BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF013H20

Length=710
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009596634.1|  PREDICTED: polyol transporter 5-like               219   2e-68   Nicotiana tomentosiformis
ref|XP_002313809.1|  putative sorbitol transporter family protein       230   4e-68   Populus trichocarpa [western balsam poplar]
ref|XP_009766648.1|  PREDICTED: polyol transporter 5-like               218   6e-68   Nicotiana sylvestris
ref|XP_011048787.1|  PREDICTED: polyol transporter 5-like               228   2e-67   Populus euphratica
ref|XP_002519083.1|  sugar transporter, putative                        228   4e-67   Ricinus communis
ref|XP_008368693.1|  PREDICTED: polyol transporter 5-like               222   7e-67   
ref|XP_011037561.1|  PREDICTED: polyol transporter 5                    227   7e-67   Populus euphratica
ref|XP_009611551.1|  PREDICTED: polyol transporter 5-like               225   3e-66   Nicotiana tomentosiformis
ref|XP_009378956.1|  PREDICTED: putative polyol transporter 1           224   5e-66   Pyrus x bretschneideri [bai li]
ref|XP_008345143.1|  PREDICTED: polyol transporter 5-like               224   6e-66   Malus domestica [apple tree]
ref|XP_003631630.1|  PREDICTED: polyol transporter 5                    224   8e-66   Vitis vinifera
gb|AGY96955.1|  polyol transporter 1                                    224   8e-66   Vitis vinifera
ref|XP_008387375.1|  PREDICTED: polyol transporter 5-like               223   9e-66   
ref|XP_008368694.1|  PREDICTED: polyol transporter 5-like               222   1e-65   
ref|XP_011092774.1|  PREDICTED: polyol transporter 5-like               221   1e-65   Sesamum indicum [beniseed]
ref|XP_007042744.1|  Polyol/monosaccharide transporter 5                223   1e-65   
ref|XP_009350912.1|  PREDICTED: putative polyol transporter 1           222   3e-65   Pyrus x bretschneideri [bai li]
gb|KDP46229.1|  hypothetical protein JCGZ_10069                         222   3e-65   Jatropha curcas
ref|XP_010096202.1|  Polyol transporter 5                               222   6e-65   Morus notabilis
ref|XP_009342010.1|  PREDICTED: putative polyol transporter 1           221   1e-64   Pyrus x bretschneideri [bai li]
ref|XP_009342008.1|  PREDICTED: putative polyol transporter 1           221   1e-64   Pyrus x bretschneideri [bai li]
ref|XP_008359575.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...    220   2e-64   
ref|XP_011088358.1|  PREDICTED: polyol transporter 5-like               219   4e-64   Sesamum indicum [beniseed]
ref|XP_002305419.2|  hypothetical protein POPTR_0004s15960g             219   5e-64   Populus trichocarpa [western balsam poplar]
gb|KEH30427.1|  polyol/monosaccharide transporter 1                     214   5e-64   Medicago truncatula
ref|XP_004507415.1|  PREDICTED: polyol transporter 5-like               219   7e-64   Cicer arietinum [garbanzo]
ref|NP_001280902.1|  putative polyol transporter 1                      219   8e-64   Malus domestica [apple tree]
ref|XP_008387377.1|  PREDICTED: putative polyol transporter 1           218   8e-64   
ref|XP_008387376.1|  PREDICTED: putative polyol transporter 1           218   9e-64   
ref|XP_006384498.1|  hypothetical protein POPTR_0004s15900g             218   1e-63   
ref|XP_009375838.1|  PREDICTED: putative polyol transporter 1           218   1e-63   Pyrus x bretschneideri [bai li]
ref|XP_010909852.1|  PREDICTED: putative polyol transporter 1           218   2e-63   Elaeis guineensis
ref|XP_008236797.1|  PREDICTED: putative polyol transporter 2           218   2e-63   Prunus mume [ume]
ref|XP_008387373.1|  PREDICTED: putative polyol transporter 1           218   2e-63   
ref|XP_009800568.1|  PREDICTED: polyol transporter 5-like               215   2e-63   Nicotiana sylvestris
ref|XP_006487182.1|  PREDICTED: polyol transporter 5-like               218   2e-63   Citrus sinensis [apfelsine]
ref|XP_008236860.1|  PREDICTED: putative polyol transporter 1           217   2e-63   Prunus mume [ume]
ref|XP_006423215.1|  hypothetical protein CICLE_v10028170mg             218   2e-63   Citrus clementina [clementine]
ref|XP_009344435.1|  PREDICTED: putative polyol transporter 1           217   2e-63   Pyrus x bretschneideri [bai li]
ref|XP_009375822.1|  PREDICTED: putative polyol transporter 1           217   2e-63   Pyrus x bretschneideri [bai li]
ref|XP_009342009.1|  PREDICTED: putative polyol transporter 1           217   3e-63   Pyrus x bretschneideri [bai li]
ref|XP_004299107.1|  PREDICTED: polyol transporter 5-like               217   4e-63   Fragaria vesca subsp. vesca
ref|XP_009350914.1|  PREDICTED: putative polyol transporter 1           216   4e-63   Pyrus x bretschneideri [bai li]
ref|NP_001281038.1|  polyol transporter 5-like                          215   5e-63   Malus domestica [apple tree]
ref|XP_008246181.1|  PREDICTED: polyol transporter 5-like               212   6e-63   Prunus mume [ume]
gb|KHG20989.1|  Polyol transporter 5 -like protein                      216   8e-63   Gossypium arboreum [tree cotton]
ref|XP_003541068.1|  PREDICTED: polyol transporter 5-like               216   1e-62   
gb|KHN25361.1|  Polyol transporter 5                                    216   1e-62   Glycine soja [wild soybean]
ref|XP_009336961.1|  PREDICTED: putative polyol transporter 1           216   1e-62   Pyrus x bretschneideri [bai li]
ref|XP_009345071.1|  PREDICTED: putative polyol transporter 1           215   2e-62   Pyrus x bretschneideri [bai li]
ref|XP_006361759.1|  PREDICTED: polyol transporter 5-like               202   2e-62   Solanum tuberosum [potatoes]
gb|AFI61955.1|  polyol transporter                                      213   3e-62   Camellia sinensis [black tea]
gb|ACD68477.1|  plasma membrane mannitol transporter                    212   3e-62   Arachis hypogaea [goober]
gb|EYU42629.1|  hypothetical protein MIMGU_mgv1a0059092mg               207   3e-62   Erythranthe guttata [common monkey flower]
gb|ACB56939.1|  mannitol transporter                                    214   4e-62   Artemisia annua [sweet Annie]
gb|KEH30425.1|  polyol/monosaccharide transporter 1                     213   4e-62   Medicago truncatula
ref|NP_001289249.1|  polyol transporter 5-like                          214   4e-62   Pyrus x bretschneideri [bai li]
gb|AAM44082.1|  putative sorbitol transporter                           214   5e-62   Prunus cerasus [pie cherry]
gb|ACB86853.1|  mannitol transporter                                    214   7e-62   Citrus sinensis [apfelsine]
gb|KJB32189.1|  hypothetical protein B456_005G228500                    214   7e-62   Gossypium raimondii
ref|XP_006423216.1|  hypothetical protein CICLE_v10028174mg             213   9e-62   Citrus clementina [clementine]
gb|KEH30426.1|  polyol/monosaccharide transporter 1                     213   9e-62   Medicago truncatula
emb|CDO97075.1|  unnamed protein product                                211   1e-61   Coffea canephora [robusta coffee]
ref|XP_009345072.1|  PREDICTED: putative polyol transporter 1           213   1e-61   
ref|XP_008466959.1|  PREDICTED: polyol transporter 5-like               206   2e-61   Cucumis melo [Oriental melon]
ref|XP_008245258.1|  PREDICTED: polyol transporter 5-like               212   2e-61   Prunus mume [ume]
gb|ABK29439.1|  sugar transport protein                                 211   3e-61   Coffea canephora [robusta coffee]
ref|XP_008361285.1|  PREDICTED: putative polyol transporter 1           212   3e-61   
ref|XP_008236773.1|  PREDICTED: putative polyol transporter 1           212   3e-61   Prunus mume [ume]
gb|AAO39267.1|AF482011_1  sorbitol transporter                          211   5e-61   Prunus cerasus [pie cherry]
ref|XP_007199793.1|  hypothetical protein PRUPE_ppa004456mg             211   5e-61   Prunus persica
ref|XP_007199207.1|  hypothetical protein PRUPE_ppa021762mg             211   8e-61   Prunus persica
ref|XP_008236796.1|  PREDICTED: polyol transporter 5-like               210   8e-61   Prunus mume [ume]
gb|AAY88181.2|  mannitol transporter 1                                  209   8e-61   Olea europaea
ref|XP_007200254.1|  hypothetical protein PRUPE_ppa015090mg             210   1e-60   Prunus persica
ref|XP_006365518.1|  PREDICTED: polyol transporter 5-like               207   1e-60   Solanum tuberosum [potatoes]
ref|XP_007200117.1|  hypothetical protein PRUPE_ppa018884mg             210   1e-60   Prunus persica
gb|AAL85876.2|AF480069_1  mannitol transporter                          210   1e-60   Apium graveolens Dulce Group [celery]
ref|XP_008245305.1|  PREDICTED: polyol transporter 5-like               210   1e-60   Prunus mume [ume]
ref|XP_008812826.1|  PREDICTED: polyol transporter 5-like               203   1e-60   Phoenix dactylifera
ref|XP_007200033.1|  hypothetical protein PRUPE_ppa024323mg             210   1e-60   
ref|XP_007200667.1|  hypothetical protein PRUPE_ppa015294mg             210   2e-60   
gb|AIU41385.1|  sorbitol transporter 1                                  209   2e-60   Prunus salicina [Japanese plum]
ref|XP_007042751.1|  Polyol/monosaccharide transporter 5, putative      209   2e-60   
gb|AAL38359.1|  sugar transporter protein                               201   3e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004300990.1|  PREDICTED: polyol transporter 5-like               209   4e-60   Fragaria vesca subsp. vesca
ref|XP_003603886.1|  Mannitol transporter                               208   4e-60   Medicago truncatula
gb|KDP46230.1|  hypothetical protein JCGZ_10070                         209   5e-60   Jatropha curcas
ref|XP_002467638.1|  hypothetical protein SORBIDRAFT_01g031360          209   5e-60   Sorghum bicolor [broomcorn]
ref|XP_010527590.1|  PREDICTED: polyol transporter 5-like               207   1e-59   Tarenaya hassleriana [spider flower]
ref|XP_004500821.1|  PREDICTED: polyol transporter 5-like               207   1e-59   Cicer arietinum [garbanzo]
ref|XP_006487181.1|  PREDICTED: polyol transporter 5-like               208   1e-59   Citrus sinensis [apfelsine]
ref|NP_001045505.2|  Os01g0966900                                       206   1e-59   
tpg|DAA45950.1|  TPA: hypothetical protein ZEAMMB73_850316              207   1e-59   
gb|EAZ04480.1|  hypothetical protein OsI_26629                          207   2e-59   Oryza sativa Indica Group [Indian rice]
dbj|BAC83310.1|  putative sorbitol transporter                          207   2e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008387370.1|  PREDICTED: putative polyol transporter 1           207   3e-59   Malus domestica [apple tree]
ref|XP_010065409.1|  PREDICTED: polyol transporter 5-like               207   3e-59   Eucalyptus grandis [rose gum]
ref|XP_010065405.1|  PREDICTED: polyol transporter 5-like               206   3e-59   Eucalyptus grandis [rose gum]
gb|KHN39768.1|  Polyol transporter 5                                    206   4e-59   Glycine soja [wild soybean]
emb|CAP58707.1|  putative polyol transported protein 2                  206   4e-59   Hevea brasiliensis [jebe]
ref|NP_001236592.1|  sorbitol-like transporter                          206   4e-59   
ref|XP_002460923.1|  hypothetical protein SORBIDRAFT_02g037570          206   4e-59   Sorghum bicolor [broomcorn]
gb|AAZ80876.1|  putative sorbitol transporter                           200   5e-59   Nicotiana langsdorffii x Nicotiana sanderae
ref|NP_001060108.1|  Os07g0582400                                       207   5e-59   
ref|XP_010254895.1|  PREDICTED: polyol transporter 5-like               205   9e-59   Nelumbo nucifera [Indian lotus]
ref|XP_008653287.1|  PREDICTED: polyol transporter 5-like               205   1e-58   Zea mays [maize]
ref|XP_009375628.1|  PREDICTED: putative polyol transporter 1           205   1e-58   Pyrus x bretschneideri [bai li]
ref|XP_004148857.1|  PREDICTED: polyol transporter 5-like               205   1e-58   Cucumis sativus [cucumbers]
ref|NP_001281033.1|  polyol transporter 5-like                          205   1e-58   Malus domestica [apple tree]
ref|XP_009344433.1|  PREDICTED: putative polyol transporter 1           205   1e-58   Pyrus x bretschneideri [bai li]
gb|EPS69995.1|  sugar transport protein                                 204   1e-58   Genlisea aurea
ref|XP_006657888.1|  PREDICTED: polyol transporter 5-like               204   1e-58   Oryza brachyantha
ref|XP_007131851.1|  hypothetical protein PHAVU_011G046700g             204   2e-58   Phaseolus vulgaris [French bean]
ref|XP_010068107.1|  PREDICTED: polyol transporter 5-like               203   2e-58   Eucalyptus grandis [rose gum]
emb|CAJ29291.1|  putative polyol transporter protein 4                  204   2e-58   Lotus japonicus
ref|XP_004983902.1|  PREDICTED: polyol transporter 5-like isoform X2    204   3e-58   
ref|XP_004170410.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...    204   4e-58   
gb|KCW62858.1|  hypothetical protein EUGRSUZ_G00452                     203   4e-58   Eucalyptus grandis [rose gum]
ref|XP_004983901.1|  PREDICTED: polyol transporter 5-like isoform X1    204   4e-58   Setaria italica
ref|XP_008387369.1|  PREDICTED: putative polyol transporter 1 iso...    204   4e-58   
ref|XP_010507195.1|  PREDICTED: polyol transporter 5                    203   6e-58   Camelina sativa [gold-of-pleasure]
ref|XP_004958137.1|  PREDICTED: polyol transporter 5-like               203   6e-58   Setaria italica
ref|XP_003562817.1|  PREDICTED: polyol transporter 5-like               202   8e-58   Brachypodium distachyon [annual false brome]
ref|XP_007135989.1|  hypothetical protein PHAVU_009G008900g             202   8e-58   Phaseolus vulgaris [French bean]
ref|XP_010487804.1|  PREDICTED: polyol transporter 5-like               203   8e-58   Camelina sativa [gold-of-pleasure]
ref|XP_002885281.1|  ATPLT5                                             202   1e-57   Arabidopsis lyrata subsp. lyrata
gb|KJB12317.1|  hypothetical protein B456_002G011600                    201   1e-57   Gossypium raimondii
ref|XP_009135601.1|  PREDICTED: polyol transporter 5                    202   1e-57   Brassica rapa
ref|XP_010465998.1|  PREDICTED: polyol transporter 5-like               202   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_008791366.1|  PREDICTED: polyol transporter 5-like               201   2e-57   
ref|XP_009407915.1|  PREDICTED: putative polyol transporter 1           201   2e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008800418.1|  PREDICTED: polyol transporter 5-like               201   3e-57   Phoenix dactylifera
dbj|BAM66295.1|  sorbitol transporter                                   199   4e-57   Pyrus pyrifolia [sha li]
ref|XP_008236795.1|  PREDICTED: polyol transporter 5-like               201   6e-57   Prunus mume [ume]
ref|XP_009785574.1|  PREDICTED: polyol transporter 5-like isoform X1    196   7e-57   Nicotiana sylvestris
ref|NP_188513.1|  polyol transporter 5                                  201   7e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009345075.1|  PREDICTED: putative polyol transporter 1           200   8e-57   Pyrus x bretschneideri [bai li]
ref|XP_008393068.1|  PREDICTED: putative polyol transporter 1           200   9e-57   Malus domestica [apple tree]
gb|AGG19155.1|  sorbitol transporter                                    200   1e-56   Pyrus pyrifolia [sha li]
ref|XP_009375627.1|  PREDICTED: putative polyol transporter 1           200   1e-56   Pyrus x bretschneideri [bai li]
ref|XP_009344434.1|  PREDICTED: polyol transporter 5-like               199   1e-56   Pyrus x bretschneideri [bai li]
ref|XP_009375629.1|  PREDICTED: polyol transporter 5-like               199   1e-56   Pyrus x bretschneideri [bai li]
gb|AGG19156.1|  sorbitol transporter                                    199   1e-56   Pyrus pyrifolia [sha li]
ref|XP_008775333.1|  PREDICTED: polyol transporter 5-like               199   1e-56   Phoenix dactylifera
dbj|BAM66296.1|  sorbitol transporter                                   197   2e-56   Pyrus pyrifolia [sha li]
gb|EYU37769.1|  hypothetical protein MIMGU_mgv1a005015mg                196   2e-56   Erythranthe guttata [common monkey flower]
ref|XP_009345073.1|  PREDICTED: polyol transporter 5-like               198   2e-56   Pyrus x bretschneideri [bai li]
ref|XP_009785575.1|  PREDICTED: polyol transporter 5-like isoform X2    194   2e-56   Nicotiana sylvestris
ref|NP_001281036.1|  polyol transporter 5-like                          198   3e-56   Malus domestica [apple tree]
ref|XP_008795608.1|  PREDICTED: putative polyol transporter 1           198   3e-56   Phoenix dactylifera
gb|AEX55225.1|  sugar transporter                                       198   4e-56   Allium sativum
gb|KJB12318.1|  hypothetical protein B456_002G011700                    198   4e-56   Gossypium raimondii
ref|XP_008800420.1|  PREDICTED: polyol transporter 5-like               198   4e-56   Phoenix dactylifera
gb|KFK30307.1|  hypothetical protein AALP_AA7G244900                    198   5e-56   Arabis alpina [alpine rockcress]
emb|CAP58706.1|  putative polyol transporter protein 1                  198   5e-56   Hevea brasiliensis [jebe]
ref|NP_001049270.1|  Os03g0197200                                       192   6e-56   
emb|CDY61985.1|  BnaC03g73840D                                          197   8e-56   Brassica napus [oilseed rape]
ref|XP_006577924.1|  PREDICTED: polyol transporter 5-like               196   1e-55   Glycine max [soybeans]
ref|XP_009602627.1|  PREDICTED: polyol transporter 5-like               195   1e-55   Nicotiana tomentosiformis
emb|CDX95491.1|  BnaC01g33830D                                          196   2e-55   
ref|XP_008447049.1|  PREDICTED: polyol transporter 5                    196   2e-55   Cucumis melo [Oriental melon]
gb|AAO88964.1|  sorbitol transporter                                    196   2e-55   Malus domestica [apple tree]
ref|XP_010690917.1|  PREDICTED: polyol transporter 5 isoform X2         197   2e-55   
ref|XP_010690916.1|  PREDICTED: polyol transporter 5 isoform X1         196   3e-55   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAJ85302.1|  predicted protein                                      196   3e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB12316.1|  hypothetical protein B456_002G011500                    196   3e-55   Gossypium raimondii
ref|NP_001287655.1|  polyol transporter 5-like                          190   3e-55   Solanum lycopersicum
ref|XP_008795662.1|  PREDICTED: probable polyol transporter 6           195   3e-55   
ref|XP_010905472.1|  PREDICTED: polyol transporter 5-like               196   4e-55   
gb|EMT15230.1|  Polyol transporter 5                                    195   4e-55   
ref|XP_009112300.1|  PREDICTED: polyol transporter 5                    195   5e-55   Brassica rapa
ref|XP_007131852.1|  hypothetical protein PHAVU_011G046800g             195   5e-55   Phaseolus vulgaris [French bean]
ref|NP_001168177.1|  uncharacterized protein LOC100381931               195   5e-55   Zea mays [maize]
gb|AAT06053.2|  sorbitol transporter                                    195   6e-55   Malus domestica [apple tree]
gb|EMS55536.1|  Polyol transporter 5                                    194   7e-55   Triticum urartu
ref|XP_009344431.1|  PREDICTED: putative polyol transporter 1           195   9e-55   Pyrus x bretschneideri [bai li]
ref|XP_003607077.1|  Sorbitol-like transporter                          194   1e-54   Medicago truncatula
ref|XP_008795604.1|  PREDICTED: putative polyol transporter 1           194   1e-54   Phoenix dactylifera
gb|KJB12315.1|  hypothetical protein B456_002G011400                    194   1e-54   Gossypium raimondii
ref|XP_011078884.1|  PREDICTED: polyol transporter 5-like isoform X2    191   2e-54   Sesamum indicum [beniseed]
ref|XP_004148312.1|  PREDICTED: polyol transporter 5-like               193   2e-54   
ref|XP_011088360.1|  PREDICTED: polyol transporter 5-like               188   2e-54   Sesamum indicum [beniseed]
ref|XP_011078883.1|  PREDICTED: polyol transporter 5-like isoform X1    190   2e-54   Sesamum indicum [beniseed]
ref|XP_009407903.1|  PREDICTED: polyol transporter 5-like               193   3e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004171995.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...    193   3e-54   
gb|KGN44323.1|  Sugar transporter                                       192   4e-54   Cucumis sativus [cucumbers]
ref|XP_008795607.1|  PREDICTED: polyol transporter 5-like isoform X2    192   5e-54   Phoenix dactylifera
ref|XP_002460924.1|  hypothetical protein SORBIDRAFT_02g037580          192   6e-54   Sorghum bicolor [broomcorn]
ref|XP_008795606.1|  PREDICTED: polyol transporter 5-like isoform X1    192   6e-54   Phoenix dactylifera
ref|NP_001141158.1|  hypothetical protein                               191   8e-54   Zea mays [maize]
ref|XP_010908358.1|  PREDICTED: probable polyol transporter 6           192   8e-54   
gb|EAY88906.1|  hypothetical protein OsI_10385                          192   9e-54   Oryza sativa Indica Group [Indian rice]
ref|XP_008667512.1|  PREDICTED: hypothetical protein isoform X1         191   1e-53   Zea mays [maize]
gb|EEE58504.1|  hypothetical protein OsJ_09775                          191   1e-53   Oryza sativa Japonica Group [Japonica rice]
gb|EYU20732.1|  hypothetical protein MIMGU_mgv1a026176mg                187   2e-53   Erythranthe guttata [common monkey flower]
ref|XP_002463086.1|  hypothetical protein SORBIDRAFT_02g037590          191   2e-53   Sorghum bicolor [broomcorn]
gb|ABF94465.1|  Sugar transporter family protein, expressed             191   2e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007131850.1|  hypothetical protein PHAVU_011G046600g             190   4e-53   Phaseolus vulgaris [French bean]
gb|KHN41994.1|  Putative polyol transporter 6                           189   5e-53   Glycine soja [wild soybean]
ref|XP_009395604.1|  PREDICTED: putative polyol transporter 1           191   5e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009396401.1|  PREDICTED: polyol transporter 5-like               189   6e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006590682.1|  PREDICTED: probable polyol transporter 6-like      189   7e-53   Glycine max [soybeans]
ref|XP_010905473.1|  PREDICTED: putative polyol transporter 1           189   9e-53   
ref|XP_008670519.1|  PREDICTED: putative polyol transporter 1           189   1e-52   
ref|XP_006406559.1|  hypothetical protein EUTSA_v10020495mg             189   1e-52   Eutrema salsugineum [saltwater cress]
ref|XP_006349557.1|  PREDICTED: polyol transporter 5-like               189   1e-52   Solanum tuberosum [potatoes]
ref|XP_006297395.1|  hypothetical protein CARUB_v10013420mg             189   1e-52   Capsella rubella
gb|ACN26310.1|  unknown                                                 187   2e-52   Zea mays [maize]
gb|ACG35144.1|  proton myo-inositol cotransporter                       188   2e-52   Zea mays [maize]
ref|NP_001132062.1|  proton myo-inositol cotransporter                  188   2e-52   Zea mays [maize]
gb|AAG43998.1|AF215837_1  mannitol transporter                          187   5e-52   Apium graveolens Dulce Group [celery]
ref|XP_006856084.1|  hypothetical protein AMTR_s00059p00122840          186   8e-52   Amborella trichopoda
ref|XP_004148314.1|  PREDICTED: polyol transporter 5-like               186   9e-52   
ref|XP_007156029.1|  hypothetical protein PHAVU_003G252500g             186   1e-51   Phaseolus vulgaris [French bean]
dbj|BAK00091.1|  predicted protein                                      186   1e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008447047.1|  PREDICTED: polyol transporter 5-like               186   1e-51   Cucumis melo [Oriental melon]
ref|XP_006349565.1|  PREDICTED: polyol transporter 5-like               186   2e-51   Solanum tuberosum [potatoes]
gb|KGN44327.1|  hypothetical protein Csa_7G253820                       186   2e-51   Cucumis sativus [cucumbers]
gb|KHN41995.1|  Putative polyol transporter 3                           184   2e-51   Glycine soja [wild soybean]
ref|XP_004509296.1|  PREDICTED: probable polyol transporter 3-like      185   2e-51   Cicer arietinum [garbanzo]
ref|XP_010254894.1|  PREDICTED: polyol transporter 5-like               184   4e-51   Nelumbo nucifera [Indian lotus]
ref|XP_006590681.1|  PREDICTED: probable polyol transporter 3-like      184   4e-51   Glycine max [soybeans]
gb|ABX71752.1|  mannitol transporter                                    185   4e-51   Apium graveolens
ref|XP_010527594.1|  PREDICTED: polyol transporter 5-like isoform X4    184   5e-51   Tarenaya hassleriana [spider flower]
ref|XP_004958138.1|  PREDICTED: polyol transporter 5-like               184   5e-51   Setaria italica
ref|XP_010527591.1|  PREDICTED: polyol transporter 5-like isoform X1    184   6e-51   Tarenaya hassleriana [spider flower]
gb|AAN07021.1|  putative mannitol transporter                           183   6e-51   Phelipanche ramosa
ref|XP_010527593.1|  PREDICTED: polyol transporter 5-like isoform X3    184   6e-51   Tarenaya hassleriana [spider flower]
gb|KHN44499.1|  Putative polyol transporter 3                           182   7e-51   Glycine soja [wild soybean]
ref|XP_010527592.1|  PREDICTED: polyol transporter 5-like isoform X2    184   1e-50   Tarenaya hassleriana [spider flower]
ref|XP_003548895.1|  PREDICTED: probable polyol transporter 3-like      182   2e-50   Glycine max [soybeans]
ref|XP_010095276.1|  putative polyol transporter 6                      182   2e-50   Morus notabilis
gb|KHN00554.1|  Putative polyol transporter 3                           182   2e-50   Glycine soja [wild soybean]
ref|XP_008465477.1|  PREDICTED: polyol transporter 5-like               182   3e-50   Cucumis melo [Oriental melon]
gb|EMS66679.1|  Putative polyol transporter 2                           181   3e-50   Triticum urartu
ref|XP_007131748.1|  hypothetical protein PHAVU_011G038700g             182   3e-50   Phaseolus vulgaris [French bean]
ref|NP_001147446.1|  sorbitol transporter                               182   3e-50   Zea mays [maize]
ref|XP_006649564.1|  PREDICTED: polyol transporter 5-like               182   3e-50   Oryza brachyantha
ref|XP_007046983.1|  Major facilitator superfamily protein              181   5e-50   
ref|XP_009371568.1|  PREDICTED: probable polyol transporter 6           181   5e-50   Pyrus x bretschneideri [bai li]
ref|XP_003540961.2|  PREDICTED: polyol transporter 5-like               182   5e-50   Glycine max [soybeans]
emb|CDY70259.1|  BnaCnng67460D                                          175   6e-50   Brassica napus [oilseed rape]
emb|CDP10064.1|  unnamed protein product                                172   8e-50   Coffea canephora [robusta coffee]
ref|XP_008338123.1|  PREDICTED: probable polyol transporter 6           181   8e-50   
ref|XP_009109331.1|  PREDICTED: probable polyol transporter 6           181   9e-50   Brassica rapa
gb|EMT00465.1|  Putative polyol transporter 1                           181   9e-50   
emb|CDY24775.1|  BnaA08g15350D                                          181   1e-49   Brassica napus [oilseed rape]
emb|CDX75588.1|  BnaA01g01140D                                          180   1e-49   
emb|CDY35469.1|  BnaC03g61910D                                          180   2e-49   Brassica napus [oilseed rape]
gb|ACN35873.1|  unknown                                                 178   2e-49   Zea mays [maize]
ref|XP_009142783.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    180   2e-49   Brassica rapa
gb|KHN25431.1|  Polyol transporter 5                                    180   2e-49   Glycine soja [wild soybean]
ref|XP_004985338.1|  PREDICTED: polyol transporter 5-like isoform X2    179   2e-49   
ref|XP_004985337.1|  PREDICTED: polyol transporter 5-like isoform X1    180   2e-49   Setaria italica
ref|XP_002440825.1|  hypothetical protein SORBIDRAFT_09g007450          180   3e-49   Sorghum bicolor [broomcorn]
ref|XP_010028575.1|  PREDICTED: polyol transporter 5-like               180   3e-49   Eucalyptus grandis [rose gum]
emb|CAD58709.1|  polyol transporter                                     171   3e-49   Plantago major [cart-track plant]
ref|XP_008241649.1|  PREDICTED: probable polyol transporter 6           179   3e-49   Prunus mume [ume]
ref|XP_006856085.1|  hypothetical protein AMTR_s00059p00123280          179   3e-49   
ref|XP_010442448.1|  PREDICTED: putative polyol transporter 2           179   4e-49   Camelina sativa [gold-of-pleasure]
emb|CDY67098.1|  BnaCnng53530D                                          178   4e-49   Brassica napus [oilseed rape]
ref|XP_006411974.1|  hypothetical protein EUTSA_v10024974mg             179   5e-49   Eutrema salsugineum [saltwater cress]
emb|CDY72601.1|  BnaAnng41630D                                          176   9e-49   Brassica napus [oilseed rape]
ref|XP_006285274.1|  hypothetical protein CARUB_v10006648mg             177   1e-48   Capsella rubella
ref|XP_009138439.1|  PREDICTED: probable polyol transporter 6           178   1e-48   Brassica rapa
ref|XP_002884156.1|  predicted protein                                  178   1e-48   Arabidopsis lyrata subsp. lyrata
gb|AFK38433.1|  unknown                                                 169   2e-48   Lotus japonicus
ref|XP_010497333.1|  PREDICTED: putative polyol transporter 1           173   2e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010446763.1|  PREDICTED: probable polyol transporter 6           177   2e-48   
ref|NP_001182999.1|  uncharacterized protein LOC100501319               175   2e-48   Zea mays [maize]
gb|KGN56185.1|  hypothetical protein Csa_3G095020                       176   2e-48   Cucumis sativus [cucumbers]
ref|XP_010432153.1|  PREDICTED: probable polyol transporter 6           176   3e-48   Camelina sativa [gold-of-pleasure]
gb|KFK41272.1|  hypothetical protein AALP_AA2G108500                    175   3e-48   Arabis alpina [alpine rockcress]
gb|KGN44326.1|  Mannitol transporter                                    177   4e-48   Cucumis sativus [cucumbers]
emb|CDX72594.1|  BnaC07g46160D                                          178   4e-48   
ref|XP_002886203.1|  hypothetical protein ARALYDRAFT_343514             176   4e-48   Arabidopsis lyrata subsp. lyrata
ref|XP_008452333.1|  PREDICTED: polyol transporter 5-like isoform X2    176   4e-48   Cucumis melo [Oriental melon]
ref|XP_004149937.1|  PREDICTED: polyol transporter 5-like               176   5e-48   
dbj|BAC83311.1|  putative sorbitol transporter                          176   5e-48   
emb|CDY46218.1|  BnaA07g03520D                                          176   5e-48   
ref|NP_001060109.2|  Os07g0582500                                       176   5e-48   
ref|XP_009121227.1|  PREDICTED: putative polyol transporter 1           176   6e-48   
ref|XP_010445995.1|  PREDICTED: putative polyol transporter 2           176   8e-48   
ref|XP_008452332.1|  PREDICTED: putative polyol transporter 2 iso...    176   9e-48   
tpg|DAA63328.1|  TPA: hypothetical protein ZEAMMB73_585953              175   9e-48   
dbj|BAJ86116.1|  predicted protein                                      175   1e-47   
ref|XP_008651795.1|  PREDICTED: uncharacterized protein LOC100501...    175   1e-47   
ref|XP_010468639.1|  PREDICTED: putative polyol transporter 2           175   2e-47   
gb|EAZ04481.1|  hypothetical protein OsI_26630                          174   2e-47   
ref|XP_009121388.1|  PREDICTED: LOW QUALITY PROTEIN: putative pol...    175   2e-47   
ref|XP_010444944.1|  PREDICTED: probable polyol transporter 6           176   2e-47   
ref|XP_007156923.1|  hypothetical protein PHAVU_002G028600g             174   2e-47   
ref|XP_010435020.1|  PREDICTED: putative polyol transporter 2           174   3e-47   
ref|XP_006299557.1|  hypothetical protein CARUB_v10015731mg             174   3e-47   
ref|XP_010495901.1|  PREDICTED: putative polyol transporter 1           174   3e-47   
ref|XP_006409469.1|  hypothetical protein EUTSA_v10023129mg             174   3e-47   
emb|CDY46217.1|  BnaA07g03530D                                          174   4e-47   
gb|EEC66802.1|  hypothetical protein OsI_33208                          173   4e-47   
ref|NP_179209.1|  polyol/monosaccharide transporter 1                   174   4e-47   
ref|XP_003562818.1|  PREDICTED: polyol transporter 5-like               174   5e-47   
gb|EAZ15802.1|  hypothetical protein OsJ_31220                          173   7e-47   
dbj|BAJ93158.1|  predicted protein                                      173   7e-47   
ref|XP_004958139.1|  PREDICTED: putative polyol transporter 1-like      173   7e-47   
ref|XP_010516958.1|  PREDICTED: putative polyol transporter 2           173   7e-47   
ref|NP_001064429.1|  Os10g0360100                                       173   7e-47   
ref|XP_010472942.1|  PREDICTED: putative polyol transporter 2           173   7e-47   
ref|XP_009356716.1|  PREDICTED: probable polyol transporter 6           173   8e-47   
ref|XP_010472919.1|  PREDICTED: putative polyol transporter 2           173   8e-47   
gb|AAK13147.1|AC083945_22  Putative sugar transporter                   174   1e-46   
ref|XP_010531022.1|  PREDICTED: probable polyol transporter 6           172   1e-46   
ref|XP_002866999.1|  hypothetical protein ARALYDRAFT_490969             172   1e-46   
dbj|BAJ98962.1|  predicted protein                                      167   1e-46   
ref|XP_008447044.1|  PREDICTED: polyol transporter 5-like               172   2e-46   
ref|NP_179210.1|  polyol/monosaccharide transporter 2                   172   2e-46   
ref|XP_010530516.1|  PREDICTED: putative polyol transporter 1           169   2e-46   
ref|NP_195385.1|  putative polyol transporter 6                         172   2e-46   
ref|XP_003558586.1|  PREDICTED: polyol transporter 5-like               172   2e-46   
ref|XP_003629474.1|  hypothetical protein MTR_8g077890                  171   2e-46   
gb|ACJ85829.1|  unknown                                                 171   2e-46   
ref|XP_004148303.1|  PREDICTED: polyol transporter 5-like               172   2e-46   
gb|AFK37582.1|  unknown                                                 171   3e-46   
ref|XP_007203922.1|  hypothetical protein PRUPE_ppa017052mg             171   3e-46   
ref|XP_008447048.1|  PREDICTED: LOW QUALITY PROTEIN: putative pol...    171   4e-46   
ref|XP_008338588.1|  PREDICTED: probable polyol transporter 6           171   4e-46   
gb|KJB40206.1|  hypothetical protein B456_007G051000                    171   4e-46   
ref|XP_004163631.1|  PREDICTED: polyol transporter 5-like               171   4e-46   
ref|XP_003616024.1|  hypothetical protein MTR_5g075300                  171   4e-46   
gb|EMS61414.1|  Polyol transporter 5                                    168   5e-46   
ref|XP_004148313.1|  PREDICTED: polyol transporter 5-like               171   6e-46   
ref|XP_010548339.1|  PREDICTED: probable polyol transporter 6           170   6e-46   
ref|XP_004166834.1|  PREDICTED: polyol transporter 5-like               171   6e-46   
ref|XP_010442571.1|  PREDICTED: putative polyol transporter 2           171   7e-46   
emb|CAD58710.1|  polyol transporter                                     162   7e-46   
emb|CAR82417.1|  polyol transporter                                     162   1e-45   
emb|CAJ29288.1|  putative polyol transporter 1                          169   2e-45   
gb|KFK30287.1|  hypothetical protein AALP_AA7G242000                    168   5e-45   
ref|XP_010484928.1|  PREDICTED: putative polyol transporter 1           168   5e-45   
dbj|BAK07233.1|  predicted protein                                      168   6e-45   
ref|XP_004983249.1|  PREDICTED: probable polyol transporter 3-like      168   7e-45   
ref|XP_006425707.1|  hypothetical protein CICLE_v10027247mg             167   1e-44   
dbj|BAJ93015.1|  predicted protein                                      167   1e-44   
ref|XP_008440694.1|  PREDICTED: probable polyol transporter 6           166   2e-44   
ref|XP_006827104.1|  hypothetical protein AMTR_s00010p00243760          167   2e-44   
gb|KDP27565.1|  hypothetical protein JCGZ_20028                         166   2e-44   
ref|XP_006409145.1|  hypothetical protein EUTSA_v10022657mg             166   2e-44   
ref|XP_011025750.1|  PREDICTED: probable polyol transporter 3           166   3e-44   
ref|XP_004301902.2|  PREDICTED: probable polyol transporter 6           166   3e-44   
ref|XP_007156922.1|  hypothetical protein PHAVU_002G028500g             165   4e-44   
ref|XP_010530847.1|  PREDICTED: putative polyol transporter 1           166   4e-44   
ref|XP_010229631.1|  PREDICTED: putative polyol transporter 1           165   6e-44   
emb|CDP18000.1|  unnamed protein product                                162   7e-44   
ref|XP_002439891.1|  hypothetical protein SORBIDRAFT_09g022100          165   7e-44   
ref|XP_010414363.1|  PREDICTED: probable polyol transporter 3           164   9e-44   
ref|XP_004983248.1|  PREDICTED: probable polyol transporter 3-like      164   1e-43   
gb|KFK40217.1|  hypothetical protein AALP_AA3G345800                    164   1e-43   
ref|XP_009411236.1|  PREDICTED: probable polyol transporter 6           164   1e-43   
emb|CBI17542.3|  unnamed protein product                                163   1e-43   
emb|CDP17999.1|  unnamed protein product                                164   2e-43   
ref|XP_010489553.1|  PREDICTED: probable polyol transporter 3           164   2e-43   
ref|XP_002310213.2|  mannitol transporter family protein                164   2e-43   
gb|ACF83985.1|  unknown                                                 162   3e-43   
ref|NP_179438.1|  putative polyol transporter 3                         163   4e-43   
ref|XP_010467666.1|  PREDICTED: probable polyol transporter 3           163   4e-43   
ref|XP_002267872.1|  PREDICTED: probable polyol transporter 6 iso...    162   4e-43   
ref|XP_002886176.1|  predicted protein                                  162   4e-43   
ref|NP_001151390.1|  carbohydrate transporter/ sugar porter             162   5e-43   
ref|XP_008679503.1|  PREDICTED: carbohydrate transporter/ sugar p...    162   5e-43   
ref|XP_006297471.1|  hypothetical protein CARUB_v10013492mg             162   7e-43   
ref|XP_006827103.1|  hypothetical protein AMTR_s00010p00243630          161   8e-43   
emb|CDP02097.1|  unnamed protein product                                160   1e-42   
ref|XP_007201628.1|  hypothetical protein PRUPE_ppa021469mg             161   1e-42   
gb|EMS52712.1|  Putative polyol transporter 2                           161   2e-42   
ref|XP_009112494.1|  PREDICTED: probable polyol transporter 3           160   2e-42   
ref|XP_002531429.1|  sugar transporter, putative                        160   3e-42   
ref|XP_003561393.1|  PREDICTED: probable polyol transporter 6           160   3e-42   
ref|XP_010548048.1|  PREDICTED: putative polyol transporter 1           160   3e-42   
emb|CDY66868.1|  BnaUnng01720D                                          160   4e-42   
gb|KGN48817.1|  hypothetical protein Csa_6G502060                       159   1e-41   
ref|XP_011088761.1|  PREDICTED: putative polyol transporter 1           143   2e-41   
emb|CDP17996.1|  unnamed protein product                                158   2e-41   
ref|XP_008447302.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...    158   3e-41   
ref|XP_008447045.1|  PREDICTED: polyol transporter 5-like               157   4e-41   
gb|KCW58602.1|  hypothetical protein EUGRSUZ_H01261                     156   5e-41   
ref|XP_010070046.1|  PREDICTED: probable polyol transporter 6           156   8e-41   
emb|CDP02044.1|  unnamed protein product                                156   1e-40   
gb|EAY77363.1|  hypothetical protein OsI_05348                          155   2e-40   
gb|AEI98623.1|  hypothetical protein 111O18.10                          155   2e-40   
ref|XP_004159155.1|  PREDICTED: polyol transporter 5-like               154   3e-40   
ref|XP_004148302.1|  PREDICTED: polyol transporter 5-like               154   6e-40   
ref|XP_009627595.1|  PREDICTED: probable polyol transporter 6           154   6e-40   
ref|XP_010527602.1|  PREDICTED: polyol transporter 5-like               145   1e-39   
ref|XP_007046981.1|  Polyol/monosaccharide transporter 5-like pro...    152   1e-39   
ref|XP_009799010.1|  PREDICTED: probable polyol transporter 6           153   1e-39   
ref|XP_002514303.1|  sugar transporter, putative                        153   2e-39   
ref|XP_007013176.1|  Polyol/monosaccharide transporter 5 isoform 3      151   2e-39   
ref|XP_008447046.1|  PREDICTED: polyol transporter 5-like               152   2e-39   
gb|KDP33672.1|  hypothetical protein JCGZ_07243                         152   2e-39   
ref|XP_004512978.1|  PREDICTED: polyol transporter 5-like               152   3e-39   
ref|XP_006833286.1|  hypothetical protein AMTR_s00109p00027810          152   3e-39   
gb|KCW58603.1|  hypothetical protein EUGRSUZ_H01262                     151   5e-39   
ref|XP_004980363.1|  PREDICTED: polyol transporter 5-like               151   5e-39   
ref|XP_011078372.1|  PREDICTED: polyol transporter 5-like               151   6e-39   
gb|ACF85526.1|  unknown                                                 143   6e-39   
ref|XP_010244297.1|  PREDICTED: putative polyol transporter 1           151   8e-39   
ref|XP_010026167.1|  PREDICTED: probable polyol transporter 6           151   8e-39   
ref|XP_007013174.1|  Polyol/monosaccharide transporter 5 isoform 1      151   9e-39   
gb|ACL53204.1|  unknown                                                 150   1e-38   
ref|XP_010531021.1|  PREDICTED: probable polyol transporter 3           150   1e-38   
ref|XP_011100123.1|  PREDICTED: uncharacterized protein LOC105178355    154   1e-38   
ref|NP_001049269.1|  Os03g0197100                                       150   1e-38   
gb|KHN41999.1|  Putative polyol transporter 6                           150   1e-38   
ref|XP_009371465.1|  PREDICTED: polyol transporter 5-like               150   1e-38   
ref|XP_006475613.1|  PREDICTED: polyol transporter 5-like               150   2e-38   
ref|XP_006451144.1|  hypothetical protein CICLE_v10007938mg             150   2e-38   
gb|KDO50887.1|  hypothetical protein CISIN_1g009185mg                   150   2e-38   
ref|XP_007203309.1|  hypothetical protein PRUPE_ppa025908mg             150   2e-38   
ref|XP_010680814.1|  PREDICTED: probable polyol transporter 3           150   2e-38   
ref|XP_009396729.1|  PREDICTED: probable polyol transporter 6           149   2e-38   
ref|NP_001150711.1|  LOC100284344                                       150   2e-38   
ref|XP_003538845.1|  PREDICTED: probable polyol transporter 3-like      150   2e-38   
ref|XP_008386449.1|  PREDICTED: polyol transporter 5-like               149   3e-38   
ref|XP_011458741.1|  PREDICTED: polyol transporter 5-like               149   3e-38   
ref|XP_002308474.2|  hypothetical protein POPTR_0006s16130g             149   3e-38   
ref|XP_010049436.1|  PREDICTED: polyol transporter 5-like               148   4e-38   
dbj|BAJ86526.1|  predicted protein                                      149   4e-38   
ref|XP_010067985.1|  PREDICTED: polyol transporter 5-like               141   5e-38   
gb|EYU23018.1|  hypothetical protein MIMGU_mgv1a005494mg                149   5e-38   
gb|KHN41996.1|  Putative polyol transporter 6                           148   5e-38   
ref|XP_009374073.1|  PREDICTED: probable polyol transporter 6           148   7e-38   
gb|KCW81997.1|  hypothetical protein EUGRSUZ_C03362                     148   7e-38   
ref|XP_003538847.1|  PREDICTED: probable polyol transporter 3-like      148   7e-38   
ref|XP_010530848.1|  PREDICTED: LOW QUALITY PROTEIN: putative pol...    148   8e-38   
ref|XP_010688202.1|  PREDICTED: polyol transporter 5-like               148   9e-38   
ref|XP_004985339.1|  PREDICTED: polyol transporter 5-like               148   1e-37   
tpg|DAA43975.1|  TPA: polyol transporter protein 4                      148   1e-37   
ref|XP_003620669.1|  Myo-inositol transporter                           148   1e-37   
ref|NP_001142160.1|  hypothetical protein                               148   1e-37   
gb|ACG47895.1|  polyol transporter protein 4                            148   1e-37   
ref|XP_006649563.1|  PREDICTED: polyol transporter 5-like               148   1e-37   
ref|XP_008668471.1|  PREDICTED: hypothetical protein isoform X1         148   1e-37   
gb|EYU40145.1|  hypothetical protein MIMGU_mgv1a004984mg                147   2e-37   
ref|XP_006363185.1|  PREDICTED: probable polyol transporter 6-like      146   3e-37   
ref|XP_007203539.1|  hypothetical protein PRUPE_ppa1027213mg            147   4e-37   
ref|XP_006658740.1|  PREDICTED: polyol transporter 5-like               146   4e-37   
ref|XP_007013178.1|  Polyol/monosaccharide transporter 5 isoform 2      144   4e-37   
ref|XP_002468337.1|  hypothetical protein SORBIDRAFT_01g044010          146   5e-37   
gb|KDP33673.1|  hypothetical protein JCGZ_07244                         146   5e-37   
ref|XP_008242649.1|  PREDICTED: probable polyol transporter 6           146   5e-37   
ref|XP_002514302.1|  sugar transporter, putative                        146   6e-37   
ref|XP_010317207.1|  PREDICTED: probable polyol transporter 6 iso...    145   6e-37   
ref|XP_002280978.1|  PREDICTED: polyol transporter 5                    145   6e-37   
ref|XP_006346943.1|  PREDICTED: probable polyol transporter 6-like      145   7e-37   
ref|XP_010317209.1|  PREDICTED: probable polyol transporter 6 iso...    145   7e-37   
ref|XP_003558585.1|  PREDICTED: putative polyol transporter 1           145   7e-37   
ref|NP_001289849.1|  probable polyol transporter 6                      145   7e-37   
ref|XP_004233513.1|  PREDICTED: probable polyol transporter 6 iso...    145   7e-37   
ref|XP_010049692.1|  PREDICTED: polyol transporter 5-like               145   1e-36   
dbj|BAO96231.1|  polyol/monosaccharide Transporter 8                    145   1e-36   
gb|EPS67834.1|  hypothetical protein M569_06938                         145   1e-36   
ref|XP_007160334.1|  hypothetical protein PHAVU_002G312900g             145   1e-36   
ref|XP_007013177.1|  Polyol/monosaccharide transporter 5 isoform 1      144   1e-36   
ref|XP_003618299.1|  Mannitol transporter                               144   2e-36   
ref|XP_011458734.1|  PREDICTED: probable polyol transporter 6           144   2e-36   
ref|XP_006451145.1|  hypothetical protein CICLE_v10008031mg             144   3e-36   
ref|XP_006475614.1|  PREDICTED: polyol transporter 5-like isoform X1    144   4e-36   
gb|EMT15229.1|  Putative polyol transporter 1                           140   6e-36   
ref|XP_009774532.1|  PREDICTED: polyol transporter 5-like               143   6e-36   
ref|XP_010051593.1|  PREDICTED: polyol transporter 5-like               142   7e-36   
ref|XP_009607069.1|  PREDICTED: polyol transporter 5-like               142   1e-35   
gb|KJB64901.1|  hypothetical protein B456_010G071400                    142   1e-35   
ref|XP_010099586.1|  Polyol transporter 5                               142   2e-35   
gb|KHG11695.1|  Polyol transporter 5 -like protein                      142   2e-35   
ref|XP_009398416.1|  PREDICTED: probable polyol transporter 4           142   2e-35   
gb|KHN41997.1|  Putative polyol transporter 6                           141   2e-35   
ref|XP_008463391.1|  PREDICTED: probable polyol transporter 6           141   2e-35   
gb|KHN41998.1|  Putative polyol transporter 6                           141   2e-35   
ref|XP_004148315.1|  PREDICTED: polyol transporter 5-like               140   3e-35   
ref|XP_003533389.1|  PREDICTED: polyol transporter 5-like               141   3e-35   
ref|XP_004170584.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    140   4e-35   
gb|KGN44328.1|  hypothetical protein Csa_7G257320                       140   4e-35   
ref|XP_007216663.1|  hypothetical protein PRUPE_ppb017057mg             137   7e-35   
emb|CDP03333.1|  unnamed protein product                                140   8e-35   
dbj|BAJ92224.1|  predicted protein                                      139   9e-35   
ref|XP_004976318.1|  PREDICTED: probable polyol transporter 4-lik...    139   1e-34   
ref|NP_001068332.1|  Os11g0637200                                       139   1e-34   
ref|XP_004150056.1|  PREDICTED: probable polyol transporter 6-like      139   1e-34   
ref|XP_004976317.1|  PREDICTED: probable polyol transporter 4-lik...    139   1e-34   
ref|XP_004979805.1|  PREDICTED: polyol transporter 5-like               139   1e-34   
ref|XP_004514460.1|  PREDICTED: probable polyol transporter 4-like      139   2e-34   
ref|XP_004979794.1|  PREDICTED: polyol transporter 5-like               139   2e-34   
ref|XP_006360474.1|  PREDICTED: polyol transporter 5-like               139   2e-34   
ref|XP_010536004.1|  PREDICTED: polyol transporter 5-like               138   2e-34   
gb|ACJ85869.1|  unknown                                                 138   2e-34   
gb|EMT28181.1|  Putative polyol transporter 4                           138   3e-34   
gb|EMS52332.1|  putative polyol transporter 4                           138   3e-34   
ref|XP_004979804.1|  PREDICTED: polyol transporter 5-like               138   3e-34   
ref|NP_001149076.1|  arabinose-proton symporter                         138   4e-34   
gb|KHN36113.1|  Putative polyol transporter 6                           132   4e-34   
ref|XP_008667987.1|  PREDICTED: arabinose-proton symporter isofor...    138   4e-34   



