BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF013F12

Length=764
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006354678.1|  PREDICTED: protein ECERIFERUM 1-like               305   8e-96   
ref|XP_004253517.1|  PREDICTED: protein CER1-like 1                     290   3e-95   Solanum lycopersicum
ref|XP_009779400.1|  PREDICTED: protein ECERIFERUM 1-like               308   6e-95   Nicotiana sylvestris
ref|XP_006354616.1|  PREDICTED: protein ECERIFERUM 1-like               302   2e-94   Solanum tuberosum [potatoes]
ref|XP_009760058.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    301   3e-94   Nicotiana sylvestris
ref|XP_009760057.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    301   3e-94   Nicotiana sylvestris
ref|XP_009612940.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    296   3e-94   
ref|XP_009793428.1|  PREDICTED: protein ECERIFERUM 1-like               299   3e-93   Nicotiana sylvestris
ref|XP_004229695.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    298   3e-93   Solanum lycopersicum
ref|XP_009787252.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    297   4e-93   Nicotiana sylvestris
ref|XP_010324966.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    298   4e-93   
ref|XP_009600723.1|  PREDICTED: protein ECERIFERUM 1-like               298   6e-93   Nicotiana tomentosiformis
ref|XP_009787251.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    298   8e-93   Nicotiana sylvestris
ref|XP_004229696.2|  PREDICTED: protein ECERIFERUM 1-like               303   2e-92   
ref|XP_009614034.1|  PREDICTED: protein ECERIFERUM 1-like               297   2e-92   Nicotiana tomentosiformis
ref|XP_009612939.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    296   2e-92   Nicotiana tomentosiformis
ref|XP_011085147.1|  PREDICTED: protein ECERIFERUM 1-like               294   2e-91   Sesamum indicum [beniseed]
ref|XP_009625188.1|  PREDICTED: protein ECERIFERUM 1-like               294   2e-91   
ref|XP_004234847.1|  PREDICTED: protein ECERIFERUM 1-like               292   1e-90   Solanum lycopersicum
ref|XP_006357723.1|  PREDICTED: protein ECERIFERUM 1-like               291   1e-90   Solanum tuberosum [potatoes]
gb|EYU42308.1|  hypothetical protein MIMGU_mgv1a002931mg                291   3e-90   Erythranthe guttata [common monkey flower]
ref|XP_009586975.1|  PREDICTED: protein ECERIFERUM 1-like               289   1e-89   Nicotiana tomentosiformis
gb|EYU42307.1|  hypothetical protein MIMGU_mgv1a003396mg                285   3e-88   Erythranthe guttata [common monkey flower]
ref|XP_009760059.1|  PREDICTED: protein ECERIFERUM 1-like isoform X3    285   4e-88   Nicotiana sylvestris
ref|XP_006361513.1|  PREDICTED: protein ECERIFERUM 1-like               284   1e-87   Solanum tuberosum [potatoes]
ref|XP_011093465.1|  PREDICTED: protein ECERIFERUM 1-like               283   4e-87   Sesamum indicum [beniseed]
ref|XP_006354617.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    283   4e-87   
ref|XP_006354620.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    280   3e-86   Solanum tuberosum [potatoes]
ref|XP_006354619.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    280   4e-86   
ref|XP_006365794.1|  PREDICTED: protein ECERIFERUM 1-like               276   2e-84   
gb|KCW76791.1|  hypothetical protein EUGRSUZ_D011442                    268   4e-84   Eucalyptus grandis [rose gum]
emb|CBI16758.3|  unnamed protein product                                264   5e-84   Vitis vinifera
gb|AFV29812.1|  sterol desaturase-like protein                          260   8e-84   Senecio aethnensis
emb|CDP09363.1|  unnamed protein product                                273   1e-83   Coffea canephora [robusta coffee]
gb|AFV29804.1|  sterol desaturase-like protein                          259   3e-83   Senecio aethnensis
gb|AFV29806.1|  sterol desaturase-like protein                          259   3e-83   Senecio aethnensis
gb|EYU40308.1|  hypothetical protein MIMGU_mgv1a002952mg                272   4e-83   Erythranthe guttata [common monkey flower]
gb|AFV29820.1|  sterol desaturase-like protein                          258   4e-83   Senecio chrysanthemifolius
ref|XP_010042043.1|  PREDICTED: protein ECERIFERUM 1-like               263   2e-82   
emb|CAN63491.1|  hypothetical protein VITISV_032726                     262   9e-82   Vitis vinifera
ref|XP_002263787.2|  PREDICTED: protein ECERIFERUM 1-like               268   1e-81   Vitis vinifera
emb|CAN83072.1|  hypothetical protein VITISV_026148                     258   2e-81   Vitis vinifera
ref|XP_010052726.1|  PREDICTED: protein ECERIFERUM 1-like               267   3e-81   Eucalyptus grandis [rose gum]
ref|XP_004252845.1|  PREDICTED: protein ECERIFERUM 1                    266   7e-81   Solanum lycopersicum
ref|XP_011093466.1|  PREDICTED: protein ECERIFERUM 1-like               266   1e-80   Sesamum indicum [beniseed]
ref|XP_002265685.2|  PREDICTED: protein ECERIFERUM 1-like               265   3e-80   Vitis vinifera
gb|KCW76795.1|  hypothetical protein EUGRSUZ_D01146                     252   7e-80   Eucalyptus grandis [rose gum]
ref|XP_007041194.1|  CER1 protein                                       262   9e-80   
emb|CBI16761.3|  unnamed protein product                                263   1e-79   Vitis vinifera
ref|XP_003633900.1|  PREDICTED: protein ECERIFERUM 1-like               262   3e-79   Vitis vinifera
ref|XP_002265189.2|  PREDICTED: protein ECERIFERUM 1                    262   3e-79   Vitis vinifera
ref|XP_002320584.1|  ECERIFERUM 1 family protein                        261   8e-79   
ref|XP_010054530.1|  PREDICTED: protein ECERIFERUM 1-like               251   4e-78   
ref|XP_007041196.1|  CER1 protein                                       259   5e-78   
ref|XP_007008729.1|  Fatty acid hydroxylase superfamily isoform 1       258   1e-77   Theobroma cacao [chocolate]
ref|XP_002262647.1|  PREDICTED: protein ECERIFERUM 1                    257   3e-77   
ref|XP_007041192.1|  CER1 protein                                       255   5e-77   
ref|XP_007219469.1|  hypothetical protein PRUPE_ppa021389mg             244   6e-77   Prunus persica
ref|XP_002262785.1|  PREDICTED: protein ECERIFERUM 1                    254   2e-76   Vitis vinifera
ref|XP_010054531.1|  PREDICTED: protein ECERIFERUM 1-like               254   2e-76   Eucalyptus grandis [rose gum]
gb|KJB76251.1|  hypothetical protein B456_012G081600                    249   1e-74   Gossypium raimondii
ref|XP_011005107.1|  PREDICTED: protein ECERIFERUM 1-like               250   1e-74   Populus euphratica
ref|XP_002526512.1|  sterol desaturase, putative                        249   2e-74   Ricinus communis
ref|XP_010052731.1|  PREDICTED: protein ECERIFERUM 1-like               249   2e-74   Eucalyptus grandis [rose gum]
gb|KJB67449.1|  hypothetical protein B456_010G191200                    249   2e-74   Gossypium raimondii
ref|XP_006375527.1|  hypothetical protein POPTR_0014s15110g             249   3e-74   Populus trichocarpa [western balsam poplar]
gb|KJB76257.1|  hypothetical protein B456_012G081600                    249   3e-74   Gossypium raimondii
gb|KJB67446.1|  hypothetical protein B456_010G191100                    246   7e-74   Gossypium raimondii
ref|XP_008232308.1|  PREDICTED: protein ECERIFERUM 1-like               247   8e-74   Prunus mume [ume]
ref|XP_007220541.1|  hypothetical protein PRUPE_ppa002903mg             248   8e-74   
ref|XP_007218858.1|  hypothetical protein PRUPE_ppa002770mg             248   9e-74   
ref|XP_008338420.1|  PREDICTED: protein ECERIFERUM 1-like               247   2e-73   
gb|KHG15491.1|  Protein WAX2 -like protein                              246   2e-73   Gossypium arboreum [tree cotton]
gb|EPS60467.1|  hypothetical protein M569_14337                         246   2e-73   Genlisea aurea
ref|XP_009376851.1|  PREDICTED: protein ECERIFERUM 1-like               246   2e-73   Pyrus x bretschneideri [bai li]
gb|KJB67445.1|  hypothetical protein B456_010G191100                    246   3e-73   Gossypium raimondii
ref|XP_008232261.1|  PREDICTED: protein ECERIFERUM 1-like               245   7e-73   Prunus mume [ume]
ref|XP_011012757.1|  PREDICTED: protein ECERIFERUM 1-like               245   7e-73   Populus euphratica
gb|KJB67450.1|  hypothetical protein B456_010G191300                    246   9e-73   Gossypium raimondii
ref|XP_006445500.1|  hypothetical protein CICLE_v10019279mg             245   9e-73   Citrus clementina [clementine]
ref|XP_008245904.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    244   9e-73   
gb|EPS71900.1|  hypothetical protein M569_02856                         244   1e-72   Genlisea aurea
ref|XP_007220536.1|  hypothetical protein PRUPE_ppa002824mg             244   2e-72   Prunus persica
ref|XP_004307281.1|  PREDICTED: protein ECERIFERUM 1-like               244   3e-72   Fragaria vesca subsp. vesca
ref|XP_008344085.1|  PREDICTED: protein ECERIFERUM 1-like               244   3e-72   Malus domestica [apple tree]
ref|XP_009337263.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    243   3e-72   Pyrus x bretschneideri [bai li]
ref|XP_008232283.1|  PREDICTED: protein ECERIFERUM 1-like               243   3e-72   Prunus mume [ume]
ref|XP_008245903.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    243   3e-72   Prunus mume [ume]
gb|KHG03871.1|  Protein WAX2 -like protein                              243   4e-72   Gossypium arboreum [tree cotton]
gb|KHN30013.1|  Protein WAX2                                            243   4e-72   Glycine soja [wild soybean]
ref|XP_011085187.1|  PREDICTED: protein ECERIFERUM 1-like               243   5e-72   Sesamum indicum [beniseed]
ref|XP_009337266.1|  PREDICTED: protein ECERIFERUM 1-like               238   5e-72   
gb|KJB76286.1|  hypothetical protein B456_012G081500                    243   6e-72   Gossypium raimondii
ref|XP_007218863.1|  hypothetical protein PRUPE_ppa002893mg             243   6e-72   Prunus persica
gb|KJB76287.1|  hypothetical protein B456_012G081500                    243   6e-72   Gossypium raimondii
ref|XP_009376850.1|  PREDICTED: protein ECERIFERUM 1-like               243   6e-72   
ref|XP_004133955.1|  PREDICTED: protein ECERIFERUM 1-like               242   9e-72   Cucumis sativus [cucumbers]
gb|KEH17984.1|  fatty acid hydroxylase superfamily protein              243   2e-71   Medicago truncatula
ref|XP_010052747.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    241   2e-71   Eucalyptus grandis [rose gum]
ref|XP_007041186.1|  Fatty acid hydroxylase superfamily isoform 2       241   3e-71   
ref|XP_007041185.1|  Fatty acid hydroxylase superfamily isoform 1       241   3e-71   
ref|XP_010052746.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    241   3e-71   Eucalyptus grandis [rose gum]
ref|XP_008232262.1|  PREDICTED: protein ECERIFERUM 1-like               241   4e-71   Prunus mume [ume]
ref|XP_008364777.1|  PREDICTED: protein ECERIFERUM 1-like               241   4e-71   
emb|CBI16760.3|  unnamed protein product                                249   5e-71   Vitis vinifera
ref|XP_009586962.1|  PREDICTED: protein ECERIFERUM 1-like               240   5e-71   Nicotiana tomentosiformis
gb|KJB76256.1|  hypothetical protein B456_012G081600                    241   6e-71   Gossypium raimondii
ref|XP_010691969.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    236   1e-70   
gb|KDP28917.1|  hypothetical protein JCGZ_14688                         238   1e-70   Jatropha curcas
ref|XP_007015845.1|  CER1 protein                                       238   3e-70   
ref|XP_008438253.1|  PREDICTED: protein ECERIFERUM 1-like               238   3e-70   Cucumis melo [Oriental melon]
ref|XP_003529007.1|  PREDICTED: protein ECERIFERUM 1-like               238   4e-70   Glycine max [soybeans]
ref|XP_009797701.1|  PREDICTED: protein ECERIFERUM 1-like               238   5e-70   Nicotiana sylvestris
ref|XP_009337262.1|  PREDICTED: protein ECERIFERUM 1-like               238   6e-70   Pyrus x bretschneideri [bai li]
ref|XP_004510148.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    235   6e-70   
ref|XP_008375723.1|  PREDICTED: protein ECERIFERUM 1-like               237   9e-70   
