G DRVERHETL+QWR RF SAGF+A H+GSNA+KQ
Sbjct  435  ----QDKVMSEVYLGKQICNVVACDGPDRVERHETLSQWRNRFGSAGFAAAHIGSNAFKQ  490

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALF GG+GYRVEE+DG L LGWHTRPLIATSAWKL++
Sbjct  491  ASMLLALFNGGEGYRVEESDGCLMLGWHTRPLIATSAWKLST  532



>sp|Q6EI06.1|GAIP_CUCMA RecName: Full=DELLA protein GAIP; AltName: Full=CmGAIP; Short=GAIP; 
AltName: Full=Gibberellic acid-insensitive phloem protein 
[Cucurbita maxima]
 gb|AAQ96164.1| gibberellic acid insensitive phloem [Cucurbita maxima]
Length=579

 Score =   265 bits (677),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 138/159 (87%), Gaps = 7/159 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ MKPEIVTVVEQEANHNGPVF++RFTESLHYYSTLFDSLE C+ +   
Sbjct  419  PGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFVERFTESLHYYSTLFDSLE-CSPN---  474

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDK+MSE+YLG+QICNVVACEG DRVERHETL QWRTR  SAGF  +HLGSNA+KQ
Sbjct  475  ---SQDKMMSEMYLGKQICNVVACEGADRVERHETLTQWRTRLSSAGFDPIHLGSNAFKQ  531

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  195
            AS+LLALF  G+GYRVEEN+G L LGWHTRPLIATSAWK
Sbjct  532  ASILLALFGSGEGYRVEENEGSLMLGWHTRPLIATSAWK  570



>ref|XP_011002785.1| PREDICTED: DELLA protein GAI [Populus euphratica]
Length=603

 Score =   265 bits (678),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 138/162 (85%), Gaps = 4/162 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG  +KVL  ++ M+P+IVT+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG     G 
Sbjct  441  PGGIDKVLGSIKAMRPKIVTIVEQEANHNGPVFLDRFTEALHYYSSLFDSLEGS----GL  496

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD VMSE+YLGR ICNVVACEG DRVERHETLAQWRTRF SAGF  VHLGSNA+KQ
Sbjct  497  TPPSQDLVMSELYLGRHICNVVACEGADRVERHETLAQWRTRFDSAGFDPVHLGSNAFKQ  556

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L +
Sbjct  557  ASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLAA  598



>ref|XP_002890081.1| hypothetical protein ARALYDRAFT_471680 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66340.1| hypothetical protein ARALYDRAFT_471680 [Arabidopsis lyrata subsp. 
lyrata]
Length=532

 Score =   264 bits (674),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 139/162 (86%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA +KVL VV  +KPEI TVVEQE+NHN PVF+DRFTESLHYYS+LFDSLEG  +    
Sbjct  377  PGAIDKVLEVVNQIKPEIFTVVEQESNHNSPVFLDRFTESLHYYSSLFDSLEGVPSG---  433

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICNVVAC+G DRVERHETL+QWR RF SAGF+A H+GSNA+KQ
Sbjct  434  ----QDKVMSEVYLGKQICNVVACDGPDRVERHETLSQWRNRFGSAGFAAAHIGSNAFKQ  489

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALF GG+GYRVEE+DG L LGWHTRPLIATSAWKL++
Sbjct  490  ASMLLALFNGGEGYRVEESDGCLMLGWHTRPLIATSAWKLST  531



>ref|XP_010476569.1| PREDICTED: DELLA protein GAI-like [Camelina sativa]
Length=533

 Score =   264 bits (674),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 139/162 (86%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA +KVL VV  +KPEI TVVEQE+NHN PVF+DRFTESLHYYSTLFDSLEG  +    
Sbjct  378  PGAIDKVLGVVNQIKPEIFTVVEQESNHNSPVFLDRFTESLHYYSTLFDSLEGVPSG---  434

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICNVVAC+G DRVERHETL+QWR RF SAGFSA HLGSNA+KQ
Sbjct  435  ----QDKVMSEVYLGKQICNVVACDGPDRVERHETLSQWRKRFGSAGFSAAHLGSNAFKQ  490

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALF GG+GYRVEE+DG L LGW+TRPLIATSAWKL++
Sbjct  491  ASMLLALFNGGEGYRVEESDGCLMLGWYTRPLIATSAWKLST  532



>sp|Q6EI05.1|GAIPB_CUCMA RecName: Full=DELLA protein GAIP-B; AltName: Full=CmGAIP-B; Short=GAIP-B; 
AltName: Full=Gibberellic acid-insensitive phloem 
protein B [Cucurbita maxima]
 gb|AAQ96165.1| gibberellic acid insensitive phloem B [Cucurbita maxima]
Length=587

 Score =   265 bits (677),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 136/160 (85%), Gaps = 7/160 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKV+SVV+ MKPEI+TVVEQEANHNGPVFMDRFTESLHYYSTLFDSLE        
Sbjct  426  PGAIEKVMSVVKQMKPEIMTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLESSP-----  480

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
               +QDK+MSE+YLG+QICNVVACEG DRVE HETL QWRTR  S+GF  +HLGSNA+KQ
Sbjct  481  --NNQDKMMSEMYLGKQICNVVACEGSDRVEWHETLTQWRTRLCSSGFEPIHLGSNAFKQ  538

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            ASMLLALF  G+GYRVEEN+G LTLGWHTRPLI TSAWKL
Sbjct  539  ASMLLALFGSGEGYRVEENNGSLTLGWHTRPLIVTSAWKL  578



>ref|XP_002534030.1| DELLA protein GAI, putative [Ricinus communis]
 gb|EEF28350.1| DELLA protein GAI, putative [Ricinus communis]
Length=567

 Score =   264 bits (675),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 139/161 (86%), Gaps = 4/161 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG  EKVLS ++ MKP+IVTVVEQEA+HNGPVF+DRFTE+LHYYS+LFDSLEG     G 
Sbjct  408  PGGMEKVLSSIKAMKPKIVTVVEQEASHNGPVFLDRFTEALHYYSSLFDSLEGS----GL  463

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
             V  QD VMSE+YLGRQICNVVACEG  RVERHE+L  WRTRF+SAGF  VHLGSNA+KQ
Sbjct  464  NVPSQDLVMSELYLGRQICNVVACEGAHRVERHESLPHWRTRFESAGFDRVHLGSNAFKQ  523

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  189
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L+
Sbjct  524  ASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLS  564



>ref|XP_010681882.1| PREDICTED: DELLA protein GAI-like [Beta vulgaris subsp. vulgaris]
Length=609

 Score =   265 bits (677),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 137/162 (85%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL +++++KP IVTVVEQEANHNGP F+DRF ESLHYYSTLFDSLE C  S   
Sbjct  449  PGAVEKVLGLMKEVKPVIVTVVEQEANHNGPAFLDRFNESLHYYSTLFDSLESCVDS---  505

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDK+MSEVYLGRQICNVVACEGVDRVERHETLAQWR RF SAGF+ VH+GSNA+KQ
Sbjct  506  ----QDKLMSEVYLGRQICNVVACEGVDRVERHETLAQWRNRFNSAGFTPVHIGSNAFKQ  561

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLL  FAGGDGY VEENDG L LGWH+RPLI TSAW+L +
Sbjct  562  ASMLLDFFAGGDGYGVEENDGCLMLGWHSRPLITTSAWQLAN  603



>gb|KFK26113.1| hypothetical protein AALP_AA8G204400 [Arabis alpina]
Length=528

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 138/162 (85%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL VV  ++PEI TVVEQE+NHN PVF+DRFTESLHYYSTLFDSLEG  +S   
Sbjct  368  PGAIEKVLGVVNQIQPEIFTVVEQESNHNSPVFLDRFTESLHYYSTLFDSLEGAPSS---  424

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICNVVAC+G DRVERHETL+QWR RF SAGFSA H+GS A+K 
Sbjct  425  ----QDKVMSEVYLGKQICNVVACDGPDRVERHETLSQWRNRFGSAGFSAAHMGSKAFKD  480

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALF GG+GYRVEE+DG LTLGWHTRPL+A SAWKL++
Sbjct  481  ASMLLALFNGGEGYRVEESDGCLTLGWHTRPLVAASAWKLST  522



>ref|XP_006469195.1| PREDICTED: DELLA protein GAIP-B-like [Citrus sinensis]
Length=594

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 138/162 (85%), Gaps = 5/162 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA +KVLSVV+++KP+I TV EQEANHNGPVF+DRFTESLHYYST+FDSLEG   S   
Sbjct  436  PGAIDKVLSVVKNIKPDIFTVAEQEANHNGPVFLDRFTESLHYYSTMFDSLEGSVNSP--  493

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
               +  K M+E Y+G QICNVVACEG DRVERHETLAQWRTRF SAGF   H+GSNAYKQ
Sbjct  494  ---ENHKAMTEAYMGNQICNVVACEGADRVERHETLAQWRTRFSSAGFIPAHIGSNAYKQ  550

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGY+VEEN+G LTLGW+TRPLIATSAWKL +
Sbjct  551  ASMLLALFAGGDGYKVEENNGCLTLGWYTRPLIATSAWKLAA  592



>gb|KDO64603.1| hypothetical protein CISIN_1g043131mg [Citrus sinensis]
Length=592

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 138/162 (85%), Gaps = 5/162 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA +KVLSVV+++KP+I TV EQEANHNGPVF+DRFTESLHYYST+FDSLEG   S   
Sbjct  434  PGAIDKVLSVVKNIKPDIFTVAEQEANHNGPVFLDRFTESLHYYSTMFDSLEGSVNSP--  491

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
               +  K M+E Y+G QICNVVACEG DRVERHETLAQWRTRF SAGF   H+GSNAYKQ
Sbjct  492  ---ENHKAMTEAYMGNQICNVVACEGADRVERHETLAQWRTRFSSAGFIPAHIGSNAYKQ  548

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGY+VEEN+G LTLGW+TRPLIATSAWKL +
Sbjct  549  ASMLLALFAGGDGYKVEENNGCLTLGWYTRPLIATSAWKLAA  590



>ref|NP_001240948.1| DELLA protein GAI 1 [Glycine max]
 gb|ACA24488.1| gibberellin insensitive-like protein [Glycine max]
Length=523

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 136/162 (84%), Gaps = 6/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ ++PEI+TVVEQEANHNG  F+DRFTESLHYYSTLFDSLEG       
Sbjct  361  PGAVEKVLSVVRQIRPEILTVVEQEANHNGLSFVDRFTESLHYYSTLFDSLEGSP-----  415

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
             V   DK MSEVYLG+QICNVVACEG+DRVERHETL QWR RF S GFS VHLGSNAYKQ
Sbjct  416  -VNPNDKAMSEVYLGKQICNVVACEGMDRVERHETLNQWRNRFGSTGFSPVHLGSNAYKQ  474

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLL+LF GGDGYRVEEN+G L LGWHTRPLIATS W+L +
Sbjct  475  ASMLLSLFGGGDGYRVEENNGCLMLGWHTRPLIATSVWQLAT  516



>ref|XP_006430617.1| hypothetical protein CICLE_v10011367mg [Citrus clementina]
 gb|ESR43857.1| hypothetical protein CICLE_v10011367mg [Citrus clementina]
Length=576

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 136/160 (85%), Gaps = 4/160 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG  EKV+S ++ M+P+I+T+VEQEANHN PVF+DRFTE+LHYYS+LFDSLEG     G 
Sbjct  414  PGGIEKVVSSIKAMRPKIITIVEQEANHNSPVFLDRFTEALHYYSSLFDSLEGS----GL  469

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD+VMSEVYLGRQICN+VACEG DR ERHETL QWRTR  SAGF  VHLGSNAYKQ
Sbjct  470  TPPSQDQVMSEVYLGRQICNIVACEGTDRNERHETLTQWRTRLGSAGFDPVHLGSNAYKQ  529

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L
Sbjct  530  ASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQL  569



>dbj|BAF62636.1| DELLA protein [Phaseolus vulgaris]
Length=516

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 135/160 (84%), Gaps = 6/160 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ ++PEI+TVVEQE+NHNG  F DRFTESLHYYSTLFDSLEG       
Sbjct  355  PGAIEKVLSVVRQIRPEILTVVEQESNHNGLSFRDRFTESLHYYSTLFDSLEGSP-----  409

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
             V  QDK MSEVYLG+QICNVVACEG DRVERHETL QWR+RF S GFS VHLGSNA+KQ
Sbjct  410  -VNPQDKAMSEVYLGKQICNVVACEGTDRVERHETLNQWRSRFSSTGFSPVHLGSNAFKQ  468

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            ASMLLALFAGGDGYRVEEN G L LGWHTR LIATSAW+L
Sbjct  469  ASMLLALFAGGDGYRVEENSGCLMLGWHTRALIATSAWQL  508



>ref|XP_007156503.1| hypothetical protein PHAVU_003G291500g [Phaseolus vulgaris]
 ref|XP_007156504.1| hypothetical protein PHAVU_003G291500g [Phaseolus vulgaris]
 gb|ESW28497.1| hypothetical protein PHAVU_003G291500g [Phaseolus vulgaris]
 gb|ESW28498.1| hypothetical protein PHAVU_003G291500g [Phaseolus vulgaris]
Length=517

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 135/160 (84%), Gaps = 6/160 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ ++PEI+TVVEQE+NHNG  F DRFTESLHYYSTLFDSLEG       
Sbjct  356  PGAIEKVLSVVRQIRPEILTVVEQESNHNGLSFRDRFTESLHYYSTLFDSLEGSP-----  410

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
             V  QDK MSEVYLG+QICNVVACEG DRVERHETL QWR+RF S GFS VHLGSNA+KQ
Sbjct  411  -VNPQDKAMSEVYLGKQICNVVACEGTDRVERHETLNQWRSRFSSTGFSPVHLGSNAFKQ  469

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            ASMLLALFAGGDGYRVEEN G L LGWHTR LIATSAW+L
Sbjct  470  ASMLLALFAGGDGYRVEENSGCLMLGWHTRALIATSAWQL  509



>emb|CDP01615.1| unnamed protein product [Coffea canephora]
Length=541

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 135/160 (84%), Gaps = 2/160 (1%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA +KVL+ ++ M+P+IV VVEQEANHNG VFMDRF E+LHYYST+FDSLE    ++  
Sbjct  377  PGAIDKVLNSIKSMRPKIVAVVEQEANHNGNVFMDRFNEALHYYSTMFDSLESSGLTQQS  436

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD VMSEVYLGRQICNVVACEGVDRVERHETL QWR R  SAGF  VHLGSNA+KQ
Sbjct  437  N--SQDLVMSEVYLGRQICNVVACEGVDRVERHETLTQWRGRMNSAGFDPVHLGSNAFKQ  494

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            ASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAW+L
Sbjct  495  ASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWQL  534



>gb|AAT08645.1| GAI-like protein [Hyacinthus orientalis]
Length=215

 Score =   251 bits (641),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            GA +KVLS V+ +KP+I+TVVEQEANHNG +F +RFTE+LHYYST+FDSLEG A+++  +
Sbjct  54   GAIDKVLSTVKAIKPKIMTVVEQEANHNGGLFAERFTEALHYYSTMFDSLEGGASADAVS  113

Query  488  VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQA  309
               Q++VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF  VHLGSNA+KQA
Sbjct  114  GGQQNQVMSEVYLGRQICNVVACEGAERTERHETLVQWRNRLSPAGFEPVHLGSNAFKQA  173

Query  308  SMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            SMLLALFAGG+GYRVEE DG LTLGWHTRPLIATSAW++
Sbjct  174  SMLLALFAGGNGYRVEEKDGCLTLGWHTRPLIATSAWRV  212



>gb|ACY74341.1| putative DELLA protein [Artemisia annua]
Length=530

 Score =   261 bits (666),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 139/162 (86%), Gaps = 3/162 (2%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG-  492
            G+ EKVL+ V+DMKP I T+VE+EANHNGPVF+DRFTE+LHYYSTLFDSLE    +  G 
Sbjct  365  GSVEKVLTAVKDMKPVIFTLVEEEANHNGPVFLDRFTEALHYYSTLFDSLESSGNNGNGE  424

Query  491  --AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAY  318
               V +QDK+MSEVYLG+QICNVVACEGVDRVERH T  QW+TRF+++GF  V+LGSNAY
Sbjct  425  VDGVSNQDKIMSEVYLGKQICNVVACEGVDRVERHMTSGQWKTRFENSGFEPVNLGSNAY  484

Query  317  KQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLI TSAWKL
Sbjct  485  KQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLITTSAWKL  526



>ref|XP_010553798.1| PREDICTED: DELLA protein GAI-like [Tarenaya hassleriana]
Length=611

 Score =   263 bits (671),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 134/160 (84%), Gaps = 7/160 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL VV+  KP+I TVVEQE+NHN P  +DRFTESLHYYSTLFDSLEG A S   
Sbjct  451  PGAMEKVLDVVKRTKPDIFTVVEQESNHNSPALLDRFTESLHYYSTLFDSLEGVANS---  507

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICNVVACEG DRVERHETL QWRTRF SAGFS V LGSNA+KQ
Sbjct  508  ----QDKVMSEVYLGKQICNVVACEGSDRVERHETLTQWRTRFCSAGFSPVQLGSNAFKQ  563

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            ASMLLALF GG+GYRVEE DG L LGWHTRPLIATSAWKL
Sbjct  564  ASMLLALFNGGEGYRVEEKDGCLMLGWHTRPLIATSAWKL  603



>ref|XP_010101954.1| hypothetical protein L484_011971 [Morus notabilis]
 gb|EXB90878.1| hypothetical protein L484_011971 [Morus notabilis]
Length=477

 Score =   259 bits (661),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 134/160 (84%), Gaps = 7/160 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ MKPEIVTVVEQEANHNG  F+DRFTE+LHYYSTLFDSLEG A     
Sbjct  316  PGAIEKVLSVVKQMKPEIVTVVEQEANHNGSFFLDRFTEALHYYSTLFDSLEGSANG---  372

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QI NVVA EGVDRVERHETL QWR R + AGF+  HLGSNA+KQ
Sbjct  373  ----QDKVMSEVYLGKQIANVVAAEGVDRVERHETLGQWRARMEGAGFTPAHLGSNAFKQ  428

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            ASMLLAL+AGGDGY VEE +G L LGWHTRPLIATSAW+L
Sbjct  429  ASMLLALYAGGDGYGVEEKNGSLMLGWHTRPLIATSAWQL  468



>ref|XP_006482132.1| PREDICTED: DELLA protein GAI-like [Citrus sinensis]
 gb|KDO50841.1| hypothetical protein CISIN_1g008153mg [Citrus sinensis]
Length=576

 Score =   261 bits (668),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 136/160 (85%), Gaps = 4/160 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG  EKV+S ++ M+P+I+T+VEQEANHN PVF+DRFTE+LHYYS+LFDSLEG     G 
Sbjct  414  PGGIEKVVSSIKAMRPKIITIVEQEANHNSPVFLDRFTEALHYYSSLFDSLEGS----GL  469

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD+VMSEVYLGRQICN+VAC+G DR ERHETL QWRTR  SAGF  VHLGSNAYKQ
Sbjct  470  TPPSQDQVMSEVYLGRQICNIVACDGTDRNERHETLTQWRTRLGSAGFEPVHLGSNAYKQ  529

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L
Sbjct  530  ASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQL  569