>ref|XP_009596634.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=526

 Score =   219 bits (558),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT+F+LVATF LD+ GRRPLLLTSVGGMV +L  L + LTVIDHS   V WA+
Sbjct  330  TVAVGIIKTIFVLVATFLLDRVGRRPLLLTSVGGMVMSLIFLSIGLTVIDHSDGTVFWAI  389

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ I M LAYVA FSIGAGPITWVYSSEIFPL+LRATGCSL   +NRVTSGVVSMTF+SL
Sbjct  390  ALCITMVLAYVALFSIGAGPITWVYSSEIFPLRLRATGCSLAVALNRVTSGVVSMTFLSL  449

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KAI+IGG+FF YA +A + WVFFFTLMP
Sbjct  450  EKAITIGGAFFFYAGLAGLAWVFFFTLMP  478


 Score = 67.4 bits (163),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  265  QTQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGTLQAAN  125
            +TQGKTLEETE LFGTFF+WR   RE+ AK+ NNN+Q+QM T+ A  
Sbjct  479  ETQGKTLEETEELFGTFFKWRLTLRELKAKEKNNNAQIQMATVPAVG  525



>ref|XP_002313809.1| putative sorbitol transporter family protein [Populus trichocarpa]
 gb|EEE87764.1| putative sorbitol transporter family protein [Populus trichocarpa]
Length=533

 Score =   230 bits (586),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GFTKTVFILVATF LD+ GRRPLLL+SVGGMV +LA LG  LT+IDHS EK+PWAV
Sbjct  336  TVAVGFTKTVFILVATFLLDRIGRRPLLLSSVGGMVLSLATLGFGLTMIDHSDEKLPWAV  395

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A++IAM LAYV+ FSIG GPITWVYSSEIFPLKLRA G S+G  +NRVTSGV+S TFI L
Sbjct  396  ALSIAMVLAYVSFFSIGMGPITWVYSSEIFPLKLRAQGTSMGVAVNRVTSGVISTTFILL  455

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGGSFFL+A +AAVGW+FF+  +P
Sbjct  456  YKAITIGGSFFLFAGVAAVGWLFFYACLP  484



>ref|XP_009766648.1| PREDICTED: polyol transporter 5-like [Nicotiana sylvestris]
Length=526

 Score =   218 bits (555),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT+FILVATF LD+ GRRPLLLTSVGGMV +L  L + LTVIDHS   V WA+
Sbjct  330  TVAVGIIKTIFILVATFLLDRVGRRPLLLTSVGGMVMSLIFLSIGLTVIDHSDGTVFWAI  389

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ I M L YVA FSIGAGPITWVYSSEIFPL+LRATGC L   +NRVTSGVVSMTF+SL
Sbjct  390  ALCITMVLVYVALFSIGAGPITWVYSSEIFPLRLRATGCGLAVALNRVTSGVVSMTFLSL  449

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KAI+IGG+FFLYA +A + WVFFFTLMP
Sbjct  450  EKAITIGGAFFLYAGLAGLAWVFFFTLMP  478


 Score = 67.4 bits (163),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  265  QTQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGTLQAANK  122
            +TQGKTLEETE LFG FF+WRS  RE+ AK+ NNN+Q+QM T+ A   
Sbjct  479  ETQGKTLEETEELFGNFFKWRSTLRELQAKEENNNAQIQMATVPAVGS  526



>ref|XP_011048787.1| PREDICTED: polyol transporter 5-like [Populus euphratica]
Length=532

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GFTKTVFILVATF LD+ GRRPLLL+SVGGMV +L+ LG  LT+IDHS EK+PWAV
Sbjct  336  TVAVGFTKTVFILVATFFLDRIGRRPLLLSSVGGMVLSLSTLGFGLTMIDHSDEKLPWAV  395

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A++IAM LAYV+ FSIG GPITWVYSSEIFPLKLRA G S+G  +NRVTSGV+S TFI L
Sbjct  396  ALSIAMVLAYVSFFSIGMGPITWVYSSEIFPLKLRAQGTSMGVAVNRVTSGVISTTFILL  455

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGGSFFL+A +AAVGW+FF+  +P
Sbjct  456  YKAITIGGSFFLFAGVAAVGWLFFYACLP  484



>ref|XP_002519083.1| sugar transporter, putative [Ricinus communis]
 gb|EEF43294.1| sugar transporter, putative [Ricinus communis]
Length=539

 Score =   228 bits (580),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+FILVATF LD+ GRRPLLL+SV GM+ +LA LG SLTVIDHSHEK+ WAV
Sbjct  334  TVAVGFVKTIFILVATFLLDRIGRRPLLLSSVAGMIFSLATLGFSLTVIDHSHEKLTWAV  393

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ IAM LAYVA FSIG GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+S TFISL
Sbjct  394  ALCIAMILAYVAFFSIGMGPITWVYSSEIFPLRLRAQGASMGVAVNRVTSGVISTTFISL  453

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YK I+IGG+FFL+AAIA+V W FFFT +P
Sbjct  454  YKGITIGGAFFLFAAIASVAWTFFFTCLP  482



>ref|XP_008368693.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=353

 Score =   222 bits (565),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+ ILVATF +D+FGRR LLL+SVGGMV +  LLG+ LTV+D SH KVPWAV
Sbjct  159  TVAVGFVKTIAILVATFQVDRFGRRILLLSSVGGMVVSFTLLGVGLTVVDQSHSKVPWAV  218

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + IAM L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR TSGV+SMTFISL
Sbjct  219  GLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRXTSGVISMTFISL  278

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA IAA+ WVFF+TL P
Sbjct  279  YKAITIGGAFFLYAGIAALSWVFFYTLYP  307



>ref|XP_011037561.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037562.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037564.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037565.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037566.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037567.1| PREDICTED: polyol transporter 5 [Populus euphratica]
Length=531

 Score =   227 bits (578),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GFTKTVFILVATF LD+ GRRPLLL+SVGGM+ +LA LG  LT+IDHSHEK+PWAV
Sbjct  336  TVAVGFTKTVFILVATFLLDRIGRRPLLLSSVGGMILSLATLGFGLTIIDHSHEKLPWAV  395

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A++IAM LA+VA FSIG GPI WVYSSEIFPL+LRA G  +G  +NRVTSGV+S TFI L
Sbjct  396  ALSIAMVLAFVAFFSIGMGPIAWVYSSEIFPLRLRAQGTGMGVAVNRVTSGVISTTFIML  455

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAISIGGSFFL+A IA V WVFFF   P
Sbjct  456  YKAISIGGSFFLFAGIATVAWVFFFACFP  484



>ref|XP_009611551.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=539

 Score =   225 bits (574),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+FILVATF LDK GRRPLLLTSV GMV +L LL   LT+ID S +KV WA+
Sbjct  335  TVAVGFVKTIFILVATFMLDKSGRRPLLLTSVAGMVLSLMLLATGLTIIDQSEQKVVWAI  394

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A++I M LAYVA FSIG GPITWVYSSEIFPL+LRATGCS+G  +NRVTSGVVSMTF+SL
Sbjct  395  ALSITMVLAYVALFSIGMGPITWVYSSEIFPLRLRATGCSIGVAVNRVTSGVVSMTFLSL  454

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KAI+IGG+FFLYA +AAV +VFFFTLMP
Sbjct  455  EKAITIGGAFFLYAGLAAVAFVFFFTLMP  483


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 8/56 (14%)
 Frame = -2

Query  265  QTQGKTLEETEALFGTFFRWRSRQREVDAKK--------ANNNSQLQMGTLQAANK  122
            +TQGKTLEE EALFGTF+ WR   RE+   K        +N+N Q+QMG   A + 
Sbjct  484  ETQGKTLEEMEALFGTFWNWRKTARELKEAKITEKTEKNSNDNGQIQMGIAPAISS  539



>ref|XP_009378956.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=530

 Score =   224 bits (571),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+ ILVATF +D+FGRR LLL+SVGGMV +  LLG+ LTVID SH KVPWAV
Sbjct  336  TVAVGFVKTIAILVATFQVDRFGRRILLLSSVGGMVISFILLGVGLTVIDQSHNKVPWAV  395

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + IAM L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTFISL
Sbjct  396  GLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVISMTFISL  455

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA IAA+ WVFF+TL P
Sbjct  456  YKAITIGGAFFLYAGIAALSWVFFYTLYP  484



>ref|XP_008345143.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=527

 Score =   224 bits (571),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+ ILVATF +D+FGRR LLL+SVGGMV +  LLG+ LTVID SH KVPWAV
Sbjct  333  TVAVGFVKTIAILVATFQVDRFGRRILLLSSVGGMVVSFTLLGVGLTVIDQSHSKVPWAV  392

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + IAM L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTFISL
Sbjct  393  GLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVISMTFISL  452

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA IAA+ WVFF+TL P
Sbjct  453  YKAITIGGAFFLYAGIAALSWVFFYTLYP  481



>ref|XP_003631630.1| PREDICTED: polyol transporter 5 [Vitis vinifera]
 gb|ADP37154.1| putative polyol/monosaccharide transporter [Vitis vinifera]
Length=528

 Score =   224 bits (570),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT FILVATF LD+ GRRPLLLTSV GM+ +LA LGM LTVIDHS  K+ WAV
Sbjct  333  TVAVGFVKTCFILVATFLLDRVGRRPLLLTSVAGMIFSLAALGMGLTVIDHSDTKLIWAV  392

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+++   L+YVA FSIG GPITWVYSSEIFPL+LRA GCS+G G+NRVTSGV+SMTFISL
Sbjct  393  ALSLCTVLSYVAFFSIGMGPITWVYSSEIFPLRLRAQGCSIGVGVNRVTSGVLSMTFISL  452

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLY+ +A VGW+FF+T +P
Sbjct  453  YKAITIGGAFFLYSGVALVGWIFFYTWLP  481



>gb|AGY96955.1| polyol transporter 1 [Vitis vinifera]
Length=528

 Score =   224 bits (570),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT FILVATF LD+ GRRPLLLTSV GM+ +LA LGM LTVIDHS  K+ WAV
Sbjct  333  TVAVGFVKTCFILVATFLLDRVGRRPLLLTSVAGMIFSLAALGMGLTVIDHSDTKLIWAV  392

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+++   L+YVA FSIG GPITWVYSSEIFPL+LRA GCS+G G+NRVTSGV+SMTFISL
Sbjct  393  ALSLCTVLSYVAFFSIGMGPITWVYSSEIFPLRLRAQGCSIGVGVNRVTSGVLSMTFISL  452

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLY+ +A VGW+FF+T +P
Sbjct  453  YKAITIGGAFFLYSGVALVGWIFFYTWLP  481



>ref|XP_008387375.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=520

 Score =   223 bits (569),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+ ILVATF +D+FGRR LLL+SVGGMV +  LLG  LTV+D SH KVPWAV
Sbjct  326  TVAVGFVKTIAILVATFQVDRFGRRILLLSSVGGMVVSFTLLGXGLTVVDQSHSKVPWAV  385

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + IAM L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTFISL
Sbjct  386  GLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVISMTFISL  445

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA IAA+ WVFF+TL P
Sbjct  446  YKAITIGGAFFLYAGIAALSWVFFYTLYP  474



>ref|XP_008368694.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=485

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+ ILVATF +D+FGRR LLL+SVGGMV +  LLG+ LTV+D SH KVPWAV
Sbjct  291  TVAVGFVKTIAILVATFQVDRFGRRILLLSSVGGMVVSFTLLGVGLTVVDQSHSKVPWAV  350

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + IAM L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR+TSGV+SMTFISL
Sbjct  351  GLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRLTSGVISMTFISL  410

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA IAA+ WVFF+TL P
Sbjct  411  YKAITIGGAFFLYAGIAALSWVFFYTLYP  439



>ref|XP_011092774.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=519

 Score =   221 bits (563),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GFTKT+FILVATF LDK GRRPLLL+SV GM+ +L  LG+ LT+I+H+ +K+ WAV
Sbjct  323  TMAVGFTKTLFILVATFLLDKIGRRPLLLSSVAGMILSLVGLGIGLTIIEHADQKLIWAV  382

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ IA  L+YVA FSIG GPITWVYSSEIFPL+LRA GCS+G   NRVTSG++SMTFISL
Sbjct  383  ALCIATVLSYVAFFSIGMGPITWVYSSEIFPLRLRAQGCSMGVAANRVTSGMISMTFISL  442

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAISIGG+FFLYA IAA+ WVFF+TL P
Sbjct  443  YKAISIGGAFFLYAGIAAIAWVFFYTLYP  471


 Score = 56.6 bits (135),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -2

Query  265  QTQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  140
            +TQGKTLEE E  FGTFF+WRS  R ++ KK  +N QLQ+ T
Sbjct  472  ETQGKTLEEMETFFGTFFKWRSTMRALEEKKGESNGQLQLTT  513



>ref|XP_007042744.1| Polyol/monosaccharide transporter 5 [Theobroma cacao]
 gb|EOX98575.1| Polyol/monosaccharide transporter 5 [Theobroma cacao]
Length=538

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+FILVATF LD+ GRRPLLL+SVGGMV +LA LG+SLT+IDHS EK+ WA+
Sbjct  336  TVAVGFVKTIFILVATFFLDRIGRRPLLLSSVGGMVASLATLGLSLTIIDHSDEKLMWAI  395

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ I M LAYVA FSIG GPITWVYSSEIFPL+LRA G S+G   NRVTSGV+SM+FISL
Sbjct  396  ALCITMVLAYVAFFSIGMGPITWVYSSEIFPLRLRAQGASMGVAANRVTSGVISMSFISL  455

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAISIGG+FFL+A +A V W FF+T +P
Sbjct  456  YKAISIGGAFFLFAGVATVAWFFFYTCLP  484



>ref|XP_009350912.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   222 bits (566),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+ ILVATF +D+FGRR LLL+SVGGMV +  LLG+ LTV+D SH KVPWAV
Sbjct  333  TVAVGFVKTIAILVATFQVDRFGRRVLLLSSVGGMVVSFTLLGVGLTVVDQSHSKVPWAV  392

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + IAM L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR+TSGV+SMTFISL
Sbjct  393  GLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRLTSGVISMTFISL  452

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKA++IGG+FFLYA IAA+ WVFF+TL P
Sbjct  453  YKAVTIGGAFFLYAGIAALSWVFFYTLYP  481



>gb|KDP46229.1| hypothetical protein JCGZ_10069 [Jatropha curcas]
Length=514

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+FILVATF LD+ GRRPLLL SV GM+ +LA LG SLT+IDHSH+K+ WA+
Sbjct  311  TVAVGFVKTMFILVATFFLDRIGRRPLLLASVAGMIFSLATLGFSLTIIDHSHDKLTWAI  370

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + I M LAYVA FSIG GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+SMTFISL
Sbjct  371  VLCITMVLAYVAFFSIGMGPITWVYSSEIFPLRLRAQGASMGVAVNRVTSGVISMTFISL  430

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YK I+IGG+FFL+AAIA V W FFFT +P
Sbjct  431  YKGITIGGAFFLFAAIATVAWTFFFTCLP  459



>ref|XP_010096202.1| Polyol transporter 5 [Morus notabilis]
 gb|EXB63597.1| Polyol transporter 5 [Morus notabilis]
Length=541

 Score =   222 bits (565),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+FILVATF LD+ GRRPLLL+SVGGM+ +LA LG++LTVIDHS EK+ WA+
Sbjct  333  TMAVGFVKTLFILVATFLLDRIGRRPLLLSSVGGMIFSLASLGIALTVIDHSSEKLMWAI  392

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + IAM LAYVA FSIG GPITWVYSSEIFPLKLRA G S+   +NRVTSGV+SM+FISL
Sbjct  393  VLCIAMVLAYVAFFSIGLGPITWVYSSEIFPLKLRAQGASMAVAVNRVTSGVISMSFISL  452

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YK I+IGG+FFL+AA+A V WVFF+TL+P
Sbjct  453  YKGITIGGAFFLFAALAVVAWVFFYTLLP  481



>ref|XP_009342010.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+ ILVATF +D+FGRR LLL+SVGGM  +  LLG+ LTV+D SH KVPWAV
Sbjct  335  TVAVGFVKTIAILVATFQVDRFGRRVLLLSSVGGMAVSFTLLGVGLTVVDQSHSKVPWAV  394