ref|XP_007134354.1|  hypothetical protein PHAVU_010G040500g             237   9e-70   Phaseolus vulgaris [French bean]
gb|KDO85390.1|  hypothetical protein CISIN_1g006590mg                   231   1e-69   Citrus sinensis [apfelsine]
ref|XP_010691968.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    236   2e-69   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU40309.1|  hypothetical protein MIMGU_mgv1a003047mg                236   2e-69   Erythranthe guttata [common monkey flower]
gb|EYU40310.1|  hypothetical protein MIMGU_mgv1a003047mg                236   2e-69   Erythranthe guttata [common monkey flower]
gb|KDO42773.1|  hypothetical protein CISIN_1g041887mg                   224   3e-69   Citrus sinensis [apfelsine]
ref|XP_004308720.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    235   4e-69   Fragaria vesca subsp. vesca
ref|XP_007015842.1|  CER1 protein isoform 1                             235   5e-69   
ref|XP_004510150.1|  PREDICTED: protein ECERIFERUM 1-like               235   6e-69   Cicer arietinum [garbanzo]
gb|KHN40120.1|  Protein WAX2                                            235   7e-69   Glycine soja [wild soybean]
ref|XP_009337264.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    234   7e-69   Pyrus x bretschneideri [bai li]
ref|XP_004510147.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    234   7e-69   Cicer arietinum [garbanzo]
gb|KDO85389.1|  hypothetical protein CISIN_1g006590mg                   230   1e-68   Citrus sinensis [apfelsine]
ref|XP_003626834.1|  gl1-like protein                                   234   2e-68   Medicago truncatula
ref|XP_003530144.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    233   3e-68   Glycine max [soybeans]
ref|XP_007041184.1|  Fatty acid hydroxylase superfamily                 239   3e-68   
gb|KDO85388.1|  hypothetical protein CISIN_1g006590mg                   230   4e-68   Citrus sinensis [apfelsine]
ref|XP_010255638.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    233   2e-67   
ref|XP_006464363.1|  PREDICTED: protein ECERIFERUM 1-like isoform X3    230   3e-67   
ref|XP_009788099.1|  PREDICTED: protein CER1-like 1                     216   4e-67   Nicotiana sylvestris
gb|KDO85387.1|  hypothetical protein CISIN_1g006590mg                   230   5e-67   Citrus sinensis [apfelsine]
ref|XP_011469549.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    229   7e-67   Fragaria vesca subsp. vesca
ref|XP_006464361.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    229   7e-67   Citrus sinensis [apfelsine]
ref|XP_006354618.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    229   8e-67   
ref|XP_006445499.1|  hypothetical protein CICLE_v10019265mg             229   8e-67   Citrus clementina [clementine]
ref|XP_010097746.1|  Protein WAX2                                       229   9e-67   
ref|XP_010920316.1|  PREDICTED: protein ECERIFERUM 1-like               229   1e-66   Elaeis guineensis
ref|XP_010691966.1|  PREDICTED: protein ECERIFERUM 1-like               229   1e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006464362.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    228   2e-66   Citrus sinensis [apfelsine]
gb|KJB09060.1|  hypothetical protein B456_001G122000                    228   4e-66   Gossypium raimondii
ref|XP_007134355.1|  hypothetical protein PHAVU_010G040600g             227   4e-66   Phaseolus vulgaris [French bean]
ref|XP_003625020.1|  Protein WAX2                                       226   1e-65   
ref|XP_004307280.1|  PREDICTED: protein ECERIFERUM 1-like               226   1e-65   Fragaria vesca subsp. vesca
gb|KHN40121.1|  Protein WAX2                                            226   2e-65   Glycine soja [wild soybean]
ref|XP_010255640.1|  PREDICTED: protein ECERIFERUM 1-like               226   2e-65   Nelumbo nucifera [Indian lotus]
ref|XP_003625022.1|  Protein WAX2                                       225   3e-65   Medicago truncatula
ref|XP_010276564.1|  PREDICTED: protein ECERIFERUM 1-like               224   4e-65   Nelumbo nucifera [Indian lotus]
ref|XP_006480707.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    224   5e-65   
ref|XP_002526511.1|  sterol desaturase, putative                        224   5e-65   
gb|KEH23596.1|  fatty acid hydroxylase superfamily protein              222   8e-65   Medicago truncatula
ref|XP_003606194.1|  Protein WAX2                                       223   9e-65   
ref|XP_006428971.1|  hypothetical protein CICLE_v10011291mg             224   1e-64   Citrus clementina [clementine]
ref|NP_001146661.1|  uncharacterized protein LOC100280261               224   1e-64   Zea mays [maize]
gb|KHG12604.1|  Protein WAX2 -like protein                              224   1e-64   Gossypium arboreum [tree cotton]
gb|AES88391.2|  fatty acid hydroxylase superfamily protein              223   2e-64   Medicago truncatula
ref|XP_004168237.1|  PREDICTED: protein ECERIFERUM 1-like               223   2e-64   
ref|XP_003574037.1|  PREDICTED: protein ECERIFERUM 1-like               223   2e-64   Brachypodium distachyon [annual false brome]
ref|XP_010936012.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    223   3e-64   Elaeis guineensis
ref|XP_004145021.1|  PREDICTED: protein ECERIFERUM 1-like               222   3e-64   
ref|XP_008460068.1|  PREDICTED: protein ECERIFERUM 1-like               222   3e-64   Cucumis melo [Oriental melon]
ref|XP_010936011.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    223   3e-64   Elaeis guineensis
gb|ACG35856.1|  CER1                                                    221   7e-64   Zea mays [maize]
ref|XP_003625024.1|  Protein WAX2                                       221   9e-64   
ref|XP_006661851.1|  PREDICTED: protein ECERIFERUM 1-like               221   9e-64   
emb|CDP09364.1|  unnamed protein product                                221   1e-63   Coffea canephora [robusta coffee]
ref|XP_002464501.1|  hypothetical protein SORBIDRAFT_01g019590          221   1e-63   Sorghum bicolor [broomcorn]
ref|XP_010496479.1|  PREDICTED: protein CER1-like 1                     213   3e-63   
gb|KHN13741.1|  Protein WAX2                                            214   3e-63   Glycine soja [wild soybean]
ref|XP_010480305.1|  PREDICTED: protein CER1-like 1 isoform X1          219   5e-63   Camelina sativa [gold-of-pleasure]
ref|XP_008438252.1|  PREDICTED: protein ECERIFERUM 1-like               219   5e-63   Cucumis melo [Oriental melon]
ref|XP_004982905.1|  PREDICTED: protein ECERIFERUM 1-like               219   5e-63   Setaria italica
ref|XP_010480306.1|  PREDICTED: protein CER1-like 1 isoform X2          219   5e-63   Camelina sativa [gold-of-pleasure]
ref|XP_003574039.1|  PREDICTED: protein ECERIFERUM 1-like               219   5e-63   
ref|XP_010276559.1|  PREDICTED: protein ECERIFERUM 1-like               219   6e-63   Nelumbo nucifera [Indian lotus]
gb|ABG66132.1|  CER1 protein, putative, expressed                       218   7e-63   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67150.1|  hypothetical protein OsI_33995                          219   8e-63   Oryza sativa Indica Group [Indian rice]
ref|NP_001064826.1|  Os10g0471100                                       218   1e-62   
ref|XP_006306552.1|  hypothetical protein CARUB_v10012639mg             218   1e-62   Capsella rubella
gb|AES88379.2|  fatty acid hydroxylase superfamily protein              218   1e-62   Medicago truncatula
ref|XP_003606182.1|  Protein WAX2                                       217   2e-62   
ref|XP_003521032.2|  PREDICTED: protein ECERIFERUM 1-like               218   3e-62   
ref|XP_010511349.1|  PREDICTED: protein CER1-like 1                     217   4e-62   Camelina sativa [gold-of-pleasure]
dbj|BAF01865.1|  CER1 protein                                           211   5e-62   Arabidopsis thaliana [mouse-ear cress]
emb|CDY07774.1|  BnaA03g17370D                                          214   5e-62   Brassica napus [oilseed rape]
gb|EMT15822.1|  Protein WAX2                                            211   6e-62   
ref|XP_010414810.1|  PREDICTED: protein CER1-like 1 isoform X1          216   7e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010414811.1|  PREDICTED: protein CER1-like 1 isoform X2          216   8e-62   Camelina sativa [gold-of-pleasure]
ref|XP_008796440.1|  PREDICTED: uncharacterized protein LOC103711898    222   1e-61   
ref|XP_004171948.1|  PREDICTED: protein ECERIFERUM 1-like               212   2e-61   
ref|XP_010539481.1|  PREDICTED: protein CER1-like 2                     216   2e-61   Tarenaya hassleriana [spider flower]
ref|XP_006410962.1|  hypothetical protein EUTSA_v10016375mg             215   2e-61   Eutrema salsugineum [saltwater cress]
ref|XP_009133199.1|  PREDICTED: protein CER1-like 2                     214   3e-61   Brassica rapa
ref|XP_007041187.1|  Fatty acid hydroxylase superfamily isoform 3       213   4e-61   
ref|XP_010496698.1|  PREDICTED: protein ECERIFERUM 1-like               208   5e-61   
ref|XP_010493027.1|  PREDICTED: protein CER1-like 1                     214   6e-61   Camelina sativa [gold-of-pleasure]
ref|XP_006857470.1|  hypothetical protein AMTR_s00067p00188650          214   6e-61   Amborella trichopoda
ref|NP_850932.2|  protein ECERIFERUM 1                                  210   6e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010512796.1|  PREDICTED: protein ECERIFERUM 1-like               206   7e-61   
gb|KGN56666.1|  hypothetical protein Csa_3G127770                       213   8e-61   Cucumis sativus [cucumbers]
ref|XP_010255641.1|  PREDICTED: protein ECERIFERUM 1-like               213   8e-61   Nelumbo nucifera [Indian lotus]
ref|XP_004493412.1|  PREDICTED: protein ECERIFERUM 1-like               213   9e-61   
ref|XP_010496697.1|  PREDICTED: protein CER1-like 1                     213   1e-60   Camelina sativa [gold-of-pleasure]
ref|XP_008438263.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    213   1e-60   Cucumis melo [Oriental melon]
gb|EPS65064.1|  hypothetical protein M569_09713                         213   1e-60   Genlisea aurea
ref|XP_008361247.1|  PREDICTED: protein ECERIFERUM 1-like               211   2e-60   
ref|XP_008438264.1|  PREDICTED: protein ECERIFERUM 1-like isoform X3    209   2e-60   Cucumis melo [Oriental melon]
gb|KDO85382.1|  hypothetical protein CISIN_1g006590mg                   212   3e-60   Citrus sinensis [apfelsine]
ref|XP_006418509.1|  hypothetical protein EUTSA_v10009534mg             212   3e-60   
ref|XP_006306971.1|  hypothetical protein CARUB_v10008547mg             211   5e-60   
gb|KGN56664.1|  hypothetical protein Csa_3G127750                       211   6e-60   Cucumis sativus [cucumbers]
ref|XP_004134362.1|  PREDICTED: protein ECERIFERUM 1-like               211   6e-60   
ref|XP_008369652.1|  PREDICTED: protein ECERIFERUM 1-like               208   7e-60   
ref|XP_010247895.1|  PREDICTED: protein ECERIFERUM 1-like               211   7e-60   Nelumbo nucifera [Indian lotus]
ref|XP_010479268.1|  PREDICTED: protein CER1-like 1                     211   9e-60   Camelina sativa [gold-of-pleasure]
gb|EAY87991.1|  hypothetical protein OsI_09413                          210   1e-59   Oryza sativa Indica Group [Indian rice]
ref|XP_006375521.1|  hypothetical protein POPTR_0014s15050g             209   1e-59   
ref|XP_009410811.1|  PREDICTED: protein ECERIFERUM 1-like               209   2e-59   
ref|XP_006375524.1|  hypothetical protein POPTR_0014s15080g             209   2e-59   
ref|NP_171721.3|  protein CER1-like 1                                   209   3e-59   Arabidopsis thaliana [mouse-ear cress]
gb|AAC24373.1|  CER1-like protein                                       209   3e-59   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973742.1|  protein CER1-like 1                                   209   3e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008438262.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    209   4e-59   Cucumis melo [Oriental melon]
ref|XP_010509285.1|  PREDICTED: protein CER1-like 2                     209   4e-59   Camelina sativa [gold-of-pleasure]
gb|EMS58604.1|  Protein WAX2                                            208   4e-59   Triticum urartu