>gb|KDP33167.1| hypothetical protein JCGZ_13432 [Jatropha curcas]
Length=539

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 133/159 (84%), Gaps = 4/159 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG  +KVLS V+ MKP+IVT+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG     G 
Sbjct  380  PGGIDKVLSSVKAMKPKIVTIVEQEANHNGPVFLDRFTEALHYYSSLFDSLEGS----GS  435

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
             V  QD VMSE+YLGRQICNVVA EG DRVERHETLAQWRTR  +AGF  VHLGSNAYKQ
Sbjct  436  VVPSQDLVMSELYLGRQICNVVAWEGADRVERHETLAQWRTRIDAAGFEPVHLGSNAYKQ  495

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  195
            A MLL +FAGGDGYRVEE DG L LGWHTRPLI TSAWK
Sbjct  496  AGMLLDIFAGGDGYRVEEKDGCLMLGWHTRPLIVTSAWK  534



>ref|XP_010032696.1| PREDICTED: DELLA protein GAI [Eucalyptus grandis]
 gb|KCW52149.1| hypothetical protein EUGRSUZ_J01594 [Eucalyptus grandis]
Length=628

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 139/162 (86%), Gaps = 4/162 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA +KVLS ++ M+P+IVT+VEQEANHNGP F+DRFTE+LHYYS+LFDSLEG     G 
Sbjct  468  PGAIDKVLSSIKAMRPKIVTMVEQEANHNGPGFVDRFTEALHYYSSLFDSLEGS----GV  523

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            A  +QD VMSEVYLGRQICNVVACEG DRVERHETL QW+ R  SAGF  VHLGSNA+KQ
Sbjct  524  APPNQDLVMSEVYLGRQICNVVACEGPDRVERHETLVQWQARMGSAGFDPVHLGSNAFKQ  583

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGG+GYRVEENDG L LGWHTRPLIATSAW+L +
Sbjct  584  ASMLLALFAGGEGYRVEENDGCLMLGWHTRPLIATSAWQLAA  625



>dbj|BAG71201.1| DELLA 2 [Lactuca sativa]
Length=590

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 137/167 (82%), Gaps = 7/167 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEG-  495
            PGA EKVLS V++MKP I+TVVEQEANHNG VF++RFTESLHYYSTLFDSLE      G 
Sbjct  423  PGAVEKVLSAVKEMKPVILTVVEQEANHNGLVFLERFTESLHYYSTLFDSLESSGTGGGG  482

Query  494  ------GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  333
                      +QDK+MSEVYLG+QICNVVACEG DRVERHETL QW+ R  S+GF AVHL
Sbjct  483  VEGGAISPASNQDKIMSEVYLGKQICNVVACEGPDRVERHETLTQWKARLDSSGFEAVHL  542

Query  332  GSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            GSNA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLI TSAWKL
Sbjct  543  GSNAFKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLITTSAWKL  589



>ref|XP_006448223.1| hypothetical protein CICLE_v10017466mg [Citrus clementina]
 gb|ESR61463.1| hypothetical protein CICLE_v10017466mg [Citrus clementina]
Length=594

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 137/162 (85%), Gaps = 5/162 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA +KVLSVV+++K +I TV EQEANHNGPVF+DRFTESLHYYST+FDSLEG   S   
Sbjct  436  PGAIDKVLSVVKNIKADIFTVAEQEANHNGPVFLDRFTESLHYYSTMFDSLEGSVNSP--  493

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
               +  K M+E YLG QICNVVACEG DRVERHETLAQWRTRF SAGF   H+GSNAYKQ
Sbjct  494  ---ENHKAMTEAYLGNQICNVVACEGADRVERHETLAQWRTRFGSAGFIPAHIGSNAYKQ  550

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGY+VEEN+G LTLGW+TRPLIATSAWKL +
Sbjct  551  ASMLLALFAGGDGYKVEENNGCLTLGWYTRPLIATSAWKLAA  592



>gb|EYU25601.1| hypothetical protein MIMGU_mgv1a003589mg [Erythranthe guttata]
Length=576

 Score =   259 bits (663),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 135/160 (84%), Gaps = 1/160 (1%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG-  492
            GA EKVL  V+++KP I+TVVEQEANHNG VF+DRF ESLHYYSTL+DSLE C    G  
Sbjct  416  GAIEKVLKFVRELKPAILTVVEQEANHNGAVFLDRFNESLHYYSTLYDSLESCGGGGGDG  475

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            AV DQDKVMSEVYLGRQICNVVACEGV+RVERHETL QWR R   AGF  VHLGSNAYKQ
Sbjct  476  AVSDQDKVMSEVYLGRQICNVVACEGVERVERHETLGQWRARLGWAGFGPVHLGSNAYKQ  535

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            ASMLLALFAGG GY VEEN+G L LGWHTRPLIATSAWK+
Sbjct  536  ASMLLALFAGGGGYVVEENNGCLMLGWHTRPLIATSAWKI  575



>ref|XP_006826893.1| hypothetical protein AMTR_s00010p00148880 [Amborella trichopoda]
 gb|ERM94130.1| hypothetical protein AMTR_s00010p00148880 [Amborella trichopoda]
Length=556

 Score =   259 bits (661),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 136/160 (85%), Gaps = 4/160 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            P A +KVL+ V+ ++P+IVT+VEQEANHNGPVFMDRFTE+LHYYSTLFDSLEGC    G 
Sbjct  398  PSALDKVLASVRALRPKIVTIVEQEANHNGPVFMDRFTEALHYYSTLFDSLEGCGLPPGS  457

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                 D+VMSEVYLGRQICN+VACEG DRVERHETL QWR R  +AGF+ VHLGSNA++Q
Sbjct  458  ----NDQVMSEVYLGRQICNIVACEGADRVERHETLTQWRARMGAAGFAPVHLGSNAFRQ  513

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            ASMLL LF+GGDGY+VEEN+G L L WHTRPLIATSAW++
Sbjct  514  ASMLLTLFSGGDGYKVEENNGCLMLAWHTRPLIATSAWQI  553



>gb|AHB17746.1| GA repressor DELLA [Actinidia deliciosa]
Length=581

 Score =   259 bits (662),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 138/162 (85%), Gaps = 3/162 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA +KVL+ ++ M+P+IVTVVEQEANHNG   ++RF E+LHYYST+FDSLE    ++  
Sbjct  420  PGAIDKVLASIKAMRPKIVTVVEQEANHNGSGLVERFNEALHYYSTMFDSLESSGLTQ--  477

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
             V +QD VMSEVYLGRQICNVVACEG DRVERHETL+QWRTR  SAGF   HLGSNA+KQ
Sbjct  478  -VSNQDLVMSEVYLGRQICNVVACEGTDRVERHETLSQWRTRMGSAGFDPAHLGSNAFKQ  536

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAW+LT+
Sbjct  537  ASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWQLTA  578



>gb|KFK33379.1| rga1 protein [Arabis alpina]
Length=590

 Score =   259 bits (663),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 136/162 (84%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG  +S   
Sbjct  434  PGAIEKVLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEGAPSS---  490

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICN+VACEG DRVERHETL QW  RF S+GF   HLGSNA+KQ
Sbjct  491  ----QDKVMSEVYLGKQICNLVACEGPDRVERHETLNQWTNRFGSSGFVPAHLGSNAFKQ  546

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALF GG+GYRVEE++G L LGWHTRPLI TSAWKLT+
Sbjct  547  ASMLLALFNGGEGYRVEESNGCLMLGWHTRPLITTSAWKLTA  588



>gb|ABI30654.1| putative gibberellin signaling DELLA protein LA [Pisum sativum]
Length=592

 Score =   259 bits (662),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 142/169 (84%), Gaps = 4/169 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASE--  498
            PG+ +KVL+ V+ + P+IVT+VEQEANHNGPVFMDRFTE+LHYYS+LFDSLEG + S   
Sbjct  425  PGSIDKVLNTVKKINPKIVTIVEQEANHNGPVFMDRFTEALHYYSSLFDSLEGSSNSNPA  484

Query  497  GGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAY  318
            G     QD +MSE+YLGRQICNVVA EGVDRVERHETL+QWR+R  SAGF  VHLGSNA+
Sbjct  485  GSGSSSQDLLMSELYLGRQICNVVAYEGVDRVERHETLSQWRSRMGSAGFDPVHLGSNAF  544

Query  317  KQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS*LTES  171
            KQAS LLALFAGGDGYRVEEN+G L LGWHTR LIATSAWKL   L+ES
Sbjct  545  KQASTLLALFAGGDGYRVEENNGCLMLGWHTRSLIATSAWKLP--LSES  591



>ref|XP_009779843.1| PREDICTED: DELLA protein GAI-like isoform X4 [Nicotiana sylvestris]
Length=572

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 139/172 (81%), Gaps = 10/172 (6%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL+ ++ M P+IVT+VEQEANHN  VF+DRF E+LHYYST+FDSLE   ++   
Sbjct  395  PGAVEKVLNSIKQMNPKIVTIVEQEANHNASVFLDRFNEALHYYSTMFDSLESSVSTSSV  454

Query  491  A----------VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSA  342
            +          V +QD VMSEVYLGRQICNVVACEGVDRVERHETL+QWR R  SAGF  
Sbjct  455  STSSTGLTQPIVNNQDLVMSEVYLGRQICNVVACEGVDRVERHETLSQWRVRMNSAGFDP  514

Query  341  VHLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            VHLGSNA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAW+L +
Sbjct  515  VHLGSNAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWRLKA  566



>ref|XP_009370101.1| PREDICTED: DELLA protein GAI-like [Pyrus x bretschneideri]
Length=580

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 135/161 (84%), Gaps = 6/161 (4%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            GA +KVLS ++ MKP+IVT+VEQEANHNGP F+DRFTE+LHYYS+LFDSLEG +      
Sbjct  423  GAVDKVLSSIKAMKPKIVTIVEQEANHNGPAFLDRFTEALHYYSSLFDSLEGSSGPS---  479

Query  488  VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQA  309
               QD VMSEVYLGRQICNVVACEG DRVERHETL QWR R  SAGF +VHLGSNA+KQA
Sbjct  480  ---QDLVMSEVYLGRQICNVVACEGGDRVERHETLTQWRGRMDSAGFDSVHLGSNAFKQA  536

Query  308  SMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            SMLLALFAG DGYRVEEN+G L LGWHT+PLI TSAWKL S
Sbjct  537  SMLLALFAGVDGYRVEENNGSLMLGWHTQPLIVTSAWKLAS  577



>gb|AEX97110.1| spur-type DELLA protein [Malus domestica]
Length=580

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 134/161 (83%), Gaps = 6/161 (4%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            GA +KVLS ++ MKP+IVT+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG +      
Sbjct  423  GAVDKVLSSIKAMKPKIVTIVEQEANHNGPVFLDRFTEALHYYSSLFDSLEGSSGPS---  479

Query  488  VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQA  309
               QD VMSEVYLGRQICNVVACEG DRVERHETL QWR R  SAGF  VHLGSNA+KQA
Sbjct  480  ---QDLVMSEVYLGRQICNVVACEGGDRVERHETLTQWRGRMDSAGFDPVHLGSNAFKQA  536

Query  308  SMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            SMLL LFAG DGYRV+EN+G L LGWHTRPLI TSAWKL S
Sbjct  537  SMLLDLFAGVDGYRVQENNGSLMLGWHTRPLIVTSAWKLAS  577



>ref|XP_008460522.1| PREDICTED: DELLA protein GAI-like [Cucumis melo]
Length=603

 Score =   258 bits (659),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 138/160 (86%), Gaps = 2/160 (1%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  ++  KP+IVT+VEQEANHNGPVF+DRFTE+LHYYS LFDSLEG  +S G 
Sbjct  440  PGAIEKVLGSIKTTKPKIVTIVEQEANHNGPVFLDRFTEALHYYSNLFDSLEG--SSSGF  497

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                +D ++SEVYLG+QICNVVACEG +RVERHE+L QWRTR +SAGF  VHLGSNA+KQ
Sbjct  498  EPGSEDVLLSEVYLGKQICNVVACEGTNRVERHESLTQWRTRMESAGFDPVHLGSNAFKQ  557

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            ASMLLALFAGG+GYRVEEN+G L LGWHTRPLIATSAW+L
Sbjct  558  ASMLLALFAGGEGYRVEENNGCLMLGWHTRPLIATSAWQL  597



>gb|ABS50250.1| DELLA protein [Malus hupehensis]
Length=580

 Score =   257 bits (657),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 134/161 (83%), Gaps = 6/161 (4%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            GA +KVLS ++ MKP+IVT+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG +      
Sbjct  423  GAVDKVLSSIKAMKPKIVTIVEQEANHNGPVFLDRFTEALHYYSSLFDSLEGSSGPS---  479

Query  488  VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQA  309
               QD VMSEVYLGRQICNVVACEG DRVERHETL QWR R  SAGF  VHLGSNA+KQA
Sbjct  480  ---QDLVMSEVYLGRQICNVVACEGGDRVERHETLTQWRGRMDSAGFDPVHLGSNAFKQA  536

Query  308  SMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            SMLL LFAG DGYRV+EN+G L LGWHTRPLI TSAWKL S
Sbjct  537  SMLLDLFAGVDGYRVQENNGSLMLGWHTRPLIVTSAWKLAS  577



>gb|AAY56749.1| DELLA protein [Malus domestica]
Length=580

 Score =   257 bits (657),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 134/161 (83%), Gaps = 6/161 (4%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            GA +KVLS ++ MKP+IVT+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG +      
Sbjct  423  GAVDKVLSSIKAMKPKIVTIVEQEANHNGPVFLDRFTEALHYYSSLFDSLEGSSGPS---  479

Query  488  VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQA  309
               QD VMSEVYLGRQICNVVACEG DRVERHETL QWR R  SAGF  VHLGSNA+KQA
Sbjct  480  ---QDLVMSEVYLGRQICNVVACEGGDRVERHETLTQWRGRMDSAGFDPVHLGSNAFKQA  536

Query  308  SMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            SMLL LFAG DGYRV+EN+G L LGWHTRPLI TSAWKL S
Sbjct  537  SMLLDLFAGVDGYRVQENNGSLMLGWHTRPLIVTSAWKLAS  577



>gb|ABO61516.1| GAI1 [Glycine max]
Length=523

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 134/162 (83%), Gaps = 6/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLSVV+ ++PEI+TVVEQEANHNG  F+DRFTESLHYYSTLFDSLEG       
Sbjct  361  PGAVEKVLSVVRQIRPEILTVVEQEANHNGLSFVDRFTESLHYYSTLFDSLEGSP-----  415

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
             V   DK MSEVYLG+QICNVVACEG+DRVERHETL QWR RF S GFS VHLGSNAYKQ
Sbjct  416  -VNPNDKAMSEVYLGKQICNVVACEGMDRVERHETLNQWRNRFGSTGFSPVHLGSNAYKQ  474

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLL+LF GGDGYRVEEN+G L LGW  RPLIATS W+L +
Sbjct  475  ASMLLSLFGGGDGYRVEENNGCLMLGWPPRPLIATSVWQLAT  516



>ref|XP_010554410.1| PREDICTED: DELLA protein GAI-like [Tarenaya hassleriana]
Length=609

 Score =   258 bits (659),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 134/160 (84%), Gaps = 7/160 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL VV+ +KPEI TVVEQE+NHN P F++RFTESLHYYST+FDSLEG   S   
Sbjct  449  PGAIEKVLGVVRQIKPEIFTVVEQESNHNSPAFLNRFTESLHYYSTMFDSLEGVGNS---  505

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICNVVACEG DRVERHE+LAQWRTRF+ AGFS  HLGSNA+KQ
Sbjct  506  ----QDKVMSEVYLGKQICNVVACEGPDRVERHESLAQWRTRFELAGFSPAHLGSNAFKQ  561

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            ASM+L+LF GG GY VEENDG L LGWHTRPLI TSAWKL
Sbjct  562  ASMILSLFNGGQGYGVEENDGCLMLGWHTRPLITTSAWKL  601



>ref|XP_003552980.1| PREDICTED: DELLA protein GAI-like [Glycine max]
 gb|ACJ61497.1| gibberellic acid-insensitive mutant protein [Glycine max]
Length=584

 Score =   257 bits (657),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG+ +KVL  V+ +KP+IVT+VEQEANHNGP F+DRFTE+LHYYS+LFDSLEG ++S G 
Sbjct  415  PGSVDKVLDTVKKIKPKIVTIVEQEANHNGPGFLDRFTEALHYYSSLFDSLEGSSSSTGL  474

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
               +QD +MSE+YLGRQICNVVA EG DRVERHETL+QWR R  SAGF  VHLGSNA+KQ
Sbjct  475  GSPNQDLLMSELYLGRQICNVVANEGADRVERHETLSQWRGRLDSAGFDPVHLGSNAFKQ  534

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAWKL S
Sbjct  535  ASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWKLPS  576



>ref|XP_006395878.1| hypothetical protein EUTSA_v10005482mg [Eutrema salsugineum]
 dbj|BAJ33650.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ33164.1| hypothetical protein EUTSA_v10005482mg [Eutrema salsugineum]
Length=616

 Score =   258 bits (659),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 136/162 (84%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG  EKVL VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG  +S   
Sbjct  460  PGGIEKVLGVVKQIKPVIFTVVEQESNHNGPVFVDRFTESLHYYSTLFDSLEGVPSS---  516

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICN+VACEG DRVERHE L+QW  RF S+GF+  HLGSNA+KQ
Sbjct  517  ----QDKVMSEVYLGKQICNLVACEGPDRVERHEMLSQWANRFGSSGFAPAHLGSNAFKQ  572

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALF GG+GYRVEEN+G L LGWHTRPLI TSAWKL++
Sbjct  573  ASMLLALFNGGEGYRVEENNGCLMLGWHTRPLITTSAWKLST  614



>ref|XP_007163387.1| hypothetical protein PHAVU_001G230500g [Phaseolus vulgaris]
 gb|ESW35381.1| hypothetical protein PHAVU_001G230500g [Phaseolus vulgaris]
Length=596

 Score =   257 bits (657),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG+ +KV+  V+++ P+IVT+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG ++S G 
Sbjct  432  PGSVDKVMDTVKNLNPKIVTIVEQEANHNGPVFLDRFTEALHYYSSLFDSLEGSSSSTGL  491

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD +MSEVYLG+QICNVVA EGV+RVERHETL+QWR R  SAGF  VHLGSNA+KQ
Sbjct  492  GSPSQDLLMSEVYLGKQICNVVAYEGVERVERHETLSQWRGRMGSAGFDPVHLGSNAFKQ  551

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAWKL S
Sbjct  552  ASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWKLPS  593



>dbj|BAF62637.1| DELLA protein [Phaseolus vulgaris]
Length=596

 Score =   257 bits (657),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG+ +KV+  V+++ P+IVT+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG ++S G 
Sbjct  432  PGSVDKVMDTVKNLNPKIVTIVEQEANHNGPVFLDRFTEALHYYSSLFDSLEGSSSSTGL  491

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD +MSEVYLG+QICNVVA EGV+RVERHETL+QWR R  SAGF  VHLGSNA+KQ
Sbjct  492  GSPSQDLLMSEVYLGKQICNVVAYEGVERVERHETLSQWRGRMGSAGFDPVHLGSNAFKQ  551

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAWKL S
Sbjct  552  ASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWKLPS  593