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + IAM L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR+TSGV+SMTFISL
Sbjct  395  GLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRLTSGVISMTFISL  454

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKA++IGG+FFLYA IAA+ WVFF+TL P
Sbjct  455  YKAVTIGGAFFLYAGIAALSWVFFYTLYP  483



>ref|XP_009342008.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+ ILVATF +D+FGRR LLL+SVGGM  +  LLG+ LTV+D SH KVPWAV
Sbjct  333  TVAVGFVKTIAILVATFQVDRFGRRVLLLSSVGGMAVSFTLLGVGLTVVDQSHSKVPWAV  392

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + IAM L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR+TSGV+SMTFISL
Sbjct  393  GLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRLTSGVISMTFISL  452

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKA++IGG+FFLYA IAA+ WVFF+TL P
Sbjct  453  YKAVTIGGAFFLYAGIAALSWVFFYTLYP  481



>ref|XP_008359575.1| PREDICTED: LOW QUALITY PROTEIN: polyol transporter 5-like [Malus 
domestica]
Length=527

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+ ILVATF +D+FGRR LLL+SVGGMV +  LLG+ LTV+D SH KVPWAV
Sbjct  333  TVAVGFVKTIAILVATFQVDRFGRRILLLSSVGGMVVSFTLLGVGLTVVDQSHSKVPWAV  392

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + IAM L  VA FSIG GPITWVYSSEIF L+LRA GCS+G  +NR+TSGV+SMTFISL
Sbjct  393  GLCIAMVLFIVAFFSIGLGPITWVYSSEIFSLQLRAQGCSMGEAVNRMTSGVISMTFISL  452

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA IAA+ WVFF+TL P
Sbjct  453  YKAITIGGAFFLYAGIAALSWVFFYTLYP  481



>ref|XP_011088358.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=532

 Score =   219 bits (559),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GFTKTVFILVATF LDK GRRPLLL+SVGGMV +L  LG+ LT++++S  K+ WA+
Sbjct  331  TMAVGFTKTVFILVATFLLDKIGRRPLLLSSVGGMVASLVGLGLGLTIVENSDHKMVWAI  390

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ I+  L++VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTFISL
Sbjct  391  ALCISTVLSFVAFFSIGMGPITWVYSSEIFPLRLRAQGCSMGVAMNRVTSGVISMTFISL  450

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            Y AISIGG FFLYA IAAV WVFF+T +P
Sbjct  451  YNAISIGGVFFLYAGIAAVAWVFFYTFLP  479


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -2

Query  265  QTQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQM  146
            +TQGKTLEE E LFGTF++WRS  R ++ KK   + Q+QM
Sbjct  480  ETQGKTLEEMETLFGTFYKWRSTLRALNEKKREGDRQVQM  519



>ref|XP_002305419.2| hypothetical protein POPTR_0004s15960g [Populus trichocarpa]
 gb|EEE85930.2| hypothetical protein POPTR_0004s15960g [Populus trichocarpa]
Length=531

 Score =   219 bits (558),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GFTKTVFILVATF LD+ GRRPLLL+SVGGMV +LA LG  LT+IDHS EK+PWAV
Sbjct  336  TVAVGFTKTVFILVATFLLDRIGRRPLLLSSVGGMVLSLATLGFGLTIIDHSPEKLPWAV  395

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A++IAM LA+VA FSIG GPI WVYSSEIFPL+LRA G  +G  +NRVTSGV+S TFI L
Sbjct  396  ALSIAMVLAFVAFFSIGMGPIPWVYSSEIFPLRLRAQGTGMGVAMNRVTSGVISTTFIML  455

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAISIGG+FFL+A  A V WVFFF   P
Sbjct  456  YKAISIGGAFFLFAGFATVAWVFFFACFP  484



>gb|KEH30427.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=333

 Score =   214 bits (544),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TIA+GF KT+FILVATF LD++GRRPLLLTSVGGMV +L  L +SLT+IDHS+ K+ WA+
Sbjct  140  TIAVGFVKTLFILVATFMLDRYGRRPLLLTSVGGMVVSLLTLAVSLTIIDHSNTKLNWAI  199

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++IA  L+YVA FSIGAGPITWVYSSEIFPL+LRA G + G  +NRVTSGV+SMTF+SL
Sbjct  200  GLSIATVLSYVATFSIGAGPITWVYSSEIFPLRLRAQGAACGVVVNRVTSGVISMTFLSL  259

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             K I+IGG+FFL+  IA +GW+FF+ ++P
Sbjct  260  SKGITIGGAFFLFGGIATIGWIFFYIMLP  288



>ref|XP_004507415.1| PREDICTED: polyol transporter 5-like [Cicer arietinum]
Length=526

 Score =   219 bits (557),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TIA+GF KT+FILVATF LD+ GRRPLLLTSVGGMV +L  L +SLT+IDHS  K+ WAV
Sbjct  329  TIAVGFVKTIFILVATFMLDRVGRRPLLLTSVGGMVLSLLTLAVSLTIIDHSETKLMWAV  388

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++IA  L+YVA FSIGAGPITWVYSSEIFPL+LRA G ++G  +NRVTSGV+SMTF+SL
Sbjct  389  GLSIATVLSYVATFSIGAGPITWVYSSEIFPLRLRAQGAAMGVVVNRVTSGVISMTFLSL  448

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KAI+IGG+FFL+ AIAA GWVFF+T++P
Sbjct  449  SKAITIGGAFFLFGAIAAAGWVFFYTMLP  477



>ref|NP_001280902.1| putative polyol transporter 1 [Malus domestica]
 dbj|BAD42343.1| sorbitol transporter [Malus domestica]
Length=526

 Score =   219 bits (557),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GFTKTVFILVATF LDKFGRRPLLLTSVGGMV +L  LG+ LT++DH    VPWA+
Sbjct  334  TVAVGFTKTVFILVATFFLDKFGRRPLLLTSVGGMVFSLMFLGVGLTIVDHHKGSVPWAI  393

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + +AM    VA FSIG GPITWVYSSEIFPLKLRA G S+G   NRVTSGVVSMTFISL
Sbjct  394  GLCMAMVYFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSIGVACNRVTSGVVSMTFISL  453

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA I+A  W+FF+T++P
Sbjct  454  YKAITIGGAFFLYAGISAAAWIFFYTMLP  482



>ref|XP_008387377.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=520

 Score =   218 bits (556),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT+FILVATF LDKFGRRPLLLTSVGGM+ +L LLG+ LTV+DHSH KV WAV
Sbjct  333  TVAVGVVKTIFILVATFMLDKFGRRPLLLTSVGGMIFSLTLLGVGLTVVDHSHGKVQWAV  392

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ IAM +  VA FSIG GP+TWVYSSEI+PL+LRA GC++G  +NRV SGV+SMTFISL
Sbjct  393  ALCIAMVMFNVAFFSIGLGPVTWVYSSEIYPLQLRAQGCAMGVAMNRVMSGVISMTFISL  452

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA  +++ ++FF+T++P
Sbjct  453  YKAITIGGAFFLYAGTSSIAFIFFYTMLP  481



>ref|XP_008387376.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=520

 Score =   218 bits (556),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT+FILVATF LDKFGRRPLLLTSVGGM+ +L LLG+ LTV+DHSH KV WAV
Sbjct  333  TVAVGVVKTIFILVATFMLDKFGRRPLLLTSVGGMIFSLTLLGVGLTVVDHSHGKVQWAV  392

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ IAM +  VA FSIG GP+TWVYSSEI+PL+LRA GC++G  +NRV SGV+SMTFISL
Sbjct  393  ALCIAMVMFNVAFFSIGLGPVTWVYSSEIYPLQLRAQGCAMGVAMNRVMSGVISMTFISL  452

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA  +++ ++FF+T++P
Sbjct  453  YKAITIGGAFFLYAGTSSIAFIFFYTMLP  481



>ref|XP_006384498.1| hypothetical protein POPTR_0004s15900g [Populus trichocarpa]
 gb|ERP62295.1| hypothetical protein POPTR_0004s15900g [Populus trichocarpa]
Length=503

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GFTKT+FILVATF LD+ GRRPLLL+SVGGMV +LA LG  LT+IDHSHEK+PWAV
Sbjct  336  TVAVGFTKTLFILVATFFLDRIGRRPLLLSSVGGMVLSLATLGFGLTIIDHSHEKLPWAV  395

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A++IAM LA+VA FSIG GPI  VYSSEIFPL+LRA G  +G  +NRVTSGV++ TFI L
Sbjct  396  ALSIAMVLAFVAFFSIGMGPIAGVYSSEIFPLRLRAQGIGMGVAVNRVTSGVITTTFIML  455

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAISIGG+FFL+A IA V WVFFF   P
Sbjct  456  YKAISIGGAFFLFAGIATVAWVFFFACYP  484



>ref|XP_009375838.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=528

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT  ILVATF +D+FGRR LLL+SVGGMV +  LLG+ LTV+D S  KVPWA+
Sbjct  334  TVAVGFVKTTAILVATFQVDRFGRRILLLSSVGGMVVSFTLLGVGLTVVDQSPSKVPWAI  393

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + IAM L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTFISL
Sbjct  394  GLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVISMTFISL  453

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA IAA+ WVFF+TL P
Sbjct  454  YKAITIGGAFFLYAGIAALSWVFFYTLYP  482



>ref|XP_010909852.1| PREDICTED: putative polyol transporter 1 [Elaeis guineensis]
Length=520

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 127/149 (85%), Gaps = 1/149 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SHEKVPWA  534
            T+A+GFTKT+FILVATF LD+ GRRPLLL+S GGM+ +LA LG  LTVIDH  H ++PWA
Sbjct  334  TVAVGFTKTLFILVATFMLDRVGRRPLLLSSTGGMIVSLASLGFGLTVIDHHPHGQLPWA  393

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            + ++IA  LAYVA FSIG GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV++MTFIS
Sbjct  394  IGLSIASILAYVAFFSIGLGPITWVYSSEIFPLRLRAQGASVGVVVNRVTSGVITMTFIS  453

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLM  267
            LYKAI+IGGSFFLYA +AAV WVFFFT +
Sbjct  454  LYKAITIGGSFFLYAGVAAVAWVFFFTYL  482



>ref|XP_008236797.1| PREDICTED: putative polyol transporter 2 [Prunus mume]
Length=531

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TIA+G  KT+FILVATF +D+ GRRPLLL S+GGMV +L  LG SLTVID SH  VPWA+
Sbjct  337  TIAVGVVKTLFILVATFLIDRIGRRPLLLISMGGMVFSLGFLGASLTVIDQSHGTVPWAI  396

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + I M L  VA FSIG GP+TWVY+SEIFPLKLRA GCSLG  INRVTSG++SMTFISL
Sbjct  397  GLCITMVLFNVAFFSIGLGPVTWVYTSEIFPLKLRAQGCSLGVAINRVTSGIISMTFISL  456

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA +  VGW+FF+T++P
Sbjct  457  YKAITIGGAFFLYAGVGVVGWIFFYTMLP  485



>ref|XP_008387373.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=526

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GFTKTVFILVATF LDKFGRRPLLLTSVGGMV +L  LG+ LT++DH    VPWAV
Sbjct  334  TVAVGFTKTVFILVATFFLDKFGRRPLLLTSVGGMVFSLMFLGVGLTIVDHHKGSVPWAV  393

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + +AM    VA FSIG GPITWVYSSEIFPLKLRA G S+G   NRVTSG+VSMTFISL
Sbjct  394  GLCMAMIYFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSIGVACNRVTSGIVSMTFISL  453

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA I+A  W+FF+T++P
Sbjct  454  YKAITIGGAFFLYAGISAAAWMFFYTMLP  482



>ref|XP_009800568.1| PREDICTED: polyol transporter 5-like [Nicotiana sylvestris]
Length=534

 Score =   215 bits (548),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+FILVATF LDK GRRPLLLTSV GMV +L LL   LT+ID S +KV WA+
Sbjct  333  TVAVGFVKTIFILVATFMLDKSGRRPLLLTSVAGMVLSLLLLATGLTIIDQSEQKVVWAI  392

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A++I M LAYVA FSIG GPITWVYSSEIFPL+LRATGCS+G  +NRVTSGVVSMTF+SL
Sbjct  393  ALSITMVLAYVALFSIGMGPITWVYSSEIFPLRLRATGCSIGVAVNRVTSGVVSMTFLSL  452

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             K+I+IGG+FFLY  +AAV +VFFFTLMP
Sbjct  453  VKSITIGGAFFLYFGLAAVAFVFFFTLMP  481


 Score = 55.1 bits (131),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 35/53 (66%), Gaps = 5/53 (9%)
 Frame = -2

Query  265  QTQGKTLEETEALFGTFFRWRSRQRE-----VDAKKANNNSQLQMGTLQAANK  122
            +TQGKTLEE EALFG+F+ WR   RE     +  K +N+N Q+QMGT  A + 
Sbjct  482  ETQGKTLEEMEALFGSFWDWRKTARELKEAKITEKNSNDNGQIQMGTAPAISS  534



>ref|XP_006487182.1| PREDICTED: polyol transporter 5-like [Citrus sinensis]
Length=535

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+FILVATF LDK GRRPLLL+SV GM+ +LA L +SLTVID SH+K+ WA+
Sbjct  335  TVAVGFVKTIFILVATFLLDKIGRRPLLLSSVAGMIASLATLAISLTVIDQSHKKMIWAI  394

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             +AI+  L+YVA FSIG GPITWVYSSEI PLKLRA G S+G  +NRVTSGVVSMTF+SL
Sbjct  395  GLAISTVLSYVAFFSIGMGPITWVYSSEILPLKLRAQGASIGVMVNRVTSGVVSMTFLSL  454

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KAI+IGGSFFLYA+IA+V WVFF+T +P
Sbjct  455  SKAITIGGSFFLYASIASVAWVFFYTCLP  483



>ref|XP_008236860.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
Length=525

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+ ILVATF LD+FGRRPLLL+SV GM+ +L  LG+ LT+ID  H+ VPWA+
Sbjct  334  TVAVGFVKTIAILVATFFLDRFGRRPLLLSSVAGMIFSLVCLGVGLTIIDQHHDTVPWAI  393

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ I M L  VA FSIG GPITWVYSSEIFPLKLRA G S+G  +NR+TSGV+SMTF+SL
Sbjct  394  ALCITMVLLNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSMGVAVNRITSGVISMTFLSL  453

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGGSFFLYA IAAV WVFF+ L+P
Sbjct  454  YKAITIGGSFFLYAGIAAVSWVFFYMLLP  482



>ref|XP_006423215.1| hypothetical protein CICLE_v10028170mg [Citrus clementina]
 gb|ESR36455.1| hypothetical protein CICLE_v10028170mg [Citrus clementina]
Length=535

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+FILVATF LDK GRRPLLL+SV GM+ +LA L +SLTVID SH+K+ WA+
Sbjct  335  TVAVGFVKTIFILVATFLLDKIGRRPLLLSSVAGMIASLATLAISLTVIDQSHKKMIWAI  394

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             +AI+  L+YVA FSIG GPITWVYSSEI PLKLRA G S+G  +NRVTSGVVSMTF+SL
Sbjct  395  GLAISTVLSYVAFFSIGMGPITWVYSSEILPLKLRAQGASIGVMVNRVTSGVVSMTFLSL  454

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KAI+IGGSFFLYA+IA+V WVFF+T +P
Sbjct  455  SKAITIGGSFFLYASIASVAWVFFYTCLP  483



>ref|XP_009344435.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=526

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GFTKTVFILVATF LDKFGRRPLLLTSVGGM+ +L  LG+ LT++DH    VPWAV
Sbjct  334  TVAVGFTKTVFILVATFFLDKFGRRPLLLTSVGGMIFSLMFLGVGLTIVDHHKGSVPWAV  393

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + +AM    VA FSIG GPITWVYSSEIFPLKLRA G S+G   NRVTSG+VSMTFISL
Sbjct  394  GLCMAMVYFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSIGVACNRVTSGIVSMTFISL  453

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA I+A  W+FF+T++P
Sbjct  454  YKAITIGGAFFLYAGISAAAWMFFYTMLP  482



>ref|XP_009375822.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=520

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT+FILVATF LDKFGRRPLLLTSVGGM+ +L LLG+ LTV++HSH KV WA+
Sbjct  333  TVAVGVVKTLFILVATFMLDKFGRRPLLLTSVGGMIFSLMLLGVGLTVVEHSHSKVQWAI  392

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ IAM L+ VA FSIG GPITWVYSSEI+PL+LRA GC++G  +NR+ SGV+SMTFISL
Sbjct  393  ALCIAMVLSNVAFFSIGLGPITWVYSSEIYPLQLRAQGCAMGVAMNRLMSGVISMTFISL  452

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA  +++ ++FF+T++P
Sbjct  453  YKAITIGGAFFLYAGTSSIAFMFFYTMLP  481



>ref|XP_009342009.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+ ILVATF +D+FGRR LLL+SVGGMV +  LLG+ LTV+D SH KV WAV
Sbjct  335  TVAVGFVKTIAILVATFQVDRFGRRVLLLSSVGGMVVSFTLLGVGLTVVDQSHSKVSWAV  394

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + IAM L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR TSGV+SMTFISL
Sbjct  395  GLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRFTSGVISMTFISL  454

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YK I+IGG+FFLYA IAA+ WVFF+TL P
Sbjct  455  YKTITIGGAFFLYAGIAALSWVFFYTLYP  483



>ref|XP_004299107.1| PREDICTED: polyol transporter 5-like [Fragaria vesca subsp. vesca]
Length=535

 Score =   217 bits (552),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TIA+G  KT+FILVATF LD+ GRRPLLL+S+ GM+ +LA LG  LT++ HS EKV WAV
Sbjct  334  TIAVGSVKTIFILVATFLLDRIGRRPLLLSSMAGMIASLACLGFGLTIVVHSDEKVMWAV  393

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++I M L YVA FSIG GPITWVYSSEIFPLKLRA GCS+G  +NRV SG +SMTFISL
Sbjct  394  VLSITMVLVYVAFFSIGMGPITWVYSSEIFPLKLRAQGCSIGVAVNRVVSGTLSMTFISL  453

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            Y+AI+IGG+FFL+A IAAVGWVFF+T++P
Sbjct  454  YEAITIGGAFFLFAGIAAVGWVFFYTMLP  482



>ref|XP_009350914.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   216 bits (551),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+ ILVATF +D+FGRR LLL+SVGGMV +  LLG+ LTV+D SH KV WAV
Sbjct  335  TVAVGFVKTIAILVATFQVDRFGRRVLLLSSVGGMVVSFTLLGVGLTVVDQSHSKVSWAV  394

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + IAM L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR TSGV+SMTFISL
Sbjct  395  GLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRFTSGVISMTFISL  454

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YK I+IGG+FFLYA IAA+ WVFF+TL P
Sbjct  455  YKTITIGGAFFLYAGIAALSWVFFYTLYP  483



>ref|NP_001281038.1| polyol transporter 5-like [Malus domestica]
 gb|AAO88965.1| sorbitol transporter [Malus domestica]
Length=481

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT+ ILVAT  LDKFGRRPLLLTSV GMV +L+ LG SLT++D  H K+ WA+
Sbjct  291  TVAVGVVKTICILVATVFLDKFGRRPLLLTSVAGMVFSLSCLGASLTIVDQQHGKIMWAI  350

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + I M L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTFISL
Sbjct  351  VLCITMVLLNVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVISMTFISL  410

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA IAAVGWVFF+ L P
Sbjct  411  YKAITIGGAFFLYAGIAAVGWVFFYMLYP  439



>ref|XP_008246181.1| PREDICTED: polyol transporter 5-like, partial [Prunus mume]
Length=359

 Score =   212 bits (539),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+FI +ATF LD+ GRRPLLLTS+GGM+ +LA LG +LT++DH    +PWAV
Sbjct  166  TVAVGFIKTIFIFIATFLLDRVGRRPLLLTSMGGMILSLACLGAALTIVDHHDSTIPWAV  225

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ I M L  VA FSIG GPITWVYSSEIFPLKLRA G SLG  +NRV SG++SMTF+SL
Sbjct  226  ALCITMVLFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSLGVAVNRVISGIISMTFLSL  285

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA I  + WVFF+T++P
Sbjct  286  YKAITIGGAFFLYAGIGVLAWVFFYTMLP  314



>gb|KHG20989.1| Polyol transporter 5 -like protein [Gossypium arboreum]
Length=539

 Score =   216 bits (550),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+ IL+ATF LD+ GRRPLLL+S+ GMV +L  LG SLT+IDHSHEK+PWA+
Sbjct  338  TVAVGFVKTITILIATFLLDRIGRRPLLLSSIIGMVASLTTLGFSLTIIDHSHEKIPWAI  397

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + I M LAYVA FSIG GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+SMTFISL
Sbjct  398  GLCITMVLAYVALFSIGMGPITWVYSSEIFPLRLRAQGASMGVAVNRVTSGVISMTFISL  457

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAISIGG+FFL+A IA V  +FF+   P
Sbjct  458  YKAISIGGAFFLFAGIATVATLFFYMFYP  486



>ref|XP_003541068.1| PREDICTED: polyol transporter 5-like [Glycine max]
Length=523

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KTVFIL ATFTLD+ GRRPLLL+SVGGMV +L  L +SLT+I HS  K+ WAV
Sbjct  330  TVAVGFVKTVFILAATFTLDRVGRRPLLLSSVGGMVLSLLTLAISLTIIGHSERKLMWAV  389

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A++IAM LAYVA FSIGAGPITWVYSSEIFPL+LRA G + G  +NR TSGVVSMTF+SL
Sbjct  390  ALSIAMVLAYVATFSIGAGPITWVYSSEIFPLRLRAQGAAAGVVVNRTTSGVVSMTFLSL  449

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             +AI+IGG+FFLY  IA +GW+FF+TL+P
Sbjct  450  SEAITIGGAFFLYCGIATLGWIFFYTLLP  478



>gb|KHN25361.1| Polyol transporter 5 [Glycine soja]
Length=521

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KTVFIL ATFTLD+ GRRPLLL+SVGGMV +L  L +SLT+I HS  K+ WAV
Sbjct  328  TVAVGFVKTVFILAATFTLDRVGRRPLLLSSVGGMVLSLLTLAISLTIIGHSERKLMWAV  387

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A++IAM LAYVA FSIGAGPITWVYSSEIFPL+LRA G + G  +NR TSGVVSMTF+SL
Sbjct  388  ALSIAMVLAYVATFSIGAGPITWVYSSEIFPLRLRAQGAAAGVVVNRTTSGVVSMTFLSL  447

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             +AI+IGG+FFLY  IA +GW+FF+TL+P
Sbjct  448  SEAITIGGAFFLYCGIATLGWIFFYTLLP  476



>ref|XP_009336961.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=526

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TIA+GFTKTVFILVATF LDKFGRRPLLLTSV GMV +L  LG+ LT++DH    VPWA+
Sbjct  334  TIAVGFTKTVFILVATFFLDKFGRRPLLLTSVAGMVFSLTFLGVGLTIVDHHKGSVPWAI  393

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + +AM    VA FSIG GPITWVYSSEIFPLKLRA G S+G   NRVTSGVVS TFISL
Sbjct  394  GLCLAMVYFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSIGVACNRVTSGVVSTTFISL  453

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA I+A  W+FF+TL+P
Sbjct  454  YKAITIGGAFFLYAGISAAAWIFFYTLLP  482



>ref|XP_009345071.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT+ ILVAT  LDKFGRRPLLLTSV GMV +L  LG  LT++D  H K+ WA+
Sbjct  336  TVAVGVVKTICILVATVFLDKFGRRPLLLTSVAGMVFSLTCLGAGLTIVDQHHGKITWAI  395

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + I M L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTFISL
Sbjct  396  VLCITMVLLNVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVISMTFISL  455

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA IAAVGWVFF+TL P
Sbjct  456  YKAITIGGAFFLYAGIAAVGWVFFYTLYP  484



>ref|XP_006361759.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=475

 Score =   202 bits (513),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KTVFILVATF LD+ GRRPLLLTS GGM  +L LL + L VID S+ +V WAV
Sbjct  279  TVAMGCVKTVFILVATFLLDRVGRRPLLLTSFGGMTISLILLSIGLAVIDRSNSQVTWAV  338

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ + M   YVA FSIGAGPI WVY SE+FPLKLRATG S+G  +NRVTSGV+SMTF+SL
Sbjct  339  ALCVMMVSVYVALFSIGAGPIAWVYGSEVFPLKLRATGFSVGVAVNRVTSGVISMTFLSL  398

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KAI+I G+FF YA IA + WVFFFTLMP
Sbjct  399  EKAITIQGAFFSYAGIAGMAWVFFFTLMP  427


 Score = 65.5 bits (158),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  265  QTQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  140
            +TQGKTLEET ALFGTFF WRS  RE+  KK NNN ++QM T
Sbjct  428  ETQGKTLEETVALFGTFFEWRSTARELKGKKMNNNDEIQMAT  469



>gb|AFI61955.1| polyol transporter [Camellia sinensis]
Length=532

 Score =   213 bits (541),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GFTKT+FILVATF LD+ GRRPLLL+SVGGM+ +LA L +SLT+IDHS +KV WAV
Sbjct  333  TVAVGFTKTIFILVATFLLDRVGRRPLLLSSVGGMILSLAGLAVSLTIIDHSEKKVAWAV  392

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+AI   L++V  FSIG GPI WVYSSEIFPL+LRA G S+GT +NR+ SG +SMTFISL
Sbjct  393  ALAITTVLSFVGTFSIGMGPIAWVYSSEIFPLRLRAQGTSIGTAMNRLISGTISMTFISL  452

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            Y AISIGG+FFL+  +A V WVFF+TL+P
Sbjct  453  YNAISIGGAFFLFMGVAIVSWVFFYTLLP  481


 Score = 53.9 bits (128),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 5/47 (11%)
 Frame = -2

Query  265  QTQGKTLEETEALFGTFFRWRSRQREVDAKKA-----NNNSQLQMGT  140
            +TQG+TLEE + LFGTFF+WRS  RE++  K      N+N Q+Q+GT
Sbjct  482  ETQGRTLEEMQVLFGTFFKWRSTLREMEKNKKIRDNDNSNGQIQLGT  528



>gb|ACD68477.1| plasma membrane mannitol transporter [Arachis hypogaea]
Length=434

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+FILVATF LD+ GRRPLLL+SVGGM+ ++  LG+SLT+I HS +K+ WAV
Sbjct  246  TVAVGFVKTLFILVATFMLDRVGRRPLLLSSVGGMILSVLTLGISLTIITHSDKKLMWAV  305

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++IA  L+YVA FSIGAGPITWVYSSEIFPL+LRA G ++G  +NRVTSGV+SMTF+SL
Sbjct  306  GLSIATVLSYVATFSIGAGPITWVYSSEIFPLRLRAQGAAMGVVVNRVTSGVISMTFLSL  365

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KAISIGG+FFL+  IA VGW+FF+T++P
Sbjct  366  SKAISIGGAFFLFGGIATVGWIFFYTMLP  394



>gb|EYU42629.1| hypothetical protein MIMGU_mgv1a0059092mg, partial [Erythranthe 
guttata]
Length=275

 Score =   207 bits (528),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GFTKT+FILVATF LDK GRRPLLL+SV GM+ +L  L + LTVI+H+  K+ WA+
Sbjct  80   TMAVGFTKTLFILVATFLLDKIGRRPLLLSSVAGMIVSLLGLAIGLTVIEHAEHKLIWAI  139

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ I  TL+YV+ FSIG GPITWVYSSEIFPL+LRA GC++G  +NRVTSGV+SMTF+SL
Sbjct  140  ALCIGSTLSYVSFFSIGMGPITWVYSSEIFPLRLRAQGCAMGVALNRVTSGVISMTFLSL  199

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             +AI+IGG+FFLYA +AA+  VFF+TL P
Sbjct  200  NRAITIGGAFFLYAGVAAIALVFFYTLYP  228


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -2

Query  265  QTQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQM  146
            +TQGKTLEE E+LFGTF +WRS  R ++ KK+  N Q+Q+
Sbjct  229  ETQGKTLEEMESLFGTFSKWRSTLRTLNEKKSEKNGQIQL  268



>gb|ACB56939.1| mannitol transporter [Artemisia annua]
Length=522

 Score =   214 bits (545),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TIA+GF KTVFILVATF LDK GRRPLLL+SV GM+ +L  LG+ LT+IDHS  K+ WA+
Sbjct  332  TIAVGFVKTVFILVATFFLDKVGRRPLLLSSVAGMILSLMGLGIGLTIIDHSDHKIEWAI  391

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ IA  L+YVA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR+ SGV+ MTFISL
Sbjct  392  ALCIATILSYVAFFSIGMGPITWVYSSEIFPLRLRAQGCSMGVAVNRIVSGVIGMTFISL  451

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFL+  +A VG+VFF+TL P
Sbjct  452  YKAITIGGAFFLFTGVAIVGFVFFYTLYP  480



>gb|KEH30425.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=472

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TIA+GF KT+FILVATF LD++GRRPLLLTSVGGMV +L  L +SLT+IDHS+ K+ WA+
Sbjct  279  TIAVGFVKTLFILVATFMLDRYGRRPLLLTSVGGMVVSLLTLAVSLTIIDHSNTKLNWAI  338

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++IA  L+YVA FSIGAGPITWVYSSEIFPL+LRA G + G  +NRVTSGV+SMTF+SL
Sbjct  339  GLSIATVLSYVATFSIGAGPITWVYSSEIFPLRLRAQGAACGVVVNRVTSGVISMTFLSL  398

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             K I+IGG+FFL+  IA +GW+FF+ ++P
Sbjct  399  SKGITIGGAFFLFGGIATIGWIFFYIMLP  427



>ref|NP_001289249.1| polyol transporter 5-like [Pyrus x bretschneideri]
 ref|XP_009375824.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
 gb|AFM91103.1| sorbitol transporter [Pyrus x bretschneideri]
Length=526

 Score =   214 bits (544),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT+ ILVAT  LDKFGRRPLLLTSV GMV +L+ LG  LT++D  H K+ WA+
Sbjct  336  TVAVGVVKTICILVATVFLDKFGRRPLLLTSVAGMVFSLSCLGAGLTIVDQQHGKIMWAI  395

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + I M L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTFISL
Sbjct  396  VLCITMVLLNVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVISMTFISL  455

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA IAAVGWVFF+ L P
Sbjct  456  YKAITIGGAFFLYAGIAAVGWVFFYMLYP  484



>gb|AAM44082.1| putative sorbitol transporter [Prunus cerasus]
Length=538

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KTVFILVATF LD+ GRRPLLLTSV GMV TLA LG+ LT+IDHS EK+ WA+
Sbjct  334  TVAVGFVKTVFILVATFMLDRIGRRPLLLTSVAGMVFTLACLGLGLTIIDHSGEKIMWAI  393

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+++ M LAYVA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRV SGV+SMTFISL
Sbjct  394  ALSLTMVLAYVAFFSIGMGPITWVYSSEIFPLQLRAQGCSIGVAVNRVVSGVLSMTFISL  453

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFL+AAIAAVGW FFFT++P
Sbjct  454  YKAITIGGAFFLFAAIAAVGWTFFFTMLP  482



>gb|ACB86853.1| mannitol transporter [Citrus sinensis]
Length=535

 Score =   214 bits (544),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT FILVATF LDK GRRPLLL+SV GM+ +LA L +SLTVID SH+KV WAV
Sbjct  335  TVAVGFVKTTFILVATFLLDKIGRRPLLLSSVAGMIASLATLAISLTVIDQSHKKVIWAV  394

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             +AI+  L+YVA FSIG GPIT VYSSEI PLKLRA G S+G  +NRVTSGVVSMTF+SL
Sbjct  395  GLAISTVLSYVAFFSIGMGPITLVYSSEILPLKLRAQGASIGIMVNRVTSGVVSMTFLSL  454

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KAI+IGGSFFLYA+IA+V WVFF+T +P
Sbjct  455  SKAITIGGSFFLYASIASVAWVFFYTCLP  483



>gb|KJB32189.1| hypothetical protein B456_005G228500 [Gossypium raimondii]
Length=539

 Score =   214 bits (544),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+ IL+ATF LD+ GRRPLLL+S+ GMV +L  LG SLT+IDHSHEK+PWA+
Sbjct  338  TVAVGFVKTITILIATFLLDRIGRRPLLLSSIIGMVASLTTLGFSLTIIDHSHEKIPWAI  397

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + I M LAYVA FSIG GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+SMTFISL
Sbjct  398  GLCITMVLAYVALFSIGMGPITWVYSSEIFPLRLRAQGASMGVAVNRVTSGVISMTFISL  457

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            Y+AISIGG+FFL+A +A V  +FF+   P
Sbjct  458  YEAISIGGAFFLFAGVAMVATLFFYMFYP  486



>ref|XP_006423216.1| hypothetical protein CICLE_v10028174mg [Citrus clementina]
 gb|ESR36456.1| hypothetical protein CICLE_v10028174mg [Citrus clementina]
Length=535

 Score =   213 bits (543),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT FILVATF LDK GRRPLLL+SV GM+ +LA L +SLTVID SH+KV WAV
Sbjct  335  TVAVGFVKTTFILVATFLLDKIGRRPLLLSSVAGMIASLATLAISLTVIDQSHKKVIWAV  394

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             +AI+  L+YVA FSIG GPIT VYSSEI PLKLRA G S+G  +NRVTSGVVSMTF+SL
Sbjct  395  GLAISTVLSYVAFFSIGMGPITLVYSSEILPLKLRAQGASIGIMVNRVTSGVVSMTFLSL  454

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KAI+IGGSFFLYA+IA+V WVFF+T +P
Sbjct  455  SKAITIGGSFFLYASIASVAWVFFYTCLP  483