emb|CAA65200.1|  CER1-like                                              209   4e-59   Arabidopsis thaliana [mouse-ear cress]
gb|AAB87721.1|  maize gl1 homolog                                       208   5e-59   Arabidopsis thaliana [mouse-ear cress]
ref|NP_171723.2|  protein ECERIFERUM 1                                  208   5e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004253318.1|  PREDICTED: protein CER1-like 2                     208   7e-59   
dbj|BAK00236.1|  predicted protein                                      208   8e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX74937.1|  BnaA05g06830D                                          207   8e-59   
gb|EMS58603.1|  hypothetical protein TRIUR3_05201                       203   8e-59   Triticum urartu
ref|NP_001048490.1|  Os02g0814200                                       208   8e-59   
ref|XP_009143457.1|  PREDICTED: protein CER1-like 2                     208   9e-59   Brassica rapa
gb|ABF51011.1|  putative aldehyde decarbonylase enzyme CER1;1           207   9e-59   Hordeum vulgare [barley]
gb|AAC23640.1|  CER1-like protein                                       208   9e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011466125.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    207   9e-59   Fragaria vesca subsp. vesca
ref|XP_011466122.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    207   1e-58   Fragaria vesca subsp. vesca
gb|KFK36660.1|  hypothetical protein AALP_AA4G153400                    207   1e-58   Arabis alpina [alpine rockcress]
ref|XP_009384064.1|  PREDICTED: protein ECERIFERUM 1-like               207   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001184890.1|  protein ECERIFERUM 1                               207   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010517047.1|  PREDICTED: protein CER1-like 2 isoform X2          206   1e-58   
ref|XP_006306997.1|  hypothetical protein CARUB_v10008574mg             207   1e-58   Capsella rubella
gb|KFK42593.1|  hypothetical protein AALP_AA1G015500                    207   2e-58   Arabis alpina [alpine rockcress]
ref|XP_010505369.1|  PREDICTED: protein CER1-like 2                     207   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_002892019.1|  hypothetical protein ARALYDRAFT_470048             206   2e-58   
emb|CDX91381.1|  BnaC04g07690D                                          206   2e-58   
emb|CAA65199.1|  CER1-like                                              206   3e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010517046.1|  PREDICTED: protein CER1-like 2 isoform X1          206   3e-58   Camelina sativa [gold-of-pleasure]
gb|AIE57503.1|  CER1                                                    206   4e-58   Camelina sativa [gold-of-pleasure]
emb|CDX93353.1|  BnaC04g45430D                                          206   4e-58   
ref|XP_010520222.1|  PREDICTED: protein ECERIFERUM 1-like               206   5e-58   Tarenaya hassleriana [spider flower]
ref|XP_006652506.1|  PREDICTED: protein ECERIFERUM 1-like               204   7e-58   
emb|CDY55894.1|  BnaA04g29150D                                          205   1e-57   Brassica napus [oilseed rape]
gb|EMT06855.1|  Protein WAX2                                            204   1e-57   
ref|XP_009141689.1|  PREDICTED: protein CER1-like 2 isoform X2          204   1e-57   Brassica rapa
gb|KFK42594.1|  hypothetical protein AALP_AA1G015600                    204   2e-57   Arabis alpina [alpine rockcress]
emb|CDX93352.1|  BnaC04g45440D                                          203   4e-57   
ref|XP_009141683.1|  PREDICTED: protein CER1-like 2                     202   7e-57   Brassica rapa
emb|CDY55893.1|  BnaA04g29140D                                          202   1e-56   Brassica napus [oilseed rape]
ref|XP_004954341.1|  PREDICTED: protein ECERIFERUM 1-like               202   1e-56   Setaria italica
gb|EMS51791.1|  hypothetical protein TRIUR3_23680                       191   2e-56   Triticum urartu
ref|XP_006418508.1|  hypothetical protein EUTSA_v10007056mg             201   2e-56   
gb|AFK43395.1|  unknown                                                 188   3e-56   Medicago truncatula
ref|XP_002881545.1|  hypothetical protein ARALYDRAFT_321478             201   4e-56   
ref|XP_010535407.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    199   8e-56   
ref|XP_009141688.1|  PREDICTED: protein CER1-like 2 isoform X1          200   9e-56   Brassica rapa
ref|XP_010496713.1|  PREDICTED: protein ECERIFERUM 1 isoform X1         199   1e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010496714.1|  PREDICTED: protein ECERIFERUM 1 isoform X2         199   1e-55   
ref|XP_010496480.1|  PREDICTED: protein ECERIFERUM 1-like               199   1e-55   Camelina sativa [gold-of-pleasure]
ref|XP_004976194.1|  PREDICTED: protein ECERIFERUM 1-like               199   1e-55   Setaria italica
ref|XP_010535406.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    199   1e-55   Tarenaya hassleriana [spider flower]
ref|XP_009118866.1|  PREDICTED: protein ECERIFERUM 1                    199   2e-55   Brassica rapa
emb|CAN60676.1|  hypothetical protein VITISV_029045                     198   2e-55   Vitis vinifera
ref|XP_006857475.1|  hypothetical protein AMTR_s00067p00190600          197   2e-55   
gb|EEE61327.1|  hypothetical protein OsJ_15439                          197   2e-55   
gb|EEC77626.1|  hypothetical protein OsI_16615                          197   4e-55   
gb|AHD24918.1|  CER1                                                    197   6e-55   
emb|CAE03390.2|  OSJNBa0004N05.14                                       197   8e-55   
ref|XP_008779294.1|  PREDICTED: protein ECERIFERUM 1-like               188   1e-54   
ref|NP_181306.3|  protein CER1-like 2                                   196   2e-54   
gb|KCW76761.1|  hypothetical protein EUGRSUZ_D01120                     195   3e-54   
emb|CDY38059.1|  BnaCnng09200D                                          197   4e-54   
gb|EEE57393.1|  hypothetical protein OsJ_07566                          194   6e-54   
ref|NP_001047459.1|  Os02g0621300                                       194   6e-54   
gb|EEC73617.1|  hypothetical protein OsI_08114                          194   6e-54   
emb|CDX79754.1|  BnaC03g20900D                                          194   1e-53   
ref|XP_006295717.1|  hypothetical protein CARUB_v10024836mg             194   1e-53   
ref|XP_002454185.1|  hypothetical protein SORBIDRAFT_04g026320          194   1e-53   
ref|XP_003575378.1|  PREDICTED: protein ECERIFERUM 1-like               193   2e-53   
gb|ACN31737.1|  unknown                                                 192   4e-53   
gb|ACR38546.1|  unknown                                                 192   7e-53   
gb|EMS48099.1|  Protein WAX2                                            190   1e-52   
ref|XP_002454767.1|  hypothetical protein SORBIDRAFT_04g036940          191   2e-52   
gb|EMS68717.1|  Protein WAX2                                            190   3e-52   
gb|ACA14353.1|  TCER1                                                   190   3e-52   
ref|XP_006647531.1|  PREDICTED: protein ECERIFERUM 1-like               190   4e-52   
ref|XP_003570374.1|  PREDICTED: protein ECERIFERUM 1-like               189   5e-52   
gb|EMT07276.1|  Protein WAX2                                            189   6e-52   
gb|EMT33049.1|  Protein WAX2                                            189   7e-52   
ref|XP_002448160.1|  hypothetical protein SORBIDRAFT_06g022320          189   7e-52   
ref|XP_006583526.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    187   1e-51   
gb|AFW64032.1|  hypothetical protein ZEAMMB73_844277                    185   2e-51   
ref|XP_002443045.1|  hypothetical protein SORBIDRAFT_08g006850          182   8e-51   
ref|NP_001141595.1|  uncharacterized protein LOC100273712               185   9e-51   
gb|ABD28318.1|  Sterol desaturase, putative                             174   1e-50   
emb|CDX79752.1|  BnaC03g20880D                                          181   1e-50   
gb|ACG47659.1|  CER1                                                    185   2e-50   
ref|XP_004953128.1|  PREDICTED: protein ECERIFERUM 1-like               185   2e-50   
gb|AFW64026.1|  hypothetical protein ZEAMMB73_844277                    185   3e-50   
gb|EMT04955.1|  Protein WAX2                                            184   3e-50   
gb|AFW64028.1|  hypothetical protein ZEAMMB73_844277                    184   3e-50   
ref|XP_008676841.1|  PREDICTED: uncharacterized protein LOC100273...    184   3e-50   
gb|ABG47420.1|  putative CER1                                           184   4e-50   
gb|EMS58051.1|  Protein WAX2                                            184   4e-50   
ref|XP_008676840.1|  PREDICTED: uncharacterized protein LOC100273...    184   4e-50   
dbj|BAJ85488.1|  predicted protein                                      184   4e-50   
dbj|BAA11025.1|  CER1-like                                              166   1e-47   
gb|ADE77466.1|  unknown                                                 166   2e-46   
emb|CBI16765.3|  unnamed protein product                                160   6e-46   
gb|KHG12333.1|  Protein WAX2                                            165   6e-46   
gb|EMS48098.1|  Protein WAX2                                            171   2e-45   
ref|XP_009141690.1|  PREDICTED: protein CER1-like 2 isoform X3          169   6e-45   
ref|XP_003580122.1|  PREDICTED: protein ECERIFERUM 1-like               168   2e-44   
ref|XP_010661477.1|  PREDICTED: protein ECERIFERUM 1-like               160   4e-43   
emb|CAN81825.1|  hypothetical protein VITISV_014168                     166   4e-42   
ref|XP_004164810.1|  PREDICTED: LOW QUALITY PROTEIN: protein CER1...    149   1e-41   
ref|XP_010097743.1|  Protein WAX2                                       154   4e-39   
ref|XP_007015843.1|  CER1 protein isoform 2                             150   3e-38   
gb|EMT07275.1|  hypothetical protein F775_30507                         142   7e-38   
gb|ABN07983.1|  Sterol desaturase, putative                             139   8e-38   
gb|KDO85383.1|  hypothetical protein CISIN_1g006590mg                   145   2e-36   
ref|XP_006828768.1|  hypothetical protein AMTR_s00001p00090180          131   8e-35   
gb|AAD29719.1|AF143746_1  CER1                                          141   9e-35   
gb|AAC24374.1|  CER1 protein                                            140   2e-34   
ref|XP_006365793.1|  PREDICTED: protein ECERIFERUM 1-like               122   2e-31   
ref|XP_007041189.1|  Fatty acid hydroxylase superfamily isoform 5       129   1e-30   
dbj|BAA11024.1|  possible aldehyde decarbonylase                        129   1e-30   
gb|EEC73226.1|  hypothetical protein OsI_07314                          125   1e-29   
ref|XP_003549515.1|  PREDICTED: protein ECERIFERUM 3-like               123   3e-28   
gb|KHN17538.1|  Protein WAX2                                            122   9e-28   
ref|NP_001063227.1|  Os09g0426800                                       121   9e-28   
ref|XP_003542310.1|  PREDICTED: protein ECERIFERUM 3-like               121   1e-27   
gb|EAZ44800.1|  hypothetical protein OsJ_29433                          121   1e-27   
ref|XP_001783415.1|  predicted protein                                  121   1e-27   
ref|XP_004956872.1|  PREDICTED: protein ECERIFERUM 3-like               120   2e-27   
ref|XP_004973574.1|  PREDICTED: protein ECERIFERUM 3-like               119   5e-27   
ref|XP_002960347.1|  hypothetical protein SELMODRAFT_437448             119   9e-27   
ref|XP_002967368.1|  hypothetical protein SELMODRAFT_408343             119   9e-27   
ref|XP_002891511.1|  hypothetical protein ARALYDRAFT_891843             110   1e-26   
gb|ADE77418.1|  unknown                                                 114   2e-26   
gb|AGT16346.1|  glossy1 protein                                         117   2e-26   
ref|XP_003578148.1|  PREDICTED: protein ECERIFERUM 3-like               117   3e-26   
gb|ACF79426.1|  unknown                                                 114   6e-26   
ref|XP_009120300.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    115   1e-25   