>gb|ACN33960.1| unknown [Zea mays]
Length=447

 Score =   253 bits (645),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 133/167 (80%), Gaps = 7/167 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEG-  495
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG  A  G 
Sbjct  275  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGAGAGSGQ  334

Query  494  ------GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  333
                   A    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR+R   +GF+ VHL
Sbjct  335  STDASPAAAGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRSRLGGSGFAPVHL  394

Query  332  GSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            GSNAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW++
Sbjct  395  GSNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRV  441



>gb|EYU45810.1| hypothetical protein MIMGU_mgv1a003644mg [Erythranthe guttata]
Length=572

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 136/168 (81%), Gaps = 10/168 (6%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAA----  504
            PGA EKVL+ ++ M P+IVTVVEQEANHNG VF+DRF E+LHYYST+FDSLE C      
Sbjct  407  PGALEKVLNSIRAMNPKIVTVVEQEANHNGGVFLDRFNEALHYYSTMFDSLESCGGVTQQ  466

Query  503  --SEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLG  330
                GG    QD VM+EVYLGRQICNVVAC+G DRVERHETL QWR R  SAGF   HLG
Sbjct  467  LPPNGG----QDLVMTEVYLGRQICNVVACDGADRVERHETLPQWRRRMGSAGFEPAHLG  522

Query  329  SNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            SNA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+LT+
Sbjct  523  SNAHKQASMLLALFAGGDGYRVEENEGCLMLGWHTRPLIATSAWRLTA  570



>gb|ACN36682.1| unknown [Zea mays]
Length=447

 Score =   252 bits (644),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 133/167 (80%), Gaps = 7/167 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEG-  495
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG  A  G 
Sbjct  275  PGALEKVLGTVRAVRPRIVTVVEQEANHNPGTFLDRFTESLHYYSTMFDSLEGAGAGSGQ  334

Query  494  ------GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  333
                   A    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR+R   +GF+ VHL
Sbjct  335  STDASPAAAGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRSRLGGSGFAPVHL  394

Query  332  GSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            GSNAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW++
Sbjct  395  GSNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRV  441



>ref|XP_010551797.1| PREDICTED: DELLA protein RGL1-like [Tarenaya hassleriana]
Length=553

 Score =   255 bits (651),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 135/162 (83%), Gaps = 8/162 (5%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG+ EKV S ++ +KP+I+TVVEQEANHNG VF+DRFTESLHYYS+LFDSLEG  +    
Sbjct  395  PGSIEKVFSTIKSIKPDIITVVEQEANHNGAVFLDRFTESLHYYSSLFDSLEGPPS----  450

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD+VMSE++LGRQI N+VACEG DRVERHETLAQWRTRF SAGF  VHLGSNAYKQ
Sbjct  451  ----QDRVMSELFLGRQILNLVACEGPDRVERHETLAQWRTRFNSAGFKPVHLGSNAYKQ  506

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLL LF+G DGY VEENDG L LGW TRPLIATSAW+L +
Sbjct  507  ASMLLDLFSGADGYNVEENDGCLLLGWQTRPLIATSAWQLAA  548



>gb|AFD62413.1| reduced height-2 [Eragrostis tef]
 gb|AFD62414.1| reduced height-2 [Eragrostis tef]
 gb|AFD62415.1| reduced height-2 [Eragrostis tef]
 gb|AFD62416.1| reduced height-2 [Eragrostis tef]
 gb|AFD62417.1| reduced height-2 [Eragrostis tef]
 gb|AFD62418.1| reduced height-2 [Eragrostis tef]
Length=617

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 135/166 (81%), Gaps = 4/166 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEG-  495
            PGA EKVL  V+ ++P+IVTVVEQEANHN   F+DRFT+SLHYYST+FDSLEG A+ +  
Sbjct  451  PGALEKVLGTVRAVRPKIVTVVEQEANHNSGSFLDRFTQSLHYYSTMFDSLEGGASGQSD  510

Query  494  ---GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSN  324
               GA    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF  VHLGSN
Sbjct  511  ASPGAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLVQWRNRLGRAGFEPVHLGSN  570

Query  323  AYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            AYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW+L +
Sbjct  571  AYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRLAA  616



>ref|XP_004155733.1| PREDICTED: DELLA protein GAI-like [Cucumis sativus]
 emb|CCG14221.1| gibberellin DELLA protein [Cucumis sativus]
 gb|KGN51056.1| hypothetical protein Csa_5G421370 [Cucumis sativus]
Length=603

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 139/160 (87%), Gaps = 2/160 (1%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  ++  KP+IVT+VEQEANHNGP+F+DRFTE+LHYYS LFDSLEG  +S G 
Sbjct  440  PGAIEKVLGSIKTTKPKIVTIVEQEANHNGPIFLDRFTEALHYYSNLFDSLEG--SSSGF  497

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                +D ++SEVYLG+QICNVVACEG +RVERHE+L+QWR+R +S+GF  VHLGSNA+KQ
Sbjct  498  EPGSEDVLLSEVYLGKQICNVVACEGTNRVERHESLSQWRSRMESSGFDPVHLGSNAFKQ  557

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            ASMLLALFAGG+GYRVEEN+G L LGWHTRPLIATSAW+L
Sbjct  558  ASMLLALFAGGEGYRVEENNGCLMLGWHTRPLIATSAWQL  597



>ref|XP_008381346.1| PREDICTED: DELLA protein GAI [Malus domestica]
Length=580

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 133/161 (83%), Gaps = 6/161 (4%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            GA +KVLS ++ MKP+I T+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG +      
Sbjct  423  GAVDKVLSSIKAMKPKIXTIVEQEANHNGPVFLDRFTEALHYYSSLFDSLEGSSGPS---  479

Query  488  VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQA  309
               QD VMSEVYLGRQICNVVACEG DRVERHETL QWR R  SAGF  VHLGSNA+KQA
Sbjct  480  ---QDLVMSEVYLGRQICNVVACEGGDRVERHETLTQWRGRMDSAGFDPVHLGSNAFKQA  536

Query  308  SMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            SMLL LFAG DGYRV+EN+G L LGWHTRPLI TSAWKL S
Sbjct  537  SMLLDLFAGVDGYRVQENNGSLMLGWHTRPLIVTSAWKLAS  577



>sp|Q5BN22.1|RGA2_BRACM RecName: Full=DELLA protein RGA2; AltName: Full=BrRGA2; AltName: 
Full=RGA-like protein 2 [Brassica rapa]
 gb|AAX33298.1| DELLA protein [Brassica rapa]
Length=579

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 136/161 (84%), Gaps = 7/161 (4%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            G  EKVL VV+ +KP I TVVEQE++HNGPVF+DRFTESLHYYSTLFDSLEG  +S    
Sbjct  424  GGIEKVLGVVKQIKPVIFTVVEQESSHNGPVFLDRFTESLHYYSTLFDSLEGVPSS----  479

Query  488  VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQA  309
               QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF S+GF+  HLGSNA+KQA
Sbjct  480  ---QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWANRFGSSGFAPAHLGSNAFKQA  536

Query  308  SMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            SMLLALF GG+GYRVEEN+G L LGWHTRPLI TSAWKL++
Sbjct  537  SMLLALFNGGEGYRVEENNGCLMLGWHTRPLITTSAWKLSA  577



>gb|AFA35960.1| ELLA domain GRAS family transcription factor [Nicotiana attenuata]
Length=561

 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 138/167 (83%), Gaps = 5/167 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL+ ++ M P+IVT+VEQEANHN  VF+DRF E+LHYYST+FDSLE   ++   
Sbjct  389  PGAVEKVLNSIKQMNPKIVTIVEQEANHNASVFLDRFNEALHYYSTMFDSLESSVSTSST  448

Query  491  A-----VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGS  327
                  V  QD VMSEVYLGRQICNVVACEGVDRVERHETL+QWR R  SAGF+ VHLGS
Sbjct  449  GLTQPIVNSQDLVMSEVYLGRQICNVVACEGVDRVERHETLSQWRVRMNSAGFNPVHLGS  508

Query  326  NAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            NA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAW+L +
Sbjct  509  NAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWRLKA  555



>gb|EYU30908.1| hypothetical protein MIMGU_mgv1a024641mg [Erythranthe guttata]
Length=532

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 135/162 (83%), Gaps = 1/162 (1%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASE-G  495
            PGA EKVL  ++ M P+IVTVVEQEA+HNG VFMDRF ESLHYYST+FDSLEG   ++  
Sbjct  368  PGAVEKVLGSIRAMGPKIVTVVEQEADHNGVVFMDRFNESLHYYSTMFDSLEGSGLTQPD  427

Query  494  GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYK  315
            G    QD  M+EVYLGRQICNVVAC+G +RVERHETLA+WR R  SAGF   HLGSNA+K
Sbjct  428  GGGGGQDLFMTEVYLGRQICNVVACDGAERVERHETLAKWRRRMGSAGFEPAHLGSNAFK  487

Query  314  QASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  189
            QASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAW+LT
Sbjct  488  QASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWRLT  529



>ref|XP_009796771.1| PREDICTED: DELLA protein GAI-like [Nicotiana sylvestris]
Length=568

 Score =   254 bits (650),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 138/167 (83%), Gaps = 5/167 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL+ ++ M P+IVT+VEQEANHN  VF+DRF E+LHYYST+FDSLE   ++   
Sbjct  395  PGAVEKVLNSIKQMNPKIVTIVEQEANHNASVFLDRFNEALHYYSTMFDSLESSVSTSST  454

Query  491  A-----VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGS  327
                  V +QD VMSEVYLGRQICNVVACEGVDRVERHETL+QWR R  SAGF  VHLGS
Sbjct  455  GLTQPIVNNQDLVMSEVYLGRQICNVVACEGVDRVERHETLSQWRVRMNSAGFDPVHLGS  514

Query  326  NAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            NA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAW+L +
Sbjct  515  NAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWRLKA  561



>gb|AFD62385.1| reduced height-1 [Eragrostis tef]
 gb|AFD62386.1| reduced height-1 [Eragrostis tef]
 gb|AFD62387.1| reduced height-1 [Eragrostis tef]
 gb|AFD62388.1| reduced height-1 [Eragrostis tef]
Length=618

 Score =   256 bits (653),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 134/167 (80%), Gaps = 5/167 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCA-----  507
            PGA EKVL  V+ ++P+IVTVVEQEANHN   F+DRFT+SLHYYST+FDSLEG       
Sbjct  451  PGALEKVLGTVRAVRPKIVTVVEQEANHNSGSFLDRFTQSLHYYSTMFDSLEGAGSGQSD  510

Query  506  ASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGS  327
            A+  GA    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF  VHLGS
Sbjct  511  AASPGAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLVQWRNRLGRAGFEPVHLGS  570

Query  326  NAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            NAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW+L +
Sbjct  571  NAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRLAA  617



>emb|CDY36236.1| BnaC07g20900D [Brassica napus]
Length=556

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 134/162 (83%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG  EKV  VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG  +S   
Sbjct  400  PGGIEKVFGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEGAPSS---  456

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF S+GF+  HLGSNA+KQ
Sbjct  457  ----QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWSNRFGSSGFAPAHLGSNAFKQ  512

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            AS LLALF GG+GYRVEEN+G L L WHTRPLI TSAWKL++
Sbjct  513  ASTLLALFNGGEGYRVEENNGCLMLSWHTRPLITTSAWKLSA  554



>ref|XP_009779842.1| PREDICTED: DELLA protein GAI-like isoform X3 [Nicotiana sylvestris]
Length=567

 Score =   254 bits (649),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 138/167 (83%), Gaps = 5/167 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL+ ++ M P+IVT+VEQEANHN  VF+DRF E+LHYYST+FDSLE   ++   
Sbjct  395  PGAVEKVLNSIKQMNPKIVTIVEQEANHNASVFLDRFNEALHYYSTMFDSLESSVSTSST  454

Query  491  A-----VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGS  327
                  V +QD VMSEVYLGRQICNVVACEGVDRVERHETL+QWR R  SAGF  VHLGS
Sbjct  455  GLTQPIVNNQDLVMSEVYLGRQICNVVACEGVDRVERHETLSQWRVRMNSAGFDPVHLGS  514

Query  326  NAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            NA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAW+L +
Sbjct  515  NAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWRLKA  561



>dbj|BAG16380.1| GRAS family transcription factor [Brassica rapa var. perviridis]
Length=570

 Score =   254 bits (649),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 136/161 (84%), Gaps = 7/161 (4%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            G  EKVL VV+ +KP I TVVEQE++HNGPVF+DRFTESLHYYSTLFDSLEG  +S    
Sbjct  415  GGIEKVLGVVKQIKPVIFTVVEQESSHNGPVFLDRFTESLHYYSTLFDSLEGVPSS----  470

Query  488  VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQA  309
               QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF ++GF+  HLGSNA+KQA
Sbjct  471  ---QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWANRFGTSGFAPAHLGSNAFKQA  527

Query  308  SMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            SMLLALF GG+GYRVEEN+G L LGWHTRPLI TSAWKL++
Sbjct  528  SMLLALFNGGEGYRVEENNGCLMLGWHTRPLITTSAWKLSA  568



>ref|XP_009779840.1| PREDICTED: DELLA protein GAI-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009779841.1| PREDICTED: DELLA protein GAI-like isoform X2 [Nicotiana sylvestris]
Length=567

 Score =   254 bits (648),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 138/167 (83%), Gaps = 5/167 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL+ ++ M P+IVT+VEQEANHN  VF+DRF E+LHYYST+FDSLE   ++   
Sbjct  395  PGAVEKVLNSIKQMNPKIVTIVEQEANHNASVFLDRFNEALHYYSTMFDSLESSVSTSST  454

Query  491  A-----VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGS  327
                  V +QD VMSEVYLGRQICNVVACEGVDRVERHETL+QWR R  SAGF  VHLGS
Sbjct  455  GLTQPIVNNQDLVMSEVYLGRQICNVVACEGVDRVERHETLSQWRVRMNSAGFDPVHLGS  514

Query  326  NAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            NA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAW+L +
Sbjct  515  NAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWRLKA  561



>gb|AFD62419.1| reduced height-2 [Eragrostis tef]
 gb|AFD62420.1| reduced height-2 [Eragrostis tef]
 gb|AFD62421.1| reduced height-2 [Eragrostis tef]
Length=617

 Score =   255 bits (651),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 134/166 (81%), Gaps = 4/166 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEG-  495
            PGA EKVL  V+ ++P+IVTVVEQEANHN   F+DRFT+SLHYYST+FDSLEG  + +  
Sbjct  451  PGALEKVLGTVRAVRPKIVTVVEQEANHNSGSFLDRFTQSLHYYSTMFDSLEGGGSGQSD  510

Query  494  ---GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSN  324
               GA    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF  VHLGSN
Sbjct  511  ASPGAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLVQWRNRLGRAGFEPVHLGSN  570

Query  323  AYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            AYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW+L +
Sbjct  571  AYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRLAA  616



>gb|AFD62396.1| reduced height-2 [Eragrostis tef]
 gb|AFD62397.1| reduced height-2 [Eragrostis tef]
 gb|AFD62398.1| reduced height-2 [Eragrostis tef]
 gb|AFD62399.1| reduced height-2 [Eragrostis tef]
 gb|AFD62400.1| reduced height-2 [Eragrostis tef]
 gb|AFD62401.1| reduced height-2 [Eragrostis tef]
 gb|AFD62402.1| reduced height-2 [Eragrostis tef]
 gb|AFD62403.1| reduced height-2 [Eragrostis tef]
 gb|AFD62404.1| reduced height-2 [Eragrostis tef]
 gb|AFD62405.1| reduced height-2 [Eragrostis tef]
 gb|AFD62406.1| reduced height-2 [Eragrostis tef]
 gb|AFD62407.1| reduced height-2 [Eragrostis tef]
 gb|AFD62408.1| reduced height-2 [Eragrostis tef]
 gb|AFD62409.1| reduced height-2 [Eragrostis tef]
 gb|AFD62410.1| reduced height-2 [Eragrostis tef]
 gb|AFD62411.1| reduced height-2 [Eragrostis tef]
 gb|AFD62412.1| reduced height-2 [Eragrostis tef]
Length=617

 Score =   255 bits (651),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 134/166 (81%), Gaps = 4/166 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEG-  495
            PGA EKVL  V+ ++P+IVTVVEQEANHN   F+DRFT+SLHYYST+FDSLEG  + +  
Sbjct  451  PGALEKVLGTVRAVRPKIVTVVEQEANHNSGSFLDRFTQSLHYYSTMFDSLEGGGSGQSD  510

Query  494  ---GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSN  324
               GA    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF  VHLGSN
Sbjct  511  ASPGAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLVQWRNRLGRAGFEPVHLGSN  570

Query  323  AYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            AYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW+L +
Sbjct  571  AYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRLAA  616



>gb|AFD62391.1| reduced height-2 [Eragrostis tef]
 gb|AFD62392.1| reduced height-2 [Eragrostis tef]
 gb|AFD62393.1| reduced height-2 [Eragrostis tef]
 gb|AFD62394.1| reduced height-2 [Eragrostis tef]
 gb|AFD62395.1| reduced height-2 [Eragrostis tef]
Length=617

 Score =   255 bits (651),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 134/166 (81%), Gaps = 4/166 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEG-  495
            PGA EKVL  V+ ++P+IVTVVEQEANHN   F+DRFT+SLHYYST+FDSLEG  + +  
Sbjct  451  PGALEKVLGTVRAVRPKIVTVVEQEANHNSGSFLDRFTQSLHYYSTMFDSLEGGGSGQSD  510

Query  494  ---GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSN  324
               GA    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF  VHLGSN
Sbjct  511  ASPGAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLVQWRNRLGRAGFEPVHLGSN  570

Query  323  AYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            AYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW+L +
Sbjct  571  AYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRLAA  616



>gb|AFD62360.1| reduced height-1 [Eragrostis tef]
 gb|AFD62361.1| reduced height-1 [Eragrostis tef]
 gb|AFD62362.1| reduced height-1 [Eragrostis tef]
 gb|AFD62363.1| reduced height-1 [Eragrostis tef]
 gb|AFD62364.1| reduced height-1 [Eragrostis tef]
 gb|AFD62365.1| reduced height-1 [Eragrostis tef]
 gb|AFD62366.1| reduced height-1 [Eragrostis tef]
 gb|AFD62367.1| reduced height-1 [Eragrostis tef]
 gb|AFD62368.1| reduced height-1 [Eragrostis tef]
 gb|AFD62379.1| reduced height-1 [Eragrostis tef]
 gb|AFD62380.1| reduced height-1 [Eragrostis tef]
 gb|AFD62381.1| reduced height-1 [Eragrostis tef]
 gb|AFD62382.1| reduced height-1 [Eragrostis tef]
 gb|AFD62383.1| reduced height-1 [Eragrostis tef]
Length=618

 Score =   254 bits (650),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 134/167 (80%), Gaps = 5/167 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCA-----  507
            PGA EKVL  V+ ++P+IVTVVEQEANHN   F+DRFT+SLHYYST+FDSLEG       
Sbjct  451  PGALEKVLGTVRAVRPKIVTVVEQEANHNSGSFLDRFTQSLHYYSTMFDSLEGGGSGQSD  510

Query  506  ASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGS  327
            A+  GA    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF  VHLGS
Sbjct  511  AASPGAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLVQWRNRLGRAGFEPVHLGS  570

Query  326  NAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            NAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW+L +
Sbjct  571  NAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRLAA  617