>gb|KEH30426.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=522

 Score =   213 bits (542),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TIA+GF KT+FILVATF LD++GRRPLLLTSVGGMV +L  L +SLT+IDHS+ K+ WA+
Sbjct  329  TIAVGFVKTLFILVATFMLDRYGRRPLLLTSVGGMVVSLLTLAVSLTIIDHSNTKLNWAI  388

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++IA  L+YVA FSIGAGPITWVYSSEIFPL+LRA G + G  +NRVTSGV+SMTF+SL
Sbjct  389  GLSIATVLSYVATFSIGAGPITWVYSSEIFPLRLRAQGAACGVVVNRVTSGVISMTFLSL  448

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             K I+IGG+FFL+  IA +GW+FF+ ++P
Sbjct  449  SKGITIGGAFFLFGGIATIGWIFFYIMLP  477



>emb|CDO97075.1| unnamed protein product [Coffea canephora]
Length=529

 Score =   211 bits (537),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GFTKT+FILVATF LDK GRRPLLL+SV GM+ +LALLG+ LT++DHS  K+ WAV
Sbjct  334  TMAVGFTKTLFILVATFFLDKVGRRPLLLSSVAGMIGSLALLGVGLTIVDHSEHKMVWAV  393

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A  + M LAYV+ FSIG GPITWVYSSEIFPL+LRA GCS+G   NRVTSGV+SMTF+SL
Sbjct  394  AWCLIMVLAYVSFFSIGLGPITWVYSSEIFPLRLRAQGCSIGVAANRVTSGVISMTFLSL  453

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KAI+ GG+FFL+A IA+V + FF+TL+P
Sbjct  454  SKAITTGGAFFLFAGIASVAFAFFYTLLP  482


 Score = 53.5 bits (127),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 2/48 (4%)
 Frame = -2

Query  265  QTQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGTLQAANK  122
            +T+G+TLEE E LFGTFF+WR++ RE++ +K     QLQMGT   A K
Sbjct  483  ETRGRTLEEMEELFGTFFQWRTKMRELEKQK--TGQQLQMGTTATAAK  528



>ref|XP_009345072.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=523

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TIA+G TKTVFILVATF LDKFGRRPLLLTSV GMV +L  LG+ LT++DH    VPWAV
Sbjct  334  TIAVGGTKTVFILVATFFLDKFGRRPLLLTSVAGMVFSLLFLGVGLTIVDHHKGSVPWAV  393

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + +AM    VA FSIG GPITWVYSSEIFPLKLRA G S+G   NRVTSG+VSMTFISL
Sbjct  394  GLCMAMVYFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSIGVACNRVTSGIVSMTFISL  453

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLY+ I+A  WVFF+T++P
Sbjct  454  YKAITIGGAFFLYSGISAAAWVFFYTMLP  482



>ref|XP_008466959.1| PREDICTED: polyol transporter 5-like, partial [Cucumis melo]
Length=276

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+FILVATF LD+ GRRPLLLTSV GM+ +L  LG++LTVI+ + +K+ WAV
Sbjct  79   TVAVGFVKTIFILVATFLLDRIGRRPLLLTSVLGMIISLGTLGLALTVINQTDKKLMWAV  138

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + I+M L YVA+FSIG GPITWVYSSEIFPLKLRA G S+G  +NRVTSGV+SM+F+SL
Sbjct  139  VLCISMVLTYVASFSIGMGPITWVYSSEIFPLKLRAQGTSMGVAVNRVTSGVISMSFLSL  198

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KAI+ GG+FFL+AAIA V W FF+T +P
Sbjct  199  SKAITTGGAFFLFAAIAIVAWFFFYTALP  227



>ref|XP_008245258.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=511

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+ ILVATF LD+FGRRPLLL+SV GM+ +L  LG+ LT+IDH  + VPWA+
Sbjct  320  TVAVGFVKTIAILVATFFLDRFGRRPLLLSSVAGMIFSLVCLGVGLTIIDHHSDTVPWAI  379

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ I M L  VA FSIG GPITWVYSSEIFPLKLRA G S+G  +NR+TSGV+SMTF+SL
Sbjct  380  ALCITMVLLNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSMGVAVNRITSGVISMTFLSL  439

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA I A+ WVFF+ L+P
Sbjct  440  YKAITIGGAFFLYAGIGALSWVFFYMLLP  468



>gb|ABK29439.1| sugar transport protein [Coffea canephora]
Length=529

 Score =   211 bits (537),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GFTKT+FILVATF LDK GRRPLLL+SV GM+ +LALLG+ LT++DHS  K+ WAV
Sbjct  334  TMAVGFTKTLFILVATFFLDKVGRRPLLLSSVAGMIGSLALLGVGLTIVDHSEHKMVWAV  393

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A  + M LAYV+ FSIG GPITWVYSSEIFPL+LRA GCS+G   NRVTSGV+SMTF+SL
Sbjct  394  AWCLIMVLAYVSFFSIGLGPITWVYSSEIFPLRLRAQGCSIGVAANRVTSGVISMTFLSL  453

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KAI+ GG+FFL+A IA+V + FF+TL+P
Sbjct  454  SKAITTGGAFFLFAGIASVAFAFFYTLLP  482


 Score = 52.0 bits (123),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 2/42 (5%)
 Frame = -2

Query  265  QTQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMGT  140
            +T+G+TLEE E LFGTFF+WR++ RE++ +K     QLQMGT
Sbjct  483  ETRGRTLEEMEELFGTFFQWRTKMRELEKQK--TGQQLQMGT  522



>ref|XP_008361285.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=527

 Score =   212 bits (539),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 120/149 (81%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT+ ILVAT  LDKFGRRPLLLTSV GMV +L  LG  LT++D  H K+ WA+
Sbjct  336  TVAVGVVKTICILVATVFLDKFGRRPLLLTSVAGMVLSLTCLGAGLTIVDQHHGKITWAI  395

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + I M L  VA  SIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTFISL
Sbjct  396  VLCITMVLLNVAFXSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVISMTFISL  455

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA IAA+GWVFF+TL P
Sbjct  456  YKAITIGGAFFLYAGIAALGWVFFYTLYP  484



>ref|XP_008236773.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
 ref|XP_008236774.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
Length=528

 Score =   212 bits (539),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+FI +ATF LD+ GRRPLLLTS+GGM+ +LA LG +LT++DH    +PWAV
Sbjct  335  TVAVGFIKTIFIFIATFLLDRVGRRPLLLTSMGGMILSLACLGAALTIVDHHDSTIPWAV  394

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ I M L  VA FSIG GPITWVYSSEIFPLKLRA G SLG  +NRV SG++SMTF+SL
Sbjct  395  ALCITMVLFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSLGVAVNRVISGIISMTFLSL  454

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA I  + WVFF+T++P
Sbjct  455  YKAITIGGAFFLYAGIGVLAWVFFYTMLP  483



>gb|AAO39267.1|AF482011_1 sorbitol transporter [Prunus cerasus]
Length=509

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF+KT+F LVA   LD+ GRRPLLLTSV GM+ +L  LG SLT++DH  EK+ WA 
Sbjct  326  TVAVGFSKTIFTLVAIGFLDRVGRRPLLLTSVAGMIASLLCLGTSLTIVDHETEKMMWAS  385

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + + M LAYV  FSIG GPI WVYSSEIFPLKLRA GCS+GT +NR+ SGV+SM+FISL
Sbjct  386  VLCLTMVLAYVGFFSIGMGPIAWVYSSEIFPLKLRAQGCSMGTAVNRIMSGVLSMSFISL  445

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI++GG+FFLYA IA VGWVFF+T++P
Sbjct  446  YKAITMGGTFFLYAGIATVGWVFFYTMLP  474



>ref|XP_007199793.1| hypothetical protein PRUPE_ppa004456mg [Prunus persica]
 gb|EMJ00992.1| hypothetical protein PRUPE_ppa004456mg [Prunus persica]
Length=509

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF+KTVF L+A   LD+ GRRPLLLTSV GM+ +L  LG SLT++DH +EK+ WA 
Sbjct  326  TVAVGFSKTVFTLIAIGFLDRVGRRPLLLTSVAGMIASLLCLGTSLTIVDHENEKMMWAT  385

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + + M LAYV  FSIG GPI WVYSSEIFPLKLRA GCS+GT +NR+ SGV++MTFI+L
Sbjct  386  VVCLTMVLAYVGFFSIGMGPIAWVYSSEIFPLKLRAQGCSMGTAVNRIMSGVLTMTFITL  445

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI++GG+FFLY AIA VGWVFF+T++P
Sbjct  446  YKAITMGGTFFLYGAIATVGWVFFYTMLP  474



>ref|XP_007199207.1| hypothetical protein PRUPE_ppa021762mg [Prunus persica]
 gb|EMJ00406.1| hypothetical protein PRUPE_ppa021762mg [Prunus persica]
Length=528

 Score =   211 bits (536),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+ +GF KT+ ILVATF LD+FGRR LLL+SV GM+ +LA LG+ LT+ID+  E VPWA+
Sbjct  334  TVGVGFVKTIAILVATFFLDRFGRRKLLLSSVAGMIFSLACLGVGLTIIDNHKETVPWAI  393

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ I M L  VA FSIG GPITWVYSSEIFPLKLRA G S+G  +NR+TSGV+SMTF+SL
Sbjct  394  ALCITMVLLNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSMGVAVNRITSGVISMTFLSL  453

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGGSFFLYA IAA+ WVFF+ L+P
Sbjct  454  YKAITIGGSFFLYAGIAALSWVFFYMLLP  482



>ref|XP_008236796.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=509

 Score =   210 bits (535),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF+KT+F L+A   LD+ GRRPLLLTSV GM+ +L  LG SLT++DH +EK+ WA 
Sbjct  326  TVAVGFSKTIFTLIAIGFLDRVGRRPLLLTSVAGMIASLLCLGTSLTIVDHENEKMMWAS  385

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + + M LAYV  FSIG GPI WVYSSEIFPLKLRA GCS+GT +NR+ SGV++MTFI+L
Sbjct  386  VLCLTMVLAYVGFFSIGMGPIAWVYSSEIFPLKLRAQGCSMGTAVNRIMSGVLTMTFITL  445

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI++GG+FFLY AIA VGWVFF+T++P
Sbjct  446  YKAITMGGTFFLYGAIATVGWVFFYTMLP  474



>gb|AAY88181.2| mannitol transporter 1 [Olea europaea]
Length=480

 Score =   209 bits (533),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TIA+G +KT+FILVATF LD+ GRRPLLLTS+GGM+ +L LLG SL VI HS   V WAV
Sbjct  291  TIAVGISKTLFILVATFLLDRIGRRPLLLTSMGGMIISLTLLGTSLAVIGHSDHTVHWAV  350

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+AI   LAYV  FSIG GPI WVYSSE+FPL+LRA GCS+G  +NR TSG++SMTF+SL
Sbjct  351  ALAIFGVLAYVGTFSIGLGPIAWVYSSEVFPLRLRAQGCSIGVAVNRGTSGIISMTFLSL  410

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAISI G+F+L+AAIA V W+F FTL+P
Sbjct  411  YKAISIAGAFYLFAAIAGVAWIFIFTLLP  439



>ref|XP_007200254.1| hypothetical protein PRUPE_ppa015090mg [Prunus persica]
 ref|XP_007200263.1| hypothetical protein PRUPE_ppa014975mg [Prunus persica]
 gb|EMJ01453.1| hypothetical protein PRUPE_ppa015090mg [Prunus persica]
 gb|EMJ01462.1| hypothetical protein PRUPE_ppa014975mg [Prunus persica]
Length=527

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+FI +ATF LD+ GRRPLLLTS+GGM+ +L  LG +LT+ID+   K+PWAV
Sbjct  334  TVAVGFVKTIFIFIATFLLDRVGRRPLLLTSMGGMIFSLVCLGAALTIIDNHDSKIPWAV  393

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ I M L  VA FSIG GPITWVYSSEIFPLKLRA G SLG  +NRV SG+VSMTF+SL
Sbjct  394  ALCIIMVLFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSLGVAVNRVISGIVSMTFLSL  453

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA I  + WVFF+T++P
Sbjct  454  YKAITIGGAFFLYAGIGVLAWVFFYTMLP  482



>ref|XP_006365518.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=566

 Score =   207 bits (526),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT+FILVATF LD+ GRRPLLLTSVGGMV +L LL   LT+IDHS +K+ WA+
Sbjct  352  TVAVGVVKTLFILVATFMLDRSGRRPLLLTSVGGMVASLVLLATGLTIIDHSEQKLVWAI  411

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ I+M LAYVA FSIG GPITWVYSSEIFPL LRATGCS+G  +NRVTSGVVSMTF+SL
Sbjct  412  ALCISMVLAYVALFSIGMGPITWVYSSEIFPLTLRATGCSIGVAVNRVTSGVVSMTFLSL  471

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KAI+IG +FFLYAA+AAV WVFF+TLMP
Sbjct  472  QKAITIGAAFFLYAALAAVAWVFFYTLMP  500


 Score = 54.3 bits (129),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 5/47 (11%)
 Frame = -2

Query  265  QTQGKTLEETEALFGTFFRWRSRQREVD-----AKKANNNSQLQMGT  140
            +TQGKTLEE E LFGTF+ WR R RE+       K +N+N Q+QMGT
Sbjct  501  ETQGKTLEEMETLFGTFWNWRERGRELKELKKTEKNSNDNGQIQMGT  547



>ref|XP_007200117.1| hypothetical protein PRUPE_ppa018884mg [Prunus persica]
 gb|EMJ01316.1| hypothetical protein PRUPE_ppa018884mg [Prunus persica]
Length=527

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+FI +ATF LD+ GRRPLLLTS+GGM+ +L  LG +LT+ID+   K+PWAV
Sbjct  334  TVAVGFVKTIFIFIATFLLDRVGRRPLLLTSMGGMIFSLVCLGAALTIIDNHDSKIPWAV  393

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ I M L  VA FSIG GPITWVYSSEIFPLKLRA G SLG  +NRV SG+VSMTF+SL
Sbjct  394  ALCIIMVLFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSLGVAVNRVISGIVSMTFLSL  453

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA I  + WVFF+T++P
Sbjct  454  YKAITIGGAFFLYAGIGVLAWVFFYTMLP  482



>gb|AAL85876.2|AF480069_1 mannitol transporter [Apium graveolens Dulce Group]
 gb|ABH03025.1| mannitol transporter MaT2 [Apium graveolens]
Length=524

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TIA+G +KT+FILVATF LD+ GRRPLLLTS+GGM+ +L LLG SL VIDHS   V WAV
Sbjct  335  TIAVGISKTLFILVATFLLDRIGRRPLLLTSMGGMIISLTLLGTSLAVIDHSDHTVHWAV  394

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+AI   LAYV  FSIG GPI W YSSE+FPL+LRA GCS+G  +NR TSG++SMTF+SL
Sbjct  395  ALAIFGVLAYVGTFSIGLGPIAWGYSSEVFPLRLRAQGCSIGVAVNRGTSGIISMTFLSL  454

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAISI G+F+L+AAIA V W+F FTL+P
Sbjct  455  YKAISIAGAFYLFAAIAGVAWIFIFTLLP  483



>ref|XP_008245305.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=511

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+AIGF KT+ ILVATF LD+FGRR LLL+SV GM+ +L  LG+ LT+IDH    VPWA+
Sbjct  320  TVAIGFVKTIAILVATFLLDRFGRRRLLLSSVAGMIFSLVCLGVGLTIIDHHRGTVPWAI  379

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ I M L  V  FSIG GPITWVYSSEIFPLKLRA G S+G  +NR+TSGV+SMTF+SL
Sbjct  380  ALCITMVLFNVVFFSIGLGPITWVYSSEIFPLKLRAQGASMGVAVNRITSGVISMTFLSL  439

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGGSFFLYA IAAV WVFF+ L+P
Sbjct  440  YKAITIGGSFFLYAGIAAVSWVFFYMLLP  468



>ref|XP_008812826.1| PREDICTED: polyol transporter 5-like, partial [Phoenix dactylifera]
Length=281

 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 120/150 (80%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-HEKVPWA  534
            T+A+GF KT  ILVATF LD+ GRRPLLL+S GGMV +L +L  SL+VI+H  HEK+ WA
Sbjct  88   TVAVGFMKTAAILVATFLLDRVGRRPLLLSSAGGMVISLVILASSLSVIEHHPHEKLTWA  147

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
             AM+IA  L +V +FSIG GPI WVY+SEIFPL+LRA G SLGTG NR+ SGV+SMTFIS
Sbjct  148  AAMSIATVLTFVGSFSIGLGPIAWVYTSEIFPLRLRAQGASLGTGTNRIVSGVISMTFIS  207

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAI+I GS+F YA IAA GW+FF+  +P
Sbjct  208  LYKAITIAGSYFFYAGIAAAGWLFFYFFLP  237



>ref|XP_007200033.1| hypothetical protein PRUPE_ppa024323mg [Prunus persica]
 gb|EMJ01232.1| hypothetical protein PRUPE_ppa024323mg [Prunus persica]
Length=534

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+FI +ATF LD+ GRRPLLLTS+GGM+ +L  LG +LT+ID+   K+PWAV
Sbjct  334  TVAVGFVKTIFIFIATFLLDRVGRRPLLLTSMGGMIFSLVCLGAALTIIDNHDSKIPWAV  393

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ I M L  VA FSIG GPITWVYSSEIFPLKLRA G SLG  +NRV SG+VSMTF+SL
Sbjct  394  ALCIIMVLFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSLGVAVNRVISGIVSMTFLSL  453

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA I  + WVFF+T++P
Sbjct  454  YKAITIGGAFFLYAGIGVLAWVFFYTMLP  482



>ref|XP_007200667.1| hypothetical protein PRUPE_ppa015294mg [Prunus persica]
 gb|EMJ01866.1| hypothetical protein PRUPE_ppa015294mg [Prunus persica]
Length=538

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 120/149 (81%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TIA+G  KT+FILVATF LD+ GRRPLLL S+GGMV +L  LG SLTVID S   V WAV
Sbjct  334  TIAVGVVKTLFILVATFLLDRIGRRPLLLISMGGMVFSLGFLGASLTVIDQSQGTVTWAV  393

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + I M L  VA FSIG GP+TWVY+SEIFPLKLRA GCS+G  INRVTSG++SMTFISL
Sbjct  394  GLCITMVLFNVAFFSIGLGPVTWVYTSEIFPLKLRAQGCSMGVAINRVTSGIISMTFISL  453

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA +  V W+FF+T++P
Sbjct  454  YKAITIGGAFFLYAGVGVVAWIFFYTMLP  482



>gb|AIU41385.1| sorbitol transporter 1 [Prunus salicina]
Length=509

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF+KT+F L+A   LD+ GRRPLLLTSV GM+ +L  LG SLT++DH  EK+ WA 
Sbjct  326  TVAVGFSKTIFTLIAIGFLDRVGRRPLLLTSVAGMIASLLCLGTSLTIVDHEKEKMMWAS  385

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + + M LAYV  FSIG GPI WVYSSEIFPLKLRA GCS+GT +NR+ SGV++MTFI+L
Sbjct  386  VVCLTMVLAYVGFFSIGMGPIAWVYSSEIFPLKLRAQGCSMGTAVNRIMSGVLTMTFITL  445

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI++GG+FFLY AIA VGWVFF+T++P
Sbjct  446  YKAITMGGTFFLYGAIATVGWVFFYTMLP  474



>ref|XP_007042751.1| Polyol/monosaccharide transporter 5, putative [Theobroma cacao]
 gb|EOX98582.1| Polyol/monosaccharide transporter 5, putative [Theobroma cacao]
Length=532

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+FILVATF LD+ GRRPLLL+SVGGMV +LA +  SLT+IDHS EK+ WA+
Sbjct  335  TVAVGFVKTIFILVATFLLDRIGRRPLLLSSVGGMVASLAAIAFSLTIIDHSEEKLVWAI  394

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + I M LA+VA FSIG GPI  VY+SEIFPL+LRA G S+   +NRVTSGV +MTFISL
Sbjct  395  GLCITMVLAFVAFFSIGMGPIAGVYTSEIFPLRLRAQGVSMAVAVNRVTSGVTAMTFISL  454

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            Y AI+IGG+FFL+A IAA+GWVFF+T +P
Sbjct  455  YNAITIGGAFFLFAGIAAMGWVFFYTCVP  483



>gb|AAL38359.1| sugar transporter protein [Arabidopsis thaliana]
 gb|AAM10180.1| sugar transporter protein [Arabidopsis thaliana]
Length=245

 Score =   201 bits (512),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT FILVATF LD+ GRRPLLLTSVGGMV +LA LG SLT+ID S +KV WAV
Sbjct  42   TVAVGVVKTSFILVATFLLDRIGRRPLLLTSVGGMVLSLAALGTSLTIIDQSEKKVMWAV  101

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             +AIA  + YVA FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+S++F+ +
Sbjct  102  VVAIATVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISISFLPM  161

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KA++ GG+F+L+  IA V WVFF+T +P
Sbjct  162  SKAMTTGGAFYLFGGIATVAWVFFYTFLP  190



>ref|XP_004300990.1| PREDICTED: polyol transporter 5-like [Fragaria vesca subsp. vesca]
Length=530

 Score =   209 bits (531),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TIA+G  KTV ILVATF LD+ GRRPLLL+S+ GM+ +L  LG  LT++DH+ EKV WA+
Sbjct  334  TIAVGSVKTVVILVATFLLDRIGRRPLLLSSMAGMIASLVCLGFGLTIVDHNDEKVMWAI  393

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++I M L YVA FSIG GP+TWVY+SEIFPLKLRA G S+G  +NRV SG++SMTFISL
Sbjct  394  VLSITMVLFYVAFFSIGMGPVTWVYTSEIFPLKLRAQGFSIGVAVNRVASGILSMTFISL  453

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA I  VGWVFF+T++P
Sbjct  454  YKAITIGGAFFLYAGIGVVGWVFFYTMLP  482



>ref|XP_003603886.1| Mannitol transporter [Medicago truncatula]
 gb|AES74137.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=514

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KTVFILVATF LD+ GRRPLLL+SVGGMV +L  L +SLTV+DHS  +  WAV
Sbjct  329  TVAVGLAKTVFILVATFLLDRVGRRPLLLSSVGGMVISLLTLAVSLTVVDHSRVRQMWAV  388

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++IA  L+YVA FSIGAGPITWVYSSEIFPL+LRA G S G  +NRVTSG++SMTF+SL
Sbjct  389  GLSIASVLSYVATFSIGAGPITWVYSSEIFPLRLRAQGASAGVVVNRVTSGIISMTFLSL  448

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
               ISIGG+FFL+  IAA GW+FF+TL+P
Sbjct  449  SDKISIGGAFFLFGGIAACGWIFFYTLLP  477



>gb|KDP46230.1| hypothetical protein JCGZ_10070 [Jatropha curcas]
Length=542

 Score =   209 bits (531),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+FILVATF LD+ GRRPLLL SV GM+ +LA LG SLT+IDHSH+K+ WA+
Sbjct  339  TVAVGFVKTMFILVATFFLDRIGRRPLLLASVAGMIFSLATLGFSLTIIDHSHDKLTWAI  398

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + I M LAYVA FSIG GPITWVYSSE+FPL+LRA G S+G  +  VTSGV+S TFISL
Sbjct  399  VLCITMVLAYVAFFSIGMGPITWVYSSEVFPLRLRAQGASMGVAVGGVTSGVISTTFISL  458

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YK I+IGG+FFL+AAIA   W FFFT +P
Sbjct  459  YKGITIGGAFFLFAAIATGAWTFFFTCLP  487



>ref|XP_002467638.1| hypothetical protein SORBIDRAFT_01g031360 [Sorghum bicolor]
 gb|EER94636.1| hypothetical protein SORBIDRAFT_01g031360 [Sorghum bicolor]
Length=535

 Score =   209 bits (531),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 120/151 (79%), Gaps = 2/151 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE--KVPW  537
            T A+G TKTVFILVATFTLD+FGRRPLLLTS GGMV +L  LG  LTVI H  E   +PW
Sbjct  333  TCAVGVTKTVFILVATFTLDRFGRRPLLLTSTGGMVVSLVGLGFGLTVIGHHPEGTTIPW  392

Query  536  AVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFI  357
            A+ + IA  L  VA FSIG GPITWVYSSEIFPL LRA GC+LG G+NRVTSGV+SMTF+
Sbjct  393  AIGVCIASILGVVAFFSIGLGPITWVYSSEIFPLHLRALGCALGVGVNRVTSGVISMTFL  452

Query  356  SLYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            SL K I+IGGSFFLYA +A + WVFFFT +P
Sbjct  453  SLSKGITIGGSFFLYAGVATLAWVFFFTYLP  483



>ref|XP_010527590.1| PREDICTED: polyol transporter 5-like [Tarenaya hassleriana]
Length=519

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 124/150 (83%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-HEKVPWA  534
            T+A+GF KTVFILVATF LD+ GRRPLLL+SVGGMV +L  LGMSLTV+DH+  +KV WA
Sbjct  334  TVAVGFVKTVFILVATFFLDRIGRRPLLLSSVGGMVLSLLTLGMSLTVVDHTVDKKVMWA  393

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            V ++I   + YVA FSIGAGPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+SMTF+S
Sbjct  394  VVLSITTVMTYVATFSIGAGPITWVYSSEIFPLRLRAQGASMGVIVNRVTSGVISMTFLS  453

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L KAI+ GG+FFL+  IA V WVFF+T +P
Sbjct  454  LSKAITTGGAFFLFGGIATVAWVFFYTFLP  483



>ref|XP_004500821.1| PREDICTED: polyol transporter 5-like [Cicer arietinum]
Length=517

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KTVFILVATF LD+ GRRPLLL+SVGGMV +L  L +SLTV+DHSH +  WAV
Sbjct  333  TVAVGLCKTVFILVATFLLDRVGRRPLLLSSVGGMVISLLTLAVSLTVVDHSHVRKMWAV  392

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++I   L+YVA FSIGAGPITWVYSSEIFPL+LRA G S G  +NRVTSG++SMTF+SL
Sbjct  393  GLSIVSVLSYVATFSIGAGPITWVYSSEIFPLRLRAQGASAGVVVNRVTSGIISMTFLSL  452

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
               ISIGG+FFL+  IAA GW+FF+ L+P
Sbjct  453  SDKISIGGAFFLFGGIAACGWIFFYALLP  481



>ref|XP_006487181.1| PREDICTED: polyol transporter 5-like [Citrus sinensis]
Length=539

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 125/153 (82%), Gaps = 4/153 (3%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT FILVATF LDK GRRPLLL+SV GM+ +LA L +SLTVID SH+KV WAV
Sbjct  335  TVAVGFVKTTFILVATFLLDKIGRRPLLLSSVAGMIASLATLAISLTVIDQSHKKVIWAV  394

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSL----GTGINRVTSGVVSMT  363
             +AI+  L+YVA FSIG GPIT VYSSEI PLKLRA G S+    G  +NRVTSGVVSMT
Sbjct  395  GLAISTVLSYVAFFSIGMGPITLVYSSEILPLKLRAQGASIGIMVGVMVNRVTSGVVSMT  454

Query  362  FISLYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            F+SL KAI+IGGSFFLYA+IA+V WVFF+T +P
Sbjct  455  FLSLSKAITIGGSFFLYASIASVAWVFFYTCLP  487



>ref|NP_001045505.2| Os01g0966900 [Oryza sativa Japonica Group]
 dbj|BAD88259.1| putative sorbitol transporter [Oryza sativa Japonica Group]
 gb|EAZ14958.1| hypothetical protein OsJ_04892 [Oryza sativa Japonica Group]
 dbj|BAF07419.2| Os01g0966900 [Oryza sativa Japonica Group]
Length=479

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T A+G TKT+FILVATFTLD+FGRRPLLL S GGM+ TL  LG+ LTVI        WA+
Sbjct  269  TCAVGVTKTLFILVATFTLDRFGRRPLLLASAGGMIATLVTLGLGLTVIGEDATGGGWAI  328

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A++IA  LA+VA FSIG GPITWVYSSEIFPL LRA GC+LG G+NRVTSGV+SMTF+SL
Sbjct  329  AVSIASILAFVAFFSIGLGPITWVYSSEIFPLHLRALGCALGVGLNRVTSGVISMTFLSL  388

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KAI+IGGSFFLYA +A++ W+FFFT +P
Sbjct  389  SKAITIGGSFFLYAGVASLAWLFFFTYLP  417



>tpg|DAA45950.1| TPA: hypothetical protein ZEAMMB73_850316 [Zea mays]
Length=519

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 120/151 (79%), Gaps = 2/151 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE--KVPW  537
            T A+G TKT+FILVATFTLD+FGRRPLLL S GGMV +L  LG  LTVI H  E   +PW
Sbjct  333  TCAVGVTKTLFILVATFTLDRFGRRPLLLASTGGMVVSLVGLGFGLTVIGHHQEGTTIPW  392

Query  536  AVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFI  357
            A+ + IA  L  VA FSIG GPITWVYSSEIFPL LRA GC+LG G+NRVTSGV+SMTF+
Sbjct  393  AIGVCIASILGVVAFFSIGLGPITWVYSSEIFPLHLRALGCALGVGLNRVTSGVISMTFL  452

Query  356  SLYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            SL K I+IGGSFFLYA IA++ WVFFFT +P
Sbjct  453  SLSKGITIGGSFFLYAGIASLAWVFFFTYLP  483



>gb|EAZ04480.1| hypothetical protein OsI_26629 [Oryza sativa Indica Group]
Length=510

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 123/150 (82%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVI-DHSHEKVPWA  534
            T A+G TKT+FILVATF LD+ GRRPLLL+S GGM+ +L  LG  LTV+  H   K+PWA
Sbjct  322  TCAVGVTKTLFILVATFFLDRVGRRPLLLSSTGGMILSLIGLGAGLTVVGQHPDAKIPWA  381

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            + ++IA TLAYVA FSIG GPITWVYSSEIFPL++RA GCSLG   NRVTSGV+SMTF+S
Sbjct  382  IGLSIASTLAYVAFFSIGLGPITWVYSSEIFPLQVRALGCSLGVAANRVTSGVISMTFLS  441

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L KAI+IGGSFFLY+ IAA+ WVFF+T +P
Sbjct  442  LSKAITIGGSFFLYSGIAALAWVFFYTYLP  471



>dbj|BAC83310.1| putative sorbitol transporter [Oryza sativa Japonica Group]
 gb|EAZ40438.1| hypothetical protein OsJ_24893 [Oryza sativa Japonica Group]
Length=510

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 123/150 (82%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVI-DHSHEKVPWA  534
            T A+G TKT+FILVATF LD+ GRRPLLL+S GGM+ +L  LG  LTV+  H   K+PWA
Sbjct  322  TCAVGVTKTLFILVATFFLDRVGRRPLLLSSTGGMILSLIGLGAGLTVVGQHPDAKIPWA  381

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            + ++IA TLAYVA FSIG GPITWVYSSEIFPL++RA GCSLG   NRVTSGV+SMTF+S
Sbjct  382  IGLSIASTLAYVAFFSIGLGPITWVYSSEIFPLQVRALGCSLGVAANRVTSGVISMTFLS  441

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L KAI+IGGSFFLY+ IAA+ WVFF+T +P
Sbjct  442  LSKAITIGGSFFLYSGIAALAWVFFYTYLP  471



>ref|XP_008387370.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=538

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 121/150 (81%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH-EKVPWA  534
            T+A+G  KTVFILVATF LD+ GRRPLLL+SV GMV +L  LG++LT+ID  H  K+ W 
Sbjct  335  TVAVGLAKTVFILVATFLLDRIGRRPLLLSSVAGMVFSLGSLGVALTIIDQHHGAKMTWT  394

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
             A+ + M +AY A FSIG GPITWVYSSEIFPLKLRA GCS+G  +NRV SGV+SMTFIS
Sbjct  395  TALCLTMVIAYAALFSIGLGPITWVYSSEIFPLKLRAQGCSMGVAMNRVVSGVLSMTFIS  454

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAI++GG+FFLY  IAAV WVFF+T+ P
Sbjct  455  LYKAITMGGAFFLYGGIAAVAWVFFYTMYP  484



>ref|XP_010065409.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
 gb|KCW62859.1| hypothetical protein EUGRSUZ_G00453 [Eucalyptus grandis]
Length=535

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TI +G  KT+FILVATF LD+ GRRPLLL+SVGGM+ +L  LG+ LT+I+HS  K+ WAV
Sbjct  338  TIGVGVVKTLFILVATFLLDRIGRRPLLLSSVGGMIISLGSLGVCLTIINHSQTKLMWAV  397

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + IA  L+YVA FSIG GPITWVYSSEIFPL+LRA GC++G  +NRVTSGV++M+FISL
Sbjct  398  VVCIASVLSYVAFFSIGMGPITWVYSSEIFPLRLRAQGCAIGVAMNRVTSGVLAMSFISL  457

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            Y+AISIGG+FFL+ A+A   W+FF+ LMP
Sbjct  458  YEAISIGGAFFLFMAVACAAWLFFYILMP  486



>ref|XP_010065405.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
 gb|KCW62856.1| hypothetical protein EUGRSUZ_G00450 [Eucalyptus grandis]
Length=535

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TIA+G  KT+ ILVATF LD+ GRRPLLL+SVGGM+ +L  LG+ LT+I+HS  K+ WAV
Sbjct  338  TIAVGVVKTMLILVATFLLDRIGRRPLLLSSVGGMIISLGSLGVCLTIINHSQTKLMWAV  397

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             M IA  L+YVA FSIG GPITWVYSSEIFPL+LRA GC++G  +NRVTSGV +M+FISL
Sbjct  398  VMCIASVLSYVAFFSIGMGPITWVYSSEIFPLRLRAQGCAIGVAMNRVTSGVSAMSFISL  457