ref|XP_004169575.1|  PREDICTED: protein ECERIFERUM 3-like               111   1e-25   
emb|CDY51280.1|  BnaA10g11680D                                          115   1e-25   
gb|ACN25216.1|  unknown                                                 113   1e-25   
ref|XP_009126813.1|  PREDICTED: protein ECERIFERUM 3                    115   2e-25   
gb|AFW87579.1|  hypothetical protein ZEAMMB73_499314                    113   2e-25   
emb|CDY02769.1|  BnaC02g11200D                                          115   2e-25   
gb|KEH32582.1|  fatty acid hydroxylase superfamily protein              115   2e-25   
gb|ADE75704.1|  unknown                                                 114   2e-25   
emb|CDP02895.1|  unnamed protein product                                114   4e-25   
tpg|DAA61563.1|  TPA: glossy1                                           114   4e-25   
gb|AAR90847.1|  glossy1 protein                                         114   4e-25   
emb|CDY50795.1|  BnaCnng19590D                                          114   4e-25   
ref|XP_008775261.1|  PREDICTED: protein ECERIFERUM 3-like               112   5e-25   
gb|KJB23542.1|  hypothetical protein B456_004G104100                    111   6e-25   
ref|XP_006845484.1|  hypothetical protein AMTR_s00019p00142280          112   8e-25   
ref|NP_001131238.1|  gl1 protein                                        110   9e-25   
ref|XP_007013964.1|  Fatty acid hydroxylase superfamily                 113   9e-25   
ref|NP_001266321.1|  gl1 protein                                        113   1e-24   
ref|XP_008658046.1|  PREDICTED: uncharacterized protein LOC100192...    113   1e-24   
ref|NP_001105247.1|  glossy1                                            113   1e-24   
gb|ACN25689.1|  unknown                                                 113   1e-24   
ref|NP_001146749.1|  uncharacterized protein LOC100280351               111   1e-24   
emb|CDY32747.1|  BnaA02g08090D                                          112   2e-24   
ref|XP_006401167.1|  hypothetical protein EUTSA_v10012960mg             112   2e-24   
dbj|BAK04216.1|  predicted protein                                      111   3e-24   
ref|XP_008794400.1|  PREDICTED: protein ECERIFERUM 3-like               111   3e-24   
ref|XP_002990278.1|  hypothetical protein SELMODRAFT_185167             111   3e-24   
ref|XP_002961424.1|  hypothetical protein SELMODRAFT_164680             111   3e-24   
ref|XP_011070158.1|  PREDICTED: protein ECERIFERUM 3-like               111   3e-24   
ref|XP_009587593.1|  PREDICTED: protein ECERIFERUM 3-like               111   4e-24   
dbj|BAK02959.1|  predicted protein                                      111   4e-24   
ref|XP_002864528.1|  hypothetical protein ARALYDRAFT_495876             111   5e-24   
dbj|BAJ85064.1|  predicted protein                                      111   5e-24   
gb|KJB23543.1|  hypothetical protein B456_004G104100                    110   6e-24   
gb|KJB27033.1|  hypothetical protein B456_004G273200                    110   6e-24   
dbj|BAB08850.1|  lipid transfer protein; glossy1 homolog                110   7e-24   
gb|KJB23544.1|  hypothetical protein B456_004G104100                    110   7e-24   
gb|KJB27032.1|  hypothetical protein B456_004G273200                    110   7e-24   
gb|KJB23541.1|  hypothetical protein B456_004G104100                    110   7e-24   
gb|EMS67420.1|  Protein WAX2                                            110   7e-24   
ref|XP_010929210.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    110   8e-24   
gb|ACN25333.1|  unknown                                                 110   8e-24   
ref|XP_004309858.1|  PREDICTED: protein ECERIFERUM 3                    110   8e-24   
ref|XP_010483318.1|  PREDICTED: protein ECERIFERUM 3                    110   8e-24   
dbj|BAJ85039.1|  predicted protein                                      110   9e-24   
ref|XP_004951702.1|  PREDICTED: protein ECERIFERUM 3-like isoform X3    110   1e-23   
ref|XP_008643558.1|  PREDICTED: uncharacterized protein LOC100280...    110   1e-23   
ref|XP_010443488.1|  PREDICTED: protein ECERIFERUM 3-like               110   1e-23   
ref|XP_008443806.1|  PREDICTED: protein ECERIFERUM 3                    110   1e-23   
ref|XP_011016520.1|  PREDICTED: protein ECERIFERUM 3-like               105   1e-23   
ref|NP_200588.2|  protein ECERIFERUM 3                                  110   1e-23   
gb|KDO62363.1|  hypothetical protein CISIN_1g006768mg                   109   1e-23   
ref|XP_002451653.1|  hypothetical protein SORBIDRAFT_04g005330          110   1e-23   
emb|CDY11847.1|  BnaC03g12730D                                          110   1e-23   
emb|CDX88640.1|  BnaA03g10090D                                          109   2e-23   
gb|KDO62360.1|  hypothetical protein CISIN_1g006768mg                   109   2e-23   
ref|XP_004149879.1|  PREDICTED: protein ECERIFERUM 3-like               109   2e-23   
dbj|BAJ87617.1|  predicted protein                                      109   2e-23   
ref|XP_009766364.1|  PREDICTED: protein ECERIFERUM 3-like               109   2e-23   
ref|XP_006453492.1|  hypothetical protein CICLE_v10007738mg             109   2e-23   
ref|XP_009390985.1|  PREDICTED: protein ECERIFERUM 3-like               109   2e-23   
ref|XP_010904609.1|  PREDICTED: protein ECERIFERUM 3-like               108   3e-23   
gb|KHG27245.1|  Protein WAX2                                            108   3e-23   
ref|XP_011079338.1|  PREDICTED: protein ECERIFERUM 3-like               108   3e-23   
ref|XP_009120299.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    108   3e-23   
emb|CDX88639.1|  BnaA03g10100D                                          108   3e-23   
ref|XP_006343719.1|  PREDICTED: protein ECERIFERUM 3-like               108   3e-23   
ref|XP_002270946.1|  PREDICTED: protein ECERIFERUM 3                    108   4e-23   
ref|XP_004507787.1|  PREDICTED: protein ECERIFERUM 3-like               108   4e-23   
ref|XP_008804902.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    108   4e-23   
ref|XP_004965700.1|  PREDICTED: protein ECERIFERUM 3-like               108   6e-23   
gb|EAZ01917.1|  hypothetical protein OsI_23945                          107   7e-23   
ref|XP_003563334.1|  PREDICTED: protein ECERIFERUM 3-like               107   8e-23   
ref|XP_006279594.1|  hypothetical protein CARUB_v10026077mg             107   8e-23   
ref|NP_001058237.1|  Os06g0653000                                       107   8e-23   
ref|XP_009400348.1|  PREDICTED: protein ECERIFERUM 3-like               107   8e-23   
emb|CDO98263.1|  unnamed protein product                                107   9e-23   
ref|XP_002437383.1|  hypothetical protein SORBIDRAFT_10g025920          107   9e-23   
ref|XP_003570600.1|  PREDICTED: protein ECERIFERUM 3-like               107   1e-22   
gb|KDP38762.1|  hypothetical protein JCGZ_04115                         107   1e-22   
ref|XP_004242647.1|  PREDICTED: protein ECERIFERUM 3                    107   1e-22   
ref|XP_010047031.1|  PREDICTED: protein ECERIFERUM 3                    107   1e-22   
gb|AAB87722.1|  glossy1 homolog                                         106   1e-22   
gb|EYU21788.1|  hypothetical protein MIMGU_mgv1a025856mg                107   1e-22   
ref|XP_011082697.1|  PREDICTED: protein ECERIFERUM 3-like               106   2e-22   
gb|EYU37115.1|  hypothetical protein MIMGU_mgv1a021583mg                106   2e-22   
ref|XP_010452800.1|  PREDICTED: protein ECERIFERUM 3-like               106   2e-22   
ref|XP_011073241.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    106   2e-22   
ref|XP_011073242.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    106   2e-22   
ref|XP_008223562.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         106   3e-22   
ref|XP_011018104.1|  PREDICTED: protein ECERIFERUM 3                    105   3e-22   
ref|XP_010278025.1|  PREDICTED: protein ECERIFERUM 3                    105   3e-22   
ref|XP_001781794.1|  predicted protein                                  105   3e-22   
ref|XP_006646964.1|  PREDICTED: protein ECERIFERUM 3-like               105   5e-22   
emb|CDY11848.1|  BnaC03g12740D                                          105   5e-22   
gb|KHG04939.1|  Protein WAX2                                            105   6e-22   
ref|XP_009788358.1|  PREDICTED: protein ECERIFERUM 3-like               105   6e-22   
ref|XP_003061467.1|  predicted protein                                  105   6e-22   
ref|XP_006657201.1|  PREDICTED: protein ECERIFERUM 3-like               105   6e-22   
ref|XP_009387454.1|  PREDICTED: protein ECERIFERUM 3-like isoform X4    104   7e-22   
ref|XP_009798188.1|  PREDICTED: protein ECERIFERUM 3-like               104   7e-22   
ref|XP_009417462.1|  PREDICTED: protein ECERIFERUM 3-like               104   7e-22   
ref|XP_010914062.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         104   8e-22   
ref|XP_009387453.1|  PREDICTED: protein ECERIFERUM 3-like isoform X3    104   8e-22   
gb|EEC72610.1|  hypothetical protein OsI_06088                          104   8e-22   
ref|XP_010536953.1|  PREDICTED: LOW QUALITY PROTEIN: protein ECER...    104   8e-22   
ref|NP_001046080.1|  Os02g0178800                                       104   9e-22   
ref|XP_007221983.1|  hypothetical protein PRUPE_ppa002836mg             104   1e-21   
ref|XP_009132107.1|  PREDICTED: protein ECERIFERUM 3-like               103   1e-21   
gb|KHG27244.1|  Protein WAX2                                            103   1e-21   
gb|KJB83325.1|  hypothetical protein B456_013G242200                    103   2e-21   
gb|KJB83324.1|  hypothetical protein B456_013G242200                    103   2e-21   
ref|XP_010545441.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         103   2e-21   
gb|KHG30512.1|  Protein WAX2 -like protein                              103   3e-21   
gb|EYU24562.1|  hypothetical protein MIMGU_mgv1a002930mg                103   3e-21   
gb|KJB83318.1|  hypothetical protein B456_013G242200                    103   3e-21   
ref|XP_002325096.1|  hypothetical protein POPTR_0018s10830g             103   3e-21   
gb|KJB83323.1|  hypothetical protein B456_013G242200                    103   3e-21   
ref|XP_002308430.2|  hypothetical protein POPTR_0006s19140g             103   3e-21   
ref|XP_002509294.1|  predicted protein                                  102   4e-21   
gb|AFK49575.1|  unknown                                               96.3    8e-21   
ref|XP_006350059.1|  PREDICTED: protein ECERIFERUM 3-like               102   8e-21   
ref|XP_007154832.1|  hypothetical protein PHAVU_003G1516001g          96.3    8e-21   
ref|XP_010687696.1|  PREDICTED: protein ECERIFERUM 3                    101   1e-20   
emb|CDX88642.1|  BnaA03g10070D                                          100   2e-20   
ref|XP_006836672.1|  hypothetical protein AMTR_s00088p00066300        98.6    2e-20   
emb|CBI25242.3|  unnamed protein product                                100   3e-20   
ref|XP_002270033.2|  PREDICTED: protein ECERIFERUM 3-like               100   3e-20   
ref|XP_002270075.1|  PREDICTED: protein ECERIFERUM 3-like             99.4    5e-20   
dbj|BAK04110.1|  predicted protein                                    99.4    5e-20   
emb|CBI25244.3|  unnamed protein product                              99.4    5e-20   
ref|XP_002975687.1|  hypothetical protein SELMODRAFT_103982           99.4    6e-20   
gb|ACF79563.1|  unknown                                               93.2    1e-19   
ref|XP_010318689.1|  PREDICTED: protein ECERIFERUM 3 isoform X3       98.6    1e-19   
ref|XP_006341693.1|  PREDICTED: protein ECERIFERUM 3-like             98.6    1e-19   
ref|XP_004235875.1|  PREDICTED: protein ECERIFERUM 3 isoform X1       98.2    1e-19   
ref|XP_010318688.1|  PREDICTED: protein ECERIFERUM 3 isoform X2       98.2    1e-19   
ref|XP_003081883.1|  faceless pollen-1 (ISS)                          98.6    1e-19   
emb|CEF99557.1|  Uncharacterised domain Wax2, C-terminal              97.8    2e-19   
ref|XP_010914063.1|  PREDICTED: protein ECERIFERUM 3 isoform X2       97.8    2e-19   