>gb|AFD62384.1| reduced height-1 [Eragrostis tef]
 gb|AFD62389.1| reduced height-1 [Eragrostis tef]
 gb|AFD62390.1| reduced height-1 [Eragrostis tef]
Length=618

 Score =   254 bits (650),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 134/167 (80%), Gaps = 5/167 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCA-----  507
            PGA EKVL  V+ ++P+IVTVVEQEANHN   F+DRFT+SLHYYST+FDSLEG       
Sbjct  451  PGALEKVLGTVRAVRPKIVTVVEQEANHNSGSFLDRFTQSLHYYSTMFDSLEGGGSGQSD  510

Query  506  ASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGS  327
            A+  GA    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF  VHLGS
Sbjct  511  AASPGAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLVQWRNRLGRAGFEPVHLGS  570

Query  326  NAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            NAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW+L +
Sbjct  571  NAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRLAA  617



>ref|XP_010424927.1| PREDICTED: DELLA protein RGA-like [Camelina sativa]
Length=605

 Score =   254 bits (649),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 135/162 (83%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG  EKVL VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG  +S   
Sbjct  449  PGGIEKVLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEGVPSS---  505

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF S+GF+  HLGSNA+KQ
Sbjct  506  ----QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWGIRFGSSGFAPAHLGSNAFKQ  561

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLL++F  G GYRVEEN+G L LGWHTRPLI TSAWKL++
Sbjct  562  ASMLLSVFNSGQGYRVEENNGCLMLGWHTRPLITTSAWKLSA  603



>gb|AFD62369.1| reduced height-1 [Eragrostis tef]
 gb|AFD62370.1| reduced height-1 [Eragrostis tef]
 gb|AFD62371.1| reduced height-1 [Eragrostis tef]
 gb|AFD62372.1| reduced height-1 [Eragrostis tef]
 gb|AFD62373.1| reduced height-1 [Eragrostis tef]
 gb|AFD62374.1| reduced height-1 [Eragrostis tef]
 gb|AFD62375.1| reduced height-1 [Eragrostis tef]
Length=618

 Score =   254 bits (650),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 134/167 (80%), Gaps = 5/167 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCA-----  507
            PGA EKVL  V+ ++P+IVTVVEQEANHN   F+DRFT+SLHYYST+FDSLEG       
Sbjct  451  PGALEKVLGTVRAVRPKIVTVVEQEANHNSGSFLDRFTQSLHYYSTMFDSLEGGGSGQSD  510

Query  506  ASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGS  327
            A+  GA    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF  VHLGS
Sbjct  511  AASPGAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLVQWRNRLGRAGFEPVHLGS  570

Query  326  NAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            NAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW+L +
Sbjct  571  NAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRLAA  617



>gb|ACL53794.1| unknown [Zea mays]
Length=586

 Score =   254 bits (648),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 133/167 (80%), Gaps = 7/167 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEG-  495
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG  A  G 
Sbjct  414  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGAGAGSGQ  473

Query  494  ------GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  333
                   A    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR+R   +GF+ VHL
Sbjct  474  STDASPAAAGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRSRLGGSGFAPVHL  533

Query  332  GSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            GSNAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW++
Sbjct  534  GSNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRV  580



>ref|XP_010513881.1| PREDICTED: DELLA protein RGA isoform X1 [Camelina sativa]
 ref|XP_010513882.1| PREDICTED: DELLA protein RGA isoform X2 [Camelina sativa]
Length=611

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 135/162 (83%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG  EKVL VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG  +S   
Sbjct  455  PGGIEKVLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEGVPSS---  511

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW +RF S+GF   HLGSNA+KQ
Sbjct  512  ----QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWGSRFGSSGFVPAHLGSNAFKQ  567

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLL++F  G GYRVEEN+G L LGWHTRPLI TSAWKL++
Sbjct  568  ASMLLSVFNSGQGYRVEENNGCLMLGWHTRPLITTSAWKLSA  609



>dbj|BAG16374.1| GRAS family transcription factor [Brassica oleracea var. italica]
Length=569

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 133/159 (84%), Gaps = 7/159 (4%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            G  EKVL VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG  +S    
Sbjct  414  GGIEKVLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEGVPSS----  469

Query  488  VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQA  309
               QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF ++GF+  HLGSNA+KQA
Sbjct  470  ---QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWANRFGTSGFAPAHLGSNAFKQA  526

Query  308  SMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            SMLLALF GG+GY VEEN+G L LGWHTRPLI TSAWKL
Sbjct  527  SMLLALFNGGEGYSVEENNGCLMLGWHTRPLITTSAWKL  565



>sp|Q84TQ7.1|GAI_GOSHI RecName: Full=DELLA protein GAI; AltName: Full=GhGAI; AltName: 
Full=Gibberellic acid-insensitive mutant protein [Gossypium 
hirsutum]
 gb|AAO62757.1| GIA/RGA-like gibberellin response modulator [Gossypium hirsutum]
Length=537

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 131/154 (85%), Gaps = 4/154 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG  EKV+S ++ MKP+IVTVVEQEANHNGPVF+DRFTE+LHYYSTLFDSLEG     G 
Sbjct  379  PGGIEKVVSSIKAMKPKIVTVVEQEANHNGPVFLDRFTEALHYYSTLFDSLEGS----GV  434

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            A   QD  MSE+YLGRQICNVVACEG+DRVERHE L QWRTR ++AG S VHLGSNAYKQ
Sbjct  435  APASQDLAMSELYLGRQICNVVACEGMDRVERHEPLTQWRTRMETAGVSPVHLGSNAYKQ  494

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIA  210
            ASMLLALFA GDGYRVEEN+G L LGWHTRPLIA
Sbjct  495  ASMLLALFASGDGYRVEENNGCLMLGWHTRPLIA  528



>sp|Q9ST48.1|DWRF8_MAIZE RecName: Full=DELLA protein DWARF8; Short=Protein dwarf-8 [Zea 
mays]
 emb|CAB51557.1| gibberellin response modulator [Zea mays]
 gb|ACL52869.1| unknown [Zea mays]
 tpg|DAA50920.1| TPA: dwarf plant8 [Zea mays]
Length=630

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 133/167 (80%), Gaps = 7/167 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEG-  495
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG  A  G 
Sbjct  458  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGAGAGSGQ  517

Query  494  ------GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  333
                   A    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR+R   +GF+ VHL
Sbjct  518  STDASPAAAGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRSRLGGSGFAPVHL  577

Query  332  GSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            GSNAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW++
Sbjct  578  GSNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRV  624



>tpg|DAA50918.1| TPA: dwarf plant8 [Zea mays]
Length=584

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 133/167 (80%), Gaps = 7/167 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEG-  495
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG  A  G 
Sbjct  412  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGAGAGSGQ  471

Query  494  ------GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  333
                   A    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR+R   +GF+ VHL
Sbjct  472  STDASPAAAGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRSRLGGSGFAPVHL  531

Query  332  GSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            GSNAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW++
Sbjct  532  GSNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRV  578



>ref|XP_010109004.1| hypothetical protein L484_027201 [Morus notabilis]
 gb|EXC20644.1| hypothetical protein L484_027201 [Morus notabilis]
Length=584

 Score =   253 bits (645),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 136/160 (85%), Gaps = 7/160 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG+ EKVLS ++ ++P+IVT+VEQEANHNGPVF+DRFTE+LHYYSTLFDSLE    S   
Sbjct  428  PGSIEKVLSSIKAVRPKIVTIVEQEANHNGPVFLDRFTEALHYYSTLFDSLEISPPS---  484

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                +D +MSEVYLG+QICNVVACEG DRVERHE L +WR RF SAGF  VHLGSNA+KQ
Sbjct  485  ----RDLMMSEVYLGKQICNVVACEGPDRVERHENLDRWRDRFGSAGFDRVHLGSNAFKQ  540

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            ASMLLAL+AGG+GYRVEENDG L LGWHTRPLIATSAW+L
Sbjct  541  ASMLLALYAGGEGYRVEENDGCLMLGWHTRPLIATSAWQL  580



>gb|AHB17745.1| GA repressor DELLA [Actinidia deliciosa]
Length=579

 Score =   253 bits (645),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 135/162 (83%), Gaps = 3/162 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA +KVL+ ++ M+P+IVTVVEQEANHNG  F+DRF E+LHYYST+FDSLE    ++  
Sbjct  418  PGAIDKVLASIKAMRPKIVTVVEQEANHNGSGFVDRFNEALHYYSTMFDSLESSGLTQA-  476

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
               +QD VMSEVYLGRQICNVVACEG DRVERHE L+Q RTR  SAGF   HLGSNA++Q
Sbjct  477  --SNQDLVMSEVYLGRQICNVVACEGTDRVERHEMLSQLRTRMDSAGFEPAHLGSNAFRQ  534

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAW+L +
Sbjct  535  ASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWQLAA  576



>ref|XP_009594460.1| PREDICTED: DELLA protein GAI-like [Nicotiana tomentosiformis]
Length=567

 Score =   252 bits (643),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 136/167 (81%), Gaps = 5/167 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL+ ++ M P+IVT+VEQEANHN  VF+DRF E+LHYYST+FDSLE   ++   
Sbjct  395  PGAVEKVLNSIKQMNPKIVTIVEQEANHNASVFLDRFNEALHYYSTMFDSLESSVSTSST  454

Query  491  A-----VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGS  327
                  V +QD VMSEVYLGRQICNVVACEGVDRVERHETL QWR R  SAGF  VHLGS
Sbjct  455  GLTQPIVNNQDLVMSEVYLGRQICNVVACEGVDRVERHETLRQWRVRMNSAGFDPVHLGS  514

Query  326  NAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            NA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAW+  +
Sbjct  515  NAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWRFKA  561



>ref|XP_009101333.1| PREDICTED: DELLA protein RGA1 [Brassica rapa]
 sp|Q5BN23.1|RGA1_BRACM RecName: Full=DELLA protein RGA1; AltName: Full=BrRGA1; AltName: 
Full=RGA-like protein 1 [Brassica rapa]
 gb|AAX33297.1| DELLA protein [Brassica rapa]
Length=573

 Score =   252 bits (643),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 133/161 (83%), Gaps = 7/161 (4%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            G  EKV  VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG  +S    
Sbjct  418  GGIEKVFGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEGAPSS----  473

Query  488  VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQA  309
               QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF S+GF+  HLGSNA+KQA
Sbjct  474  ---QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWSNRFGSSGFAPAHLGSNAFKQA  530

Query  308  SMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            S LLALF GG+GYRVEEN+G L L WHTRPLI TSAWKL++
Sbjct  531  STLLALFNGGEGYRVEENNGCLMLSWHTRPLITTSAWKLSA  571



>ref|XP_010502135.1| PREDICTED: DELLA protein RGA-like [Camelina sativa]
Length=615

 Score =   253 bits (645),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 133/160 (83%), Gaps = 7/160 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG  EKVL VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG  +S   
Sbjct  458  PGGIEKVLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEGVPSS---  514

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF S+GF+  HLGSNA+KQ
Sbjct  515  ----QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWGYRFGSSGFAPAHLGSNAFKQ  570

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            ASMLL++F  G GYRVEEN+G L LGWHTRPLI TSAWKL
Sbjct  571  ASMLLSVFNSGQGYRVEENNGCLMLGWHTRPLITTSAWKL  610



>gb|KEH34625.1| DELLA domain GRAS family transcription factor GAI [Medicago truncatula]
Length=547

 Score =   251 bits (640),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 137/168 (82%), Gaps = 8/168 (5%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASE--  498
            PG+ EKVL+ V+ + P+IVT+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG  +S   
Sbjct  374  PGSVEKVLNTVKKINPKIVTIVEQEANHNGPVFVDRFTEALHYYSSLFDSLEGSNSSSNN  433

Query  497  ------GGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVH  336
                  G     QD +MSE+YLG+QICNVVA EGVDRVERHETL QWR+R  SAGF  VH
Sbjct  434  SNSNSTGLGSPSQDLLMSEIYLGKQICNVVAYEGVDRVERHETLTQWRSRMGSAGFEPVH  493

Query  335  LGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            LGSNA+KQAS LLALFAGGDGYRVEEN+G L LGWHTR LIATSAWKL
Sbjct  494  LGSNAFKQASTLLALFAGGDGYRVEENNGCLMLGWHTRSLIATSAWKL  541



>ref|XP_003560731.1| PREDICTED: DELLA protein SLN1 [Brachypodium distachyon]
Length=623

 Score =   252 bits (644),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 133/167 (80%), Gaps = 5/167 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAA----  504
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG  +    
Sbjct  456  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGSFLDRFTESLHYYSTMFDSLEGAGSGQSE  515

Query  503  -SEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGS  327
             S G A    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF  VHLGS
Sbjct  516  ISPGAAAGATDQVMSEVYLGRQICNVVACEGPERTERHETLGQWRGRLGQAGFETVHLGS  575

Query  326  NAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            NAYKQAS LLALFAGGDGY+VEE DG LTLGWHTRPLIATSAW++ +
Sbjct  576  NAYKQASTLLALFAGGDGYKVEEKDGCLTLGWHTRPLIATSAWRMAA  622



>gb|AAZ08572.1| truncated gibberellic acid-insensitive isoform 1 [Saccharum hybrid 
cultivar Co 419]
 gb|AAZ08573.1| truncated gibberellic acid-insensitive isoform 2 [Saccharum hybrid 
cultivar Co 419]
 gb|AAZ08574.1| truncated gibberellic acid-insensitive isoform 3 [Saccharum hybrid 
cultivar Co 419]
Length=442

 Score =   248 bits (632),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 131/167 (78%), Gaps = 5/167 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEG-  495
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG  + +  
Sbjct  275  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGAGSGQST  334

Query  494  ----GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGS  327
                 A    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   +GF  VHLGS
Sbjct  335  DASPAAAGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGGSGFEPVHLGS  394

Query  326  NAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            NAYKQAS LLALF GGDGY+VEE DG LTLGWHTRPLIATSAW+L +
Sbjct  395  NAYKQASTLLALFNGGDGYKVEEKDGCLTLGWHTRPLIATSAWRLAA  441



>gb|ADD71137.1| DELLA protein [Brassica napus]
Length=579

 Score =   251 bits (641),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 135/161 (84%), Gaps = 7/161 (4%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            G  EKVL VV+ +KP I TVVEQE++HNGP F+DRFTESLHYYSTLFDSLEG  +S    
Sbjct  424  GGIEKVLGVVKQIKPVIFTVVEQESSHNGPDFLDRFTESLHYYSTLFDSLEGVPSS----  479

Query  488  VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQA  309
               QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF ++GF+  HLGSNA+KQA
Sbjct  480  ---QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWANRFGTSGFAPAHLGSNAFKQA  536

Query  308  SMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            SMLLALF GG+GYRVEEN+G L LGWHTRPLI TSAWKL++
Sbjct  537  SMLLALFNGGEGYRVEENNGCLMLGWHTRPLITTSAWKLSA  577



>emb|CDY17662.1| BnaA06g34810D [Brassica napus]
Length=572

 Score =   250 bits (639),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 133/161 (83%), Gaps = 7/161 (4%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            G  EKV  VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG  +S    
Sbjct  417  GGIEKVFGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEGAPSS----  472

Query  488  VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQA  309
               QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF S+GF+  HLGSNA+KQA
Sbjct  473  ---QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWSNRFGSSGFAPAHLGSNAFKQA  529

Query  308  SMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            S LLALF GG+GYRVE+N+G L L WHTRPLI TSAWKL++
Sbjct  530  STLLALFNGGEGYRVEKNNGCLMLSWHTRPLITTSAWKLSA  570



>gb|AFC88481.1| DELLA protein [Rosa lucieae]
Length=562

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 132/162 (81%), Gaps = 6/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKV++ ++ M P+IVT+VEQEANHNGPVF+DRF ESLHYYS+LFDSLEG +     
Sbjct  404  PGAIEKVMASIKAMNPKIVTMVEQEANHNGPVFLDRFNESLHYYSSLFDSLEGSSGPS--  461

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                +D VMSEVYLGRQICNVVAC+G DRVERHETL QWR R   AGF  VHLGSN +KQ
Sbjct  462  ----EDLVMSEVYLGRQICNVVACDGGDRVERHETLTQWRNRLARAGFEPVHLGSNVFKQ  517

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            A  LLAL+AGG GY+VEEN+G LTLGWHTRPLIATSAW+L S
Sbjct  518  AQTLLALYAGGGGYQVEENNGSLTLGWHTRPLIATSAWQLAS  559



>ref|XP_002876760.1| RGA1 protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53019.1| RGA1 protein [Arabidopsis lyrata subsp. lyrata]
Length=580

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 135/162 (83%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG  EKVL VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG  +S   
Sbjct  423  PGGIEKVLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEGVPSS---  479

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF S+GF+  +LGSNA+KQ
Sbjct  480  ----QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWGNRFGSSGFAPANLGSNAFKQ  535

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLL+++  G GYRVEEN+G L LGWHTRPLI TSAWKL++
Sbjct  536  ASMLLSVYNSGQGYRVEENNGCLMLGWHTRPLITTSAWKLST  577



>gb|EPS67815.1| hypothetical protein M569_06957, partial [Genlisea aurea]
Length=516

 Score =   248 bits (633),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 136/162 (84%), Gaps = 3/162 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG---CAAS  501
            PG+ + VL +V+++KPEI+TVVEQEANH G +F+DRF E+LHYYSTLFDSLE     AA+
Sbjct  355  PGSIDGVLKLVRELKPEILTVVEQEANHGGNIFLDRFNEALHYYSTLFDSLESGAAAAAA  414

Query  500  EGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNA  321
              G+  D+D++M+EVYLGRQIC++VACEG DRVERHETLAQWR RF S GF+ V LGSN 
Sbjct  415  ADGSATDEDRLMTEVYLGRQICDIVACEGADRVERHETLAQWRARFGSRGFTPVRLGSNV  474

Query  320  YKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  195
            YKQA +LL LFAGGDGYRVEENDG L LGWHTRPLIATSAWK
Sbjct  475  YKQAILLLGLFAGGDGYRVEENDGCLMLGWHTRPLIATSAWK  516



>ref|XP_009590329.1| PREDICTED: DELLA protein GAI-like [Nicotiana tomentosiformis]
Length=560

 Score =   249 bits (635),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 135/167 (81%), Gaps = 5/167 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL+ ++ M P+IVT+VEQEANHN  VF+DRF E+LHYYST+FDSLE   ++   
Sbjct  388  PGAVEKVLNSIKQMNPKIVTIVEQEANHNASVFLDRFNEALHYYSTMFDSLESSVSTSST  447

Query  491  A-----VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGS  327
                  V + D VMSEVYLGRQICNVVACEG DRVERHETL+QWR R  SAGF  VHLGS
Sbjct  448  GSTQPIVNNHDLVMSEVYLGRQICNVVACEGADRVERHETLSQWRVRMNSAGFDPVHLGS  507

Query  326  NAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            NA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAW+  +
Sbjct  508  NAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWRFKA  554



>gb|EMS65108.1| hypothetical protein TRIUR3_18790 [Triticum urartu]
Length=407

 Score =   244 bits (624),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 133/172 (77%), Gaps = 10/172 (6%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG ++    
Sbjct  235  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGGSSGGPS  294

Query  491  AVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSA  342
             V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R  +AGF  
Sbjct  295  EVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGNAGFET  354

Query  341  VHLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            VHLGSNAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  355  VHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  406