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            Y AISIGG+FFL+ A+A   W+FF+ LMP
Sbjct  458  YDAISIGGAFFLFMAVACAAWLFFYILMP  486



>gb|KHN39768.1| Polyol transporter 5 [Glycine soja]
Length=523

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KTVFIL ATFTLD+ GRRPLLL+SVGGMV +L  L +SLTVIDHS  K+ WAV
Sbjct  330  TVAVGFVKTVFILAATFTLDRVGRRPLLLSSVGGMVLSLLTLAISLTVIDHSERKLMWAV  389

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
              +IAM LAYVA FSIGAGPITWVYSSEIFPL+LRA G + G  +NR TS VVSMTF+SL
Sbjct  390  GSSIAMVLAYVATFSIGAGPITWVYSSEIFPLRLRAQGAAAGVAVNRTTSAVVSMTFLSL  449

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             +AI+IGG+FFLY  IA VGW+FF+T++P
Sbjct  450  TRAITIGGAFFLYCGIATVGWIFFYTVLP  478



>emb|CAP58707.1| putative polyol transported protein 2 [Hevea brasiliensis]
Length=547

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+FILVATF LD+ GRRPLLL+SV GMV +LA LG SLT+IDHSHEK+ WA+
Sbjct  336  TVAVGFVKTIFILVATFLLDRIGRRPLLLSSVAGMVFSLATLGFSLTIIDHSHEKLTWAI  395

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ IAM L YVA FSIG GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+S TFISL
Sbjct  396  ALCIAMVLLYVATFSIGMGPITWVYSSEIFPLRLRAQGASMGVAVNRVTSGVISTTFISL  455

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YK I+IGG+FFL+AAIAAV W FFFT +P
Sbjct  456  YKGITIGGAFFLFAAIAAVAWTFFFTCLP  484



>ref|NP_001236592.1| sorbitol-like transporter [Glycine max]
 emb|CAD91337.1| sorbitol-like transporter [Glycine max]
Length=523

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KTVFIL ATFTLD+ GRRPLLL+SVGGMV +L  L +SLTVIDHS  K+ WAV
Sbjct  330  TVAVGFVKTVFILAATFTLDRVGRRPLLLSSVGGMVLSLLTLAISLTVIDHSERKLMWAV  389

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
              +IAM LAYVA FSIGAGPITWVYSSEIFPL+LRA G + G  +NR TS VVSMTF+SL
Sbjct  390  GSSIAMVLAYVATFSIGAGPITWVYSSEIFPLRLRAQGAAAGVAVNRTTSAVVSMTFLSL  449

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             +AI+IGG+FFLY  IA VGW+FF+T++P
Sbjct  450  TRAITIGGAFFLYCGIATVGWIFFYTVLP  478



>ref|XP_002460923.1| hypothetical protein SORBIDRAFT_02g037570 [Sorghum bicolor]
 gb|EER97444.1| hypothetical protein SORBIDRAFT_02g037570 [Sorghum bicolor]
Length=510

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 123/150 (82%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWA  534
            T A+G TKT+FILVATF LD+ GRRPLLL+SVGGM+ +L  L   LTVI+H  + K+PWA
Sbjct  322  TCAVGVTKTLFILVATFLLDRVGRRPLLLSSVGGMIISLVGLAAGLTVIEHHPDGKIPWA  381

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            + +AIA T+AYVA FSIG GPITWVYSSE+FPL +RA GC+LG   NRVTSGV+SMTFIS
Sbjct  382  IGVAIASTMAYVAFFSIGMGPITWVYSSEVFPLHVRALGCALGVASNRVTSGVISMTFIS  441

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L KAI+IGG+FFLYA +A + WVFFFT +P
Sbjct  442  LTKAITIGGAFFLYAGVAVLAWVFFFTFLP  471



>gb|AAZ80876.1| putative sorbitol transporter, partial [Nicotiana langsdorffii 
x Nicotiana sanderae]
Length=312

 Score =   200 bits (509),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+FILVATF LDK GRR LLLTSV GMV +L LL   LT+ID S +KV WA+
Sbjct  108  TVAVGFVKTIFILVATFMLDKSGRRKLLLTSVAGMVLSLMLLATGLTIIDQSEQKVIWAI  167

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A++I M LAYVA FSIG GPITWVYSSEIFPL+LRATGCS+G  +NRVTSGVVSMTF++L
Sbjct  168  ALSITMVLAYVALFSIGMGPITWVYSSEIFPLRLRATGCSIGVAVNRVTSGVVSMTFLTL  227

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             K I+IGG+FFLY  +AA  +VFFFTLMP
Sbjct  228  VKRITIGGAFFLYFGLAAAAFVFFFTLMP  256


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 35/55 (64%), Gaps = 8/55 (15%)
 Frame = -2

Query  265  QTQGKTLEETEALFGTFFRWRSRQREVDAKK--------ANNNSQLQMGTLQAAN  125
            +TQGKTLEE EALFGTF+ WR   RE+   K        +N+N Q+QMGT  A +
Sbjct  257  ETQGKTLEEMEALFGTFWNWRKTARELKEAKITEKTEKNSNDNGQIQMGTAPAIS  311



>ref|NP_001060108.1| Os07g0582400 [Oryza sativa Japonica Group]
 gb|AAL14615.1|AF416867_1 putative sugar transporter [Oryza sativa]
 dbj|BAF22022.1| Os07g0582400 [Oryza sativa Japonica Group]
Length=577

 Score =   207 bits (526),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 123/150 (82%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVI-DHSHEKVPWA  534
            T A+G TKT+FILVATF LD+ GRRPLLL+S GGM+ +L  LG  LTV+  H   K+PWA
Sbjct  389  TCAVGVTKTLFILVATFFLDRVGRRPLLLSSTGGMILSLIGLGAGLTVVGQHPDAKIPWA  448

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            + ++IA TLAYVA FSIG GPITWVYSSEIFPL++RA GCSLG   NRVTSGV+SMTF+S
Sbjct  449  IGLSIASTLAYVAFFSIGLGPITWVYSSEIFPLQVRALGCSLGVAANRVTSGVISMTFLS  508

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L KAI+IGGSFFLY+ IAA+ WVFF+T +P
Sbjct  509  LSKAITIGGSFFLYSGIAALAWVFFYTYLP  538



>ref|XP_010254895.1| PREDICTED: polyol transporter 5-like [Nelumbo nucifera]
Length=531

 Score =   205 bits (522),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT FILVATF LD+ GRRPLLL+SV GM+ +L  L   LTVI++S +K+PWA+
Sbjct  326  TVAVGFVKTCFILVATFLLDRVGRRPLLLSSVAGMIVSLVGLATGLTVIENSDKKLPWAI  385

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + I M L +VA+FSIG GPITWVYSSEIFPL+LRA G ++G  +NRVTSGV++MTFISL
Sbjct  386  VLCIMMVLTFVASFSIGLGPITWVYSSEIFPLRLRAQGAAVGVAVNRVTSGVLAMTFISL  445

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLY  +A V W FFFT +P
Sbjct  446  YKAITIGGAFFLYGGVATVAWFFFFTFLP  474



>ref|XP_008653287.1| PREDICTED: polyol transporter 5-like [Zea mays]
 tpg|DAA63325.1| TPA: hypothetical protein ZEAMMB73_442702 [Zea mays]
Length=513

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 122/150 (81%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SHEKVPWA  534
            T A+G TKT+FILVATF LD+ GRRPLLL+SVGGM+ +L  L   LTVI H   EK+PWA
Sbjct  322  TCAVGVTKTLFILVATFLLDRVGRRPLLLSSVGGMIFSLVGLAAGLTVIGHYQDEKIPWA  381

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            + +AIA T+AYVA FSIG GPITWVYSSE+FPL +RA GC+LG   NR+TSGV+SMTFIS
Sbjct  382  IGVAIASTMAYVAFFSIGLGPITWVYSSEVFPLHVRAMGCALGVASNRLTSGVISMTFIS  441

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L KAI+IGG+FFLYA +A + WVFFFT +P
Sbjct  442  LSKAITIGGAFFLYAGVAVLAWVFFFTFLP  471



>ref|XP_009375628.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=537

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 120/150 (80%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH-EKVPWA  534
            T+A+G  KT+FILVATF LD+ GRRPLLL+SV GM+ +L  LG+ LT+ID  H  K+ W 
Sbjct  334  TVAVGLAKTIFILVATFLLDRVGRRPLLLSSVAGMIFSLGALGVGLTIIDQHHGAKMTWT  393

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
             A+ + M +AY A FSIG GPITWVYSSEIFPLKLRA GCS+G  +NRV SGV+SMTFIS
Sbjct  394  TALCLTMVIAYAALFSIGLGPITWVYSSEIFPLKLRAQGCSMGVAMNRVVSGVLSMTFIS  453

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAI++GG+FFLY  IAAV WVFF+T+ P
Sbjct  454  LYKAITMGGAFFLYGGIAAVAWVFFYTMYP  483



>ref|XP_004148857.1| PREDICTED: polyol transporter 5-like [Cucumis sativus]
 gb|KGN61777.1| hypothetical protein Csa_2G245410 [Cucumis sativus]
Length=533

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+FILVATF LD+ GRRPLLLTSV GM+ +L  LG++LTVI+ + +K+ WAV
Sbjct  337  TVAVGFVKTIFILVATFLLDRIGRRPLLLTSVLGMIISLGTLGLALTVINQTDKKLMWAV  396

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + I+M L YVA+FSIG GPITWVYSSEIFPLKLRA G S+G  +NRVTSGV+SM+F+SL
Sbjct  397  VLCISMVLTYVASFSIGMGPITWVYSSEIFPLKLRAQGTSMGVAVNRVTSGVISMSFLSL  456

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KAI+ GG+FFL+AAIA V W FF+T +P
Sbjct  457  SKAITTGGAFFLFAAIAIVAWFFFYTALP  485



>ref|NP_001281033.1| polyol transporter 5-like [Malus domestica]
 dbj|BAD42345.1| sorbitol transporter [Malus domestica]
Length=535

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KTVFILVATF +DK GRRPLLL SV GM+ +L  LG+ LT+ID +HE++ WA 
Sbjct  333  TVAVGFVKTVFILVATFFVDKVGRRPLLLASVAGMILSLTGLGLGLTIIDQNHERILWAA  392

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + + M L YVA FSIG GPITWVYSSEIFPLKLRA GCSLG  +NRV SGV+SMTFISL
Sbjct  393  VLCLTMVLLYVAFFSIGMGPITWVYSSEIFPLKLRAQGCSLGVAMNRVVSGVLSMTFISL  452

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            Y+AI+IGG+FFLYAAIA+V WVFFFT++P
Sbjct  453  YEAITIGGAFFLYAAIASVAWVFFFTMLP  481



>ref|XP_009344433.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=537

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 120/150 (80%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH-EKVPWA  534
            T+A+G  KT+FILVATF LD+ GRRPLLL+SV GM+ +L  LG+ LT+ID  H  K+ W 
Sbjct  334  TVAVGLAKTIFILVATFLLDRVGRRPLLLSSVAGMIFSLGALGVGLTIIDQHHGAKMTWT  393

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
             A+ + M +AY A FSIG GPITWVYSSEIFPLKLRA GCS+G  +NRV SG++SMTFIS
Sbjct  394  TALCLTMVIAYAALFSIGLGPITWVYSSEIFPLKLRAQGCSMGVAMNRVVSGILSMTFIS  453

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAI++GG+FFLY  IAAV WVFF+T+ P
Sbjct  454  LYKAITMGGAFFLYGGIAAVAWVFFYTMYP  483



>gb|EPS69995.1| sugar transport protein [Genlisea aurea]
Length=530

 Score =   204 bits (520),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GFTKTVFILVATF LDK GRRPLLL+SV GM+ +L  LG+ LTVI  S  K+ WAV
Sbjct  330  TMAVGFTKTVFILVATFFLDKIGRRPLLLSSVAGMILSLMGLGLGLTVIARSDHKLVWAV  389

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ I   L+YVA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+SMTF+SL
Sbjct  390  ALCITSVLSYVAFFSIGMGPITWVYSSEIFPLQLRAQGCSVGVAVNRVTSGVISMTFLSL  449

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAISIGG+FFLY  +A V WVFF++L+P
Sbjct  450  YKAISIGGTFFLYGGVAMVAWVFFYSLLP  478


 Score = 49.3 bits (116),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  265  QTQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQM  146
            +TQG+TLEE E+LFGTFF+WRS +R ++  K      +QM
Sbjct  479  ETQGRTLEEMESLFGTFFKWRSTRRALEENKKFGGKHVQM  518



>ref|XP_006657888.1| PREDICTED: polyol transporter 5-like [Oryza brachyantha]
Length=510

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 122/150 (81%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVI-DHSHEKVPWA  534
            T A+G TKT+FILVATF LD+ GRRPLLL+S GGM+ +L  LG  LTV+  H   K+PWA
Sbjct  322  TCAVGVTKTLFILVATFFLDRIGRRPLLLSSTGGMILSLIGLGAGLTVVGQHPDAKIPWA  381

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            + ++IA TLAYVA FSIG GPITWVYSSEIFPL++RA GC+LG   NRVTSGV+SMTF+S
Sbjct  382  IGLSIASTLAYVAFFSIGLGPITWVYSSEIFPLQVRALGCALGVASNRVTSGVISMTFLS  441

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L  AI+IGGSFFLYA IAA+ WVFF+T +P
Sbjct  442  LSNAITIGGSFFLYAGIAALAWVFFYTYLP  471



>ref|XP_007131851.1| hypothetical protein PHAVU_011G046700g [Phaseolus vulgaris]
 gb|ESW03845.1| hypothetical protein PHAVU_011G046700g [Phaseolus vulgaris]
Length=518

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT+FILVATF LD+ GRRPLLL+SVGGMV +L  L +SLT+ID S  K+ WA+
Sbjct  327  TVAVGTVKTLFILVATFMLDRVGRRPLLLSSVGGMVLSLLTLAISLTIIDRSESKLMWAI  386

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++I M L YVA FSIGAGPITWVYSSEIFPL+LRA G + G  +NR TSGV+SMTF+SL
Sbjct  387  GLSITMVLVYVATFSIGAGPITWVYSSEIFPLRLRAQGAAAGVVVNRTTSGVISMTFLSL  446

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KAI+IGG+FFLY  IA VGW+FFF ++P
Sbjct  447  TKAITIGGAFFLYCGIAVVGWLFFFIVLP  475



>ref|XP_010068107.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
Length=487

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TIA+GF KT+FILV+TF LD+ GRRPLLL+SVGGM+ +LA L   LT+ID SH  + WAV
Sbjct  291  TIAVGFVKTIFILVSTFLLDRVGRRPLLLSSVGGMIVSLATLATCLTIIDRSHTTLKWAV  350

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            AM IA  L +VA FSIG GPI WVYSSEIFPL+LRA GC++G  INRV SGV+ MTF+SL
Sbjct  351  AMCIASVLFFVAFFSIGLGPIAWVYSSEIFPLRLRAQGCAIGVAINRVASGVLVMTFLSL  410

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KAI+IGG+FFLY  I    WVFF+ LMP
Sbjct  411  SKAITIGGAFFLYTGIVCASWVFFYVLMP  439



>emb|CAJ29291.1| putative polyol transporter protein 4 [Lotus japonicus]
Length=519

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT FILVATF LD+ GRRPLLLTSVGGMV +L  LG SLT+ID S  KV WAV
Sbjct  332  TVAVGFVKTCFILVATFMLDRIGRRPLLLTSVGGMVLSLLTLGTSLTIIDRSDTKVTWAV  391

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++IA  L+YVA FSIGAGPITWVYSSEIFPL+LRA GC++G  +NRVTSGV+SMTF+SL
Sbjct  392  GLSIATVLSYVATFSIGAGPITWVYSSEIFPLRLRAQGCAMGVVVNRVTSGVISMTFLSL  451

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             K I+IGG+FFL+  IA  GW+FF+T++P
Sbjct  452  SKGITIGGAFFLFGGIAICGWIFFYTMLP  480



>ref|XP_004983902.1| PREDICTED: polyol transporter 5-like isoform X2 [Setaria italica]
Length=523

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 119/150 (79%), Gaps = 2/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE--KVPW  537
            T A+G TKT+FILVATFTLD FGRRPLLLTS GGMV +L  LG+ LTVI H  E   +PW
Sbjct  322  TCAVGATKTLFILVATFTLDHFGRRPLLLTSTGGMVVSLVGLGLGLTVIGHHPEGTTIPW  381

Query  536  AVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFI  357
            AV + IA  L  VA FSIG GPI WVYSSEIFPL LRA GC+LG G+NRVTSGV+SMTF+
Sbjct  382  AVGVCIASILGVVAFFSIGLGPIAWVYSSEIFPLHLRALGCALGVGLNRVTSGVISMTFL  441

Query  356  SLYKAISIGGSFFLYAAIAAVGWVFFFTLM  267
            SL K I+IGGSFFLYA IA++ WVFFFT +
Sbjct  442  SLSKGITIGGSFFLYAGIASLAWVFFFTYL  471



>ref|XP_004170410.1| PREDICTED: LOW QUALITY PROTEIN: polyol transporter 5-like [Cucumis 
sativus]
Length=533

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+FILVATF LD+ GRRPLLLTSV GM+ +L  LG++LTVI+ + +K+ WAV
Sbjct  337  TVAVGFVKTIFILVATFLLDRIGRRPLLLTSVLGMIISLGTLGLALTVINQTDKKLMWAV  396

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + I+M L YVA+FSIG GPITWVYSSE FPLKLRA G S+G  +NRVTSGV+SM+F+SL
Sbjct  397  VLCISMVLTYVASFSIGMGPITWVYSSEXFPLKLRAQGTSMGVAVNRVTSGVISMSFLSL  456

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KAI+ GG+FFL+AAIA V W FF+T +P
Sbjct  457  SKAITTGGAFFLFAAIAIVAWXFFYTALP  485



>gb|KCW62858.1| hypothetical protein EUGRSUZ_G00452 [Eucalyptus grandis]
Length=529

 Score =   203 bits (517),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TIA+GF KT+FILV+TF LD+ GRRPLLL+SVGGM+ +LA L   LT+ID SH  + WAV
Sbjct  327  TIAVGFVKTIFILVSTFLLDRVGRRPLLLSSVGGMIVSLATLATCLTIIDRSHTTLKWAV  386

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            AM IA  L +VA FSIG GPI WVYSSEIFPL+LRA GC++G  INRV SGV+ MTF+SL
Sbjct  387  AMCIASVLFFVAFFSIGLGPIAWVYSSEIFPLRLRAQGCAIGVAINRVASGVLVMTFLSL  446

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KAI+IGG+FFLY  I    WVFF+ LMP
Sbjct  447  SKAITIGGAFFLYTGIVCASWVFFYVLMP  475



>ref|XP_004983901.1| PREDICTED: polyol transporter 5-like isoform X1 [Setaria italica]
Length=535

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 119/150 (79%), Gaps = 2/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE--KVPW  537
            T A+G TKT+FILVATFTLD FGRRPLLLTS GGMV +L  LG+ LTVI H  E   +PW
Sbjct  334  TCAVGATKTLFILVATFTLDHFGRRPLLLTSTGGMVVSLVGLGLGLTVIGHHPEGTTIPW  393

Query  536  AVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFI  357
            AV + IA  L  VA FSIG GPI WVYSSEIFPL LRA GC+LG G+NRVTSGV+SMTF+
Sbjct  394  AVGVCIASILGVVAFFSIGLGPIAWVYSSEIFPLHLRALGCALGVGLNRVTSGVISMTFL  453

Query  356  SLYKAISIGGSFFLYAAIAAVGWVFFFTLM  267
            SL K I+IGGSFFLYA IA++ WVFFFT +
Sbjct  454  SLSKGITIGGSFFLYAGIASLAWVFFFTYL  483



>ref|XP_008387369.1| PREDICTED: putative polyol transporter 1 isoform X2 [Malus domestica]
Length=535

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KTVFILVATF +DK GRRPLLL SV GM+ +L  LG+ LT+ID +HE++ WA 
Sbjct  333  TVAVGFVKTVFILVATFFVDKVGRRPLLLASVAGMILSLTGLGLGLTIIDQNHERILWAA  392

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + + M L YVA FSIG GPITWVYSSEIFPLKLRA GCS+G  +NRV SGV+SMTFISL
Sbjct  393  VLCLTMVLLYVAFFSIGMGPITWVYSSEIFPLKLRAQGCSIGVAMNRVVSGVLSMTFISL  452

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            Y AI+IGG+FFLYAAIA+V WVFFFT++P
Sbjct  453  YDAITIGGAFFLYAAIASVAWVFFFTMLP  481



>ref|XP_010507195.1| PREDICTED: polyol transporter 5 [Camelina sativa]
Length=534

 Score =   203 bits (517),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT+FILVATF LD+ GRRPLLLTSVGGMV +L  LG SLT+IDHS +KV WAV
Sbjct  337  TVAVGVVKTLFILVATFLLDRIGRRPLLLTSVGGMVLSLMALGTSLTIIDHSEKKVMWAV  396

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             +AIA  + YVA FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+SMTF+ +
Sbjct  397  VLAIATVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISMTFLPM  456

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             K ++ GG+F+L+  IA V W+FF+T +P
Sbjct  457  SKKMTTGGAFYLFGGIATVAWLFFYTFLP  485



>ref|XP_004958137.1| PREDICTED: polyol transporter 5-like [Setaria italica]
Length=515

 Score =   203 bits (516),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 122/150 (81%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWA  534
            T A+G TKT+FILVATF LDK GRRPLLL+SVGGM+ +L  L   LTVI H  + K+PWA
Sbjct  322  TCAVGVTKTLFILVATFLLDKVGRRPLLLSSVGGMIFSLVGLATGLTVIGHYPDAKIPWA  381

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            +A++IA T+AYVA FSIG GPITWVYSSEIFPL++RA GC+LG   NRVTSGV+SMTFIS
Sbjct  382  IAVSIASTMAYVAFFSIGLGPITWVYSSEIFPLQVRAMGCALGVATNRVTSGVISMTFIS  441

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L  AI+IGG+FFLY  IA + WVFFF+ +P
Sbjct  442  LSNAITIGGAFFLYGGIAVLAWVFFFSFLP  471



>ref|XP_003562817.1| PREDICTED: polyol transporter 5-like [Brachypodium distachyon]
Length=513

 Score =   202 bits (515),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 120/150 (80%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWA  534
            T A+G TKTVFILVATF LD+ GRRPLLL+S GGM+ +L  L   LTV+  H  E++PWA
Sbjct  322  TCAVGVTKTVFILVATFLLDRVGRRPLLLSSTGGMIVSLVGLAAGLTVVSRHPDEQIPWA  381

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            +A+ I   LAYVA FSIG GPITWVYSSEIFPL +RA GCSLG   NR+TSGV+SMTFIS
Sbjct  382  IALCILCILAYVAFFSIGLGPITWVYSSEIFPLHVRALGCSLGVAANRLTSGVISMTFIS  441

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L KAI+IGG+FFL+A IA++ WVFFFT +P
Sbjct  442  LSKAITIGGAFFLFAGIASLAWVFFFTYLP  471



>ref|XP_007135989.1| hypothetical protein PHAVU_009G008900g [Phaseolus vulgaris]
 gb|ESW07983.1| hypothetical protein PHAVU_009G008900g [Phaseolus vulgaris]
Length=514

 Score =   202 bits (515),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KTVFILVATF LD+ GRRPLLLTSVGGMV +L  L +SLTVI+ S  ++ WA+
Sbjct  327  TVAVGFAKTVFILVATFLLDRVGRRPLLLTSVGGMVFSLLTLAVSLTVIERSRAELKWAI  386

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++IA  L+YV+ FS+GAGPITWVYSSEIFPL+LRA G ++G  +NRVTSGV+SMTF+SL
Sbjct  387  GLSIATVLSYVSTFSVGAGPITWVYSSEIFPLRLRAQGAAMGVVVNRVTSGVISMTFLSL  446

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
               I+IGG+FF++  IA  GW+FFFT++P
Sbjct  447  SNKITIGGAFFIFGGIAMCGWIFFFTMLP  475



>ref|XP_010487804.1| PREDICTED: polyol transporter 5-like [Camelina sativa]
Length=535

 Score =   203 bits (516),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT+FILVATF LD+ GRRPLLLTSVGGMV +L  LG SLT+IDHS +KV WAV
Sbjct  337  TVAVGVVKTLFILVATFLLDRIGRRPLLLTSVGGMVLSLLALGTSLTIIDHSEKKVMWAV  396

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             +AIA  + YVA FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+SMTF+ +
Sbjct  397  VLAIATVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISMTFLPM  456

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             K ++ GG+F+L+  IA V W+FF+T +P
Sbjct  457  SKKMTTGGAFYLFGGIATVAWLFFYTFLP  485



>ref|XP_002885281.1| ATPLT5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61540.1| ATPLT5 [Arabidopsis lyrata subsp. lyrata]
Length=538

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT FILVATF LD+ GRRPLLLTSVGGMV +LA LG SLT+ID S +KV WAV
Sbjct  336  TVAVGVVKTSFILVATFLLDRIGRRPLLLTSVGGMVLSLAALGTSLTIIDQSEKKVMWAV  395

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             +AIA  + YVA FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+SM F+ L
Sbjct  396  VVAIATVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISMAFLPL  455

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             K I+ GG+F+L+  IA V WVFF+T +P
Sbjct  456  SKGITTGGAFYLFGGIATVAWVFFYTFLP  484



>gb|KJB12317.1| hypothetical protein B456_002G011600 [Gossypium raimondii]
Length=486

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 120/149 (81%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TIAIGF KT+F+LVAT  LDK GRR LLL+SVGGMV +LA +G SLT+ DHS  K+ WA+
Sbjct  304  TIAIGFFKTIFVLVATLLLDKIGRRVLLLSSVGGMVVSLATIGFSLTIADHSETKLTWAI  363

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + + M LA+V+ F+IG GPIT VY SEIFPL+LRA G S+G  +NRV SG++SMTFISL
Sbjct  364  VLCMTMVLAFVSFFAIGMGPITNVYMSEIFPLRLRAQGVSMGVAVNRVVSGIISMTFISL  423

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFL+A IA VGWVFF+  MP
Sbjct  424  YKAITIGGAFFLFAGIATVGWVFFYVCMP  452



>ref|XP_009135601.1| PREDICTED: polyol transporter 5 [Brassica rapa]
Length=532

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT FILVATF LD+ GRRPLLLTSVGGMV +LA+LG SLTVID S +KV WAV
Sbjct  342  TVAVGIVKTSFILVATFLLDRVGRRPLLLTSVGGMVISLAVLGTSLTVIDQSDKKVMWAV  401

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++IA  + YVA FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+SMTF+ +
Sbjct  402  VLSIATVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISMTFLPM  461

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             K ++ GG+F+L+  IA V WVFF+T +P
Sbjct  462  SKGMTTGGAFYLFGGIATVAWVFFYTFLP  490



>ref|XP_010465998.1| PREDICTED: polyol transporter 5-like [Camelina sativa]
Length=534

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT+FILVATF LD+ GRRPLLLTSVGGMV +L  LG SLT+IDH+ +KV WAV
Sbjct  337  TVAVGVVKTLFILVATFLLDRIGRRPLLLTSVGGMVISLIALGTSLTIIDHTKKKVTWAV  396

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             +AIA  + YVA FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+SMTF+ +
Sbjct  397  VLAIATVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISMTFLPM  456

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             K ++ GG+F+L+  IA V W+FF+T +P
Sbjct  457  SKKMTTGGAFYLFGGIATVAWLFFYTFLP  485



>ref|XP_008791366.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=507

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 120/150 (80%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-HEKVPWA  534
            T+A+GF KT  +LVATF LD+ GRRPLLL+S GGMV +L +L   L+VI+H  HEK+ WA
Sbjct  312  TVAVGFMKTASVLVATFLLDRVGRRPLLLSSAGGMVISLVILASCLSVIEHHPHEKLTWA  371

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
             AM+IA  L +V +FSIG GPI WVY+SEIFPL+LRA G SLGTG NR+ SGVV+MTFIS
Sbjct  372  AAMSIATVLTFVGSFSIGLGPIAWVYTSEIFPLRLRAQGVSLGTGTNRILSGVVTMTFIS  431

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAI+I GSFFLYA IAA GW+FF+  +P
Sbjct  432  LYKAITIAGSFFLYAGIAAAGWLFFYFFLP  461



>ref|XP_009407915.1| PREDICTED: putative polyol transporter 1 [Musa acuminata subsp. 
malaccensis]
Length=520

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 125/150 (83%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWA  534
            T+A+GFTKT+FILVATF LD+ GRRPLLLTS  GM+ +LA LG+ LT  +H  +  +PWA
Sbjct  328  TVAVGFTKTLFILVATFLLDRVGRRPLLLTSFAGMILSLAGLGLGLTAAEHHTDGHLPWA  387

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            V ++IA  LAYVA FSIGAGPITWVYSSEIFPL+LRA G S+G  +NRVTSGV++MTFIS
Sbjct  388  VGLSIACVLAYVAFFSIGAGPITWVYSSEIFPLRLRAVGASIGVAVNRVTSGVITMTFIS  447

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAIS+GGSFFLY  IAAV WVFFFT +P
Sbjct  448  LYKAISLGGSFFLYGGIAAVAWVFFFTYLP  477



>ref|XP_008800418.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=528

 Score =   201 bits (511),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SHEKVPWA  534
            T+A+GF KT  ILVATF LD+ GRRPLLL+S GGMV +L +L  SL+VI+H  HEK+ WA
Sbjct  333  TVAVGFMKTAAILVATFLLDRVGRRPLLLSSAGGMVISLVILASSLSVIEHHPHEKLTWA  392

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
             AM+IA  L +V +FSIG GPI WVY+SEIFPL+LRA G SLGT  NR+ SGV++MTFIS
Sbjct  393  AAMSIASVLTFVGSFSIGLGPIAWVYTSEIFPLRLRAQGASLGTATNRIVSGVITMTFIS  452

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYK I+I GSFFLYA IAA GW+FF+  +P
Sbjct  453  LYKTITIAGSFFLYAGIAAAGWIFFYFFLP  482



>dbj|BAM66295.1| sorbitol transporter, partial [Pyrus pyrifolia]
Length=454

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KTVFILVATF +DK GRRPLLL SV GM+ +L  LG+ LT+ID +H ++ WA 
Sbjct  284  TVAVGFVKTVFILVATFFVDKVGRRPLLLASVAGMILSLIGLGLGLTIIDQNHGRIMWAA  343

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + I M L YVA FSIG GPITWVYSSEIFPLKLRA GCSLG  +NRV SGV+SMTFISL
Sbjct  344  VLCITMVLLYVAFFSIGMGPITWVYSSEIFPLKLRAQGCSLGVAMNRVVSGVLSMTFISL  403

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            Y+AI+IGG+FFLYAAIA V WVFFF ++P
Sbjct  404  YEAITIGGAFFLYAAIATVAWVFFFIMLP  432



>ref|XP_008236795.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=538

 Score =   201 bits (510),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KTVFILVATF LD+ GRRPLLLTSV GMV TLALLG+ LT+IDH HE++ WAV
Sbjct  334  TVAVGFVKTVFILVATFMLDRLGRRPLLLTSVAGMVVTLALLGLGLTIIDHHHERIMWAV  393

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + + M LAYVA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRV SGV+SMTFISL
Sbjct  394  VLCLTMVLAYVAFFSIGMGPITWVYSSEIFPLQLRAQGCSIGVAVNRVVSGVLSMTFISL  453

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFL+AAIAAVGW FFFT++P
Sbjct  454  YKAITIGGAFFLFAAIAAVGWTFFFTMLP  482



>ref|XP_009785574.1| PREDICTED: polyol transporter 5-like isoform X1 [Nicotiana sylvestris]
Length=355

 Score =   196 bits (498),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TIA+G  KT FILVATF +DK GRR LLL+S GGM+ +L  L   LT+IDHS  K+ WA+
Sbjct  141  TIAVGCMKTFFILVATFLVDKVGRRVLLLSSCGGMILSLLGLATGLTIIDHSDHKLKWAI  200

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + I  TL+ VA FSIG GPI WVYSSEIFPL+LRA GCS+G  +NR  SG + MTFISL
Sbjct  201  VLCICTTLSSVAFFSIGMGPIAWVYSSEIFPLRLRAQGCSIGVAVNRAMSGAILMTFISL  260

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAISIGG+FFLY  IA + W+FF+TL+P
Sbjct  261  YKAISIGGAFFLYTGIAIIAWIFFYTLLP  289



>ref|NP_188513.1| polyol transporter 5 [Arabidopsis thaliana]
 sp|Q8VZ80.2|PLT5_ARATH RecName: Full=Polyol transporter 5; AltName: Full=Protein POLYOL 
TRANSPORTER 5; Short=AtPLT5; AltName: Full=Sugar-proton 
symporter PLT5 [Arabidopsis thaliana]
 dbj|BAB01812.1| sugar transporter protein [Arabidopsis thaliana]
 gb|AEE76153.1| polyol transporter 5 [Arabidopsis thaliana]
Length=539

 Score =   201 bits (510),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT FILVATF LD+ GRRPLLLTSVGGMV +LA LG SLT+ID S +KV WAV
Sbjct  336  TVAVGVVKTSFILVATFLLDRIGRRPLLLTSVGGMVLSLAALGTSLTIIDQSEKKVMWAV  395

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             +AIA  + YVA FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+S++F+ +
Sbjct  396  VVAIATVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISISFLPM  455

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KA++ GG+F+L+  IA V WVFF+T +P
Sbjct  456  SKAMTTGGAFYLFGGIATVAWVFFYTFLP  484