>ref|XP_006354678.1| PREDICTED: protein ECERIFERUM 1-like [Solanum tuberosum]
Length=626

 Score =   305 bits (782),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGT+QVVLRG  SKVA SIALALCQ GTQV ++  +EYKRLKA LNPE ATNLV 
Sbjct  442  LNSIPKGTSQVVLRGRFSKVAYSIALALCQGGTQVYLIYGEEYKRLKALLNPEVATNLVP  501

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K+Y++K WLVGDGLS D+Q+KAPKGT FIPFSQFPP+KVRKDC YFNTPAM +PKHLEN
Sbjct  502  SKSYTSKIWLVGDGLSEDEQLKAPKGTLFIPFSQFPPRKVRKDCFYFNTPAMNIPKHLEN  561

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            +DSCENWLPRRVMSAWR+AGILH +EGWN +ECGN MFDI K+W+ASL+HGF P T  +A
Sbjct  562  VDSCENWLPRRVMSAWRIAGILHALEGWNEHECGNKMFDIDKVWKASLQHGFSPLTTPSA  621

Query  178  TE  173
             E
Sbjct  622  IE  623



>ref|XP_004253517.1| PREDICTED: protein CER1-like 1, partial [Solanum lycopersicum]
Length=215

 Score =   290 bits (743),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 158/182 (87%), Gaps = 2/182 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGT+QVVLRG  SKVA SIAL LC+ G QV  L E++YKRLKA+L PEAATNLVL
Sbjct  34   LNSIPKGTSQVVLRGRFSKVANSIALVLCEGGIQVVTLDEEDYKRLKAKLTPEAATNLVL  93