>ref|XP_011097451.1| PREDICTED: DELLA protein GAI-like [Sesamum indicum]
Length=565

 Score =   248 bits (634),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 137/162 (85%), Gaps = 3/162 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL+ ++ + P+IVT+VEQEA+HNG  F++RF E+LHYYST+FDSLE    ++  
Sbjct  405  PGAIEKVLNSIKAINPKIVTIVEQEADHNGNNFLERFNEALHYYSTMFDSLESSGPTQPD  464

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            +   QD  M+EVYLGRQICNVVACEG +RVERHETLA+WR R +SAGFS  HLGSNA+KQ
Sbjct  465  S---QDLAMTEVYLGRQICNVVACEGAERVERHETLARWRRRMESAGFSPAHLGSNAFKQ  521

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+LT+
Sbjct  522  ASMLLALFAGGDGYRVEENEGCLMLGWHTRPLIATSAWRLTA  563



>ref|XP_002466594.1| hypothetical protein SORBIDRAFT_01g010660 [Sorghum bicolor]
 gb|EER93592.1| hypothetical protein SORBIDRAFT_01g010660 [Sorghum bicolor]
Length=627

 Score =   249 bits (637),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 132/167 (79%), Gaps = 5/167 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEG-  495
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG  + +  
Sbjct  460  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGAGSGQST  519

Query  494  ----GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGS  327
                 A    D+VMSEVYLGRQICNVVACEG +R ERHETL+QWR R   +GF  VHLGS
Sbjct  520  DASPAAAGGTDQVMSEVYLGRQICNVVACEGAERTERHETLSQWRGRLVGSGFEPVHLGS  579

Query  326  NAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            NAYKQAS LLALF GGDGYRVEE DG LTLGWHTRPLIATSAW+L +
Sbjct  580  NAYKQASTLLALFNGGDGYRVEEKDGCLTLGWHTRPLIATSAWRLAA  626



>gb|AAZ08571.1| gibberellic acid-insensitive [Saccharum hybrid cultivar Co 419]
Length=618

 Score =   249 bits (636),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 131/167 (78%), Gaps = 5/167 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEG-  495
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG  + +  
Sbjct  451  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGAGSGQST  510

Query  494  ----GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGS  327
                 A    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   +GF  VHLGS
Sbjct  511  DASPAAAGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGGSGFEPVHLGS  570

Query  326  NAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            NAYKQAS LLALF GGDGY+VEE DG LTLGWHTRPLIATSAW+L +
Sbjct  571  NAYKQASTLLALFNGGDGYKVEEKDGCLTLGWHTRPLIATSAWRLAA  617



>ref|NP_178266.1| DELLA protein RGA [Arabidopsis thaliana]
 sp|Q9SLH3.1|RGA_ARATH RecName: Full=DELLA protein RGA; AltName: Full=GAI-related sequence; 
AltName: Full=GRAS family protein 10; Short=AtGRAS-10; 
AltName: Full=Repressor on the ga1-3 mutant; AltName: Full=Restoration 
of growth on ammonia protein 1 [Arabidopsis thaliana]
 gb|AAC67333.1| putative RGA1, giberellin repsonse modulation protein [Arabidopsis 
thaliana]
 gb|AAL06821.1| At2g01570/F2I9.19 [Arabidopsis thaliana]
 gb|AAQ65090.1| At2g01570/F2I9.19 [Arabidopsis thaliana]
 gb|AEC05469.1| DELLA protein RGA [Arabidopsis thaliana]
Length=587

 Score =   248 bits (634),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 133/162 (82%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG  EKVL VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG   S   
Sbjct  430  PGGIEKVLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEGVPNS---  486

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF S+G +  HLGSNA+KQ
Sbjct  487  ----QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWGNRFGSSGLAPAHLGSNAFKQ  542

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLL++F  G GYRVEE++G L LGWHTRPLI TSAWKL++
Sbjct  543  ASMLLSVFNSGQGYRVEESNGCLMLGWHTRPLITTSAWKLST  584



>emb|CAA75493.1| GRS protein [Arabidopsis thaliana]
Length=587

 Score =   248 bits (634),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 133/162 (82%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG  EKVL VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG   S   
Sbjct  430  PGGIEKVLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEGVPNS---  486

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF S+G +  HLGSNA+KQ
Sbjct  487  ----QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWGNRFGSSGLAPAHLGSNAFKQ  542

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLL++F  G GYRVEE++G L LGWHTRPLI TSAWKL++
Sbjct  543  ASMLLSVFNSGQGYRVEESNGCLMLGWHTRPLITTSAWKLST  584



>emb|CAA72177.1| RGA1 protein [Arabidopsis thaliana]
Length=587

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 133/162 (82%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG  EKVL VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG   S   
Sbjct  430  PGGIEKVLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEGVPNS---  486

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF S+G +  HLGSNA+KQ
Sbjct  487  ----QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWGNRFGSSGLAPAHLGSNAFKQ  542

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLL++F  G GYRVEE++G L LGWHTRPLI TSAWKL++
Sbjct  543  ASMLLSVFNSGQGYRVEESNGCLMLGWHTRPLITTSAWKLST  584



>gb|AAK97709.1| At2g01570/F2I9.19 [Arabidopsis thaliana]
Length=587

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 133/162 (82%), Gaps = 7/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG  EKVL VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG   S   
Sbjct  430  PGGIEKVLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEGVPNS---  486

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF S+G +  HLGSNA+KQ
Sbjct  487  ----QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWGNRFGSSGLAPAHLGSNAFKQ  542

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLL++F  G GYRVEE++G L LGWHTRPLI TSAWKL++
Sbjct  543  ASMLLSVFNSGQGYRVEESNGCLMLGWHTRPLITTSAWKLST  584



>ref|XP_011099949.1| PREDICTED: LOW QUALITY PROTEIN: DELLA protein GAI [Sesamum indicum]
Length=565

 Score =   248 bits (632),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 133/162 (82%), Gaps = 3/162 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA  KVL+ ++ M P+IVTVVEQEANHNG VF+DRF E+LHYYST+FDSLE    +   
Sbjct  405  PGAINKVLNSIKAMNPKIVTVVEQEANHNGDVFLDRFNEALHYYSTMFDSLESSGLTPAN  464

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            +    D VM+EVYLGRQIC+VVA +G +RVERHETLAQWR+R  SAGF  VHLGSNA+KQ
Sbjct  465  S---HDLVMTEVYLGRQICDVVAYDGPERVERHETLAQWRSRMHSAGFDPVHLGSNAFKQ  521

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEENDG L LGWHTRPLI TSAW+L +
Sbjct  522  ASMLLALFAGGDGYRVEENDGCLMLGWHTRPLITTSAWRLAA  563



>ref|XP_004503135.1| PREDICTED: DELLA protein GAI-like [Cicer arietinum]
Length=622

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 144/171 (84%), Gaps = 6/171 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG+ EKVL+ V+ +KP+IVT+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG +++   
Sbjct  454  PGSIEKVLNTVKRIKPKIVTIVEQEANHNGPVFVDRFTEALHYYSSLFDSLEGSSSNSSS  513

Query  491  AVCD----QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSN  324
            +       QD +MSE+YLGRQICNVVA EGVDRVERHETL+QWR+R  +AGF  VHLGSN
Sbjct  514  STGSGSSGQDLLMSELYLGRQICNVVAYEGVDRVERHETLSQWRSRMGAAGFDPVHLGSN  573

Query  323  AYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS*LTES  171
            A+KQAS LLALFAGGDGYRVEEN+G L LGWHTR LIATSAWKL   L+ES
Sbjct  574  AFKQASTLLALFAGGDGYRVEENNGCLMLGWHTRSLIATSAWKLP--LSES  622



>ref|XP_010916517.1| PREDICTED: DELLA protein SLR1 isoform X1 [Elaeis guineensis]
 ref|XP_010916518.1| PREDICTED: DELLA protein SLR1 isoform X2 [Elaeis guineensis]
 ref|XP_010916519.1| PREDICTED: DELLA protein SLR1 isoform X3 [Elaeis guineensis]
Length=647

 Score =   249 bits (635),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 133/166 (80%), Gaps = 4/166 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG----CAA  504
            PGA EKVL  V+ ++P IVTVVEQEANHN   F++RFTE+LHYYST+FDSLEG     AA
Sbjct  474  PGALEKVLGTVRAVRPRIVTVVEQEANHNAGSFLERFTEALHYYSTMFDSLEGGCTAAAA  533

Query  503  SEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSN  324
                    QD+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF  VHLGSN
Sbjct  534  EVAAGGGQQDRVMSEVYLGRQICNVVACEGAERTERHETLGQWRGRMTRAGFEPVHLGSN  593

Query  323  AYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            A+KQASMLLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW++ +
Sbjct  594  AFKQASMLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRVAT  639



>gb|EEE59780.1| hypothetical protein OsJ_12286 [Oryza sativa Japonica Group]
Length=639

 Score =   248 bits (633),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 136/179 (76%), Gaps = 7/179 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEG-  495
            PGA EKVL  V  ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG ++ +  
Sbjct  456  PGALEKVLGTVHAVRPRIVTVVEQEANHNSGSFLDRFTESLHYYSTMFDSLEGGSSGQAE  515

Query  494  ------GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  333
                  G     D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF  VHL
Sbjct  516  LSPPAAGGGGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGRAGFEPVHL  575

Query  332  GSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS*LTESDHGAI  156
            GSNAYKQAS LLALFAGGDGYRVEE +G LTLGWHTRPLIATSAW++ + L  +D   +
Sbjct  576  GSNAYKQASTLLALFAGGDGYRVEEKEGCLTLGWHTRPLIATSAWRVAAALIANDRSGL  634



>ref|XP_004140302.1| PREDICTED: DELLA protein GAI-like [Cucumis sativus]
Length=597

 Score =   247 bits (630),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 137/161 (85%), Gaps = 3/161 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  ++  KP+IVT+VEQEANHNGP+F+DRFTE+LHYYS LFDSLEG  +S G 
Sbjct  439  PGAIEKVLGSIKTTKPKIVTIVEQEANHNGPIFLDRFTEALHYYSNLFDSLEG--SSSGF  496

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                +D ++SEVYLG+QICNVVACEG +RVERHE+L+QWR+R +S+GF  VHLGSNA+KQ
Sbjct  497  EPGSEDVLLSEVYLGKQICNVVACEGTNRVERHESLSQWRSRMESSGFDPVHLGSNAFKQ  556

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIAT-SAWKL  192
            ASMLLALFAGG+GYRVEEN+G L LGWHTRPLIA+ S W L
Sbjct  557  ASMLLALFAGGEGYRVEENNGCLMLGWHTRPLIASRSEWTL  597



>gb|AFD62376.1| reduced height-1 [Eragrostis tef]
 gb|AFD62377.1| reduced height-1 [Eragrostis tef]
 gb|AFD62378.1| reduced height-1 [Eragrostis tef]
Length=618

 Score =   248 bits (632),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 132/167 (79%), Gaps = 5/167 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCA-----  507
            PGA EKVL  V+ ++P+IVTVVE EANHN   F+DRFT+SLHYYST+FDSLEG       
Sbjct  451  PGALEKVLGTVRAVRPKIVTVVEHEANHNSGSFLDRFTQSLHYYSTMFDSLEGGGSGQSD  510

Query  506  ASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGS  327
            A+  GA    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF  VHLGS
Sbjct  511  AASPGAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLVQWRNRLGRAGFEPVHLGS  570

Query  326  NAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            NAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSA +L +
Sbjct  571  NAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSACRLAA  617



>ref|XP_006650473.1| PREDICTED: DELLA protein SLR1-like [Oryza brachyantha]
Length=618

 Score =   247 bits (631),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 132/167 (79%), Gaps = 5/167 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAA----  504
            PGA EKVL  V  ++P I+TVVEQEANHN   F+DRFTESLHYYST+FDSLEG ++    
Sbjct  451  PGALEKVLGTVHAVRPRIITVVEQEANHNSGSFLDRFTESLHYYSTMFDSLEGGSSGQAE  510

Query  503  -SEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGS  327
             S   A    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF  VHLGS
Sbjct  511  LSPPAAGGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGRAGFEPVHLGS  570

Query  326  NAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            NAYKQAS LLALFAGGDGYRVEE +G LTLGWHTRPLIATSAW++ +
Sbjct  571  NAYKQASTLLALFAGGDGYRVEEKEGCLTLGWHTRPLIATSAWRVAA  617



>emb|CBX87014.1| DELLA protein [Triticum aestivum]
Length=555

 Score =   246 bits (627),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 133/172 (77%), Gaps = 10/172 (6%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG ++    
Sbjct  383  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGGSSGGPS  442

Query  491  AVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSA  342
             V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R  +AGF  
Sbjct  443  EVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGNAGFET  502

Query  341  VHLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            VHLGSNAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  503  VHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  554



>ref|NP_001234365.1| DELLA protein GAI [Solanum lycopersicum]
 sp|Q7Y1B6.1|GAI_SOLLC RecName: Full=DELLA protein GAI; AltName: Full=Gibberellic acid-insensitive 
mutant protein [Solanum lycopersicum]
 gb|AAP22369.1| GAI-like protein [Solanum lycopersicum]
Length=588

 Score =   246 bits (629),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 140/180 (78%), Gaps = 12/180 (7%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL+ ++ + P+IVT+VEQEANHN  VF+DRF E+LHYYST+FDSLE   +S   
Sbjct  407  PGAIEKVLNSIKQINPKIVTLVEQEANHNAGVFIDRFNEALHYYSTMFDSLESSGSSSSA  466

Query  491  ---------AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAV  339
                      V +QD VMSEVYLGRQICNVVACEG DRVERHETL QWR R  S+GF  V
Sbjct  467  SPTGILPQPPVNNQDLVMSEVYLGRQICNVVACEGSDRVERHETLNQWRVRMNSSGFDPV  526

Query  338  HLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS*LTESDHGA  159
            HLGSNA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAWKL   L +S  GA
Sbjct  527  HLGSNAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWKL---LPDSGTGA  583



>ref|XP_004982031.1| PREDICTED: DELLA protein DWARF8-like [Setaria italica]
Length=621

 Score =   247 bits (630),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 129/165 (78%), Gaps = 6/165 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG  +    
Sbjct  453  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGSFLDRFTESLHYYSTMFDSLEGAGSDNSA  512

Query  491  AVCDQ------DKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLG  330
            A          D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF  VHLG
Sbjct  513  ADASPAPAGGTDQVMSEVYLGRQICNVVACEGTERTERHETLGQWRNRLGRAGFEPVHLG  572

Query  329  SNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  195
            SNAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW+
Sbjct  573  SNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWR  617



>gb|AHK61037.1| DELLA protein, partial [Psathyrostachys huashanica]
Length=617

 Score =   247 bits (630),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 132/171 (77%), Gaps = 9/171 (5%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG  +    
Sbjct  446  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGSFLDRFTESLHYYSTMFDSLEGAGSGGPS  505

Query  491  AVCD---------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAV  339
             V            D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R  +AGF  V
Sbjct  506  EVSSGAAAAAPAATDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGNAGFETV  565

Query  338  HLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            HLGSNAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  566  HLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  616



>ref|XP_010528540.1| PREDICTED: DELLA protein RGL1 [Tarenaya hassleriana]
Length=546

 Score =   245 bits (625),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 132/161 (82%), Gaps = 8/161 (5%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            G+ EKV S ++ +KP+I+TVVEQEANHNG VF+DRFTESLHY S+LFDSLEG  +     
Sbjct  393  GSIEKVFSTIKSIKPDIITVVEQEANHNGAVFLDRFTESLHYSSSLFDSLEGPPS-----  447

Query  488  VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQA  309
               QD++MSE++LGRQI N+VACEG DRVERHETL+QWR RF SAGF  VHLGSNAYKQA
Sbjct  448  ---QDRIMSELFLGRQILNLVACEGPDRVERHETLSQWRIRFGSAGFEPVHLGSNAYKQA  504

Query  308  SMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            SMLLALFAG DGYRVEENDG L LGW  RPLI TSAW+L +
Sbjct  505  SMLLALFAGADGYRVEENDGCLLLGWQMRPLIGTSAWRLAA  545



>emb|CBW30283.1| RHT-A1 protein [Triticum aestivum]
 gb|AGG68466.1| DELLA protein [Triticum aestivum]
Length=620

 Score =   246 bits (629),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 133/172 (77%), Gaps = 10/172 (6%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG ++    
Sbjct  448  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGGSSGGPS  507

Query  491  AVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSA  342
             V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R  +AGF  
Sbjct  508  EVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGNAGFET  567

Query  341  VHLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            VHLGSNAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  568  VHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  619



>gb|ADM32428.1| DELLA protein Rht-A1 [Triticum aestivum]
 gb|AEV92814.1| DELLA protein [Triticum aestivum]
 emb|CBW30282.1| RHT-A1 protein [Triticum aestivum]
 gb|AFW04244.1| DELLA [Triticum aestivum]
 gb|AFW04253.1| DELLA [Triticum urartu]
 gb|AGG68461.1| DELLA protein [Triticum aestivum]
 gb|AGG68463.1| DELLA protein [Triticum aestivum]
 gb|AGG68465.1| DELLA protein [Triticum aestivum]
 gb|AGG68467.1| DELLA protein [Triticum aestivum]
 gb|AGG68468.1| DELLA protein [Triticum aestivum]
 gb|AGG68469.1| DELLA protein [Triticum aestivum]
 gb|AGG68470.1| DELLA protein [Triticum dicoccoides]
 gb|AGG68471.1| DELLA protein [Triticum dicoccoides]
 gb|AGG68494.1| DELLA protein [Triticum aestivum]
 gb|AGG68495.1| DELLA protein [Triticum aestivum]
 gb|AGG68496.1| DELLA protein [Triticum aestivum]
 gb|AGG68497.1| DELLA protein [Triticum aestivum]
 gb|AGG68498.1| DELLA protein [Triticum aestivum]
 gb|AGG68499.1| DELLA protein [Triticum aestivum]
 gb|AGG68500.1| DELLA protein [Triticum aestivum]
 gb|AGG68501.1| DELLA protein [Triticum aestivum]
 gb|AGG68502.1| DELLA protein [Triticum aestivum]
 gb|AGG68503.1| DELLA protein [Triticum aestivum]
 gb|AGG68504.1| DELLA protein [Triticum aestivum]
 gb|AGG68505.1| DELLA protein [Triticum aestivum]
 gb|AGG68506.1| DELLA protein [Triticum aestivum]
 gb|AGG68507.1| DELLA protein [Triticum aestivum]
 gb|AGG68508.1| DELLA protein [Triticum aestivum]
 gb|AGG68509.1| DELLA protein [Triticum aestivum]
 gb|AGG68510.1| DELLA protein [Triticum aestivum]
 gb|AGG68511.1| DELLA protein [Triticum aestivum]
 gb|AGG68512.1| DELLA protein [Triticum aestivum]
 gb|AGG68513.1| DELLA protein [Triticum aestivum]
 gb|AGG68514.1| DELLA protein [Triticum aestivum]
 gb|AGG68515.1| DELLA protein [Triticum aestivum]
 gb|AGG68516.1| DELLA protein [Triticum aestivum]
 gb|AGG68517.1| DELLA protein [Triticum aestivum]
 gb|AGG68518.1| DELLA protein [Triticum aestivum]
 gb|AGG68519.1| DELLA protein [Triticum aestivum]
 gb|AGG68520.1| DELLA protein [Triticum aestivum]
 gb|AGG68521.1| DELLA protein [Triticum aestivum]
 gb|AGO59332.1| DELLA protein [Triticum aestivum]
 gb|AGO59333.1| DELLA protein [Triticum turgidum subsp. durum]
 gb|AGQ43577.1| DELLA [Triticum aestivum]
 emb|CCD31541.1| Reduced height-1 protein [Triticum aestivum]
 emb|CCD31542.1| Reduced height-1 protein [Triticum aestivum]
Length=620