>ref|XP_009345075.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=538

 Score =   200 bits (509),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH-EKVPWA  534
            T+A+G  KT+FILVATF +D+ GRRPLLLTSV GMV +L  L + LT+ID  H  K+ W 
Sbjct  334  TVAVGLAKTIFILVATFLIDRIGRRPLLLTSVAGMVLSLGSLAVGLTIIDQHHGAKMTWT  393

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
             A+ + M LAY A FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRV SGV+SMTFIS
Sbjct  394  TALCLTMVLAYAAFFSIGLGPITWVYSSEIFPLRLRAQGCSIGVAMNRVVSGVLSMTFIS  453

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAI++GG+FF Y  IA V W+FF+T++P
Sbjct  454  LYKAITMGGAFFFYGGIATVAWLFFYTMLP  483



>ref|XP_008393068.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=538

 Score =   200 bits (509),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWA  534
            T+A+G  KT+FILVA F +D+ GRRPLLLTSV GMV +L  L + LT+ID H   K+ W 
Sbjct  334  TVAVGLAKTIFILVAMFLIDRIGRRPLLLTSVAGMVLSLGSLAVGLTIIDRHQGAKMTWT  393

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
             A+ + M LAY A FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRV SGV+SMTFIS
Sbjct  394  TALCLTMVLAYAAFFSIGLGPITWVYSSEIFPLRLRAQGCSIGVAMNRVVSGVLSMTFIS  453

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAI++GG+FF YA IA V WVFF+T++P
Sbjct  454  LYKAITMGGAFFFYAGIATVAWVFFYTMLP  483



>gb|AGG19155.1| sorbitol transporter [Pyrus pyrifolia]
Length=535

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KTVFILVATF +DK GRRPLLL SV GM+ +L  LG+ LT+ID +H ++ WA 
Sbjct  333  TVAVGFVKTVFILVATFFVDKVGRRPLLLASVAGMILSLIGLGLGLTIIDQNHGRIMWAA  392

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + I M L YVA FSIG GPITWVYSSEIFPLKLRA GCSLG  +NRV SGV+SMTFISL
Sbjct  393  VLCITMVLLYVAFFSIGMGPITWVYSSEIFPLKLRAQGCSLGVAMNRVVSGVLSMTFISL  452

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            Y+AI+IGG+FFLYAAIA V WVFFF ++P
Sbjct  453  YEAITIGGAFFLYAAIATVAWVFFFIMLP  481



>ref|XP_009375627.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=535

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KTVFILVATF +DK GRRPLLL SV GM+ +L  LG+ LT+ID +H ++ WA 
Sbjct  333  TVAVGFVKTVFILVATFFVDKVGRRPLLLASVAGMILSLIGLGLGLTIIDQNHGRIMWAA  392

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + I M L YVA FSIG GPITWVYSSEIFPLKLRA GCSLG  +NRV SGV+SMTFISL
Sbjct  393  VLCITMVLLYVAFFSIGMGPITWVYSSEIFPLKLRAQGCSLGVAMNRVVSGVLSMTFISL  452

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            Y+AI+IGG+FFLYAAIA V WVFFF ++P
Sbjct  453  YEAITIGGAFFLYAAIATVAWVFFFIMLP  481



>ref|XP_009344434.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
Length=491

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWA  534
            T+ +G +KTVF LVATF LD+ GRRPLLLTS+ GMV +L  LG SLT++D H   ++ WA
Sbjct  291  TVGVGLSKTVFTLVATFFLDRVGRRPLLLTSMAGMVVSLVCLGTSLTIVDQHEGARMTWA  350

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            V + +   LA+V  FS G GPI WVYSSEIFPL+LRA GC +G  +NRV SG++SMTFIS
Sbjct  351  VVLCLFCVLAFVGFFSTGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRVMSGILSMTFIS  410

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAI++GG+FFLYAAI AVGW+FFFT++P
Sbjct  411  LYKAITMGGAFFLYAAIGAVGWIFFFTMLP  440



>ref|XP_009375629.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
Length=491

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWA  534
            T+ +G +KTVF LVATF LD+ GRRPLLLTS+ GMV +L  LG SLT++D H   ++ WA
Sbjct  291  TVGVGLSKTVFTLVATFFLDRVGRRPLLLTSMAGMVVSLVCLGTSLTIVDQHEGARMTWA  350

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            V + +   LA+V  FS G GPI WVYSSEIFPL+LRA GC +G  +NRV SG++SMTFIS
Sbjct  351  VVLCLFCVLAFVGFFSTGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRVMSGILSMTFIS  410

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAI++GG+FFLYAAI AVGW+FFFT++P
Sbjct  411  LYKAITMGGAFFLYAAIGAVGWIFFFTMLP  440



>gb|AGG19156.1| sorbitol transporter [Pyrus pyrifolia]
Length=491

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWA  534
            T+ +G +KTVF LVATF LD+ GRRPLLLTS+ GMV +L  LG SLT++D H   ++ WA
Sbjct  291  TVGVGLSKTVFTLVATFFLDRVGRRPLLLTSMAGMVVSLVCLGTSLTIVDQHEGARMTWA  350

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            V + +   LA+V  FS G GPI WVYSSEIFPL+LRA GC +G  +NRV SG++SMTFIS
Sbjct  351  VVLCLFCVLAFVGFFSTGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRVMSGILSMTFIS  410

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAI++GG+FFLYAAI AVGW+FFFT++P
Sbjct  411  LYKAITMGGAFFLYAAIGAVGWIFFFTMLP  440



>ref|XP_008775333.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=528

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-HEKVPWA  534
            T+A+GF KT  ILVATF LD+ GRRPLLL+S GGMV +L +L   L+VI+H  HEK+ WA
Sbjct  333  TVAVGFMKTAAILVATFLLDRVGRRPLLLSSAGGMVISLVILASCLSVIEHHPHEKLTWA  392

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
             AM+IA  L +V +FSIG GPI WVY+SEIFPL+LRA G SLGT  NR+ SGVV+MTFIS
Sbjct  393  AAMSIATVLTFVGSFSIGLGPIAWVYTSEIFPLRLRAQGASLGTATNRILSGVVTMTFIS  452

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAI+I GSFFLY+ IAA GW+FF+  +P
Sbjct  453  LYKAITIAGSFFLYSGIAAAGWLFFYFFLP  482



>dbj|BAM66296.1| sorbitol transporter, partial [Pyrus pyrifolia]
 dbj|BAM66297.1| sorbitol transporter, partial [Pyrus pyrifolia]
Length=454

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT+FILVATF LD+ GRRPLLL SV GM+ +L  LG+ LT+ID +H ++ WA 
Sbjct  284  TVAVGLAKTIFILVATFLLDRVGRRPLLLASVAGMILSLIGLGLGLTIIDQNHGRIMWAA  343

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + I M L YVA FSIG GPITWVYSSEIFPLKLRA GCSLG  +NRV SGV+SMTFISL
Sbjct  344  VLCITMVLLYVAFFSIGMGPITWVYSSEIFPLKLRAQGCSLGVAMNRVVSGVLSMTFISL  403

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            Y+AI+IGG+FFLYAAIA V WVFFF ++P
Sbjct  404  YEAITIGGAFFLYAAIATVAWVFFFIMLP  432



>gb|EYU37769.1| hypothetical protein MIMGU_mgv1a005015mg [Erythranthe guttata]
Length=500

 Score =   196 bits (499),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GFTKTVFILVATF LD+ GRRP++L+S+GGM+ ++  L   LTVID +  K+ WA+
Sbjct  311  TVAVGFTKTVFILVATFLLDRVGRRPMVLSSMGGMIVSIMCLATGLTVIDQADHKIMWAI  370

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+  A  + YVA FSIG GPI WVYSSE FPL+LRA GCS+G  +NR  S ++SMTFI+L
Sbjct  371  ALCTASIMFYVAFFSIGMGPIAWVYSSETFPLRLRAQGCSMGVALNRCISALISMTFITL  430

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YK I+IGG+F+LY AI+ V W+FFFTL+P
Sbjct  431  YKGITIGGAFYLYGAISIVAWLFFFTLLP  459


 Score = 50.4 bits (119),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  265  QTQGKTLEETEALFGTFFRWRSRQREVDAKKANNN  161
            +TQGKTLEE E+LFGTFFRWR+  RE++ +K   N
Sbjct  460  ETQGKTLEEMESLFGTFFRWRTTLRELNERKREKN  494



>ref|XP_009345073.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
Length=491

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWA  534
            T+ +G +KTVF LVATF LD+ GRRPLLLTS+ GMV +L  LG SLT++D H   ++ WA
Sbjct  291  TVGVGLSKTVFTLVATFFLDRVGRRPLLLTSMAGMVGSLVCLGTSLTIVDQHEGVRMTWA  350

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            V + +   LAYV  FSIG GPI WVYSSEIFPL+LRA GC +G  +NR+ SG++SMTFI+
Sbjct  351  VVLCLCCVLAYVGFFSIGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRLMSGILSMTFIT  410

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAI++GG+FFLYAAI  VGW+FFFT++P
Sbjct  411  LYKAITMGGTFFLYAAIGIVGWIFFFTMLP  440



>ref|XP_009785575.1| PREDICTED: polyol transporter 5-like isoform X2 [Nicotiana sylvestris]
Length=336

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 113/149 (76%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TIA+G  KT FILVATF +DK GRR LLL+S GGM+ +L  L   LT+IDHS  K+ WA+
Sbjct  141  TIAVGCMKTFFILVATFLVDKVGRRVLLLSSCGGMILSLLGLATGLTIIDHSDHKLKWAI  200

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + I  TL+ VA FSIG GPI WVYSSEIFPL+LRA GCS+G  +NR  SG + MTFISL
Sbjct  201  VLCICTTLSSVAFFSIGMGPIAWVYSSEIFPLRLRAQGCSIGVAVNRAMSGAILMTFISL  260

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAISIGG+FFLY  IA + W+FF+ L+P
Sbjct  261  YKAISIGGAFFLYTGIAIIAWIFFYALLP  289


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 2/43 (5%)
 Frame = -2

Query  265  QTQGKTLEETEALFGTFFRWRSRQREVDAKK--ANNNSQLQMG  143
            +TQG+TLEE E LFGTFF+WRS  +E+   K  ++ ++Q+QMG
Sbjct  290  ETQGRTLEEMEELFGTFFKWRSTMKELKKNKVESDGSAQVQMG  332



>ref|NP_001281036.1| polyol transporter 5-like [Malus domestica]
 dbj|BAD42344.1| sorbitol transporter [Malus domestica]
Length=491

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWA  534
            T+ +G +KTVF  VATF LD+ GRRPL+LTS+ GMV +L  LG SLT++D H   ++ WA
Sbjct  291  TVGVGLSKTVFTFVATFFLDRVGRRPLVLTSMAGMVASLVCLGTSLTIVDQHEGARMTWA  350

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            V + +   LA+V  FS G GPI WVYSSEIFPL+LRA GC +G  +NRV SGV+SMTFIS
Sbjct  351  VVLCLCCVLAFVGFFSTGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRVMSGVLSMTFIS  410

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAI++GG+FFLYAAI AVGW+FFFT++P
Sbjct  411  LYKAITMGGAFFLYAAIGAVGWIFFFTMLP  440



>ref|XP_008795608.1| PREDICTED: putative polyol transporter 1 [Phoenix dactylifera]
Length=522

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 124/149 (83%), Gaps = 1/149 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-HEKVPWA  534
            T+A+GFTKT+FILVATF LD+ GRRPLLL+S GGM+ +LA LG+ LT++DH  +  +PWA
Sbjct  334  TVAVGFTKTLFILVATFLLDRVGRRPLLLSSTGGMILSLAGLGLGLTIVDHHPNGHLPWA  393

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            + + IA  LAYVA FSIG GPITWVYSSEIFPL+LRA G S G  +NRVTSGV++MTFIS
Sbjct  394  LGLCIASILAYVAFFSIGLGPITWVYSSEIFPLRLRAQGASAGVVVNRVTSGVITMTFIS  453

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLM  267
            LYKAI+IGGSFFLYA +AA  WVFFFT +
Sbjct  454  LYKAITIGGSFFLYAGVAAAAWVFFFTYL  482



>gb|AEX55225.1| sugar transporter [Allium sativum]
Length=522

 Score =   198 bits (503),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 120/150 (80%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWA  534
            T+A+GFTKT+FILVAT  LD+ GRRPLLLT   GM+ +LA LG  LTV+D H +E++ WA
Sbjct  328  TVAVGFTKTIFILVATVLLDRVGRRPLLLTGTAGMILSLASLGFGLTVVDRHPNERLEWA  387

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            + + IA  L YVA FSIG GPITWVY+SE+FPL+LRA G ++G  +NR TSGV++MTFIS
Sbjct  388  IVVCIASILIYVAFFSIGLGPITWVYTSEVFPLRLRAQGAAIGVAVNRTTSGVLTMTFIS  447

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAI+IGG+FFLY  +A + W+FFFT +P
Sbjct  448  LYKAITIGGAFFLYGGVALIAWIFFFTYLP  477



>gb|KJB12318.1| hypothetical protein B456_002G011700 [Gossypium raimondii]
Length=525

 Score =   198 bits (503),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 120/149 (81%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT+FILVATF LDK GRR LLL S GGMV +LA LG SLT+I+HS  K+ WA+
Sbjct  333  TVAVGICKTIFILVATFLLDKSGRRALLLISTGGMVVSLATLGFSLTIINHSEAKLTWAI  392

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ I M L++ A F+IG GPI  +Y+SEIFPLKLRA G SLG  +NRVTSG++SMTF+SL
Sbjct  393  ALCITMVLSFAAFFAIGMGPIAGIYTSEIFPLKLRAQGISLGVAVNRVTSGIISMTFLSL  452

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            Y+AI+IGG+FFL+A IAAVGW+FF   +P
Sbjct  453  YQAITIGGAFFLFAGIAAVGWLFFNICLP  481



>ref|XP_008800420.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=526

 Score =   198 bits (503),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SHEKVPWA  534
            T+A+GF KT  ILVATF LD+ GRRPLLL+S GGMV +L +L  SL+VI+H  HEK+ WA
Sbjct  333  TVAVGFMKTAAILVATFLLDRVGRRPLLLSSAGGMVISLVILASSLSVIEHHPHEKLTWA  392

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
             AM+I+  L +V +FSIG GPI WVY+SEIFPL+LRA G SLGT  NR+ SGV+SMTFIS
Sbjct  393  AAMSISTVLTFVGSFSIGLGPIAWVYTSEIFPLRLRAQGASLGTATNRIVSGVISMTFIS  452

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYK I+I GS+F YA IAA GW+FF+  +P
Sbjct  453  LYKTITIAGSYFFYAGIAAAGWLFFYFFLP  482



>gb|KFK30307.1| hypothetical protein AALP_AA7G244900 [Arabis alpina]
Length=526

 Score =   198 bits (503),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 120/149 (81%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT FILVATFTLD+FGRRPLLLTSVGGMV +LA LG SLT+ID + +KV WAV
Sbjct  336  TVAVGIVKTSFILVATFTLDRFGRRPLLLTSVGGMVLSLAALGTSLTIIDQTEKKVMWAV  395

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++I   + YVA FSIGAGPITWVY+SEIFPL+LR+ G S+G  +NRVTSGV+S+ FI L
Sbjct  396  VLSITTVMTYVATFSIGAGPITWVYTSEIFPLRLRSQGSSMGVVVNRVTSGVISIGFIPL  455

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             + I+ GG+F+L+  +A V W+FF+T +P
Sbjct  456  SEGITTGGAFYLFCGVATVAWIFFYTFLP  484



>emb|CAP58706.1| putative polyol transporter protein 1 [Hevea brasiliensis]
 emb|CAN88842.1| polyols transporter 1 [Hevea brasiliensis]
Length=525

 Score =   198 bits (503),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KTVFILVATF LD+ GRRPLLL+SVGGM+ +LA LG +LT+IDHSHEK+ WA+
Sbjct  335  TVAVGFVKTVFILVATFLLDRIGRRPLLLSSVGGMIFSLATLGFALTIIDHSHEKLTWAI  394

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ IAM LA VA FSIG GPI WVY++EI PL+LRA G S+G  +NRVTSGV+S TFISL
Sbjct  395  ALCIAMVLANVAFFSIGLGPIAWVYTTEIIPLRLRAQGASMGAAVNRVTSGVISTTFISL  454

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YK I+IGG+FFL+AAIAAV W FFFT +P
Sbjct  455  YKGITIGGAFFLFAAIAAVAWSFFFTCLP  483



>ref|NP_001049270.1| Os03g0197200 [Oryza sativa Japonica Group]
 dbj|BAF11184.1| Os03g0197200, partial [Oryza sativa Japonica Group]
Length=295

 Score =   192 bits (487),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWA-  534
            ++A+G +KT+FILVATF LD+ GRRPLLLTS GGMV +L  L  +L +I+H  E    A 
Sbjct  103  SVAVGASKTLFILVATFLLDRVGRRPLLLTSAGGMVISLVTLASALHMIEHRPEGQATAL  162

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            V ++IAM L +VA+FSIG GPI WVYSSEIFPL+LRA GC+LGT +NRV SG VSM+FIS
Sbjct  163  VGLSIAMVLVFVASFSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRVVSGAVSMSFIS  222

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAI+  GSF+LYA IAA GWVF F  +P
Sbjct  223  LYKAITFAGSFYLYAGIAAAGWVFMFFFLP  252



>emb|CDY61985.1| BnaC03g73840D [Brassica napus]
Length=530

 Score =   197 bits (502),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT FILVATF LD+ GRRPLLLTSVGGMV +LA+LG SLTVI+ S +KV WAV
Sbjct  342  TVAVGVVKTSFILVATFLLDRVGRRPLLLTSVGGMVLSLAVLGTSLTVINQSDKKVMWAV  401

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++IA  + YVA FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+SMTF+ +
Sbjct  402  VLSIATVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISMTFLPM  461

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLM  267
             K ++ GG+F+L+  IA V WVFF+T +
Sbjct  462  SKGMTTGGAFYLFGGIATVAWVFFYTFL  489



>ref|XP_006577924.1| PREDICTED: polyol transporter 5-like [Glycine max]
Length=509

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KTVFILVATF LD+ GRRPLLLTSVGGMV +L  LG+SLTVIDHS   + WA+
Sbjct  326  TVAVGFAKTVFILVATFLLDRVGRRPLLLTSVGGMVFSLLTLGLSLTVIDHSRAVLKWAI  385

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++I M L+YV+ FS+GAGPITWVYSSEIFPL+LRA G ++G  +NRVTSGV+SMTF+SL
Sbjct  386  GLSIGMVLSYVSTFSVGAGPITWVYSSEIFPLRLRAQGAAMGVVVNRVTSGVISMTFLSL  445

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
               I+IGG+FFL+  IA  GW+FF+T++P
Sbjct  446  SNKITIGGAFFLFGGIAMCGWIFFYTMLP  474



>ref|XP_009602627.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=531

 Score =   195 bits (496),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TIA+G  KT FIL+ATF +DK GRR LLL+S GGM+ +L  L   LT+IDHS  K+ WA+
Sbjct  336  TIAVGCMKTFFILIATFLVDKVGRRVLLLSSCGGMILSLLGLATGLTIIDHSDHKLKWAI  395

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + I  TL+ VA FSIG GPI WVYSSEIFPL+LRA GCS+G  +NR  SG + MTFISL
Sbjct  396  VLCICTTLSSVAFFSIGMGPIAWVYSSEIFPLRLRAQGCSIGVAVNRAMSGAILMTFISL  455

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAISIGG+FFLY  IA + W+FF+TL+P
Sbjct  456  YKAISIGGAFFLYTGIAVIAWIFFYTLLP  484


 Score = 48.5 bits (114),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 32/42 (76%), Gaps = 2/42 (5%)
 Frame = -2

Query  265  QTQGKTLEETEALFGTFFRWRSRQREVDAKK--ANNNSQLQM  146
            +TQG+TLEE E LFGTFF+WRS  +E+   K  ++ ++Q+QM
Sbjct  485  ETQGRTLEEMEELFGTFFKWRSTMKELKKNKVESDGSAQVQM  526



>emb|CDX95491.1| BnaC01g33830D [Brassica napus]
Length=531

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 120/149 (81%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT FILVATF +D+ GRRPLLLTSVGGM+ +LA LG SLT+IDH+ +KV WA+
Sbjct  336  TVAVGVVKTSFILVATFLIDRVGRRPLLLTSVGGMILSLAALGTSLTIIDHTEKKVTWAL  395

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++I   + YVA FSIGAGPITWVY+SEIFPL+LR+ G S+   +NRVTSGV+SMTF+ L
Sbjct  396  VLSITTVMTYVATFSIGAGPITWVYTSEIFPLRLRSQGSSMAVVVNRVTSGVISMTFLLL  455

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KA++ GG+F+L+  IA V WVFF+T +P
Sbjct  456  SKAMTTGGAFYLFGGIATVAWVFFYTFLP  484



>ref|XP_008447049.1| PREDICTED: polyol transporter 5 [Cucumis melo]
Length=516

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWA  534
            T+A+GF+KTVFILVATF LD+ GRRPLLLTSV G + +L  LG  LTVI  + E K+ WA
Sbjct  323  TVAVGFSKTVFILVATFLLDRVGRRPLLLTSVAGKMVSLVTLGFGLTVIQQNEEVKLRWA  382

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            V + IAM L  VA FSIG GPI WVYSSEIFPLKLRA G S+G  +NRVTSGV++MTF+S
Sbjct  383  VGLCIAMVLCDVAFFSIGMGPIAWVYSSEIFPLKLRAQGASVGVIVNRVTSGVITMTFLS  442

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L KAI+IGG+FFLYA IAA+ W+FF+ + P
Sbjct  443  LTKAITIGGAFFLYAGIAAISWLFFYVVFP  472



>gb|AAO88964.1| sorbitol transporter [Malus domestica]
Length=491

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWA  534
            T+ +G +KTVF LVATF LD+ GRRPLLLTS+ GMV  L  LG SLT++D H   ++ WA
Sbjct  291  TVGVGLSKTVFTLVATFFLDRVGRRPLLLTSMAGMVGALVCLGTSLTIVDQHEGVRMTWA  350

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            V + +   LAYV  FS G GPI WVYSSEIFPL+LRA GC +G  +NR+ SG++SMTFIS
Sbjct  351  VILCLCCVLAYVGFFSSGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRLMSGILSMTFIS  410

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAI++GG+FFLYAAI  VGW+FFFT++P
Sbjct  411  LYKAITMGGTFFLYAAIGTVGWIFFFTMLP  440



>ref|XP_010690917.1| PREDICTED: polyol transporter 5 isoform X2 [Beta vulgaris subsp. 
vulgaris]
 gb|AAB68029.1| putative sugar transporter; member of major facilitative superfamily; 
integral membrane protein [Beta vulgaris]
Length=545

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT+FILVATF LDK+GRRPLLLTSVGGM+  +  L MSLTVIDHSH K+ WA+
Sbjct  338  TVAVGVVKTLFILVATFQLDKYGRRPLLLTSVGGMIIAILTLAMSLTVIDHSHHKITWAI  397

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ I M  A VA+FSIG GPITWVYSSE+FPL+LRA G S+G  +NRV SGV+S+ F+ L
Sbjct  398  ALCITMVCAVVASFSIGLGPITWVYSSEVFPLRLRAQGTSMGVAVNRVVSGVISIFFLPL  457

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
               I+ GG+FFL+  IA + W FF T +P
Sbjct  458  SHKITTGGAFFLFGGIAIIAWFFFLTFLP  486



>ref|XP_010690916.1| PREDICTED: polyol transporter 5 isoform X1 [Beta vulgaris subsp. 
vulgaris]
 gb|AAB68028.1| putative sugar transporter; member of major facilitative superfamily; 
integral membrane protein [Beta vulgaris]
Length=549

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT+FILVATF LDK+GRRPLLLTSVGGM+  +  L MSLTVIDHSH K+ WA+
Sbjct  338  TVAVGVVKTLFILVATFQLDKYGRRPLLLTSVGGMIIAILTLAMSLTVIDHSHHKITWAI  397

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ I M  A VA+FSIG GPITWVYSSE+FPL+LRA G S+G  +NRV SGV+S+ F+ L
Sbjct  398  ALCITMVCAVVASFSIGLGPITWVYSSEVFPLRLRAQGTSMGVAVNRVVSGVISIFFLPL  457

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
               I+ GG+FFL+  IA + W FF T +P
Sbjct  458  SHKITTGGAFFLFGGIAIIAWFFFLTFLP  486



>dbj|BAJ85302.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=546

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWA  534
            T+A+G TKTVFILVATF LD+ GRRPLLLTS GGM+ +L  L   LTV+  H  EK+ WA
Sbjct  354  TVAVGATKTVFILVATFLLDRIGRRPLLLTSTGGMIVSLVGLATGLTVVSRHPDEKITWA  413

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            + + I   +AYVA FSIG GPITWVYSSEIFPL +RA GCSLG  +NR+TSGV+SMTFIS
Sbjct  414  IVLCIFCIMAYVAFFSIGLGPITWVYSSEIFPLHVRALGCSLGVAVNRLTSGVISMTFIS  473

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L KA++IGG+FFL+A IA+  WVFFF  +P
Sbjct  474  LSKAMTIGGAFFLFAGIASFAWVFFFAYLP  503



>gb|KJB12316.1| hypothetical protein B456_002G011500 [Gossypium raimondii]
Length=533

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 120/149 (81%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF+KT FILVATF LDK GRRPLLL S GGMV  LA LG+SLTVI HS +K  WAV
Sbjct  336  TMAVGFSKTTFILVATFLLDKIGRRPLLLISSGGMVVILATLGLSLTVIGHSDKKQTWAV  395

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + I M L+ VA FSIG GPITWVYS+EIFPL+LRA G SLG  +NRV SGV+SM+FISL
Sbjct  396  GLCITMVLSSVAVFSIGMGPITWVYSTEIFPLRLRAQGASLGVAVNRVMSGVISMSFISL  455

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYA +A V + FFFT +P
Sbjct  456  YKAITIGGAFFLYAGVALVAFFFFFTFLP  484



>ref|NP_001287655.1| polyol transporter 5-like [Solanum lycopersicum]
 dbj|BAO96229.1| polyol/monosaccharide transporter 4 [Solanum lycopersicum]
Length=541

 Score =   190 bits (482),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT+FILVATF LD+ GRR LLLTSVGGMV +L LL   LT+I+HS +K+ WA+
Sbjct  326  TVAVGVVKTLFILVATFMLDRSGRRRLLLTSVGGMVASLVLLATGLTIIEHSEQKLIWAI  385

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ IAM LAYVA FSIG GPITWVYSSEIFPL+LRATGCS+G  +NRVTSGVVSMTF+SL
Sbjct  386  ALCIAMVLAYVALFSIGMGPITWVYSSEIFPLRLRATGCSIGVAVNRVTSGVVSMTFLSL  445

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KAI+IG +FFLYAA+AAV  VFF+TLMP
Sbjct  446  EKAITIGAAFFLYAALAAVALVFFYTLMP  474


 Score = 53.1 bits (126),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 5/47 (11%)
 Frame = -2

Query  265  QTQGKTLEETEALFGTFFRWRSRQREV-----DAKKANNNSQLQMGT  140
            +TQGKTLEE E LFGTF+ WR+R RE+       K +N+N  + MGT
Sbjct  475  ETQGKTLEEMETLFGTFWNWRARARELKELKKTEKNSNDNGHIPMGT  521



>ref|XP_008795662.1| PREDICTED: probable polyol transporter 6 [Phoenix dactylifera]
Length=480

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+ +G TKT FIL+ATF LD+ GRRPLLLTS+GGM+ +L+ LG+ LT+++H+ E++ WA+
Sbjct  291  TMGVGLTKTFFILIATFLLDRVGRRPLLLTSLGGMIVSLSGLGLGLTMVEHTEERLVWAI  350

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            +++I     +VA+FSIG GPITWVYSSEIFPLKLRA G S+G  +NRV +G +SMTFISL
Sbjct  351  SLSILTVFFFVASFSIGLGPITWVYSSEIFPLKLRAQGASIGVAVNRVMNGTISMTFISL  410

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FF++A I+ + W+FFF L P
Sbjct  411  YKAITIGGAFFMFAGISILAWMFFFFLCP  439



>ref|XP_010905472.1| PREDICTED: polyol transporter 5-like [Elaeis guineensis]
Length=525

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-HEKVPWA  534
            T+A+GF KT  ILVATF +D+ GRRPLLL S GGMV +L +L  +L +I H  HEK+ WA
Sbjct  330  TVAVGFMKTASILVATFLVDRVGRRPLLLCSAGGMVISLVILASNLCIIQHHPHEKLTWA  389

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
             A++I+  L +V +FSIG GPI WVY+SEIFPL+LRA G SLGT  NRV SGV++MTFIS
Sbjct  390  AAISISTVLTFVGSFSIGLGPIAWVYTSEIFPLRLRAQGVSLGTATNRVMSGVITMTFIS  449

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAI+I GSFFLYA IAAVGW+FF+  +P
Sbjct  450  LYKAITIAGSFFLYAGIAAVGWLFFYFFLP  479



>gb|EMT15230.1| Polyol transporter 5 [Aegilops tauschii]
Length=524

 Score =   195 bits (496),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWA  534
            T+A+G TKTVFILVATF LD+ GRRPLLL+S GGM+ +L  L   LTVI  H  EK+ WA
Sbjct  332  TVAVGATKTVFILVATFLLDRIGRRPLLLSSTGGMIVSLVGLATGLTVISRHPDEKITWA  391

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            + + I   +AYVA FSIG GPITWVYSSEIFPL +RA GCSLG  +NR+TSGV+SMTFIS
Sbjct  392  IVLCIFCIMAYVAFFSIGLGPITWVYSSEIFPLHVRALGCSLGVAVNRLTSGVISMTFIS  451

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L KA++IGG+FFL+A IA+  WVFFF  +P
Sbjct  452  LSKAMTIGGAFFLFAGIASFAWVFFFAYLP  481



>ref|XP_009112300.1| PREDICTED: polyol transporter 5 [Brassica rapa]
 emb|CDY18552.1| BnaA01g26430D [Brassica napus]
Length=529

 Score =   195 bits (496),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 120/149 (81%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT FILVATF +D+ GRRPLLLTSVGGM+ +LA LG SLT+IDH+ +KV WA+
Sbjct  336  TVAVGIVKTSFILVATFLIDRVGRRPLLLTSVGGMILSLAALGTSLTIIDHTEKKVTWAL  395

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++I   + YVA FSIGAGPITWVY+SEIFPL+LR+ G S+   +NRVTSGV+SMTF+ L
Sbjct  396  VLSITTVMTYVATFSIGAGPITWVYTSEIFPLRLRSQGSSMAVVVNRVTSGVISMTFLLL  455

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             +A++ GG+F+L+  IA V WVFF+T +P
Sbjct  456  SEAMTTGGAFYLFGGIATVAWVFFYTFLP  484



>ref|XP_007131852.1| hypothetical protein PHAVU_011G046800g [Phaseolus vulgaris]
 gb|ESW03846.1| hypothetical protein PHAVU_011G046800g [Phaseolus vulgaris]
Length=519

 Score =   195 bits (496),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+ +GF KT+FILVATF LD+ GRRPLLL+S GGM+ +L  L +SLTVI  S +K  W +
Sbjct  325  TVGVGFVKTMFILVATFMLDRLGRRPLLLSSFGGMLLSLLTLAVSLTVIHESKKKPIWVI  384

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             +++ M L+YVA+FSIGAGP+TWVYSSEIFPL+LRA G ++G  +NR TSGV+S+TF+SL
Sbjct  385  GLSMVMVLSYVASFSIGAGPVTWVYSSEIFPLRLRAQGMAVGVVVNRTTSGVLSITFLSL  444

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KAI+IGG+FFLY+AIAA GW+F +T++P
Sbjct  445  SKAITIGGAFFLYSAIAAFGWLFIYTVLP  473



>ref|NP_001168177.1| uncharacterized protein LOC100381931 [Zea mays]
 gb|ACN27335.1| unknown [Zea mays]
 tpg|DAA63326.1| TPA: hypothetical protein ZEAMMB73_286001 [Zea mays]
Length=510

 Score =   195 bits (495),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 121/150 (81%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWA  534
            T A+G TKT+FILVATF LD+ GRRPLLLTS GGMV +L  LG +LTV+ H  + K+P  
Sbjct  322  TCAVGVTKTLFILVATFLLDRVGRRPLLLTSTGGMVISLISLGTALTVVGHHPDAKIPSV  381

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            VA+ IA TLA+VA FSIG GPIT VY+SEIFPL+LRA G ++G   NRVTS V+SMTF+S
Sbjct  382  VALCIASTLAFVAFFSIGLGPITGVYNSEIFPLQLRALGFAVGVACNRVTSAVISMTFLS  441

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L KAI+IGGSFFLY+ IAAVGWVFFFT +P
Sbjct  442  LSKAITIGGSFFLYSGIAAVGWVFFFTCLP  471



>gb|AAT06053.2| sorbitol transporter [Malus domestica]
Length=533

 Score =   195 bits (496),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWA  534
            T+ +G +KTVF LVATF LD+ GRRPLLLTS+ GMV  L  LG SLT++D H   ++ WA
Sbjct  333  TVGVGLSKTVFTLVATFFLDRVGRRPLLLTSMAGMVGALVCLGTSLTMVDQHEGVRMTWA  392

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            V + +   LAYV  FS G GPI WVYSSEIFPL+LRA GC +G  +NR+ SG++SMTFIS
Sbjct  393  VILCLCCVLAYVGFFSSGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRLMSGILSMTFIS  452

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAI++GG+FFLYAAI  VGW+FFFT++P
Sbjct  453  LYKAITMGGTFFLYAAIGTVGWIFFFTMLP  482