Query  538  TKTYS-AKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            +K+Y+ +KTWLVGDGLS D+Q+KAPKGT FIP+SQFPP+KVRKDC YFNTPAMI PKH+E
Sbjct  94   SKSYNVSKTWLVGDGLSKDEQLKAPKGTLFIPYSQFPPRKVRKDCFYFNTPAMIAPKHVE  153

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFT-VS  185
            N+DSCENWLPRRVMSAWR+AGILH +EGWN +ECG+ + D  K+W+ASL+HGF P T +S
Sbjct  154  NVDSCENWLPRRVMSAWRIAGILHALEGWNEHECGDMILDTQKVWKASLKHGFCPLTKIS  213

Query  184  AA  179
            AA
Sbjct  214  AA  215



>ref|XP_009779400.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana sylvestris]
Length=824

 Score =   308 bits (788),  Expect = 6e-95, Method: Composition-based stats.
 Identities = 137/183 (75%), Positives = 157/183 (86%), Gaps = 1/183 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIPKGT+QVVLRG LSKVA SIALALCQ G QV  L E+EYKRLK +L  EAAT LVL
Sbjct  406  INSIPKGTSQVVLRGRLSKVAYSIALALCQGGIQVVTLDEEEYKRLKTKLTSEAATKLVL  465

Query  538  TKTYS-AKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            +K+Y+ +KTWLVGDGLS D+Q+K PKGT FIP+SQFPP K RKDC YF+TPAMI PKHLE
Sbjct  466  SKSYNVSKTWLVGDGLSEDEQLKVPKGTLFIPYSQFPPSKARKDCFYFSTPAMITPKHLE  525

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            N+DSCENWLPRRVMSAWR+AGILH +EGWN NECGN MFDI K+W+ASL HGF P T+++
Sbjct  526  NVDSCENWLPRRVMSAWRIAGILHALEGWNENECGNMMFDIDKVWKASLDHGFCPLTMAS  585

Query  181  ATE  173
            ATE
Sbjct  586  ATE  588



>ref|XP_006354616.1| PREDICTED: protein ECERIFERUM 1-like [Solanum tuberosum]
Length=628

 Score =   302 bits (773),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 159/183 (87%), Gaps = 1/183 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKG++ VVLRG LSKVA SIALALCQ+G QVA L E+EYKRL A L  EAATNLVL
Sbjct  442  LNSIPKGSSHVVLRGRLSKVAYSIALALCQRGIQVATLHEEEYKRLNANLTREAATNLVL  501

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K+Y +KTWLVGDGLS D+Q+KAPKGT FIP+SQFPP+K RKDC YFNTPAMI PKHLEN
Sbjct  502  SKSYVSKTWLVGDGLSEDEQLKAPKGTLFIPYSQFPPRKARKDCFYFNTPAMITPKHLEN  561

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFT-VSA  182
            +DSCENWLPRRVMSAWR+AGILH +EGWN NECG+ MFDI K+W+AS+ HGFRP T V+ 
Sbjct  562  VDSCENWLPRRVMSAWRIAGILHALEGWNENECGDMMFDIDKVWKASVDHGFRPLTLVTT  621

Query  181  ATE  173
            +T+
Sbjct  622  STD  624



>ref|XP_009760058.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Nicotiana sylvestris]
Length=622

 Score =   301 bits (771),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 156/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGT+QVVLRG LSKV+CSIAL LCQ+G QV +L E+EYKRLKARL PEAATNLV 
Sbjct  442  LNSIPKGTSQVVLRGRLSKVSCSIALVLCQRGIQVIMLDEEEYKRLKARLTPEAATNLVQ  501

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +KTY  K WLV DGLS D+Q+KAPKGT +IPFSQFPP+KVRK+C YFNTPAM+ PKHLEN
Sbjct  502  SKTYLPKIWLVDDGLSEDEQLKAPKGTLYIPFSQFPPRKVRKNCFYFNTPAMLTPKHLEN  561

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            +DSCENWLPRRVMSAWR+AGILH +EGWN +ECG+ M DI K W+ASL HGFRP  +++A
Sbjct  562  VDSCENWLPRRVMSAWRIAGILHALEGWNEHECGDMMLDIEKAWKASLDHGFRPLKMTSA  621



>ref|XP_009760057.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Nicotiana sylvestris]
Length=623

 Score =   301 bits (771),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 156/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGT+QVVLRG LSKV+CSIAL LCQ+G QV +L E+EYKRLKARL PEAATNLV 
Sbjct  443  LNSIPKGTSQVVLRGRLSKVSCSIALVLCQRGIQVIMLDEEEYKRLKARLTPEAATNLVQ  502

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +KTY  K WLV DGLS D+Q+KAPKGT +IPFSQFPP+KVRK+C YFNTPAM+ PKHLEN
Sbjct  503  SKTYLPKIWLVDDGLSEDEQLKAPKGTLYIPFSQFPPRKVRKNCFYFNTPAMLTPKHLEN  562

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            +DSCENWLPRRVMSAWR+AGILH +EGWN +ECG+ M DI K W+ASL HGFRP  +++A
Sbjct  563  VDSCENWLPRRVMSAWRIAGILHALEGWNEHECGDMMLDIEKAWKASLDHGFRPLKMTSA  622



>ref|XP_009612940.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Nicotiana tomentosiformis]
Length=463

 Score =   296 bits (759),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQVVL G+LSKVA +IALALCQ G +V  L E+EYK+LK+ L PE A NLV 
Sbjct  279  LNSIPKGTTQVVLGGHLSKVANAIALALCQGGVKVVTLREEEYKKLKSSLTPEVAINLVP  338

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +KTY++K WLVGDGLS D+Q+KAPKGT FIPFSQFPP+K RKDCLYF+TPAMI PKH EN
Sbjct  339  SKTYASKIWLVGDGLSEDEQLKAPKGTLFIPFSQFPPRKARKDCLYFHTPAMITPKHFEN  398

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            +DSCENWLPRRVMSAWRVAGILH ++GWN +ECGN MFDI K+W+ASL HGF P T+++A
Sbjct  399  VDSCENWLPRRVMSAWRVAGILHALKGWNEHECGNMMFDIEKVWKASLDHGFSPLTMASA  458

Query  178  TE  173
            +E
Sbjct  459  SE  460



>ref|XP_009793428.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana sylvestris]
Length=627

 Score =   299 bits (765),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 157/185 (85%), Gaps = 1/185 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGT+QVV RG LSKVA SIALALCQ G QV  L E+EYKRLK +L PEAAT LVL
Sbjct  442  LNSIPKGTSQVVFRGRLSKVAYSIALALCQGGIQVVTLDEEEYKRLKTKLTPEAATKLVL  501

Query  538  TKTYS-AKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            +K+Y+ +KTWLVGDGLS D+Q+KAPKGT FIP+SQFPP K RKDC YF+TPAMI PKHLE
Sbjct  502  SKSYNVSKTWLVGDGLSEDEQLKAPKGTLFIPYSQFPPSKARKDCFYFSTPAMITPKHLE  561

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            N+DSCENWLPRRVMSAWR+AGILH +EGW  +ECGN MFDI K+W+ASL HGF P T+++
Sbjct  562  NVDSCENWLPRRVMSAWRIAGILHALEGWKEHECGNMMFDIDKVWKASLDHGFCPLTLAS  621

Query  181  ATEPN  167
            A E N
Sbjct  622  AIESN  626



>ref|XP_004229695.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Solanum lycopersicum]
Length=625

 Score =   298 bits (764),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGT++VVLRG LSKVA SIAL LCQ GTQV + GE EYKRLKA LNPE A+NLV 
Sbjct  442  LNSIPKGTSRVVLRGRLSKVAYSIALTLCQGGTQVMIDGE-EYKRLKALLNPEVASNLVP  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K+Y++K WLVGD LS D+Q+KAPKGT FIPFSQFPP+KVRKDC YFNTPAM +PKHLEN
Sbjct  501  SKSYASKIWLVGDELSEDEQLKAPKGTLFIPFSQFPPRKVRKDCFYFNTPAMNIPKHLEN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            +DSCENWLPRRVMSAWR+AGILH +EGWN +ECGN MFDI K+W+ASL+HGF P T  +A
Sbjct  561  VDSCENWLPRRVMSAWRIAGILHALEGWNEHECGNKMFDIQKVWKASLQHGFSPLTTPSA  620

Query  178  TE  173
             E
Sbjct  621  IE  622



>ref|XP_009787252.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Nicotiana sylvestris]
Length=590

 Score =   297 bits (761),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQVVL G+LSKVA +IALALCQ G +V  L E+EYK+LK+ L PE A NLV 
Sbjct  406  LNSIPKGTTQVVLGGHLSKVANAIALALCQGGVKVVTLREEEYKKLKSSLTPEVAANLVP  465

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +KTY++K WLVGDGLS D+Q+KAPKGT FIPFSQFPP+K RKDCLYF+TPAMI PKH EN
Sbjct  466  SKTYASKIWLVGDGLSEDEQLKAPKGTLFIPFSQFPPRKARKDCLYFHTPAMITPKHFEN  525

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            +DSCENWLPRRVMSAWRVAGILH +EGWN +ECGN MFDI K+W+ASL HGF P T ++A
Sbjct  526  VDSCENWLPRRVMSAWRVAGILHALEGWNEHECGNMMFDIEKVWKASLDHGFSPLTTASA  585

Query  178  TE  173
            +E
Sbjct  586  SE  587



>ref|XP_010324966.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Solanum lycopersicum]
Length=626

 Score =   298 bits (764),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGT++VVLRG LSKVA SIAL LCQ GTQV + GE EYKRLKA LNPE A+NLV 
Sbjct  443  LNSIPKGTSRVVLRGRLSKVAYSIALTLCQGGTQVMIDGE-EYKRLKALLNPEVASNLVP  501

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K+Y++K WLVGD LS D+Q+KAPKGT FIPFSQFPP+KVRKDC YFNTPAM +PKHLEN
Sbjct  502  SKSYASKIWLVGDELSEDEQLKAPKGTLFIPFSQFPPRKVRKDCFYFNTPAMNIPKHLEN  561

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            +DSCENWLPRRVMSAWR+AGILH +EGWN +ECGN MFDI K+W+ASL+HGF P T  +A
Sbjct  562  VDSCENWLPRRVMSAWRIAGILHALEGWNEHECGNKMFDIQKVWKASLQHGFSPLTTPSA  621