 Score =   246 bits (629),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 133/172 (77%), Gaps = 10/172 (6%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG ++    
Sbjct  448  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGGSSGGPS  507

Query  491  AVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSA  342
             V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R  +AGF  
Sbjct  508  EVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGNAGFET  567

Query  341  VHLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            VHLGSNAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  568  VHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  619



>ref|XP_006364643.1| PREDICTED: DELLA protein GAI-like [Solanum tuberosum]
Length=588

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 136/170 (80%), Gaps = 9/170 (5%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL+ ++ + P+IVT+VEQEANHN  VF+DRF E+LHYYST+FDSLE   +S   
Sbjct  407  PGAIEKVLNSIKQINPKIVTLVEQEANHNAGVFIDRFNEALHYYSTMFDSLESSGSSSSA  466

Query  491  ---------AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAV  339
                      V +QD VMSEVYLGRQICNVVACEG DRVERHETL QWR R  S+GF  V
Sbjct  467  SPTGILPQPPVNNQDLVMSEVYLGRQICNVVACEGSDRVERHETLNQWRVRMNSSGFDPV  526

Query  338  HLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  189
            HLGSNA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAWKL+
Sbjct  527  HLGSNAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWKLS  576



>gb|AEI25530.1| gibberellic acid insensitive protein [Solanum tuberosum]
Length=588

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 136/170 (80%), Gaps = 9/170 (5%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL+ ++ + P+IVT+VEQEANHN  VF+DRF E+LHYYST+FDSLE   +S   
Sbjct  407  PGAIEKVLNSIKQINPKIVTLVEQEANHNAGVFIDRFNEALHYYSTMFDSLESSGSSSSA  466

Query  491  ---------AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAV  339
                      V +QD VMSEVYLGRQICNVVACEG DRVERHETL QWR R  S+GF  V
Sbjct  467  SPTGILPQPPVNNQDLVMSEVYLGRQICNVVACEGSDRVERHETLNQWRVRMNSSGFDPV  526

Query  338  HLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  189
            HLGSNA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAWKL+
Sbjct  527  HLGSNAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWKLS  576



>emb|CCD31540.1| Reduced height-1 protein [Triticum aestivum]
Length=620

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 133/172 (77%), Gaps = 10/172 (6%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG ++    
Sbjct  448  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGGSSGGPS  507

Query  491  AVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSA  342
             V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R  +AGF  
Sbjct  508  EVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGNAGFET  567

Query  341  VHLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            VHLGSNAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  568  VHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  619



>gb|AGG68464.1| DELLA protein [Triticum aestivum]
 emb|CCD31543.1| Reduced height-1 protein [Triticum aestivum]
Length=620

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 133/172 (77%), Gaps = 10/172 (6%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG ++    
Sbjct  448  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGGSSGGPS  507

Query  491  AVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSA  342
             V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R  +AGF  
Sbjct  508  EVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGNAGFET  567

Query  341  VHLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            VHLGSNAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  568  VHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  619



>gb|AEV92816.1| DELLA protein [Triticum aestivum]
 gb|AEW07388.1| mutant DELLA protein [Triticum aestivum]
 gb|AEW07389.1| mutant DELLA protein [Triticum aestivum]
 gb|AGE81922.1| DELLA [Triticum aestivum]
 gb|AGE81923.1| DELLA [Triticum aestivum]
 gb|AGQ43579.1| DELLA [Triticum aestivum]
Length=651

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 133/172 (77%), Gaps = 10/172 (6%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG ++    
Sbjct  479  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGGSSGGPS  538

Query  491  AVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSA  342
             V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R  +AGF  
Sbjct  539  EVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGNAGFET  598

Query  341  VHLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            VHLGSNAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  599  VHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  650



>gb|AGG68491.1| DELLA protein [Triticum aestivum]
 gb|AGG68492.1| DELLA protein [Triticum dicoccoides]
Length=621

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 133/172 (77%), Gaps = 10/172 (6%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG ++    
Sbjct  449  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGGSSGGPS  508

Query  491  AVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSA  342
             V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R  +AGF  
Sbjct  509  EVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGNAGFET  568

Query  341  VHLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            VHLGSNAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  569  VHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  620



>emb|CBW30285.1| RHT-B1 protein [Triticum aestivum]
 gb|AGG68484.1| DELLA protein [Triticum aestivum]
 gb|AGG68485.1| DELLA protein [Triticum aestivum]
 gb|AGG68535.1| DELLA protein [Triticum aestivum]
 gb|AGG68536.1| DELLA protein [Triticum aestivum]
 gb|AGG68537.1| DELLA protein [Triticum aestivum]
Length=621

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 133/172 (77%), Gaps = 10/172 (6%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG ++    
Sbjct  449  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGGSSGGPS  508

Query  491  AVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSA  342
             V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R  +AGF  
Sbjct  509  EVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGNAGFET  568

Query  341  VHLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            VHLGSNAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  569  VHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  620



>gb|AGG68490.1| DELLA protein [Triticum aestivum]
Length=621

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 133/172 (77%), Gaps = 10/172 (6%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG ++    
Sbjct  449  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGGSSGGPS  508

Query  491  AVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSA  342
             V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R  +AGF  
Sbjct  509  EVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGNAGFET  568

Query  341  VHLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            VHLGSNAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  569  VHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  620



>emb|CBW30286.1| RHT-B1 protein [Triticum aestivum]
 gb|AGG68481.1| DELLA protein [Triticum aestivum]
 gb|AGG68482.1| DELLA protein [Triticum aestivum]
 gb|AGG68483.1| DELLA protein [Triticum aestivum]
 gb|AGG68530.1| DELLA protein [Triticum aestivum]
 gb|AGG68531.1| DELLA protein [Triticum aestivum]
 gb|AGG68532.1| DELLA protein [Triticum aestivum]
 gb|AGG68533.1| DELLA protein [Triticum aestivum]
 gb|AGG68534.1| DELLA protein [Triticum aestivum]
Length=621

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 133/172 (77%), Gaps = 10/172 (6%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG ++    
Sbjct  449  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGGSSGGPS  508

Query  491  AVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSA  342
             V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R  +AGF  
Sbjct  509  EVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGNAGFET  568

Query  341  VHLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            VHLGSNAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  569  VHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  620



>gb|AEV92815.1| DELLA protein [Triticum aestivum]
 emb|CBW30284.1| RHT-B1 protein [Triticum aestivum]
 gb|AFW04248.1| DELLA [Triticum aestivum]
 gb|AGG68486.1| DELLA protein [Triticum aestivum]
 gb|AGG68487.1| DELLA protein [Triticum aestivum]
 gb|AGG68488.1| DELLA protein [Triticum aestivum]
 gb|AGG68493.1| DELLA protein [Triticum dicoccoides]
 gb|AGG68522.1| DELLA protein [Triticum aestivum]
 gb|AGG68523.1| DELLA protein [Triticum aestivum]
 gb|AGG68524.1| DELLA protein [Triticum aestivum]
 gb|AGG68525.1| DELLA protein [Triticum aestivum]
 gb|AGG68526.1| DELLA protein [Triticum aestivum]
 gb|AGG68527.1| DELLA protein [Triticum aestivum]
 gb|AGG68528.1| DELLA protein [Triticum aestivum]
 gb|AGG68529.1| DELLA protein [Triticum aestivum]
 gb|AGG68538.1| DELLA protein [Triticum aestivum]
 gb|AGG68539.1| DELLA protein [Triticum aestivum]
 gb|AGG68540.1| DELLA protein [Triticum aestivum]
 gb|AGO59330.1| DELLA protein [Triticum aestivum]
 gb|AGQ43578.1| DELLA [Triticum aestivum]
Length=621

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 133/172 (77%), Gaps = 10/172 (6%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG ++    
Sbjct  449  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGGSSGGPS  508

Query  491  AVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSA  342
             V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R  +AGF  
Sbjct  509  EVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGNAGFET  568

Query  341  VHLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            VHLGSNAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  569  VHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  620



>emb|CBW30287.1| RHT-B1 protein [Triticum aestivum]
Length=621

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 133/172 (77%), Gaps = 10/172 (6%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG ++    
Sbjct  449  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGGSSGGPS  508

Query  491  AVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSA  342
             V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R  +AGF  
Sbjct  509  EVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGNAGFET  568

Query  341  VHLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            VHLGSNAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  569  VHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  620



>gb|ADO60988.1| DELLA protein 2 [Helianthus annuus]
 gb|ADO60989.1| DELLA protein 2, partial [Helianthus annuus]
Length=171

 Score =   233 bits (593),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 126/170 (74%), Gaps = 21/170 (12%)
 Frame = -1

Query  638  QDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEG------------  495
            + M PEI+TVVEQEANHNG  F++RFTESLHYYSTLFDSLE     +G            
Sbjct  1    KQMSPEILTVVEQEANHNGTSFLERFTESLHYYSTLFDSLESSGGGDGGVGGGAAVNGGV  60

Query  494  ---------GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSA  342
                       V  +D+ MSEVYLG+QICNVVACEGVDRVERHETL QW+TR  SAGF A
Sbjct  61   DVGVNGGGVSPVSSEDRFMSEVYLGKQICNVVACEGVDRVERHETLTQWKTRLDSAGFEA  120

Query  341  VHLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            VHLGSNA+KQASMLLALFAGGDGYRV E DG L LGWHTRPLI TSAWK+
Sbjct  121  VHLGSNAFKQASMLLALFAGGDGYRVVEEDGCLMLGWHTRPLITTSAWKI  170



>sp|Q8W127.1|SLN1_HORVU RecName: Full=DELLA protein SLN1; AltName: Full=Slender protein 
1 [Hordeum vulgare]
 gb|AAL66734.1|AF460219_1 nuclear transcription factor SLN1 [Hordeum vulgare subsp. vulgare]
 dbj|BAK03262.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=618

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 133/172 (77%), Gaps = 10/172 (6%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG ++    
Sbjct  446  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGSFLDRFTESLHYYSTMFDSLEGGSSGGPS  505

Query  491  AVCDQ----------DKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSA  342
             V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R  +AGF  
Sbjct  506  EVSSGGAAPAAAAGTDQVMSEVYLGRQICNVVACEGTERTERHETLGQWRNRLGNAGFET  565

Query  341  VHLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            VHLGSNAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  566  VHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  617



>gb|AAX07462.1| gibberellic acid-insensitive [Oryza sativa Indica Group]
Length=625

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 132/169 (78%), Gaps = 7/169 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEG-  495
            PGA EKVL  V  ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG ++ +  
Sbjct  456  PGALEKVLGTVHAVRPRIVTVVEQEANHNSGSFLDRFTESLHYYSTMFDSLEGGSSGQAE  515

Query  494  ------GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  333
                  G     D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF  VHL
Sbjct  516  LSPPAAGGGGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGRAGFEPVHL  575

Query  332  GSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            GSNAYKQAS LLALFAGGDGYRVEE +G LTLGWHTRPLIATSAW++ +
Sbjct  576  GSNAYKQASTLLALFAGGDGYRVEEKEGCLTLGWHTRPLIATSAWRVAA  624



>gb|AGO59331.1| DELLA protein [Triticum turgidum subsp. durum]
Length=620

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 133/172 (77%), Gaps = 10/172 (6%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG ++    
Sbjct  448  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGGSSGGPS  507

Query  491  AVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSA  342
             V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R  +AGF  
Sbjct  508  EVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGNAGFET  567

Query  341  VHLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            VHLGSNAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  568  VHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  619



>gb|ABI84226.1| dwarf plant9 [Zea mays]
Length=622

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 131/170 (77%), Gaps = 8/170 (5%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCA-----  507
            PG  +KVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG       
Sbjct  452  PGTLDKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGAGSGSGQ  511

Query  506  ---ASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVH  336
               AS   A    D+VMSEVYLGRQICN+VACEG +R ERHETL QWR R   +GF  VH
Sbjct  512  PTDASSPAAAGGTDQVMSEVYLGRQICNIVACEGAERTERHETLVQWRGRLGGSGFEPVH  571

Query  335  LGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            LGSNAYKQAS LLALFAGGDGYRVE+ DG LTLGWHTRPLIATSAW++ +
Sbjct  572  LGSNAYKQASTLLALFAGGDGYRVEKKDGCLTLGWHTRPLIATSAWRVAA  621



>ref|NP_001051032.1| Os03g0707600 [Oryza sativa Japonica Group]
 sp|Q7G7J6.1|SLR1_ORYSJ RecName: Full=DELLA protein SLR1; AltName: Full=Gibberellic acid-insensitive 
mutant protein; AltName: Full=OsGAI; AltName: 
Full=Protein SLENDER RICE1 [Oryza sativa Japonica Group]
 gb|AAK50137.1|AC087797_22 gibberellin-insensitive protein OsGAI [Oryza sativa Japonica 
Group]
 dbj|BAA90749.1| OsGAI [Oryza sativa Japonica Group]
 gb|ABF98475.1| gibberellin response modulator, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAE96289.1| DELLA protein [Oryza sativa Japonica Group]
 dbj|BAF12946.1| Os03g0707600 [Oryza sativa Japonica Group]
Length=625

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 132/169 (78%), Gaps = 7/169 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEG-  495
            PGA EKVL  V  ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG ++ +  
Sbjct  456  PGALEKVLGTVHAVRPRIVTVVEQEANHNSGSFLDRFTESLHYYSTMFDSLEGGSSGQAE  515

Query  494  ------GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  333
                  G     D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF  VHL
Sbjct  516  LSPPAAGGGGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGRAGFEPVHL  575

Query  332  GSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            GSNAYKQAS LLALFAGGDGYRVEE +G LTLGWHTRPLIATSAW++ +
Sbjct  576  GSNAYKQASTLLALFAGGDGYRVEEKEGCLTLGWHTRPLIATSAWRVAA  624



>gb|EAY91579.1| hypothetical protein OsI_13213 [Oryza sativa Indica Group]
Length=625

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 132/169 (78%), Gaps = 7/169 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEG-  495
            PGA EKVL  V  ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG ++ +  
Sbjct  456  PGALEKVLGTVHAVRPRIVTVVEQEANHNSGSFLDRFTESLHYYSTMFDSLEGGSSGQAE  515

Query  494  ------GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  333
                  G     D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF  VHL
Sbjct  516  LSPPAAGGGGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGRAGFEPVHL  575

Query  332  GSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            GSNAYKQAS LLALFAGGDGYRVEE +G LTLGWHTRPLIATSAW++ +
Sbjct  576  GSNAYKQASTLLALFAGGDGYRVEEKEGCLTLGWHTRPLIATSAWRVAA  624



>ref|XP_002884379.1| hypothetical protein ARALYDRAFT_477591 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60638.1| hypothetical protein ARALYDRAFT_477591 [Arabidopsis lyrata subsp. 
lyrata]
Length=545

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 138/177 (78%), Gaps = 16/177 (9%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            G+ EK+L+ V+ +KP I+TVVEQEANHNG VF+DRF E+LHYYS+LFDSLE     + G+
Sbjct  384  GSIEKLLNTVKAIKPSIITVVEQEANHNGIVFLDRFNEALHYYSSLFDSLE-----DSGS  438

Query  488  VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQA  309
            +  QD+VMSEVYLGRQI NVVA EG DRVERHET+AQWR R KSAGF  VHLGS+A+KQA
Sbjct  439  LPSQDRVMSEVYLGRQILNVVAAEGSDRVERHETVAQWRIRMKSAGFDPVHLGSSAFKQA  498

Query  308  SMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS*LTESDHGAIGGSESR  138
            SMLL+L+A GDGYRVEENDG L +GW TRPLI TSAWKL            GG ESR
Sbjct  499  SMLLSLYATGDGYRVEENDGCLMIGWQTRPLITTSAWKLA-----------GGGESR  544



>gb|AGG68462.1| DELLA protein [Triticum aestivum]
 emb|CCD31539.1| Reduced height-1 protein [Triticum aestivum]
Length=620

 Score =   245 bits (626),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 133/172 (77%), Gaps = 10/172 (6%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG ++    
Sbjct  448  PGALEKVLGTVRAVRPRIVTVVEQEANHNYGTFLDRFTESLHYYSTMFDSLEGGSSGGPS  507

Query  491  AVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSA  342
             V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R  +AGF  
Sbjct  508  EVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGNAGFET  567

Query  341  VHLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            VHLGSNAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  568  VHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  619



>emb|CBI84063.1| DELLA protein RHT1 [Triticum aestivum]
Length=555

 Score =   244 bits (622),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 132/172 (77%), Gaps = 10/172 (6%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYS +FDSLEG ++    
Sbjct  383  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSAMFDSLEGGSSGGPS  442

Query  491  AVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSA  342
             V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R  +AGF  
Sbjct  443  EVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGNAGFET  502

Query  341  VHLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            VHLGSNAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  503  VHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  554



>ref|XP_009413642.1| PREDICTED: DELLA protein SLR1-like [Musa acuminata subsp. malaccensis]
Length=605

 Score =   244 bits (623),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 131/164 (80%), Gaps = 3/164 (2%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            GA EKVL  ++ M+P IVTVVEQEANHNG  F++RFTE+LHYYST+FDSLEG  ++   A
Sbjct  439  GALEKVLGTIRAMRPRIVTVVEQEANHNGETFLERFTEALHYYSTMFDSLEGGVSAAPDA  498

Query  488  VCD---QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAY  318
                  +D+ MSEVYLGRQICNVVACEG DR ERHE LAQWR R   AGF  V +GSNA+
Sbjct  499  AGGGGRRDQAMSEVYLGRQICNVVACEGADRTERHEALAQWRVRMGRAGFEPVPIGSNAF  558

Query  317  KQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            KQASMLLALFAGGDGYRVEE DG LTLGWHTRPLI TSAW++ S
Sbjct  559  KQASMLLALFAGGDGYRVEEKDGSLTLGWHTRPLITTSAWRIAS  602



>ref|XP_006400288.1| hypothetical protein EUTSA_v100155351mg, partial [Eutrema salsugineum]
 gb|ESQ41741.1| hypothetical protein EUTSA_v100155351mg, partial [Eutrema salsugineum]
Length=459

 Score =   240 bits (613),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 136/162 (84%), Gaps = 5/162 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG+ EK+L+ V+ +KP IVTVVEQEANHNG VF++RF E+LHYYS+LFDSLE     +G 
Sbjct  247  PGSIEKLLATVKAVKPSIVTVVEQEANHNGVVFLERFNEALHYYSSLFDSLE-----DGL  301

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
             +  QD+VMSEVYLGRQI NVVA EGV+RVERHETLAQWR R  SAGF+ V+LGS+A+KQ
Sbjct  302  ILPSQDRVMSEVYLGRQILNVVAAEGVERVERHETLAQWRKRMGSAGFNPVNLGSDAFKQ  361

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            AS+LLALFAGGDGYRVEEN+G L L W T+PLIA SAWKL++
Sbjct  362  ASLLLALFAGGDGYRVEENEGSLMLAWQTKPLIAASAWKLSA  403