>gb|EMS55536.1| Polyol transporter 5 [Triticum urartu]
Length=515

 Score =   194 bits (494),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWA  534
            T+A+G TKTVFILVATF LD+ GRRPLLL+S GGM+ +L  L   LTVI  H  EK+ WA
Sbjct  323  TVAVGATKTVFILVATFLLDRIGRRPLLLSSTGGMIVSLVGLATGLTVISRHPDEKITWA  382

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            + + I   +AYVA FSIG GP+TWVYSSEIFPL +RA GCSLG  +NR+TSGV+SMTFIS
Sbjct  383  IVLCIFCIMAYVAFFSIGLGPVTWVYSSEIFPLHVRALGCSLGVAVNRLTSGVISMTFIS  442

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L KA++IGG+FFL+A IA+  WVFFF  +P
Sbjct  443  LSKAMTIGGAFFLFAGIASFAWVFFFAYLP  472



>ref|XP_009344431.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
 ref|XP_009344432.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=535

 Score =   195 bits (495),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KTVFILVATF +DK GRRPLLL SV GM+ +L  LG+ LT+I  ++ ++ WA 
Sbjct  333  TVAVGFVKTVFILVATFFVDKVGRRPLLLASVAGMILSLIGLGLGLTIIGQNNGRIMWAA  392

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + I M L YVA FSIG GPITWVYSSEIFPLKLRA GCS+G  +NRV SGV+SMTFISL
Sbjct  393  VLCITMVLLYVAFFSIGMGPITWVYSSEIFPLKLRAQGCSMGVAMNRVVSGVLSMTFISL  452

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FFLYAAIA+V WVFFF ++P
Sbjct  453  YKAITIGGAFFLYAAIASVAWVFFFIMLP  481



>ref|XP_003607077.1| Sorbitol-like transporter [Medicago truncatula]
 gb|AES89274.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=520

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT+F+LVATF LD+ GRR LLLTSVGG++ +L  L +SLT+ID+S   + WA+
Sbjct  325  TVAVGFVKTMFVLVATFLLDRVGRRVLLLTSVGGLIISLLTLAISLTIIDNSSATLTWAI  384

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            +++IA  L+Y A FSIG+GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+SMTF+SL
Sbjct  385  SLSIAAVLSYAATFSIGSGPITWVYSSEIFPLRLRAQGVSIGAVVNRVTSGVISMTFLSL  444

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
              AI+IGG+FFL+A IA V W+F +T++P
Sbjct  445  SNAITIGGAFFLFAGIAIVAWIFHYTMLP  473



>ref|XP_008795604.1| PREDICTED: putative polyol transporter 1 [Phoenix dactylifera]
Length=522

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 124/149 (83%), Gaps = 1/149 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWA  534
            T+A+GFTKT+FILVATF LD+ GRRPLLL+S GGM+ +LA LG+ LTV+D H   ++PWA
Sbjct  334  TVAVGFTKTLFILVATFQLDRVGRRPLLLSSTGGMIVSLAGLGLGLTVVDRHPDGQLPWA  393

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            V + IA  LAYVA FSIG GPIT VY SEIFPL+LRA G S+G  +NRVTSGV++MTFIS
Sbjct  394  VGLCIASILAYVAFFSIGLGPITSVYCSEIFPLRLRAQGVSVGVVVNRVTSGVITMTFIS  453

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLM  267
            LYKAI+IGGSFFLYA IAAV WVFFFT +
Sbjct  454  LYKAITIGGSFFLYAGIAAVAWVFFFTYL  482



>gb|KJB12315.1| hypothetical protein B456_002G011400 [Gossypium raimondii]
Length=536

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TIAIG +KT+FILVATF LDK GRRPLLL S GGMV  LA LG SLT+I HS  K+ WAV
Sbjct  336  TIAIGLSKTIFILVATFLLDKIGRRPLLLISSGGMVVILATLGFSLTIIGHSDNKITWAV  395

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + I M L+ VA FSIG GPI WVYS+EIFPL+LRA G S+G  +NRVTSGV+SM+FISL
Sbjct  396  GLCITMVLSSVAVFSIGMGPIAWVYSTEIFPLRLRAQGASIGVAVNRVTSGVISMSFISL  455

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            Y+AI+IGG+FFLYA +A V + FFFT +P
Sbjct  456  YEAITIGGAFFLYAGVALVAFFFFFTFLP  484



>ref|XP_011078884.1| PREDICTED: polyol transporter 5-like isoform X2 [Sesamum indicum]
Length=524

 Score =   191 bits (484),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SHEKVPWA  534
            TIA+G +KT+FILVATF +DK GRR LLLTS GG+  +L  L   LT+IDH   +K+ WA
Sbjct  337  TIAVGVSKTMFILVATFLVDKVGRRVLLLTSCGGLAASLFGLATGLTLIDHYDDQKLTWA  396

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            V + +A +LA VA FSIG GPI WVYSSEIFPL+LRA GCS+G   NR TSGVV MTFIS
Sbjct  397  VVLCVATSLACVAFFSIGMGPIAWVYSSEIFPLRLRAQGCSMGVAANRFTSGVVLMTFIS  456

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAI+IGG+FFL+  +A + W+FF+TL+P
Sbjct  457  LYKAITIGGAFFLFTGVAVIAWIFFYTLLP  486


 Score = 49.7 bits (117),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  265  QTQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  158
            +TQG+ LEE EALFG+FFRWRS  RE+  KK   +S
Sbjct  487  ETQGRNLEEIEALFGSFFRWRSTMRELKRKKLEQDS  522



>ref|XP_004148312.1| PREDICTED: polyol transporter 5-like [Cucumis sativus]
Length=492

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWA  534
            T+A+GF+KTVFILVATF LD+ GRRPLLLTSV G + +L  LG+ LTVI+ H   K+ WA
Sbjct  299  TVAVGFSKTVFILVATFLLDRVGRRPLLLTSVAGKMVSLVTLGLGLTVIEQHEDVKLTWA  358

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            V + IAM L  VA FSIG GPI WVYSSEIFPLKLRA G S+G  +NRVTSGV++MTF+S
Sbjct  359  VGLCIAMVLCDVAFFSIGMGPIAWVYSSEIFPLKLRAQGASVGVIVNRVTSGVITMTFLS  418

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L KAI+IGG+FFLYA IAA+  VFF+ + P
Sbjct  419  LTKAITIGGAFFLYAGIAAISLVFFYVVFP  448



>ref|XP_011088360.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=522

 Score =   188 bits (478),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF K +FILVATFTLDK GRRPL+LTS+GG    L +L   LT I +S  ++ WA+
Sbjct  326  TMAVGFVKLMFILVATFTLDKIGRRPLILTSIGGCCVCLLVLATGLTFIQNSDHRLVWAI  385

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ +   L +VA F +G GPITWVYSSEIFPL+LRA GC+L    NRVTS +++MTFISL
Sbjct  386  ALCLVAILCFVAIFGMGMGPITWVYSSEIFPLRLRAQGCALAIASNRVTSALLTMTFISL  445

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI++ G+FFLYA  AAV WVFF+TL P
Sbjct  446  YKAITLAGAFFLYAGFAAVAWVFFYTLYP  474


 Score = 51.6 bits (122),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -2

Query  265  QTQGKTLEETEALFGTFFRWRSRQREVDAKKANNNSQLQMG  143
            +T+GKTLEE  +LFGTFF+WRS  R ++ KK + N  +Q G
Sbjct  475  ETKGKTLEEMGSLFGTFFKWRSTVRALEEKKGDYNGHVQTG  515



>ref|XP_011078883.1| PREDICTED: polyol transporter 5-like isoform X1 [Sesamum indicum]
Length=526

 Score =   190 bits (483),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SHEKVPWA  534
            TIA+G +KT+FILVATF +DK GRR LLLTS GG+  +L  L   LT+IDH   +K+ WA
Sbjct  339  TIAVGVSKTMFILVATFLVDKVGRRVLLLTSCGGLAASLFGLATGLTLIDHYDDQKLTWA  398

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            V + +A +LA VA FSIG GPI WVYSSEIFPL+LRA GCS+G   NR TSGVV MTFIS
Sbjct  399  VVLCVATSLACVAFFSIGMGPIAWVYSSEIFPLRLRAQGCSMGVAANRFTSGVVLMTFIS  458

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAI+IGG+FFL+  +A + W+FF+TL+P
Sbjct  459  LYKAITIGGAFFLFTGVAVIAWIFFYTLLP  488


 Score = 49.7 bits (117),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  265  QTQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  158
            +TQG+ LEE EALFG+FFRWRS  RE+  KK   +S
Sbjct  489  ETQGRNLEEIEALFGSFFRWRSTMRELKRKKLEQDS  524



>ref|XP_009407903.1| PREDICTED: polyol transporter 5-like [Musa acuminata subsp. malaccensis]
Length=507

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 115/150 (77%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH-EKVPWA  534
            T+A+GFTKT FILVATF LD+ GRRPLLL+S  GM+ +L  L   L  IDH   EK+ WA
Sbjct  312  TVAVGFTKTSFILVATFLLDRVGRRPLLLSSAAGMIASLITLASVLLTIDHHPGEKLTWA  371

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            VA+ IA  L +V +FSIG GPI WVYSSEIFPL+LRA G SLG  +NR+ SG V+M+F+S
Sbjct  372  VALCIATVLTFVGSFSIGLGPIAWVYSSEIFPLRLRAQGASLGASMNRLMSGAVTMSFLS  431

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAISI GSF+LYA IAA GWVFF+  +P
Sbjct  432  LYKAISISGSFYLYAGIAAAGWVFFYVFLP  461



>ref|XP_004171995.1| PREDICTED: LOW QUALITY PROTEIN: polyol transporter 5-like [Cucumis 
sativus]
Length=516

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWA  534
            T+A+GF+KTVFILVATF LD+ GRRPLLLTSV G + +L  LG+ LTVI+ H   K+ WA
Sbjct  323  TVAVGFSKTVFILVATFLLDRVGRRPLLLTSVAGKMVSLVTLGLGLTVIEQHEDVKLTWA  382

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            V + IAM L  VA FSIG GPI WVYSSEIFPLKLRA G S+G  +NRVTSGV++MTF+S
Sbjct  383  VGLCIAMVLCDVAFFSIGMGPIAWVYSSEIFPLKLRAQGASVGVIVNRVTSGVITMTFLS  442

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L KAI+IGG+FFLYA IAA+  VFF+ + P
Sbjct  443  LTKAITIGGAFFLYAGIAAISLVFFYVVFP  472



>gb|KGN44323.1| Sugar transporter [Cucumis sativus]
Length=516

 Score =   192 bits (489),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWA  534
            T+A+GF+KTVFILVATF LD+ GRRPLLLTSV G + +L  LG+ LTVI+ H   K+ WA
Sbjct  323  TVAVGFSKTVFILVATFLLDRVGRRPLLLTSVAGKMVSLVTLGLGLTVIEQHEDVKLTWA  382

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            V + IAM L  VA FSIG GPI WVYSSEIFPLKLRA G S+G  +NRVTSGV++MTF+S
Sbjct  383  VGLCIAMVLCDVAFFSIGMGPIAWVYSSEIFPLKLRAQGASVGVIVNRVTSGVITMTFLS  442

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L KAI+IGG+FFLYA IAA+  VFF+ + P
Sbjct  443  LTKAITIGGAFFLYAGIAAISLVFFYVVFP  472



>ref|XP_008795607.1| PREDICTED: polyol transporter 5-like isoform X2 [Phoenix dactylifera]
Length=487

 Score =   192 bits (487),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 123/149 (83%), Gaps = 1/149 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWA  534
            T+A+GFTKT+FILVATF LD+ GRRPLLL+S GGM+ +LA LG+ LTV+D H   ++PWA
Sbjct  299  TVAVGFTKTLFILVATFLLDRVGRRPLLLSSTGGMIVSLAGLGLGLTVVDRHPDGQLPWA  358

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            V   IA  LAYVA FSIG GPIT VY SEIFPL+LRA G S+G  +NRVTSGV++MTFIS
Sbjct  359  VGFCIASILAYVAFFSIGLGPITSVYCSEIFPLRLRAQGVSVGVVVNRVTSGVITMTFIS  418

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLM  267
            LYKAI+IGGSFFLYA IAAV WVFFFT +
Sbjct  419  LYKAITIGGSFFLYAGIAAVAWVFFFTYL  447



>ref|XP_002460924.1| hypothetical protein SORBIDRAFT_02g037580 [Sorghum bicolor]
 gb|EER97445.1| hypothetical protein SORBIDRAFT_02g037580 [Sorghum bicolor]
Length=510

 Score =   192 bits (488),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWA  534
            T A+G +KT+FILVATF LD+ GRRPLLLTS GGM+  L  LG  LTV+ H  + K+P A
Sbjct  322  TCAVGVSKTLFILVATFLLDRVGRRPLLLTSAGGMIVALIGLGTGLTVVGHHPDAKIPSA  381

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            VA+ IA TLAYVA FSIG GPIT VY+SEIFPL++RA G ++G   NRVTS V+SMTF+S
Sbjct  382  VALCIASTLAYVAFFSIGLGPITGVYNSEIFPLQVRALGFAVGMACNRVTSAVISMTFLS  441

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L K I+IGGSFFLY+ IAAVGWVFFFT +P
Sbjct  442  LSKGITIGGSFFLYSGIAAVGWVFFFTCLP  471



>ref|XP_008795606.1| PREDICTED: polyol transporter 5-like isoform X1 [Phoenix dactylifera]
Length=522

 Score =   192 bits (488),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 123/149 (83%), Gaps = 1/149 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWA  534
            T+A+GFTKT+FILVATF LD+ GRRPLLL+S GGM+ +LA LG+ LTV+D H   ++PWA
Sbjct  334  TVAVGFTKTLFILVATFLLDRVGRRPLLLSSTGGMIVSLAGLGLGLTVVDRHPDGQLPWA  393

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            V   IA  LAYVA FSIG GPIT VY SEIFPL+LRA G S+G  +NRVTSGV++MTFIS
Sbjct  394  VGFCIASILAYVAFFSIGLGPITSVYCSEIFPLRLRAQGVSVGVVVNRVTSGVITMTFIS  453

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLM  267
            LYKAI+IGGSFFLYA IAAV WVFFFT +
Sbjct  454  LYKAITIGGSFFLYAGIAAVAWVFFFTYL  482



>ref|NP_001141158.1| hypothetical protein [Zea mays]
 gb|ACF85577.1| unknown [Zea mays]
 tpg|DAA41235.1| TPA: hypothetical protein ZEAMMB73_633247 [Zea mays]
Length=473

 Score =   191 bits (485),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWA  534
            T A+G  KT+FILVATF LD+ GRRPLLLTS GGM+ +L  LG  LTV+ H  + K+P A
Sbjct  281  TCAVGVAKTLFILVATFLLDRAGRRPLLLTSTGGMIVSLVGLGTGLTVVGHHPDAKIPSA  340

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            VA+ IA TLAYVA FSIG GP+T VY+SEIFPL++RA G ++G   NRVTS V+SMTF+S
Sbjct  341  VALCIASTLAYVAFFSIGLGPVTGVYNSEIFPLQVRALGFAVGVACNRVTSAVISMTFLS  400

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L K I+IGGSFFLY+ IAAVGWVFFFT +P
Sbjct  401  LSKGITIGGSFFLYSGIAAVGWVFFFTCLP  430



>ref|XP_010908358.1| PREDICTED: probable polyol transporter 6 [Elaeis guineensis]
Length=535

 Score =   192 bits (488),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+++G TKT FIL+ATF LD+ GRRPLLLTS+GGMV +L+ LG+ LT+++H+ E++ WAV
Sbjct  279  TMSVGLTKTCFILIATFLLDRVGRRPLLLTSLGGMVVSLSGLGLGLTMVEHTEERLVWAV  338

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++I   L++VA +S+G GPITWVYSSEIFPL+LRA G S+G  +NRV +G +SMTFISL
Sbjct  339  TLSILAVLSFVAFYSVGLGPITWVYSSEIFPLRLRAQGASMGVAVNRVMNGTISMTFISL  398

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            Y AI+IGG+FF++  I+ + W+FFF L P
Sbjct  399  YNAITIGGAFFMFGGISILAWLFFFFLCP  427



>gb|EAY88906.1| hypothetical protein OsI_10385 [Oryza sativa Indica Group]
Length=521

 Score =   192 bits (487),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWA-  534
            ++A+G +KT+FILVATF LD+ GRRPLLLTS GGMV +L  L  +L +I+H  E    A 
Sbjct  329  SVAVGASKTLFILVATFLLDRVGRRPLLLTSAGGMVISLVTLASALHMIEHRSEGQATAL  388

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            V ++IAM L +VA+FSIG GPI WVYSSEIFPL+LRA GC+LGT +NRV SG VSM+FIS
Sbjct  389  VGLSIAMVLVFVASFSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRVVSGAVSMSFIS  448

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAI+  GSF+LYA IAA GWVF F  +P
Sbjct  449  LYKAITFAGSFYLYAGIAAAGWVFMFFFLP  478



>ref|XP_008667512.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA41234.1| TPA: hypothetical protein ZEAMMB73_633247 [Zea mays]
Length=516

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWA  534
            T A+G  KT+FILVATF LD+ GRRPLLLTS GGM+ +L  LG  LTV+ H  + K+P A
Sbjct  324  TCAVGVAKTLFILVATFLLDRAGRRPLLLTSTGGMIVSLVGLGTGLTVVGHHPDAKIPSA  383

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            VA+ IA TLAYVA FSIG GP+T VY+SEIFPL++RA G ++G   NRVTS V+SMTF+S
Sbjct  384  VALCIASTLAYVAFFSIGLGPVTGVYNSEIFPLQVRALGFAVGVACNRVTSAVISMTFLS  443

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L K I+IGGSFFLY+ IAAVGWVFFFT +P
Sbjct  444  LSKGITIGGSFFLYSGIAAVGWVFFFTCLP  473



>gb|EEE58504.1| hypothetical protein OsJ_09775 [Oryza sativa Japonica Group]
Length=521

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWA-  534
            ++A+G +KT+FILVATF LD+ GRRPLLLTS GGMV +L  L  +L +I+H  E    A 
Sbjct  329  SVAVGASKTLFILVATFLLDRVGRRPLLLTSAGGMVISLVTLASALHMIEHRPEGQATAL  388

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            V ++IAM L +VA+FSIG GPI WVYSSEIFPL+LRA GC+LGT +NRV SG VSM+FIS
Sbjct  389  VGLSIAMVLVFVASFSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRVVSGAVSMSFIS  448

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAI+  GSF+LYA IAA GWVF F  +P
Sbjct  449  LYKAITFAGSFYLYAGIAAAGWVFMFFFLP  478



>gb|EYU20732.1| hypothetical protein MIMGU_mgv1a026176mg [Erythranthe guttata]
Length=509

 Score =   187 bits (476),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 117/151 (77%), Gaps = 2/151 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS--HEKVPW  537
            TIA+G +KT+FILVATF +D+ GRR LLLTS GG+  +L  L   LTVID +   +K+ W
Sbjct  322  TIAVGISKTMFILVATFLVDRVGRRTLLLTSCGGLAASLFGLATGLTVIDQNDDEQKLTW  381

Query  536  AVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFI  357
            AVA+ +AM+L+ VA FSIG GPI WVYSSEI+PL+LRA GCS+G   NR  SGVV MTFI
Sbjct  382  AVALCVAMSLSSVAFFSIGMGPIAWVYSSEIYPLRLRAQGCSMGVAANRFMSGVVLMTFI  441

Query  356  SLYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            SLY+ I+IGG+FFL+  IA V W+FF+TL+P
Sbjct  442  SLYETITIGGAFFLFTGIAVVAWIFFYTLLP  472


 Score = 48.9 bits (115),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  265  QTQGKTLEETEALFGTFFRWRSRQREVDAKKANNNS  158
            +T+G+TLEE E LFGTFF WRS  +E++ KK  NN+
Sbjct  473  ETKGRTLEEMEDLFGTFFNWRSTSKELNIKKEANNT  508



>ref|XP_002463086.1| hypothetical protein SORBIDRAFT_02g037590 [Sorghum bicolor]
 gb|EER99607.1| hypothetical protein SORBIDRAFT_02g037590 [Sorghum bicolor]
Length=505

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWA  534
            T A+G TKT+FILVATF LD+ GRRPLLLTS GGM+ +L  LG  LTV+ H  + K+PWA
Sbjct  317  TCAVGVTKTLFILVATFLLDRAGRRPLLLTSTGGMIVSLVGLGTGLTVVGHHPDAKIPWA  376

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            VA+ I   LAYV+ FSIG GPI  VY+SEIFPL++RA G ++G   NRVTSGV+SMTF+S
Sbjct  377  VALCILSVLAYVSFFSIGLGPIAGVYTSEIFPLRVRALGFAVGVASNRVTSGVISMTFLS  436

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L KAI+IGGSFFLY+ IAA+ WVFFFT +P
Sbjct  437  LSKAITIGGSFFLYSGIAALAWVFFFTYLP  466



>gb|ABF94465.1| Sugar transporter family protein, expressed [Oryza sativa Japonica 
Group]
Length=553

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWA-  534
            ++A+G +KT+FILVATF LD+ GRRPLLLTS GGMV +L  L  +L +I+H  E    A 
Sbjct  361  SVAVGASKTLFILVATFLLDRVGRRPLLLTSAGGMVISLVTLASALHMIEHRPEGQATAL  420

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            V ++IAM L +VA+FSIG GPI WVYSSEIFPL+LRA GC+LGT +NRV SG VSM+FIS
Sbjct  421  VGLSIAMVLVFVASFSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRVVSGAVSMSFIS  480

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAI+  GSF+LYA IAA GWVF F  +P
Sbjct  481  LYKAITFAGSFYLYAGIAAAGWVFMFFFLP  510



>ref|XP_007131850.1| hypothetical protein PHAVU_011G046600g [Phaseolus vulgaris]
 gb|ESW03844.1| hypothetical protein PHAVU_011G046600g [Phaseolus vulgaris]
Length=510

 Score =   190 bits (482),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT FILVATF +D+ GRRP+LL+SVGGMV +  +LG+  T+I+ S  K  WA+
Sbjct  327  TVAVGFVKTTFILVATFMMDRVGRRPMLLSSVGGMVVSFLILGIVFTIIEQSESKPMWAI  386

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++I M L +VA FSIGAGPITWVYS+EIFPL+LRA G + G  +NR+TSGV++MTF+SL
Sbjct  387  GLSITMVLVFVATFSIGAGPITWVYSAEIFPLRLRAQGVAAGVVVNRITSGVITMTFLSL  446

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KAI++GG+FFLY  IAA G +FF+  +P
Sbjct  447  TKAITVGGTFFLYCGIAATGGLFFYIALP  475



>gb|KHN41994.1| Putative polyol transporter 6 [Glycine soja]
Length=460

 Score =   189 bits (479),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TI +G TK + +++ATF +DK GRRPLLL SVGGMV +L +LG SLT++D SHE++ WA+
Sbjct  279  TIGVGLTKVICLIIATFFIDKVGRRPLLLVSVGGMVCSLGVLGFSLTMVDTSHEELLWAL  338

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++I  T  YVA F++G GPITWVYSSEIFPLKLRA G S+G  +NR+T+  +SM+FIS+
Sbjct  339  ILSIVATYIYVAFFNLGLGPITWVYSSEIFPLKLRAQGASIGVAVNRLTNAAISMSFISI  398

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            Y AI+IGG+FF++A I+ + W FF+  MP
Sbjct  399  YNAITIGGAFFMFAGISVIAWAFFYFFMP  427



>ref|XP_009395604.1| PREDICTED: putative polyol transporter 1 [Musa acuminata subsp. 
malaccensis]
Length=561

 Score =   191 bits (484),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 120/150 (80%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWA  534
            T+A+GFTKT+FILVATF +D+ GRRPLLL+S GGM+ +LA LG+ LT IDH  + ++ WA
Sbjct  373  TVAVGFTKTLFILVATFLVDRIGRRPLLLSSTGGMILSLAALGLGLTQIDHHPDGQLRWA  432

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            + + I   LAYVA FSIG GP+TWVY SEI PL+LRA G S+G  +NRVTSGV++MTFIS
Sbjct  433  IGLCIVSILAYVAFFSIGLGPVTWVYCSEILPLRLRAQGASIGVAVNRVTSGVITMTFIS  492

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAI+IGGSFFLY  IA   WVFFFT +P
Sbjct  493  LYKAITIGGSFFLYGGIALAAWVFFFTYLP  522



>ref|XP_009396401.1| PREDICTED: polyol transporter 5-like [Musa acuminata subsp. malaccensis]
Length=513

 Score =   189 bits (481),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 121/150 (81%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWA  534
            T+A+G TKT+FILVATF LD+ GRRPLLL+S GGM+ +LA LG+ LT+IDH  + ++ WA
Sbjct  325  TVAVGVTKTLFILVATFLLDRIGRRPLLLSSTGGMILSLAGLGLGLTLIDHHPDGQLRWA  384

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            V + IA  L YVA FSIG GPITWVYSSEI PL+LRA G S+   +NRVTSGV++MTFIS
Sbjct  385  VGLCIASILGYVAFFSIGLGPITWVYSSEILPLRLRAQGASIAVAVNRVTSGVITMTFIS  444

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAI+IGGSFFLY  IAA+ WVFFF  +P
Sbjct  445  LYKAITIGGSFFLYGGIAALAWVFFFACLP  474



>ref|XP_006590682.1| PREDICTED: probable polyol transporter 6-like [Glycine max]
Length=497

 Score =   189 bits (479),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TI +G TK + +++ATF +DK GRRPLLL SVGGMV +L +LG SLT++D SHE++ WA+
Sbjct  316  TIGVGLTKVICLIIATFFIDKVGRRPLLLVSVGGMVCSLGVLGFSLTMVDTSHEELLWAL  375

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++I  T  YVA F++G GPITWVYSSEIFPLKLRA G S+G  +NR+T+  +SM+FIS+
Sbjct  376  ILSIVATYIYVAFFNLGLGPITWVYSSEIFPLKLRAQGASIGVAVNRLTNAAISMSFISI  435

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            Y AI+IGG+FF++A I+ + W FF+  MP
Sbjct  436  YNAITIGGAFFMFAGISVIAWAFFYFFMP  464



>ref|XP_010905473.1| PREDICTED: putative polyol transporter 1 [Elaeis guineensis]
Length=523

 Score =   189 bits (480),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 125/149 (84%), Gaps = 1/149 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SHEKVPWA  534
            T+A+GFTKT+FILVATF LD+ GRRPLLL+S GGM+ +LA LG+ LT+IDH  + ++PWA
Sbjct  334  TVAVGFTKTLFILVATFLLDRVGRRPLLLSSQGGMIVSLAGLGLGLTIIDHHPNGQLPWA  393

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            + + IA  LA+VA FSIG GP+  VY SEIFPL+LRA G S+G  +NRVTSGV++MTF+S
Sbjct  394  IGLCIASILAFVAFFSIGMGPMPSVYCSEIFPLRLRAQGVSVGVVVNRVTSGVITMTFLS  453

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLM  267
            LYKAI+IGGSFFLYA IAAVGWVFFFT +
Sbjct  454  LYKAITIGGSFFLYAGIAAVGWVFFFTYL  482



>ref|XP_008670519.1| PREDICTED: putative polyol transporter 1 [Zea mays]
 tpg|DAA41238.1| TPA: hypothetical protein ZEAMMB73_503211 [Zea mays]
Length=520

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 116/150 (77%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWA  534
            T A+G TKT FILVATF LD+ GRRPLLL S GGM+ +L  LG  LTV  H  + KV WA
Sbjct  325  TCAVGVTKTFFILVATFLLDRAGRRPLLLASTGGMIVSLLSLGAGLTVAGHHPDGKVAWA  384

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            VA+ IA TLAY+A FSIG GPIT VY+SEIFPL++RA G ++G   NRVTS V+SMTF+S
Sbjct  385  VALCIASTLAYIAFFSIGLGPITGVYTSEIFPLRVRALGFAVGVASNRVTSAVISMTFLS  444

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L K I+IGGSFFLYA IAAV WVFFFT +P
Sbjct  445  LSKGITIGGSFFLYAGIAAVAWVFFFTCLP  474



>ref|XP_006406559.1| hypothetical protein EUTSA_v10020495mg [Eutrema salsugineum]
 gb|ESQ48012.1| hypothetical protein EUTSA_v10020495mg [Eutrema salsugineum]
Length=529

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 115/150 (77%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVP-WA  534
            T+A+G  KT FILVATF LD+ GRRPLLLTSVGGMV +LA LG SLT+IDH  EK   W 
Sbjct  336  TVAVGIVKTSFILVATFLLDRVGRRPLLLTSVGGMVLSLATLGTSLTIIDHQTEKKAMWV  395

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            + ++I+M + YVA FSIGAGPITWVYSSEIFPL+LR+ G S    +NRVTSGV+SM F+ 
Sbjct  396  LVLSISMVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSFAVVVNRVTSGVISMGFLP  455

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L + I+ GG+F+L+  IA V W FF+T +P
Sbjct  456  LTEGITTGGAFYLFCGIATVAWFFFYTFLP  485



>ref|XP_006349557.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=519

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 113/149 (76%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TIA+G  KT F LVATF +DK GRR LLL+S GGM+ +L  L   LT+IDHS   + WA+
Sbjct  318  TIAVGCMKTFFTLVATFLVDKIGRRILLLSSCGGMILSLLALATGLTIIDHSDHTLKWAI  377

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + +  T + VA FSIG GP+ WVYSSEIFPL+LRA GCS+G  +NR  SG + MTFISL
Sbjct  378  VVCVCATYSTVAFFSIGMGPLAWVYSSEIFPLRLRAQGCSIGVAVNRAVSGGILMTFISL  437

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAISIGG+FFLYA +A+V W+FF+TL+P
Sbjct  438  YKAISIGGAFFLYAGVASVAWIFFYTLLP  466



>ref|XP_006297395.1| hypothetical protein CARUB_v10013420mg [Capsella rubella]
 gb|EOA30293.1| hypothetical protein CARUB_v10013420mg [Capsella rubella]
Length=536

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 116/150 (77%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEK-VPWA  534
            T+A+G  KT FILVATF LD+ GRRPLLLTSVGGMV +L  LG SLT+I  S EK V WA
Sbjct  335  TVAVGVVKTSFILVATFLLDRIGRRPLLLTSVGGMVLSLMGLGTSLTIIGQSGEKKVMWA  394

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            V +AI   + YVA FSIGAGPITWVYSSEIFPL+LR+ G SLG  +NRVTSGV+SMTF+ 
Sbjct  395  VVVAITTVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSLGVVVNRVTSGVISMTFLP  454

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            +   ++ GG+F+L+  IA V WVFF+T +P
Sbjct  455  MSDGMTTGGAFYLFGGIATVAWVFFYTFLP  484



>gb|ACN26310.1| unknown [Zea mays]
Length=483

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWA  534
            T A+G TKT FILVATF LD+ GRRPLLL S GGM+ +L  LG  LTV  H  + KV WA
Sbjct  293  TCAVGVTKTFFILVATFLLDRAGRRPLLLISTGGMIVSLICLGSGLTVAGHHPDTKVAWA  352

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            VA+ IA TL+Y+A FSIG GPIT VY+SEIFPL++RA G ++G   NRVTS V+SMTF+S
Sbjct  353  VALCIASTLSYIAFFSIGLGPITGVYTSEIFPLQVRALGFAVGVASNRVTSAVISMTFLS  412

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L KAI+IGGSFFLY+ IAAV WVFFFT +P
Sbjct  413  LSKAITIGGSFFLYSGIAAVAWVFFFTCLP  442



>gb|ACG35144.1| proton myo-inositol cotransporter [Zea mays]
Length=513

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWA  534
            T A+G TKT FILVATF LD+ GRRPLLL S GGM+ +L  LG  LTV  H  + KV WA
Sbjct  323  TCAVGVTKTFFILVATFLLDRAGRRPLLLISTGGMIVSLICLGSGLTVAGHHPDTKVAWA  382

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            VA+ IA TL+Y+A FSIG GPIT VY+SEIFPL++RA G ++G   NRVTS V+SMTF+S
Sbjct  383  VALCIASTLSYIAFFSIGLGPITGVYTSEIFPLQVRALGFAVGVASNRVTSAVISMTFLS  442

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L KAI+IGGSFFLY+ IAAV WVFFFT +P
Sbjct  443  LSKAITIGGSFFLYSGIAAVAWVFFFTCLP  472



>ref|NP_001132062.1| proton myo-inositol cotransporter [Zea mays]
 gb|ACF80747.1| unknown [Zea mays]
 tpg|DAA63327.1| TPA: proton myo-inositol cotransporter [Zea mays]
Length=513

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWA  534
            T A+G TKT FILVATF LD+ GRRPLLL S GGM+ +L  LG  LTV  H  + KV WA
Sbjct  323  TCAVGVTKTFFILVATFLLDRAGRRPLLLISTGGMIVSLICLGSGLTVAGHHPDTKVAWA  382

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            VA+ IA TL+Y+A FSIG GPIT VY+SEIFPL++RA G ++G   NRVTS V+SMTF+S
Sbjct  383  VALCIASTLSYIAFFSIGLGPITGVYTSEIFPLQVRALGFAVGVASNRVTSAVISMTFLS  442

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L KAI+IGGSFFLY+ IAAV WVFFFT +P
Sbjct  443  LSKAITIGGSFFLYSGIAAVAWVFFFTCLP  472



>gb|AAG43998.1|AF215837_1 mannitol transporter [Apium graveolens Dulce Group]
Length=513

 Score =   187 bits (474),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TIA+G  KTVFIL++TF LDK GRRPL+LTS+GGMV  L +L  SLTVI+ SH    WA 
Sbjct  323  TIAVGVCKTVFILISTFQLDKIGRRPLMLTSMGGMVIALFVLAGSLTVINKSHHTGHWAG  382