Query  178  TE  173
             E
Sbjct  622  IE  623



>ref|XP_009600723.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana tomentosiformis]
Length=657

 Score =   298 bits (764),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 158/183 (86%), Gaps = 1/183 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIPKGT+QVVLRG LSKVA SIALALCQ G QV  L ++EY+RLK +L PEAATNLVL
Sbjct  472  INSIPKGTSQVVLRGRLSKVAYSIALALCQGGIQVVTLDQEEYRRLKTKLTPEAATNLVL  531

Query  538  TKTYS-AKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            +K+Y+ +KTWLVGDGLS D+Q+KAPKGT FIP+SQFPP K RKDC YF+TPAMI PKHLE
Sbjct  532  SKSYNISKTWLVGDGLSEDEQLKAPKGTLFIPYSQFPPSKARKDCFYFSTPAMITPKHLE  591

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            N+DSCENWLPRRVMSAWR+AGILH +EGW  +ECGN MFDI K+W+ASL HGF P T+++
Sbjct  592  NVDSCENWLPRRVMSAWRIAGILHALEGWKEHECGNMMFDIDKVWKASLDHGFCPLTMAS  651

Query  181  ATE  173
             TE
Sbjct  652  VTE  654



>ref|XP_009787251.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Nicotiana sylvestris]
Length=626

 Score =   298 bits (762),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQVVL G+LSKVA +IALALCQ G +V  L E+EYK+LK+ L PE A NLV 
Sbjct  442  LNSIPKGTTQVVLGGHLSKVANAIALALCQGGVKVVTLREEEYKKLKSSLTPEVAANLVP  501

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +KTY++K WLVGDGLS D+Q+KAPKGT FIPFSQFPP+K RKDCLYF+TPAMI PKH EN
Sbjct  502  SKTYASKIWLVGDGLSEDEQLKAPKGTLFIPFSQFPPRKARKDCLYFHTPAMITPKHFEN  561

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            +DSCENWLPRRVMSAWRVAGILH +EGWN +ECGN MFDI K+W+ASL HGF P T ++A
Sbjct  562  VDSCENWLPRRVMSAWRVAGILHALEGWNEHECGNMMFDIEKVWKASLDHGFSPLTTASA  621

Query  178  TE  173
            +E
Sbjct  622  SE  623



>ref|XP_004229696.2| PREDICTED: protein ECERIFERUM 1-like [Solanum lycopersicum]
Length=918

 Score =   303 bits (776),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGT+QVVLRG LSKVA SIALALCQ+G QVA L E++YKRL A+L  EAATNLVL
Sbjct  442  LNSIPKGTSQVVLRGRLSKVAYSIALALCQRGIQVATLDEEDYKRLNAKLTHEAATNLVL  501

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K++ +KTWLVGDGLS D+Q+KAPKGT FIP+SQFPP+K RKDC YFNTPAMI PKHLEN
Sbjct  502  SKSFVSKTWLVGDGLSEDEQLKAPKGTLFIPYSQFPPRKSRKDCFYFNTPAMIAPKHLEN  561

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            +DSCENWLPRRVMSAWR+AGILH +EGWN NECG+ MFDI K W+AS+ HGFRP T+ A 
Sbjct  562  VDSCENWLPRRVMSAWRIAGILHALEGWNENECGDMMFDIEKAWKASVDHGFRPLTLVAT  621

Query  178  T  176
            +
Sbjct  622  S  622


 Score =   282 bits (722),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 156/182 (86%), Gaps = 2/182 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIP+GT+QVVLRG+LSKVA SIALALCQ   QV  L +D+YKRLKA+L PEAA NLVL
Sbjct  737  LNSIPEGTSQVVLRGSLSKVANSIALALCQGEIQVVTLNKDDYKRLKAKLTPEAAINLVL  796

Query  538  TKTYS-AKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            +K+Y+ +KTWLVGDGLS D+Q+K PKGT FIPFSQFP ++VRKDC YFNTPAMI PKHLE
Sbjct  797  SKSYNVSKTWLVGDGLSDDEQLKVPKGTLFIPFSQFPVREVRKDCFYFNTPAMIAPKHLE  856

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFT-VS  185
            N+DSCENWLPRRVMSAWR+AGI+H +EGWN ++CG+ M D+ K+W+ASL HGF   T +S
Sbjct  857  NVDSCENWLPRRVMSAWRIAGIVHALEGWNEHDCGDTMIDVEKVWKASLSHGFCSLTKIS  916

Query  184  AA  179
            AA
Sbjct  917  AA  918



>ref|XP_009614034.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana tomentosiformis]
Length=657

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 158/183 (86%), Gaps = 1/183 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIPKGT+QVVLRG LSKVA SIALALCQ G QV  L ++EYKRLK +L PEAAT LVL
Sbjct  472  INSIPKGTSQVVLRGRLSKVAYSIALALCQGGIQVVTLDDEEYKRLKTKLTPEAATKLVL  531

Query  538  TKTYS-AKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            +K+Y+ +KTWLV DGLS D+Q+KAPKGT FIP+SQFPPKK RKDC YF+TPAMI PKHLE
Sbjct  532  SKSYNVSKTWLVRDGLSEDEQLKAPKGTIFIPYSQFPPKKARKDCFYFSTPAMITPKHLE  591

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            N+DSCENWLPRRVMSAWR+AGILH +EGW  +ECGN MFDI K+W+ASL HGF P T+++
Sbjct  592  NVDSCENWLPRRVMSAWRIAGILHALEGWKEHECGNMMFDIDKVWKASLDHGFCPLTMAS  651

Query  181  ATE  173
            ATE
Sbjct  652  ATE  654



>ref|XP_009612939.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Nicotiana tomentosiformis]
Length=626

 Score =   296 bits (759),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQVVL G+LSKVA +IALALCQ G +V  L E+EYK+LK+ L PE A NLV 
Sbjct  442  LNSIPKGTTQVVLGGHLSKVANAIALALCQGGVKVVTLREEEYKKLKSSLTPEVAINLVP  501

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +KTY++K WLVGDGLS D+Q+KAPKGT FIPFSQFPP+K RKDCLYF+TPAMI PKH EN
Sbjct  502  SKTYASKIWLVGDGLSEDEQLKAPKGTLFIPFSQFPPRKARKDCLYFHTPAMITPKHFEN  561

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            +DSCENWLPRRVMSAWRVAGILH ++GWN +ECGN MFDI K+W+ASL HGF P T+++A
Sbjct  562  VDSCENWLPRRVMSAWRVAGILHALKGWNEHECGNMMFDIEKVWKASLDHGFSPLTMASA  621

Query  178  TE  173
            +E
Sbjct  622  SE  623



>ref|XP_011085147.1| PREDICTED: protein ECERIFERUM 1-like [Sesamum indicum]
Length=623

 Score =   294 bits (753),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQVVLRGNL+KVA SIALALC+ G QV  L E+EYK+LK +L+ +A  NLVL
Sbjct  441  LNSIPKGTTQVVLRGNLTKVAYSIALALCKGGIQVFTLHENEYKKLKEKLSCDAGNNLVL  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K   +KTWLVGDGL  D+Q+KA KGT FIPFSQFPPKK+RKDCLY NTPAM+ PKHLEN
Sbjct  501  SKHNLSKTWLVGDGLREDEQLKASKGTVFIPFSQFPPKKMRKDCLYNNTPAMLAPKHLEN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            +DSCENWLPRRVMSAWR+AGILHG+E WNV+ECGN MFDI KIW+ASL HGFRP TVSA
Sbjct  561  VDSCENWLPRRVMSAWRIAGILHGIEEWNVHECGNMMFDIEKIWQASLEHGFRPLTVSA  619



>ref|XP_009625188.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana tomentosiformis]
Length=626

 Score =   294 bits (752),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IPKGT+QVVLRG LSKV+CSIAL LCQ+G QV +L  +E+KRLKARL P+ ATNLVL
Sbjct  442  LNNIPKGTSQVVLRGRLSKVSCSIALVLCQRGIQVVMLDGEEFKRLKARLTPKVATNLVL  501

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +KT ++K WLVGD LS D+Q+KAPKGT FIPFSQFPP+K RKDC+YF+TPAM +PK LEN
Sbjct  502  SKTNASKIWLVGDRLSEDEQLKAPKGTLFIPFSQFPPRKARKDCIYFSTPAMTIPKQLEN  561

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            +DSCENWLPRRVMSA R+AGILH +EGWN NECGN MFDI ++W+ASL HGFRP T+++A
Sbjct  562  VDSCENWLPRRVMSASRIAGILHTLEGWNENECGNMMFDIERVWKASLDHGFRPLTMTSA  621

Query  178  TE  173
             E
Sbjct  622  AE  623



>ref|XP_004234847.1| PREDICTED: protein ECERIFERUM 1-like [Solanum lycopersicum]
Length=626

 Score =   292 bits (747),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNS+PKGTTQVVL G+LSKVA +IALALCQ G +V  L E+EYK+LK+ L PEAATNL+L
Sbjct  442  LNSLPKGTTQVVLGGHLSKVANAIALALCQGGVKVMTLREEEYKKLKSSLTPEAATNLLL  501

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +KTY++K WLVGDGL+ D+Q+K PKGT FIPFSQFPP+K RKDC YF+TPAMI PKH EN
Sbjct  502  SKTYTSKIWLVGDGLNEDEQLKVPKGTIFIPFSQFPPRKTRKDCFYFHTPAMITPKHFEN  561

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            +DSCENWLPRRVMSAWR+AGILH +E W+ +ECGN MFDI K+W+ASL HGF+P +V +A
Sbjct  562  VDSCENWLPRRVMSAWRIAGILHALEDWHEHECGNLMFDIEKVWKASLDHGFQPISVVSA  621

Query  178  TE  173
            +E
Sbjct  622  SE  623



>ref|XP_006357723.1| PREDICTED: protein ECERIFERUM 1-like [Solanum tuberosum]
Length=626

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQVVL G+LSKVA SIALALCQ G +V  L E+EYK+LK+ L PEAA NL+ 
Sbjct  442  LNSIPKGTTQVVLGGHLSKVANSIALALCQGGVKVMALREEEYKKLKSNLTPEAAINLLP  501