>ref|XP_009390245.1| PREDICTED: DELLA protein SLR1-like [Musa acuminata subsp. malaccensis]
Length=612

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 135/165 (82%), Gaps = 4/165 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVTVVEQEANHNG  F++RFTE+LHYYST+FDSLEG A +   
Sbjct  438  PGALEKVLGTVRAVQPRIVTVVEQEANHNGGTFVERFTEALHYYSTMFDSLEGGALA-AD  496

Query  491  AVC---DQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNA  321
            A C    +D+  SEVYLGRQICNVV+CEGV+R ERHETLAQWR R   AGF  V +GSNA
Sbjct  497  AACGGGRRDQAFSEVYLGRQICNVVSCEGVERTERHETLAQWRVRMGRAGFDPVAIGSNA  556

Query  320  YKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            +KQASMLLALFAGGDGYRVEE +G LTLGWHTRPLIATSAW++ +
Sbjct  557  FKQASMLLALFAGGDGYRVEEKEGCLTLGWHTRPLIATSAWRVAA  601



>ref|XP_008644580.1| PREDICTED: DELLA protein DWARF8-like [Zea mays]
 gb|ABI84225.1| dwarf plant9 [Zea mays]
 gb|AFW67870.1| dwarf plant9 [Zea mays]
Length=625

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 130/173 (75%), Gaps = 11/173 (6%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCA-----  507
            PG  +KVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG       
Sbjct  452  PGTLDKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGAGSGSGS  511

Query  506  ------ASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFS  345
                   ++       D+VMSEVYLGRQICN+VACEG +R ERHETL QWR R   +GF 
Sbjct  512  GSGSGQPTDASPPAGTDQVMSEVYLGRQICNIVACEGAERTERHETLVQWRGRLGGSGFE  571

Query  344  AVHLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
             VHLGSNAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW++ +
Sbjct  572  PVHLGSNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRVAA  624



>ref|XP_009380281.1| PREDICTED: DELLA protein SLN1-like [Musa acuminata subsp. malaccensis]
Length=595

 Score =   241 bits (615),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA +KVL  V+ ++P IVTVVEQEANHNG  F +RFTE+LHYYST+FDSLEG AA+ G 
Sbjct  422  PGALDKVLGTVRAVRPRIVTVVEQEANHNGGTFQERFTEALHYYSTMFDSLEGGAAAAGA  481

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                 D+ +SEVYLGRQICNVVACEG +R ERHETLAQWR R   AGF  V +GSNA+KQ
Sbjct  482  DDGGPDQALSEVYLGRQICNVVACEGAERTERHETLAQWRGRMDRAGFEPVPIGSNAFKQ  541

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW++ +
Sbjct  542  ASMLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRVAA  583



>emb|CDY55037.1| BnaCnng28010D [Brassica napus]
Length=507

 Score =   239 bits (609),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 131/161 (81%), Gaps = 8/161 (5%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG+ + +L  ++ +KP+I+TVVEQEANHNG VF+DRFTESLHYYS+LFDSLEG ++    
Sbjct  352  PGSIDNILLTIKSIKPDIITVVEQEANHNGAVFLDRFTESLHYYSSLFDSLEGPSS----  407

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD+VMSE+YLGRQI N+VACEG DRVERHETLAQWR RF   GF +V +GS AYKQ
Sbjct  408  ----QDRVMSELYLGRQILNLVACEGEDRVERHETLAQWRNRFTMGGFKSVSIGSYAYKQ  463

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  189
            ASMLLAL+AG DGY+VEEN+G L LGW TRPLIATSAW+  
Sbjct  464  ASMLLALYAGADGYKVEENEGCLLLGWQTRPLIATSAWRFN  504



>ref|XP_003538395.1| PREDICTED: DELLA protein GAI1 [Glycine max]
Length=595

 Score =   241 bits (614),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 136/162 (84%), Gaps = 1/162 (1%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            G+ +KVL  V+ + P+IVT+VEQEANHNGP F+DRFTE+LHYYS+LFDSLEG ++S  G 
Sbjct  425  GSVDKVLDTVKKINPQIVTIVEQEANHNGPGFLDRFTEALHYYSSLFDSLEGSSSSSTGL  484

Query  488  VCD-QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD +MSE+YLGRQICNVVA EG DRVERHETL QWR R  SAGF  VHLGSNA+KQ
Sbjct  485  GSPSQDLLMSELYLGRQICNVVAYEGPDRVERHETLTQWRGRLDSAGFDPVHLGSNAFKQ  544

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            ASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAWKL S
Sbjct  545  ASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWKLPS  586



>ref|XP_008809806.1| PREDICTED: DELLA protein SLR1 [Phoenix dactylifera]
Length=656

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 132/168 (79%), Gaps = 8/168 (5%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVT VEQEANHN   F++RFTE+LHYYST+FDSLEG   + G 
Sbjct  478  PGALEKVLGTVRAVRPRIVTAVEQEANHNAGSFLERFTEALHYYSTMFDSLEGGCTATGA  537

Query  491  AVC--------DQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVH  336
            A           QD+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF  VH
Sbjct  538  AAAAEVATGGGQQDRVMSEVYLGRQICNVVACEGAERTERHETLGQWRGRMTRAGFEPVH  597

Query  335  LGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            LGSNA+KQASMLLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW++
Sbjct  598  LGSNAFKQASMLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRV  645



>ref|XP_006408301.1| hypothetical protein EUTSA_v10020431mg [Eutrema salsugineum]
 gb|ESQ49754.1| hypothetical protein EUTSA_v10020431mg [Eutrema salsugineum]
Length=554

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 132/161 (82%), Gaps = 5/161 (3%)
 Frame = -1

Query  674  APGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEG  495
            +PG+ +K+L+ V+ +KP IVTVVEQEANHNG VF+DRF E+LHYYS+LFDSLE     + 
Sbjct  390  SPGSIDKLLATVKAVKPSIVTVVEQEANHNGIVFLDRFNEALHYYSSLFDSLE-----DS  444

Query  494  GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYK  315
             ++  QD+VMSEVYLGRQI NVVA EG DRVERHETLAQWR R  SAGF  V LGS+A+K
Sbjct  445  YSLPSQDRVMSEVYLGRQILNVVAAEGSDRVERHETLAQWRIRMGSAGFDPVSLGSSAFK  504

Query  314  QASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            QASMLL+LFAGGDGYRVEE DG L LGW TRPLI TSAWKL
Sbjct  505  QASMLLSLFAGGDGYRVEEKDGCLMLGWQTRPLITTSAWKL  545



>gb|EPS58722.1| hypothetical protein M569_16090, partial [Genlisea aurea]
Length=520

 Score =   237 bits (605),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 129/161 (80%), Gaps = 4/161 (2%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            P    +VL +V+++KPEI TVVEQEAN +G  F+DRFTE+LHYYS +FDSLE C    GG
Sbjct  364  PAEIGRVLQLVRELKPEIFTVVEQEANLSGNFFLDRFTEALHYYSAIFDSLESC----GG  419

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            A   +DK+MSEVYLGRQICNVV+CEG DR ER+ETL +W+ R   AGF  V LGSN YKQ
Sbjct  420  AASGEDKMMSEVYLGRQICNVVSCEGADRFERYETLERWKRRLGRAGFQPVRLGSNVYKQ  479

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  189
            A +LLALFAGGDGYRVEENDG L LGWHTRP+IATSAWKL+
Sbjct  480  AILLLALFAGGDGYRVEENDGCLMLGWHTRPIIATSAWKLS  520



>ref|NP_186995.1| DELLA protein RGL2 [Arabidopsis thaliana]
 sp|Q8GXW1.2|RGL2_ARATH RecName: Full=DELLA protein RGL2; AltName: Full=GRAS family protein 
15; Short=AtGRAS-15; AltName: Full=RGA-like protein 2; 
AltName: Full=Scarecrow-like protein 19; Short=AtSCL19 [Arabidopsis 
thaliana]
 gb|AAF01590.1|AC009895_11 RGA1-like protein [Arabidopsis thaliana]
 gb|AEE73945.1| DELLA protein RGL2 [Arabidopsis thaliana]
Length=547

 Score =   238 bits (607),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 131/159 (82%), Gaps = 5/159 (3%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            G+ EK+L+ V+ +KP IVTVVEQEANHNG VF+DRF E+LHYYS+LFDSLE     +  +
Sbjct  393  GSIEKLLNTVKAIKPSIVTVVEQEANHNGIVFLDRFNEALHYYSSLFDSLE-----DSYS  447

Query  488  VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQA  309
            +  QD+VMSEVYLGRQI NVVA EG DRVERHET AQWR R KSAGF  +HLGS+A+KQA
Sbjct  448  LPSQDRVMSEVYLGRQILNVVAAEGSDRVERHETAAQWRIRMKSAGFDPIHLGSSAFKQA  507

Query  308  SMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            SMLL+L+A GDGYRVEENDG L +GW TRPLI TSAWKL
Sbjct  508  SMLLSLYATGDGYRVEENDGCLMIGWQTRPLITTSAWKL  546



>dbj|BAC42642.1| putative RGA1 [Arabidopsis thaliana]
Length=547

 Score =   238 bits (606),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 131/159 (82%), Gaps = 5/159 (3%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            G+ EK+L+ V+ +KP IVTVVEQEANHNG VF+DRF E+LHYYS+LFDSLE     +  +
Sbjct  393  GSIEKLLNTVKAIKPSIVTVVEQEANHNGIVFLDRFNEALHYYSSLFDSLE-----DSYS  447

Query  488  VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQA  309
            +  QD+VMSEVYLGRQI NVVA EG DRVERHET AQWR R KSAGF  +HLGS+A+KQA
Sbjct  448  LPSQDRVMSEVYLGRQILNVVAAEGSDRVERHETAAQWRIRMKSAGFDPIHLGSSAFKQA  507

Query  308  SMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            SMLL+L+A GDGYRVEENDG L +GW TRPLI TSAWKL
Sbjct  508  SMLLSLYATGDGYRVEENDGCLMIGWQTRPLITTSAWKL  546



>ref|XP_008782281.1| PREDICTED: DELLA protein SLR1-like [Phoenix dactylifera]
Length=649

 Score =   240 bits (612),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 132/170 (78%), Gaps = 8/170 (5%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVTVVEQEANHN   F++RFTE+LHYYST+FDSLEG   +   
Sbjct  470  PGALEKVLGTVRAVRPRIVTVVEQEANHNAGSFLERFTEALHYYSTMFDSLEGGGTAGAA  529

Query  491  AVC--------DQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVH  336
            A           QD+VMSEVYLGRQICNVV CEG +R ERHETL QWR R   AGF  VH
Sbjct  530  AAEGAVGASGGQQDQVMSEVYLGRQICNVVPCEGTERTERHETLGQWRERMTRAGFEPVH  589

Query  335  LGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            LGSNA+KQASMLLALFAGGDGYRVEE +G LTLGWHTRPLIATSAW++ +
Sbjct  590  LGSNAFKQASMLLALFAGGDGYRVEEKEGCLTLGWHTRPLIATSAWRVPA  639



>ref|NP_176809.1| DELLA protein RGL1 [Arabidopsis thaliana]
 sp|Q9C8Y3.1|RGL1_ARATH RecName: Full=DELLA protein RGL1; AltName: Full=GRAS family protein 
9; Short=AtGRAS-9; AltName: Full=RGA-like protein 1; 
Short=RGA-like protein [Arabidopsis thaliana]
 gb|AAG52171.1|AC020665_16 gibberellin regulatory protein, putative; 49974-51509 [Arabidopsis 
thaliana]
 gb|AAL05911.1| RGL1 protein [Arabidopsis thaliana]
 gb|AAL49792.1| putative gibberellin regulatory protein [Arabidopsis thaliana]
 gb|AAM20156.1| putative gibberellin regulatory protein [Arabidopsis thaliana]
 gb|AEE34499.1| DELLA protein RGL1 [Arabidopsis thaliana]
Length=511

 Score =   236 bits (603),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 130/161 (81%), Gaps = 8/161 (5%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG+ +K LS ++ ++P+I+TVVEQEANHNG VF+DRFTESLHYYS+LFDSLEG  +    
Sbjct  356  PGSIDKFLSTIKSIRPDIMTVVEQEANHNGTVFLDRFTESLHYYSSLFDSLEGPPS----  411

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD+VMSE++LGRQI N+VACEG DRVERHETL QWR RF   GF  V +GSNAYKQ
Sbjct  412  ----QDRVMSELFLGRQILNLVACEGEDRVERHETLNQWRNRFGLGGFKPVSIGSNAYKQ  467

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  189
            ASMLLAL+AG DGY VEEN+G L LGW TRPLIATSAW++ 
Sbjct  468  ASMLLALYAGADGYNVEENEGCLLLGWQTRPLIATSAWRIN  508



>ref|XP_006302161.1| hypothetical protein CARUB_v10020171mg [Capsella rubella]
 gb|EOA35059.1| hypothetical protein CARUB_v10020171mg [Capsella rubella]
Length=505

 Score =   236 bits (602),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 130/160 (81%), Gaps = 8/160 (5%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG+ +K LS ++ ++P+I+T+VEQEANHNG VF+DRFTESLHYYS+LFDSLEG  +    
Sbjct  354  PGSIDKFLSTIRSIRPDIMTIVEQEANHNGTVFLDRFTESLHYYSSLFDSLEGSPS----  409

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD+VMSE++LGRQI N+VACEG DRVERHETL QWR RF S GF  V++GSNAYKQ
Sbjct  410  ----QDRVMSELFLGRQILNLVACEGEDRVERHETLNQWRNRFGSGGFKPVNIGSNAYKQ  465

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            ASMLLAL AG DGY V+EN+G L LGW TRPLIATSAW L
Sbjct  466  ASMLLALHAGADGYSVDENEGCLLLGWQTRPLIATSAWSL  505



>ref|XP_010420475.1| PREDICTED: DELLA protein RGL3 [Camelina sativa]
Length=528

 Score =   236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 129/162 (80%), Gaps = 5/162 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG+ EK+L+ V+ +KP IVTVVEQEANHNG VF+DRF E+LHYYS+LFDSLE      G 
Sbjct  368  PGSIEKLLATVKAVKPSIVTVVEQEANHNGVVFLDRFNEALHYYSSLFDSLEDSVVIPG-  426

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD+VMSEVYLGRQI NVVA EG+DRVERHETL QWR R  +AGF  V+LG +A+KQ
Sbjct  427  ----QDRVMSEVYLGRQILNVVAAEGIDRVERHETLDQWRRRMGTAGFDPVNLGYDAFKQ  482

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            AS+LLALF GGDGYRVEENDG L L W T+PL+A SAWKL +
Sbjct  483  ASLLLALFGGGDGYRVEENDGSLMLAWQTKPLVAASAWKLAA  524



>ref|XP_010453948.1| PREDICTED: DELLA protein RGL3-like [Camelina sativa]
Length=527

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 129/162 (80%), Gaps = 5/162 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG+ EK+L+ V+ +KP IVTVVEQEANHNG VF+DRF E+LHYYS+LFDSLE  A   G 
Sbjct  367  PGSIEKLLATVKAVKPSIVTVVEQEANHNGVVFLDRFNEALHYYSSLFDSLEDSAVIPG-  425

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD+V+SEVYLGRQI NVVA EG DRVERHETL QWR R  SAGF  V+LG +A+KQ
Sbjct  426  ----QDRVLSEVYLGRQILNVVAAEGTDRVERHETLDQWRRRMGSAGFDPVNLGYDAFKQ  481

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            AS+LLALF GGDGYRVEENDG L L W T+PL+A SAWKL +
Sbjct  482  ASLLLALFGGGDGYRVEENDGSLMLAWQTKPLVAASAWKLAA  523



>emb|CDY70426.1| BnaCnng68300D [Brassica napus]
Length=507

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 130/161 (81%), Gaps = 8/161 (5%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG+ + +L  ++ +KP+I+TVVEQEA+HNG VF DRFTESLHYYS+LFDSLEG  +    
Sbjct  352  PGSIDNILLTIKSIKPDIITVVEQEADHNGAVFFDRFTESLHYYSSLFDSLEGPPS----  407

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD+VMSE+YLGRQI N+VACEG DRVERHETLAQWR RF   GF +V++GS AYKQ
Sbjct  408  ----QDRVMSELYLGRQILNLVACEGEDRVERHETLAQWRNRFTMGGFKSVNIGSYAYKQ  463

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  189
            ASMLLAL+AG DGY+VEEN+G L LGW TRPLIATSAW+  
Sbjct  464  ASMLLALYAGADGYKVEENEGCLLLGWQTRPLIATSAWRFN  504



>gb|AGA16543.1| DELLA protein RGL2, partial [Sisymbrium officinale]
Length=533

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 131/159 (82%), Gaps = 5/159 (3%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            G+ EK+L+ V+ +KP IVTVVEQEANHNG VF+DRF E+LHYYS+LFDSLE     +  +
Sbjct  372  GSIEKLLATVKAVKPSIVTVVEQEANHNGNVFLDRFNEALHYYSSLFDSLE-----DSYS  426

Query  488  VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQA  309
            +  QD+VMSEVYLGRQI NVVA EG DRVERHETLAQW++R  S GF  V LGS+A+KQA
Sbjct  427  LPSQDRVMSEVYLGRQIVNVVAAEGSDRVERHETLAQWKSRMGSVGFDPVPLGSSAFKQA  486

Query  308  SMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            SMLL++FAGGDGYRVEENDG L LGW TRPLI TSAWKL
Sbjct  487  SMLLSVFAGGDGYRVEENDGCLMLGWQTRPLITTSAWKL  525



>ref|XP_008457015.1| PREDICTED: DELLA protein GAI-like [Cucumis melo]
Length=563

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 131/160 (82%), Gaps = 7/160 (4%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            GA EKVL+ ++++ P+I+TVVEQ ANHNGP F+DRFTE+LHYYS+LFDSLEG  A E   
Sbjct  400  GAIEKVLTTIKELNPKIITVVEQVANHNGPSFVDRFTEALHYYSSLFDSLEGSPAGE---  456

Query  488  VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQA  309
               +D V SE YLGRQI NVVACEG DRVERHET+AQWR+R  S+GF  VHLGSNA+ QA
Sbjct  457  ---EDVVRSEEYLGRQIYNVVACEGSDRVERHETVAQWRSRLSSSGFEMVHLGSNAFNQA  513

Query  308  SMLL-ALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            S LL ALF GG+GYRVEEN+G LTLGWHTRPLIATSAW +
Sbjct  514  STLLAALFGGGNGYRVEENNGSLTLGWHTRPLIATSAWTV  553



>gb|AFC88482.1| DELLA protein [Rosa lucieae]
Length=564

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 132/162 (81%), Gaps = 6/162 (4%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKV++ ++ M P+IVT+VEQEANHNGPVF+DRF ESLHYYS+LFDSLEG + S   
Sbjct  406  PGAIEKVMASIKAMNPKIVTMVEQEANHNGPVFLDRFNESLHYYSSLFDSLEGSSGSS--  463

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                +D VMSEVYLGRQICNVVAC+G DRVERHETL QWR R   AGF  VHLGSN +KQ
Sbjct  464  ----EDLVMSEVYLGRQICNVVACDGGDRVERHETLTQWRNRLSRAGFEPVHLGSNVFKQ  519

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            A  LLAL+AGG GY+VEEN+G L LGWHTRPLIATSAW+L S
Sbjct  520  AKTLLALYAGGGGYQVEENNGSLMLGWHTRPLIATSAWQLAS  561