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             +AI    A+V+ FS G GPI WVYSSE+FPL+LRA GCS+G  +NR  SG++ MTFIS+
Sbjct  383  GLAIFTVYAFVSIFSSGMGPIAWVYSSEVFPLRLRAQGCSIGVAVNRGMSGIIGMTFISM  442

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKA++IGG+F L+A +A++GWVF +T+ P
Sbjct  443  YKAMTIGGAFLLFAVVASIGWVFMYTMFP  471



>ref|XP_006856084.1| hypothetical protein AMTR_s00059p00122840 [Amborella trichopoda]
 gb|ERN17551.1| hypothetical protein AMTR_s00059p00122840 [Amborella trichopoda]
Length=518

 Score =   186 bits (473),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 120/149 (81%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GFTKT+ IL+ATF LDK GRRPLLLTSVGGM+ +L  LG  LT+I +S EK+ WA+
Sbjct  324  TVAVGFTKTITILIATFMLDKVGRRPLLLTSVGGMIISLCGLGFGLTMITNSDEKLVWAI  383

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ IA  L +V  FSIG GPITWVYSSEIFPL+LRA G S+   +NRV SGV++M+FISL
Sbjct  384  AICIATVLLFVTFFSIGMGPITWVYSSEIFPLRLRAQGASIAVAVNRVVSGVLTMSFISL  443

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGGSFFL+A IA+V + FFF  +P
Sbjct  444  YKAITIGGSFFLFAGIASVAFCFFFFFLP  472



>ref|XP_004148314.1| PREDICTED: polyol transporter 5-like [Cucumis sativus]
 ref|XP_004166833.1| PREDICTED: polyol transporter 5-like [Cucumis sativus]
Length=485

 Score =   186 bits (471),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT FILVATF LD+ GRRP +LTSV G   +LA LG SLT+I++SHEKV WA+
Sbjct  301  TVAVGIVKTAFILVATFFLDRMGRRPCILTSVAGQTVSLATLGFSLTIINNSHEKVKWAI  360

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + IAM L+ V+ FSIG GP+  VY+SEIFPL+LRA G S+    NR+TSGVV+MTF+SL
Sbjct  361  VLCIAMVLSNVSFFSIGLGPMASVYTSEIFPLRLRALGVSVAIMANRITSGVVTMTFLSL  420

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            Y A++IGG+FFL+A I+AV W+FF+ + P
Sbjct  421  YHAVTIGGAFFLFAGISAVSWLFFYVVFP  449



>ref|XP_007156029.1| hypothetical protein PHAVU_003G252500g [Phaseolus vulgaris]
 gb|ESW28023.1| hypothetical protein PHAVU_003G252500g [Phaseolus vulgaris]
Length=495

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 116/149 (78%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+ IG TK VF+++A F LD+ GRR LL  S GGM+  L LLG SLT++DHS EK+ WA+
Sbjct  317  TVGIGLTKIVFLVMALFLLDRVGRRRLLQVSTGGMICGLTLLGFSLTMVDHSSEKLLWAL  376

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            +++I  T AYVA F+IG GP+TWVYSSEIFPL+LRA G S+G  +NR  + VVSM+FIS+
Sbjct  377  SLSIVATYAYVAFFNIGLGPVTWVYSSEIFPLRLRAQGASIGVAVNRTMNAVVSMSFISV  436

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGGSFF++AA++ + W FF+  +P
Sbjct  437  YKAITIGGSFFMFAAVSILAWFFFYFFLP  465



>dbj|BAK00091.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=528

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 115/150 (77%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHEKVPWA  534
            T A+G  KT+FILVATF LD+ GRRPLLLTS  GM+  L  LG  LTV+D H   K+PWA
Sbjct  336  TCAMGVMKTLFILVATFQLDRIGRRPLLLTSTAGMLACLIGLGTGLTVVDRHPDTKIPWA  395

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            +A+ I   LAYV+ FS G GP+T VY+SE+FPL++RA G +LG   NRVTS  VSM+F+S
Sbjct  396  IALCIVSVLAYVSFFSTGLGPLTSVYTSEVFPLRVRALGFALGASCNRVTSAAVSMSFLS  455

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L KAI+IGGSFFLYA IAA+GW+FFFT +P
Sbjct  456  LSKAITIGGSFFLYAGIAALGWIFFFTFIP  485



>ref|XP_008447047.1| PREDICTED: polyol transporter 5-like [Cucumis melo]
Length=519

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  K +FILVATF LD+ GRRPL+LTSV G   +LA+LG SLT+I++S  KV WA+
Sbjct  336  TVAVGIVKAIFILVATFLLDRVGRRPLILTSVAGQTISLAILGFSLTIINNSDVKVKWAI  395

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + IA  L+ VA FSIG GP++ VY+SEIFPL+LRA G S+   +NR+ SGVV+MTF+SL
Sbjct  396  VLCIATVLSNVAFFSIGLGPMSPVYTSEIFPLRLRALGVSVAVTLNRIVSGVVAMTFLSL  455

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            Y A++IGG+FFLYA IAAVGW+FFF + P
Sbjct  456  YHALTIGGAFFLYAGIAAVGWLFFFVVFP  484



>ref|XP_006349565.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=518

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 111/149 (74%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TIA+G  KT F LVATF +DK GRR LLL+S GGM+ +L  L   LT+IDHS   + WA+
Sbjct  332  TIAVGCMKTFFTLVATFFVDKIGRRILLLSSCGGMILSLLALATGLTIIDHSDHTLKWAI  391

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + +  T + VA FSIG GP+ WVYSSEIFPL+LRA GCS+G  +NR  SG + MTFISL
Sbjct  392  VVCVCATYSTVAFFSIGMGPLAWVYSSEIFPLRLRAQGCSIGVAVNRAVSGGILMTFISL  451

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAISIGG+FFLY  IA V W+FF+TL+P
Sbjct  452  YKAISIGGAFFLYTGIAIVAWIFFYTLLP  480



>gb|KGN44327.1| hypothetical protein Csa_7G253820 [Cucumis sativus]
Length=519

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT FILVATF LD+ GRRP +LTSV G   +LA LG SLT+I++SHEKV WA+
Sbjct  335  TVAVGIVKTAFILVATFFLDRMGRRPCILTSVAGQTVSLATLGFSLTIINNSHEKVKWAI  394

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + IAM L+ V+ FSIG GP+  VY+SEIFPL+LRA G S+    NR+TSGVV+MTF+SL
Sbjct  395  VLCIAMVLSNVSFFSIGLGPMASVYTSEIFPLRLRALGVSVAIMANRITSGVVTMTFLSL  454

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            Y A++IGG+FFL+A I+AV W+FF+ + P
Sbjct  455  YHAVTIGGAFFLFAGISAVSWLFFYVVFP  483



>gb|KHN41995.1| Putative polyol transporter 3 [Glycine soja]
Length=459

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TI +G TK  F+++A+F LD+FGRR LLLTS GGMV +LA+LG SLT++  S EK+ WA+
Sbjct  279  TIGVGLTKIFFLIIASFLLDRFGRRRLLLTSTGGMVCSLAVLGFSLTMVHTSQEKLSWAL  338

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++I  T ++VA+F+IG GP+TWVYSSEIFP KLRA G S+G  +NRV +  VSM+FIS+
Sbjct  339  TLSIVATYSFVASFNIGLGPVTWVYSSEIFPSKLRAQGASIGVAVNRVMNAAVSMSFISI  398

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YK I+IGG+FF++AAI+ + W+FF+  +P
Sbjct  399  YKTITIGGTFFMFAAISILAWLFFYFFLP  427



>ref|XP_004509296.1| PREDICTED: probable polyol transporter 3-like [Cicer arietinum]
Length=499

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+ +G TK VF+L+A F LDK GRR LL  S  GM+  L +LG SLT+++ S+EKV WA+
Sbjct  318  TVGVGLTKIVFLLIALFLLDKVGRRRLLQISTAGMICGLTVLGFSLTMVERSNEKVLWAL  377

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++I  T +YVA F+IG GP+TWVYSSEIFPLKLRA G S+G  +NR  + VVSMTFIS+
Sbjct  378  TLSIVATYSYVAFFNIGLGPVTWVYSSEIFPLKLRAQGASIGVAVNRTMNAVVSMTFISI  437

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGGSFF++AA++ + WVFF+  +P
Sbjct  438  YKAITIGGSFFMFAAVSVLAWVFFYFFLP  466



>ref|XP_010254894.1| PREDICTED: polyol transporter 5-like [Nelumbo nucifera]
Length=504

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+ +G +KT FILVATF LD+ GRRPLLL+SVGGM+ +L  L   LT+++HS EKV WA+
Sbjct  330  TVCVGISKTSFILVATFLLDRMGRRPLLLSSVGGMILSLLGLASGLTIVNHSEEKVGWAI  389

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+ I   L +VA+FSIG GPI WVYSSEIFPL+LRA G SL  G+NR+ SG++  TF+SL
Sbjct  390  ALCILTVLTFVASFSIGLGPIAWVYSSEIFPLRLRAQGGSLAAGVNRMMSGIIVTTFLSL  449

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+I GSFF++A IA V WVF +  +P
Sbjct  450  YKAITIEGSFFMFAGIATVTWVFIYVFLP  478



>ref|XP_006590681.1| PREDICTED: probable polyol transporter 3-like [Glycine max]
Length=496

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TI +G TK  F+++A+F LD+FGRR LLLTS GGMV +LA+LG SLT++  S EK+ WA+
Sbjct  316  TIGVGLTKIFFLIIASFLLDRFGRRRLLLTSTGGMVCSLAVLGFSLTMVHTSQEKLSWAL  375

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++I  T ++VA+F+IG GP+TWVYSSEIFP KLRA G S+G  +NRV +  VSM+FIS+
Sbjct  376  TLSIVATYSFVASFNIGLGPVTWVYSSEIFPSKLRAQGASIGVAVNRVMNAAVSMSFISI  435

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YK I+IGG+FF++AAI+ + W+FF+  +P
Sbjct  436  YKTITIGGTFFMFAAISILAWLFFYFFLP  464



>gb|ABX71752.1| mannitol transporter [Apium graveolens]
Length=524

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 120/149 (81%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TI +G  KT+F+L++TF LDK GRRPL+L+S+GGMV  L +L  SL+VI+HSH+ VPWAV
Sbjct  334  TIGVGVCKTIFVLISTFLLDKVGRRPLMLSSMGGMVIALLVLSGSLSVINHSHQTVPWAV  393

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            A+AI     +V+ FS G GPI WVYSSE+FPL+LRA GCS+G  +NR  SG++ MTFIS+
Sbjct  394  ALAIISVYGFVSVFSSGMGPIAWVYSSEVFPLRLRAQGCSIGVAVNRGVSGIIGMTFISM  453

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKA++IGG+FF++A +AA+GWVF FT+ P
Sbjct  454  YKALTIGGAFFVFAVVAAIGWVFMFTMFP  482



>ref|XP_010527594.1| PREDICTED: polyol transporter 5-like isoform X4 [Tarenaya hassleriana]
Length=526

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-HEKVPWA  534
            T+AIG  KT  ILV+TF LD+ GRRPLLL+SVGGMV +L  L MSLTVIDH   +K+ WA
Sbjct  327  TVAIGTVKTTSILVSTFLLDRIGRRPLLLSSVGGMVISLLTLAMSLTVIDHRPDKKMIWA  386

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            + +++A  + YVA FS G GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV++MTF+S
Sbjct  387  LGLSLATAITYVATFSTGLGPITWVYSSEIFPLRLRAQGMSMGLIVNRVTSGVIAMTFLS  446

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L KAI+ GG+FFL+  +A   W+FF+T +P
Sbjct  447  LTKAITTGGAFFLFGGLAMAAWMFFYTFLP  476



>ref|XP_004958138.1| PREDICTED: polyol transporter 5-like [Setaria italica]
Length=509

 Score =   184 bits (467),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 117/149 (79%), Gaps = 1/149 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWA  534
            T A+G TKT+FILVATF LD+ GRRPLLLTS GGMV +L  LG  LTV+ H  + K+PWA
Sbjct  321  TCAVGVTKTLFILVATFLLDRAGRRPLLLTSTGGMVISLIGLGTGLTVVGHHPDAKIPWA  380

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            VA+ I   LAYV+ FSIG GP+  VY+SEIFPL++RA G ++G   NRVTSGV+SMTF+S
Sbjct  381  VALCILSILAYVSFFSIGLGPMASVYTSEIFPLRVRALGFAVGVASNRVTSGVISMTFLS  440

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLM  267
            L KAI+IGGSFFLY+ IA + WVFFFT +
Sbjct  441  LSKAITIGGSFFLYSGIAVLAWVFFFTYL  469



>ref|XP_010527591.1| PREDICTED: polyol transporter 5-like isoform X1 [Tarenaya hassleriana]
Length=537

 Score =   184 bits (468),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-HEKVPWA  534
            T+AIG  KT  ILV+TF LD+ GRRPLLL+SVGGMV +L  L MSLTVIDH   +K+ WA
Sbjct  327  TVAIGTVKTTSILVSTFLLDRIGRRPLLLSSVGGMVISLLTLAMSLTVIDHRPDKKMIWA  386

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            + +++A  + YVA FS G GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV++MTF+S
Sbjct  387  LGLSLATAITYVATFSTGLGPITWVYSSEIFPLRLRAQGMSMGLIVNRVTSGVIAMTFLS  446

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L KAI+ GG+FFL+  +A   W+FF+T +P
Sbjct  447  LTKAITTGGAFFLFGGLAMAAWMFFYTFLP  476



>gb|AAN07021.1| putative mannitol transporter [Orobanche ramosa]
Length=519

 Score =   183 bits (464),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 112/150 (75%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SHEKVPWA  534
            TIA+G  KTVFILV TF +D+ GRR LLLTS GG+V ++  L   LTVIDH   ++ PW 
Sbjct  332  TIAVGLCKTVFILVTTFMVDRIGRRVLLLTSCGGLVLSMLTLATGLTVIDHYGADRFPWV  391

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            V + +  T + VA FS+G GPI WVYSSEIFPLKLRA GC LG  INR T+GV+ M+FIS
Sbjct  392  VVLCVLTTYSSVAFFSMGMGPIAWVYSSEIFPLKLRAQGCGLGVAINRATNGVILMSFIS  451

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LY AI+IGG+F+L++ I  V W+FFFTL+P
Sbjct  452  LYNAITIGGAFYLFSGIGIVTWIFFFTLLP  481


 Score = 45.4 bits (106),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -2

Query  265  QTQGKTLEETEALFGTFFRWRSRQREVDAKKANN  164
            +T+G+TLE+ E LFGTFF+WR+  RE+  K+A +
Sbjct  482  ETRGRTLEDMEVLFGTFFKWRTTMRELHKKEAED  515



>ref|XP_010527593.1| PREDICTED: polyol transporter 5-like isoform X3 [Tarenaya hassleriana]
Length=528

 Score =   184 bits (468),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-HEKVPWA  534
            T+AIG  KT  ILV+TF LD+ GRRPLLL+SVGGMV +L  L MSLTVIDH   +K+ WA
Sbjct  327  TVAIGTVKTTSILVSTFLLDRIGRRPLLLSSVGGMVISLLTLAMSLTVIDHRPDKKMIWA  386

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            + +++A  + YVA FS G GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV++MTF+S
Sbjct  387  LGLSLATAITYVATFSTGLGPITWVYSSEIFPLRLRAQGMSMGLIVNRVTSGVIAMTFLS  446

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L KAI+ GG+FFL+  +A   W+FF+T +P
Sbjct  447  LTKAITTGGAFFLFGGLAMAAWMFFYTFLP  476



>gb|KHN44499.1| Putative polyol transporter 3 [Glycine soja]
Length=458

 Score =   182 bits (463),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+ IG TK +F+++A F LDK GRR LL  S GGMV  L LLG SLT++D S EK+ WA+
Sbjct  280  TVGIGLTKIIFLVLALFLLDKVGRRRLLQISTGGMVCGLTLLGFSLTMVDSSSEKLLWAL  339

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            +++I  T  YVA F++G GP+TWVY+SEIFPLKLRA G S+G  +NR  + VVSM+FIS+
Sbjct  340  SLSIGATYGYVAFFNVGLGPVTWVYASEIFPLKLRAQGASIGVAVNRTMNAVVSMSFISV  399

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGGSFF++A I+ V WVFF+  +P
Sbjct  400  YKAITIGGSFFMFAGISIVAWVFFYFFLP  428



>ref|XP_010527592.1| PREDICTED: polyol transporter 5-like isoform X2 [Tarenaya hassleriana]
Length=532

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-HEKVPWA  534
            T+AIG  KT  ILV+TF LD+ GRRPLLL+SVGGMV +L  L MSLTVIDH   +K+ WA
Sbjct  327  TVAIGTVKTTSILVSTFLLDRIGRRPLLLSSVGGMVISLLTLAMSLTVIDHRPDKKMIWA  386

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            + +++A  + YVA FS G GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV++MTF+S
Sbjct  387  LGLSLATAITYVATFSTGLGPITWVYSSEIFPLRLRAQGMSMGLIVNRVTSGVIAMTFLS  446

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L KAI+ GG+FFL+  +A   W+FF+T +P
Sbjct  447  LTKAITTGGAFFLFGGLAMAAWMFFYTFLP  476



>ref|XP_003548895.1| PREDICTED: probable polyol transporter 3-like [Glycine max]
Length=495

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+ IG TK +F+++A F LDK GRR LL  S GGMV  L LLG SLT++D S EK+ WA+
Sbjct  317  TVGIGLTKIIFLVLALFLLDKVGRRRLLQISTGGMVCGLTLLGFSLTMVDSSSEKLLWAL  376

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            +++I  T  YVA F++G GP+TWVY+SEIFPLKLRA G S+G  +NR  + VVSM+FIS+
Sbjct  377  SLSIGATYGYVAFFNVGLGPVTWVYASEIFPLKLRAQGASIGVAVNRTMNAVVSMSFISV  436

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGGSFF++A I+ V WVFF+  +P
Sbjct  437  YKAITIGGSFFMFAGISIVAWVFFYFFLP  465



>ref|XP_010095276.1| putative polyol transporter 6 [Morus notabilis]
 gb|EXB59122.1| putative polyol transporter 6 [Morus notabilis]
Length=501

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+ +G TKT FILVATF LD+ GR+ LLLTS GGM+  L  LG  LT+++HS E++ WA+
Sbjct  316  TVGVGVTKTTFILVATFWLDRIGRKRLLLTSTGGMIVALTGLGFCLTMVEHSKEELVWAL  375

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++IA    +VA FSIG GPITWVYSSEIFPL+LRA G S+G  +NRV +  VSMTFIS+
Sbjct  376  GLSIASVYVFVAFFSIGLGPITWVYSSEIFPLRLRAQGMSIGVAVNRVMNATVSMTFISI  435

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FF++A IA + W FF+  +P
Sbjct  436  YKAITIGGTFFMFAGIAVLAWGFFYFFLP  464



>gb|KHN00554.1| Putative polyol transporter 3 [Glycine soja]
Length=488

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+ IG TK +F+++A F LDK GRR LL  S GGMV  L LLG SLT++D S EK+ WA+
Sbjct  311  TVGIGLTKIIFLVMALFLLDKVGRRRLLQISTGGMVCGLTLLGFSLTMVDRSSEKLLWAL  370

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            +++I    AYVA F++G GP+TWVY+SEIFPLKLRA G S+G  +NR  + VVSM+FIS+
Sbjct  371  SLSIVAIYAYVAFFNVGLGPVTWVYASEIFPLKLRAQGASIGVAVNRTMNAVVSMSFISV  430

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGGSFF++A I+ V WVFF+  +P
Sbjct  431  YKAITIGGSFFMFAGISIVAWVFFYFFLP  459



>ref|XP_008465477.1| PREDICTED: polyol transporter 5-like [Cucumis melo]
Length=517

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G  KT FILVATF LD+ GRRP +LTSV G   +LA LG SLT+I+ S EKV WA+
Sbjct  334  TVAVGIVKTAFILVATFFLDRMGRRPCILTSVAGQTVSLATLGFSLTIINRSQEKVKWAI  393

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             + IAM L+ V+ FSIG GP+  VY+SEIFPL+LRA G S+    NR+TSGVV+MTF+SL
Sbjct  394  VLCIAMVLSNVSFFSIGLGPMAAVYTSEIFPLRLRALGVSVAIMANRITSGVVTMTFLSL  453

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            Y A++IGG+FFL+A I+AV W+FF+ + P
Sbjct  454  YHALTIGGAFFLFAGISAVSWLFFYVVFP  482



>gb|EMS66679.1| Putative polyol transporter 2 [Triticum urartu]
Length=436

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 115/150 (77%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVI-DHSHEKVPWA  534
            T A+G TKT+FIL+ATF +D+ GRRPLLLTS  GM+  L  LG  LTV+  H  EK+ WA
Sbjct  247  TCAMGVTKTLFILLATFQIDRVGRRPLLLTSTAGMLVCLIGLGTGLTVVGQHPDEKITWA  306

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            V + IA TLAYV+ FS+G GPIT VY SE+FPL++RA G +LG   NRVTS  +SMTF+S
Sbjct  307  VGLCIASTLAYVSFFSMGLGPITSVYVSEVFPLRVRALGFALGVACNRVTSAAISMTFLS  366

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L KAI+IGGSFFLYA +AA+GW++F+  +P
Sbjct  367  LSKAITIGGSFFLYAGLAALGWLYFYAFVP  396



>ref|XP_007131748.1| hypothetical protein PHAVU_011G038700g [Phaseolus vulgaris]
 gb|ESW03742.1| hypothetical protein PHAVU_011G038700g [Phaseolus vulgaris]
Length=495

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 116/149 (78%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KT  +LVATF LD+ GRR LLL SV G++ +L  LG+ LTV+ HS   + WA+
Sbjct  301  TVAVGFVKTASVLVATFLLDRAGRRVLLLCSVSGLILSLVTLGVCLTVVGHSGSTLTWAI  360

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++IA  LAY + FSIG+GPITWVYSSEIFPL+LRA G ++G  +NRVTSGV+SMTF+SL
Sbjct  361  GLSIAAVLAYASTFSIGSGPITWVYSSEIFPLRLRAQGVAIGAVVNRVTSGVISMTFLSL  420

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KAI+ GG+FFL+A +A   W+F +T++P
Sbjct  421  CKAITTGGAFFLFAGVAVAAWIFHYTMLP  449



>ref|NP_001147446.1| sorbitol transporter [Zea mays]
 gb|ACF84429.1| unknown [Zea mays]
 gb|ACG27557.1| sorbitol transporter [Zea mays]
 tpg|DAA43973.1| TPA: Sorbitol transporter [Zea mays]
Length=525

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 115/150 (77%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+G TKT+FILVATF LD+ GRRPLLLTS GGMV +L  L  +L  ID   E    ++
Sbjct  336  TMAVGATKTLFILVATFFLDRVGRRPLLLTSAGGMVVSLVTLASALRAIDRLPEGQATSL  395

Query  530  A-MAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            A ++IA  L +VA+FSIG GPI WVYSSEIFPL+LRA GC+LGT +NRV SG ++M+FIS
Sbjct  396  AGVSIAAVLTFVASFSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRVMSGTITMSFIS  455

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAI+  GSF+LYA IAA GW+F F  +P
Sbjct  456  LYKAITFAGSFYLYAGIAAAGWLFMFFFLP  485



>ref|XP_006649564.1| PREDICTED: polyol transporter 5-like [Oryza brachyantha]
Length=518

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 114/150 (76%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-KVPWA  534
            ++A+G +KT+FILVATF LD+ GRRPLLLTS  GMV +L  L  +L VID   E +    
Sbjct  329  SVAVGASKTLFILVATFLLDRVGRRPLLLTSAAGMVISLVTLASALHVIDQRPEGQATPL  388

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            V ++IAM LA+VA+FSIG GPI WVYSSEIFPL+LRA GC+LGT +NR+ SG +SM+F+S
Sbjct  389  VGLSIAMVLAFVASFSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRIMSGAISMSFLS  448

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L KAI+  GSF+LYA IA  GWVF F  +P
Sbjct  449  LCKAITFAGSFYLYAGIATAGWVFMFFFLP  478



>ref|XP_007046983.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOX91140.1| Major facilitator superfamily protein [Theobroma cacao]
Length=506

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 112/149 (75%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+ +G TKT FILVATF LDK GRR LLL S GGMV  L  LG  LT+++ + EK+ WA+
Sbjct  323  TVGVGLTKTTFILVATFLLDKVGRRRLLLISTGGMVVALTALGFGLTMVERTGEKLLWAL  382

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            ++ IA T  +VA FSIG  P+TWVYS+EIFPLKLRA G  +G  +NRV +  VSM+FIS+
Sbjct  383  SLCIASTYIFVAFFSIGLAPVTWVYSAEIFPLKLRAQGVGIGVAVNRVMNATVSMSFISI  442

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGGSFF++A IA V W FFF L+P
Sbjct  443  YKAITIGGSFFMFAGIAVVAWWFFFFLLP  471



>ref|XP_009371568.1| PREDICTED: probable polyol transporter 6 [Pyrus x bretschneideri]
Length=504

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 112/149 (75%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+ +G TKTVFI VAT  LDK GRR LLLTS GGM+  L  LG  LT+ +HS EK+ WA+
Sbjct  328  TVGVGLTKTVFICVATLFLDKAGRRRLLLTSTGGMIIALTGLGFGLTMAEHSKEKLTWAL  387

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            + +I     +VA FSIG GPITWVYS+EIFPLKLRA G S+G  +NR+ +  VSM+FIS+
Sbjct  388  SFSIVAVYVFVAFFSIGLGPITWVYSTEIFPLKLRAQGSSIGVAVNRLMNATVSMSFISI  447

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FF++A IA + W+FFF  +P
Sbjct  448  YKAITIGGAFFMFAGIAVLAWIFFFFFLP  476



>ref|XP_003540961.2| PREDICTED: polyol transporter 5-like [Glycine max]
Length=531

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+A+GF KTV ILVATF LD+ GRR LLL SV G++ +L  LG+SLTV+DHS   + WAV
Sbjct  337  TVAVGFVKTVSILVATFFLDRAGRRVLLLCSVSGLILSLLTLGLSLTVVDHSQTTLNWAV  396

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++IA  L+YVA FSIG+GPITWVYSSEIFPL+LRA G ++G  +NRVTSGV++MTF+SL
Sbjct  397  GLSIAAVLSYVATFSIGSGPITWVYSSEIFPLRLRAQGVAIGAAVNRVTSGVIAMTFLSL  456

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KAI+IGG+FFL+A +AAV W+F +TL+P
Sbjct  457  QKAITIGGAFFLFAGVAAVAWIFHYTLLP  485



>emb|CDY70259.1| BnaCnng67460D [Brassica napus]
Length=244

 Score =   175 bits (443),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 114/150 (76%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH-EKVPWA  534
            T+A+G  KT+FI+V T  +D+FGRR LLLTS+GGM  +L  LG SLTVID +  + + WA
Sbjct  59   TVAVGVVKTLFIVVGTCVVDRFGRRALLLTSMGGMFLSLTALGTSLTVIDRNPGQTLKWA  118

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            + +++   + +VA FSIGAGP+TWVY SEIFP++LRA G SLG  +NR+ SG++ MTF+S
Sbjct  119  IGLSVTTVMTFVATFSIGAGPVTWVYCSEIFPVRLRAQGASLGVMLNRLMSGIIGMTFLS  178

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L K ++IGG+F L+A +AA  WVFFFT +P
Sbjct  179  LSKGLTIGGAFLLFAGVAAAAWVFFFTFLP  208



>emb|CDP10064.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   172 bits (435),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 113/150 (75%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SHEKVPWA  534
            TIA+G TKT+FIL++T  LD+ GRR LL+ S  G+V +L  L + LTVIDH   +K+ WA
Sbjct  332  TIAVGVTKTIFILISTCYLDRVGRRVLLIASSAGLVASLWGLAIGLTVIDHYPGQKLTWA  391

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            + ++   TL+ VA FS G GPI WVYSSEIFPLKLRA G S+   INRVTSG++ MTFIS
Sbjct  392  IGISFFCTLSSVATFSSGMGPIAWVYSSEIFPLKLRAQGNSIAVAINRVTSGIILMTFIS  451

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            LYKAI+IGGSFF Y AIA  G++FF TL+P
Sbjct  452  LYKAITIGGSFFFYGAIAFAGFLFFCTLLP  481


 Score = 52.8 bits (125),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -2

Query  265  QTQGKTLEETEALFGTFFRWRSRQREVDAKKANN  164
            +T+G++LEETE LFGTFFRWRSR REV+++K  N
Sbjct  482  ETKGRSLEETEELFGTFFRWRSRAREVESRKWEN  515



>ref|XP_008338123.1| PREDICTED: probable polyol transporter 6 [Malus domestica]
Length=504

 Score =   181 bits (459),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 112/149 (75%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            T+ +G TK VFI VAT  LDK GRR LLLTS GGM+  LA LG  LT+ +HS EK+ WA+
Sbjct  328  TVGVGLTKXVFICVATLFLDKAGRRRLLLTSTGGMIIALAGLGFGLTMAEHSKEKLTWAL  387

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
            + +I     +VA FSIG GPITWVYS+EIFPLKLRA G S+G  +NR+ +  VSM+FIS+
Sbjct  388  SFSIVAIYVFVAFFSIGLGPITWVYSTEIFPLKLRAQGTSIGVAVNRLMNATVSMSFISI  447

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            YKAI+IGG+FF++A IA + W+FFF  +P
Sbjct  448  YKAITIGGAFFMFAGIAVLAWIFFFFFLP  476



>ref|XP_009109331.1| PREDICTED: probable polyol transporter 6 [Brassica rapa]
Length=506

 Score =   181 bits (459),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 111/149 (74%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TI +G  KT FIL ATF LDK GRR LLLTSVGGMV  L +LG  LT+  +S  K+ WA+
Sbjct  329  TIGVGIMKTTFILTATFLLDKVGRRKLLLTSVGGMVCALTMLGFGLTMAQNSGGKLAWAL  388

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++I    ++VA FSIG GPITWVYSSE+FPLKLRA G SLG  +NRV +  VSM+F+SL
Sbjct  389  VLSIVSAYSFVAVFSIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRVMNATVSMSFLSL  448

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             +AI+ GG+FF++A +AAV W FFF LMP
Sbjct  449  TRAITTGGAFFMFAGVAAVAWNFFFFLMP  477



>gb|EMT00465.1| Putative polyol transporter 1 [Aegilops tauschii]
Length=514

 Score =   181 bits (459),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 115/150 (77%), Gaps = 1/150 (1%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVI-DHSHEKVPWA  534
            T A+G TKT+FIL+ATF +D+ GRRPLLLTS  GM+  L  LG  LTV+  H  EK+ WA
Sbjct  324  TCAMGVTKTLFILLATFQIDRVGRRPLLLTSTAGMLVCLIGLGTGLTVVGQHPDEKITWA  383

Query  533  VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  354
            + + IA TLAYV+ FS+G GPIT VY SE+FPL++RA G +LG   NRVTS  +SMTF+S
Sbjct  384  IGLCIASTLAYVSFFSMGLGPITSVYVSEVFPLRVRALGFALGVACNRVTSAAISMTFLS  443

Query  353  LYKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
            L KAI+IGGSFFLYA +AA+GW+FF+  +P
Sbjct  444  LSKAITIGGSFFLYAGLAALGWLFFYAFVP  473



>emb|CDY24775.1| BnaA08g15350D [Brassica napus]
Length=506

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 111/149 (74%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TI +G  KT FIL ATF LDK GRR LLLTSVGGMV  L +LG  LT+  +S  K+ WA+
Sbjct  329  TIGVGIMKTTFILTATFLLDKVGRRKLLLTSVGGMVCALTMLGFGLTMAQNSGGKLAWAL  388

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++I    ++VA FSIG GPITWVYSSE+FPLKLRA G SLG  +NRV +  VSM+F+SL
Sbjct  389  VLSIVSAYSFVAVFSIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRVMNATVSMSFLSL  448

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             +AI+ GG+FF++A +AAV W FFF LMP
Sbjct  449  TRAITTGGAFFMFAGVAAVAWNFFFFLMP  477



>emb|CDX75588.1| BnaA01g01140D [Brassica napus]
Length=481

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 110/149 (74%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TI +G  KT FI  ATF LDK GRR LLLTSVGGMV  L +LG  LT+  +S  K+ WA+
Sbjct  304  TIGVGIMKTTFIFTATFLLDKVGRRKLLLTSVGGMVCALTMLGFGLTMAQNSGGKLAWAL  363

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++I    ++VA FSIG GPITWVYSSE+FPLKLRA G SLG  +NRV +  VSM+F+SL
Sbjct  364  VLSIVSAYSFVAVFSIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRVMNATVSMSFLSL  423

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             KAI+ GG+FF++A +AAV W FFF LMP
Sbjct  424  TKAITTGGAFFMFAGVAAVAWNFFFFLMP  452



>emb|CDY35469.1| BnaC03g61910D [Brassica napus]
Length=507

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 111/149 (74%), Gaps = 0/149 (0%)
 Frame = -1

Query  710  TIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAV  531
            TI +G  KT FI +ATF LDK GRR LLLTSVGGMV  L +LG  LT+  +S  K+ WA+
Sbjct  330  TIGVGIMKTTFIFIATFLLDKVGRRKLLLTSVGGMVCALTMLGFGLTMAQNSGGKLAWAL  389

Query  530  AMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISL  351
             ++I    ++VA FSIG GPITWVYSSE+FPLKLRA G SLG  +NRV +  VSM+F+SL
Sbjct  390  VLSIVSAYSFVAVFSIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRVMNATVSMSFLSL  449

Query  350  YKAISIGGSFFLYAAIAAVGWVFFFTLMP  264
             +AI+ GG+FF++A +AAV W FFF LMP
Sbjct  450  TRAITTGGAFFMFAGVAAVAWNFFFFLMP  478



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1219970116365