>ref|XP_010492705.1| PREDICTED: DELLA protein RGL3-like [Camelina sativa]
Length=529

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 129/162 (80%), Gaps = 5/162 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG+ E++L+ V+ +KP IVTVVEQEANHNG VF+DRF E+LHYYS+LFDSLE      G 
Sbjct  369  PGSIEELLATVKAVKPSIVTVVEQEANHNGVVFLDRFNEALHYYSSLFDSLEDSVVIPG-  427

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD+VMSEVYLGRQI NVVA EG +RVERHETL QWR R +SAGF  V+LG +A+KQ
Sbjct  428  ----QDRVMSEVYLGRQILNVVAAEGTERVERHETLDQWRRRMRSAGFDPVNLGYDAFKQ  483

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            AS+LLALF GGDGYRVEENDG L L W T+PLIA SAWKL +
Sbjct  484  ASLLLALFGGGDGYRVEENDGSLMLAWQTKPLIAASAWKLAA  525



>ref|NP_197251.1| DELLA protein RGL3 [Arabidopsis thaliana]
 sp|Q9LF53.1|RGL3_ARATH RecName: Full=DELLA protein RGL3; AltName: Full=GRAS family protein 
27; Short=AtGRAS-27; AltName: Full=RGA-like protein 3 
[Arabidopsis thaliana]
 emb|CAC01893.1| RGA-like protein [Arabidopsis thaliana]
 dbj|BAC41902.1| RGA-like protein [Arabidopsis thaliana]
 gb|AAO64840.1| At5g17490 [Arabidopsis thaliana]
 gb|AED92433.1| DELLA protein RGL3 [Arabidopsis thaliana]
Length=523

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 131/162 (81%), Gaps = 5/162 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG+ EK+L+ V+ +KP +VTVVEQEANHNG VF+DRF E+LHYYS+LFDSLE     +G 
Sbjct  363  PGSIEKLLATVKAVKPGLVTVVEQEANHNGDVFLDRFNEALHYYSSLFDSLE-----DGV  417

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
             +  QD+VMSEVYLGRQI N+VA EG DR+ERHETLAQWR R  SAGF  V+LGS+A+KQ
Sbjct  418  VIPSQDRVMSEVYLGRQILNLVATEGSDRIERHETLAQWRKRMGSAGFDPVNLGSDAFKQ  477

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            AS+LLAL  GGDGYRVEENDG L L W T+PLIA SAWKL +
Sbjct  478  ASLLLALSGGGDGYRVEENDGSLMLAWQTKPLIAASAWKLAA  519



>ref|XP_009127484.1| PREDICTED: DELLA protein RGL1 [Brassica rapa]
Length=507

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 129/161 (80%), Gaps = 8/161 (5%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG+ + +L  ++ +KP+I+TVVEQEA+HNG VF DRFTESLHYYS+LFDSLEG  +    
Sbjct  352  PGSIDNILLTIKSIKPDIITVVEQEADHNGAVFFDRFTESLHYYSSLFDSLEGPPS----  407

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD+VMSE+YLGRQI N+VACEG DRVERHETLAQWR RF   GF +V +GS AYKQ
Sbjct  408  ----QDRVMSELYLGRQILNLVACEGEDRVERHETLAQWRNRFTMGGFKSVSIGSYAYKQ  463

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  189
            ASMLLAL+AG DGY+VEEN+G L LGW TRPLIATSAW+  
Sbjct  464  ASMLLALYAGADGYKVEENEGCLLLGWQTRPLIATSAWRFN  504



>gb|KFK38060.1| hypothetical protein AALP_AA3G064800 [Arabis alpina]
Length=545

 Score =   236 bits (601),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 129/159 (81%), Gaps = 5/159 (3%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            G+ EK+L+ V+ +KP IVTVVEQEANHNG VF+DRF E+LHYYS+LFDSLE     +  +
Sbjct  384  GSIEKLLTTVKAIKPSIVTVVEQEANHNGIVFLDRFNEALHYYSSLFDSLE-----DSYS  438

Query  488  VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQA  309
            +  QD+VMSEVYLGRQI NVVA EG DRVERHET  QW+ R  SAGF  V LGS+A+KQA
Sbjct  439  LLSQDRVMSEVYLGRQILNVVAAEGSDRVERHETFTQWKGRLGSAGFDPVPLGSSAFKQA  498

Query  308  SMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            SMLL+LFAGGDGYRVEENDG L LGW TRPLI TSAWKL
Sbjct  499  SMLLSLFAGGDGYRVEENDGCLMLGWQTRPLITTSAWKL  537



>gb|AFN25700.1| RGA-2, partial [Pyrus pyrifolia]
Length=134

 Score =   223 bits (568),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 118/140 (84%), Gaps = 6/140 (4%)
 Frame = -1

Query  653  VLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGAVCDQD  474
            VLS ++ MKP+IVT+VEQEANHNGPVF+DRFTE+LHYYS LFDSLEG +         QD
Sbjct  1    VLSSIKAMKPKIVTIVEQEANHNGPVFLDRFTEALHYYSNLFDSLEGSSGPS------QD  54

Query  473  KVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQASMLLA  294
             VMSEVYLGRQICNV+ACEG DRVERHETL+QWR R  SAGF  VHLGSNA+KQASMLLA
Sbjct  55   LVMSEVYLGRQICNVMACEGGDRVERHETLSQWRGRMDSAGFDPVHLGSNAFKQASMLLA  114

Query  293  LFAGGDGYRVEENDGGLTLG  234
            LFAGGDGYRVEEN+G L LG
Sbjct  115  LFAGGDGYRVEENNGSLMLG  134



>ref|XP_010926472.1| PREDICTED: DELLA protein SLR1-like [Elaeis guineensis]
Length=651

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 131/168 (78%), Gaps = 8/168 (5%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVT+VEQEANHN   F++RFTE+LHYYST+FDSLEG   +   
Sbjct  470  PGALEKVLGTVRAVRPRIVTMVEQEANHNAGSFLERFTEALHYYSTMFDSLEGGGTAAAA  529

Query  491  --------AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVH  336
                    ++  QD VMSEVYLGRQICNVV CEG +R ERHETL QWR R   AGF  VH
Sbjct  530  AAEAAVGASMGQQDLVMSEVYLGRQICNVVPCEGTERTERHETLGQWRGRMTRAGFEPVH  589

Query  335  LGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            LGSNA+KQASMLLALFAGGDGYRVEE +G LTLGWHTRPLIATSAW++
Sbjct  590  LGSNAFKQASMLLALFAGGDGYRVEEKEGCLTLGWHTRPLIATSAWRV  637



>ref|XP_002887024.1| hypothetical protein ARALYDRAFT_475738 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63283.1| hypothetical protein ARALYDRAFT_475738 [Arabidopsis lyrata subsp. 
lyrata]
Length=511

 Score =   234 bits (598),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 130/161 (81%), Gaps = 8/161 (5%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG+ +K LS ++ ++P I+TVVEQEANHNG  F+DRFTESLHYYS+LFDSLEG  +    
Sbjct  356  PGSIDKFLSTIKSIRPNIMTVVEQEANHNGANFLDRFTESLHYYSSLFDSLEGPPS----  411

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD+VMSE++LGRQI N+VACEG DRVERHETL QWR RF S GF  V++GSNAYKQ
Sbjct  412  ----QDRVMSELFLGRQILNLVACEGEDRVERHETLNQWRNRFGSRGFKPVNIGSNAYKQ  467

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  189
            ASMLLAL+AG DGY VEE++G L LGW TRPLIATSAW++ 
Sbjct  468  ASMLLALYAGADGYNVEEDEGCLLLGWQTRPLIATSAWRIN  508



>ref|XP_002873832.1| hypothetical protein ARALYDRAFT_488615 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50091.1| hypothetical protein ARALYDRAFT_488615 [Arabidopsis lyrata subsp. 
lyrata]
Length=506

 Score =   234 bits (597),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 131/162 (81%), Gaps = 5/162 (3%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG+ EK+L+ V  +KP +VTVVEQEANHNG  F+DRF E+LHYYS+LFDSLE     +G 
Sbjct  346  PGSIEKLLATVNAVKPGLVTVVEQEANHNGAGFLDRFNEALHYYSSLFDSLE-----DGV  400

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
             +  QD+VMSEVYLGRQI NVVA EG+DR+ERHETLAQWR R ++AGF  V+LGS+A+KQ
Sbjct  401  VIPSQDRVMSEVYLGRQILNVVAAEGIDRIERHETLAQWRKRMENAGFDPVNLGSDAFKQ  460

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
            AS+LLAL  GGDGYRVEENDG L L W T+PLIA SAWKL +
Sbjct  461  ASLLLALSGGGDGYRVEENDGSLMLAWQTKPLIAASAWKLAA  502



>ref|XP_010511563.1| PREDICTED: DELLA protein RGL1-like [Camelina sativa]
Length=508

 Score =   234 bits (597),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 131/161 (81%), Gaps = 8/161 (5%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG+ +K +S ++ ++P+I+TVVEQEANHNG VF++RFTESLHYYS+LFDSLEG  +    
Sbjct  353  PGSIDKFISTIRSIRPDIMTVVEQEANHNGTVFVERFTESLHYYSSLFDSLEGPLS----  408

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD+VMSE++LGRQI N+VACEG DRVERHETL QWR RF S GF  V++GSNAYKQ
Sbjct  409  ----QDRVMSELFLGRQILNLVACEGEDRVERHETLNQWRNRFGSGGFKPVNIGSNAYKQ  464

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  189
            ASMLLAL AG +GY VEENDG L LGW TRPLIATSAW++ 
Sbjct  465  ASMLLALHAGANGYNVEENDGCLLLGWQTRPLIATSAWRIN  505



>emb|CAA12242.1| RGA-like [Arabidopsis thaliana]
Length=662

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 130/161 (81%), Gaps = 8/161 (5%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG+ +K LS ++ ++P+I+TVVEQEANHNG VF+DRFTESLHYYS+LFDSLEG  +    
Sbjct  507  PGSIDKFLSTIKSIRPDIMTVVEQEANHNGTVFLDRFTESLHYYSSLFDSLEGPPS----  562

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD+VMSE++LGRQI N+VACEG DRVERHETL QWR RF   GF  V +GSNAYKQ
Sbjct  563  ----QDRVMSELFLGRQILNLVACEGEDRVERHETLNQWRNRFGLGGFKPVSIGSNAYKQ  618

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  189
            ASMLLAL+AG DGY VEEN+G L LGW TRPLIATSAW++ 
Sbjct  619  ASMLLALYAGADGYNVEENEGCLLLGWQTRPLIATSAWRIN  659



>gb|KFK41051.1| hypothetical protein AALP_AA2G079000 [Arabis alpina]
Length=506

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 130/160 (81%), Gaps = 8/160 (5%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            G+ +KVL  ++ + P+I+TVVEQEANHNG VF+DRFTESLHYYS+LFDSLEG  +     
Sbjct  351  GSIDKVLLTIKSINPDIMTVVEQEANHNGDVFLDRFTESLHYYSSLFDSLEGPPS-----  405

Query  488  VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQA  309
               QD+VMSE+YLGRQI N VACEG DRVERHETL QWR RF SAGF  V++GSNAYKQA
Sbjct  406  ---QDRVMSELYLGRQILNFVACEGEDRVERHETLVQWRNRFGSAGFKPVNIGSNAYKQA  462

Query  308  SMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  189
            SML+AL+AG DGY+VEEN+G L LGW TR LIATSAW++ 
Sbjct  463  SMLVALYAGADGYKVEENEGCLLLGWQTRLLIATSAWRIN  502



>ref|XP_009130367.1| PREDICTED: LOW QUALITY PROTEIN: DELLA protein RGL2 [Brassica 
rapa]
Length=543

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 130/159 (82%), Gaps = 5/159 (3%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            G+ EK+L+ V+ ++P I+T+VEQEANHNG VF+DRF E+LHYYS+LFDSLE     +   
Sbjct  387  GSIEKLLTTVKTVRPSILTMVEQEANHNGVVFLDRFNEALHYYSSLFDSLE-----DSYT  441

Query  488  VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQA  309
            +  QD+VMSEVYLGRQI NVVA EG DRVERHETLAQW+ R  S GF  V LGS+A+KQA
Sbjct  442  LPSQDRVMSEVYLGRQIVNVVAAEGTDRVERHETLAQWKARMGSVGFDPVPLGSSAFKQA  501

Query  308  SMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            SMLL++FAGGDGYRVEENDG L LGW TRPLIATSAWKL
Sbjct  502  SMLLSVFAGGDGYRVEENDGCLMLGWQTRPLIATSAWKL  540



>gb|ADP02183.1| Rht-D1b [Triticum aestivum]
Length=559

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 133/171 (78%), Gaps = 11/171 (6%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG ++  G 
Sbjct  386  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGGSSGGGP  445

Query  491  AVCDQ-----------DKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFS  345
            +               D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R  +AGF 
Sbjct  446  SEVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGNAGFE  505

Query  344  AVHLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
             VHLGSNAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L
Sbjct  506  TVHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRL  556



>gb|AAM15897.1|AF492580_1 GIA/RGA-like gibberellin response modulator [Anisocarpus madioides]
Length=143

 Score =   221 bits (563),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 117/143 (82%), Gaps = 2/143 (1%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVLS +  MKP+IVT+VEQE+NHNG +FM+RF E+LHYYST+FDSLE  A +   
Sbjct  2    PGAVEKVLSAITKMKPKIVTLVEQESNHNGALFMERFNEALHYYSTMFDSLESSALTLPN  61

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
            +    D VMSEVYLGRQICNVVACEG DRVERHETL QWR R  SAGF  VHLGSNA+KQ
Sbjct  62   S--PDDLVMSEVYLGRQICNVVACEGTDRVERHETLTQWRVRMNSAGFEPVHLGSNAFKQ  119

Query  311  ASMLLALFAGGDGYRVEENDGGL  243
            ASMLLALFA GDGYRVEENDG L
Sbjct  120  ASMLLALFADGDGYRVEENDGCL  142



>ref|XP_010470510.1| PREDICTED: DELLA protein RGL1 isoform X1 [Camelina sativa]
 ref|XP_010470511.1| PREDICTED: DELLA protein RGL1 isoform X2 [Camelina sativa]
Length=508

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 130/161 (81%), Gaps = 8/161 (5%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PG+ +K +S ++ ++P+I+TVVEQEANHNG VF+DRFTESLHYYS+LFDSLEG  +    
Sbjct  353  PGSIDKFISTIRSIRPDIMTVVEQEANHNGTVFVDRFTESLHYYSSLFDSLEGPPS----  408

Query  491  AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQ  312
                QD+VMSE++LG+QI N+VACEG DRVERHETL QWR RF S GF  V++GSNAYKQ
Sbjct  409  ----QDRVMSELFLGQQILNLVACEGEDRVERHETLNQWRNRFGSGGFKPVNIGSNAYKQ  464

Query  311  ASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  189
            ASMLLA  AG DGY VEEN+G L LGW TRPLIATSAW++ 
Sbjct  465  ASMLLAFHAGADGYNVEENEGCLLLGWQTRPLIATSAWRIN  505



>gb|AGG68478.1| DELLA protein [Triticum aestivum]
Length=623

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 134/173 (77%), Gaps = 11/173 (6%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG ++  G 
Sbjct  450  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGGSSGGGP  509

Query  491  AVCDQ-----------DKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFS  345
            +               D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R  +AGF 
Sbjct  510  SEVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGNAGFE  569

Query  344  AVHLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  186
             VHLGSNAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  570  TVHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  622



>ref|XP_006391387.1| hypothetical protein EUTSA_v10018436mg [Eutrema salsugineum]
 gb|ESQ28673.1| hypothetical protein EUTSA_v10018436mg [Eutrema salsugineum]
Length=502

 Score =   232 bits (592),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 130/160 (81%), Gaps = 8/160 (5%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            G+ EK LS ++ ++P+I+TVVEQEANHNG  F+DRFTESLHYYS+LFDSLEG  +     
Sbjct  348  GSIEKFLSAIKLIEPDIMTVVEQEANHNGANFLDRFTESLHYYSSLFDSLEGPPS-----  402

Query  488  VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQA  309
               QD+VMSE+YLGRQI N+VACEG DRVERHETL QWR R  S+GF  V++GSNA+KQA
Sbjct  403  ---QDRVMSELYLGRQILNLVACEGEDRVERHETLNQWRNRLGSSGFKPVNIGSNAFKQA  459

Query  308  SMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  189
            SMLLAL+AG DGY+VEEN+G L LGW TRPLIATSAW+  
Sbjct  460  SMLLALYAGADGYKVEENEGCLLLGWQTRPLIATSAWRFN  499



>ref|XP_006299072.1| hypothetical protein CARUB_v10015212mg [Capsella rubella]
 gb|EOA31970.1| hypothetical protein CARUB_v10015212mg [Capsella rubella]
Length=552

 Score =   233 bits (595),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 129/159 (81%), Gaps = 5/159 (3%)
 Frame = -1

Query  668  GAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGA  489
            G+ EK+L  V+ +KP IVTVVEQEANHNG VF+DRF E+LHYYS+LFDSLE     +  +
Sbjct  394  GSIEKLLETVKAVKPSIVTVVEQEANHNGVVFLDRFNEALHYYSSLFDSLE-----DSYS  448

Query  488  VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGSNAYKQA  309
            +  QD+VMSEVYLGRQI NVVA EG DRVERHETL QW+ R +S GF  V+LGS++YKQA
Sbjct  449  LPSQDRVMSEVYLGRQILNVVAAEGYDRVERHETLPQWKNRMRSGGFDPVNLGSSSYKQA  508

Query  308  SMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
            SMLL++FA GDGYRVEENDG L LGW TRPLI TSAWKL
Sbjct  509  SMLLSVFATGDGYRVEENDGCLMLGWQTRPLITTSAWKL  547



>emb|CBW30290.1| RHT-D1 protein [Triticum aestivum]
Length=623

 Score =   234 bits (598),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 133/171 (78%), Gaps = 11/171 (6%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG ++  G 
Sbjct  450  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGGSSGGGP  509

Query  491  AVCDQ-----------DKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFS  345
            +               D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R  +AGF 
Sbjct  510  SEVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGNAGFE  569

Query  344  AVHLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
             VHLGSNAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L
Sbjct  570  TVHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRL  620



>gb|AGG68476.1| DELLA protein [Triticum aestivum]
Length=623

 Score =   234 bits (598),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 133/171 (78%), Gaps = 11/171 (6%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG ++  G 
Sbjct  450  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGGSSGGGP  509

Query  491  AVCDQ-----------DKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFS  345
            +               D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R  +AGF 
Sbjct  510  SEVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGNAGFE  569

Query  344  AVHLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
             VHLGSNAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L
Sbjct  570  TVHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRL  620



>emb|CBW30289.1| RHT-D1 protein [Triticum aestivum]
Length=623

 Score =   234 bits (598),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 133/171 (78%), Gaps = 11/171 (6%)
 Frame = -1

Query  671  PGAXEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGG  492
            PGA EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG ++  G 
Sbjct  450  PGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEGGSSGGGP  509

Query  491  AVCDQ-----------DKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFS  345
            +               D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R  +AGF 
Sbjct  510  SEVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGNAGFE  569

Query  344  AVHLGSNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  192
             VHLGSNAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L
Sbjct  570  TVHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRL  620



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520