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +KTY++K WLVGDGL+ D+Q+KAPKGT FIPFSQFPP+K RKDC YF+TPAMI PKH EN
Sbjct  502  SKTYNSKIWLVGDGLNEDEQLKAPKGTLFIPFSQFPPRKTRKDCFYFHTPAMITPKHFEN  561

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            +DSCENWLPRRVMSAWR+AGILH +E W+ +ECGN MFDI K+W+ASL HGF+P +V++A
Sbjct  562  VDSCENWLPRRVMSAWRIAGILHALEDWHEHECGNMMFDIEKVWKASLDHGFQPISVASA  621

Query  178  TE  173
            +E
Sbjct  622  SE  623



>gb|EYU42308.1| hypothetical protein MIMGU_mgv1a002931mg [Erythranthe guttata]
 gb|EYU42309.1| hypothetical protein MIMGU_mgv1a002931mg [Erythranthe guttata]
Length=624

 Score =   291 bits (744),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIPKGTTQVVL+GNLSKVA SIALALCQ G QV  +  DEYK+L+A+L+ EA  NLVL
Sbjct  441  INSIPKGTTQVVLKGNLSKVAYSIALALCQDGIQVFTMSNDEYKKLQAKLSKEAGNNLVL  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K+ + KTWLVGDGLS ++Q+ APKGT FIPFSQFPPKK+RKDC Y  TPAM+ PKHLEN
Sbjct  501  SKSNTPKTWLVGDGLSEEEQLNAPKGTIFIPFSQFPPKKMRKDCFYNTTPAMLAPKHLEN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            +DSCENWLPRRVMSAWR+AGILH +E WNVNECG+ MF+I KIW+ASL HGFRP T    
Sbjct  561  VDSCENWLPRRVMSAWRIAGILHAMEEWNVNECGDMMFNIEKIWQASLEHGFRPLTNVID  620

Query  178  TEPN  167
            ++PN
Sbjct  621  SKPN  624



>ref|XP_009586975.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana tomentosiformis]
Length=625

 Score =   289 bits (740),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQVVL G+LSKVA  IALALC+ G QV  L E++Y  LKARL PEAATNL  
Sbjct  441  LNSIPKGTTQVVLGGHLSKVAYFIALALCKDGIQVITLCENDYNMLKARLTPEAATNLAT  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            + +Y++KTWLVGDGLS + Q+KAPKGT FIPFSQFPP+K RKDC YF+TPAMI PKHLEN
Sbjct  501  SISYTSKTWLVGDGLSEEQQLKAPKGTLFIPFSQFPPRKARKDCFYFHTPAMIAPKHLEN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            +DSCENWLPRRVMSAWR+AGILH +EGW+ +ECG+ MFDI K ++ASL HGFRP T+++A
Sbjct  561  VDSCENWLPRRVMSAWRIAGILHALEGWSEHECGDKMFDIEKAYKASLDHGFRPLTLTSA  620

Query  178  TE  173
            TE
Sbjct  621  TE  622



>gb|EYU42307.1| hypothetical protein MIMGU_mgv1a003396mg [Erythranthe guttata]
Length=588

 Score =   285 bits (728),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSI KGTTQVVL+GNLSKVA SIALALCQ G QV  + E EYK+L+A+L+ EA  NLVL
Sbjct  405  INSILKGTTQVVLKGNLSKVAYSIALALCQGGIQVFTMLEYEYKKLQAKLSKEAGNNLVL  464

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K+ + KTWLVGD LS ++Q+KAPKGT FIPFSQFPPKK+RKDC Y  TPAM+ PKHLEN
Sbjct  465  SKSNTPKTWLVGDKLSEEEQLKAPKGTIFIPFSQFPPKKMRKDCSYNTTPAMLAPKHLEN  524

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            +DSCENWLPRRVMSAWR+AGILH +E WNVNECG+ MFDI KIW+ASL HGFRP T    
Sbjct  525  VDSCENWLPRRVMSAWRIAGILHAMEEWNVNECGDMMFDIEKIWQASLEHGFRPLTNVID  584

Query  178  TEPN  167
            ++PN
Sbjct  585  SKPN  588



>ref|XP_009760059.1| PREDICTED: protein ECERIFERUM 1-like isoform X3 [Nicotiana sylvestris]
Length=618

 Score =   285 bits (729),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 151/180 (84%), Gaps = 5/180 (3%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGT+QVVLRG LSKV+CSIAL LCQ+G QV +L E+EYKRLKARL PEAATNLV 
Sbjct  443  LNSIPKGTSQVVLRGRLSKVSCSIALVLCQRGIQVIMLDEEEYKRLKARLTPEAATNLVQ  502

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +KTY  K WLV DGLS D+Q+KAPKGT +IPFSQFPP+KVRK+C YFNTPAM+ PKHLEN
Sbjct  503  SKTYLPKIWLVDDGLSEDEQLKAPKGTLYIPFSQFPPRKVRKNCFYFNTPAMLTPKHLEN  562

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
                 NWLPRRVMSAWR+AGILH +EGWN +ECG+ M DI K W+ASL HGFRP  +++A
Sbjct  563  -----NWLPRRVMSAWRIAGILHALEGWNEHECGDMMLDIEKAWKASLDHGFRPLKMTSA  617



>ref|XP_006361513.1| PREDICTED: protein ECERIFERUM 1-like [Solanum tuberosum]
Length=626

 Score =   284 bits (727),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQVVL G LSKVA +IALALCQ G +V  L E+EYK+LK+ L  EAA NL+ 
Sbjct  442  LNSIPKGTTQVVLGGQLSKVANAIALALCQGGVKVMALREEEYKKLKSNLTTEAAINLLP  501

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +KTY++K WLVGDGL+ D+Q+KAPKGT FIPFSQFPP+K RKDC YF+TPAMI PKH EN
Sbjct  502  SKTYNSKIWLVGDGLNEDEQLKAPKGTLFIPFSQFPPRKTRKDCFYFHTPAMITPKHFEN  561

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            +DSCENWLPRRVMSAWR+AGILH +E W  +ECGN MFDI K+W+ASL HGF+P +V +A
Sbjct  562  VDSCENWLPRRVMSAWRMAGILHALEDWQEHECGNMMFDIEKVWKASLVHGFQPISVVSA  621

Query  178  TE  173
            +E
Sbjct  622  SE  623



>ref|XP_011093465.1| PREDICTED: protein ECERIFERUM 1-like [Sesamum indicum]
Length=624

 Score =   283 bits (723),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNS+PKGTTQV+LRG LSKVA S ALALCQ G QV    EDEY++LKA+L+ EA  NLVL
Sbjct  441  LNSVPKGTTQVLLRGKLSKVAYSTALALCQGGIQVYTTSEDEYEKLKAKLSNEAGNNLVL  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K  + KTWLVGD LS D+Q+KA KGT FIPFS+FPPKK RKDC+Y +TPAM+ PKHLEN
Sbjct  501  SKHSAPKTWLVGDDLSEDEQIKASKGTTFIPFSRFPPKKARKDCVYLSTPAMLAPKHLEN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            +DSCENWLPRRVMSAWR+AGILH +E WNV+ECGN MFDI KIW+ASL HGFRP T    
Sbjct  561  VDSCENWLPRRVMSAWRIAGILHAMEEWNVHECGNMMFDIEKIWQASLAHGFRPLTNVTQ  620

Query  178  TEPN  167
             +PN
Sbjct  621  LKPN  624



>ref|XP_006354617.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Solanum tuberosum]
Length=623

 Score =   283 bits (723),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIP+GT+QVVLRG+LSKVA SIALALCQ   QV  L  D+YKRLKA+L P+AATN+VL
Sbjct  442  LNSIPEGTSQVVLRGSLSKVANSIALALCQGEIQVVTLNRDDYKRLKAKLTPQAATNMVL  501

Query  538  TKTYS-AKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            + +Y+ +KTWLVGDGLS D+Q+KAPKGT FIPFSQFP +KVRKDC YFNTPAMI PKHLE
Sbjct  502  SNSYNVSKTWLVGDGLSDDEQLKAPKGTLFIPFSQFPLRKVRKDCFYFNTPAMIAPKHLE  561

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            N+DSCENWLPRRVMSAWRVAGI+H +EGWN ++CG  M D+ K+W+ASL HGF   T ++
Sbjct  562  NVDSCENWLPRRVMSAWRVAGIVHALEGWNEHDCGEMMIDVEKVWKASLSHGFCSLTKTS  621

Query  181  A  179
            A
Sbjct  622  A  622



>ref|XP_006354620.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Solanum tuberosum]
Length=623

 Score =   280 bits (716),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 151/177 (85%), Gaps = 1/177 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSI KGT+QVV+RG LSKVA SIALALC+ G QV  L E++YKRLKA+L PEAATNLVL
Sbjct  442  LNSISKGTSQVVVRGRLSKVANSIALALCKGGIQVVTLDEEDYKRLKAKLTPEAATNLVL  501

Query  538  TKTYS-AKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            +K Y+ +KTWLVGDGLS D+Q+KAPKGT FIP+SQFPP+KVRKDC YFNTPAMI P HLE
Sbjct  502  SKCYNVSKTWLVGDGLSKDEQLKAPKGTLFIPYSQFPPRKVRKDCFYFNTPAMIAPNHLE  561

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFT  191
            N+DSCENWLPRRV SAWR+AGI+H +EGWN +ECG+ + D  K+W+ASL HGF P T
Sbjct  562  NVDSCENWLPRRVTSAWRIAGIVHALEGWNEHECGDMILDTQKVWKASLVHGFCPLT  618



>ref|XP_006354619.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Solanum tuberosum]
Length=623

 Score =   280 bits (716),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 151/177 (85%), Gaps = 1/177 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSI KGT+QVV+RG LSKVA SIALALC+ G QV  L E++YKRLKA+L PEAATNLVL
Sbjct  442  LNSISKGTSQVVVRGRLSKVANSIALALCKGGIQVVTLDEEDYKRLKAKLTPEAATNLVL  501

Query  538  TKTYS-AKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            +K Y+ +KTWLVGDGLS D+Q+KAPKGT FIP+SQFPP+KVRKDC YFNTPAMI P HLE
Sbjct  502  SKCYNVSKTWLVGDGLSKDEQLKAPKGTLFIPYSQFPPRKVRKDCFYFNTPAMIAPNHLE  561

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFT  191
            N+DSCENWLPRRV SAWR+AGI+H +EGWN +ECG+ + D  K+W+ASL HGF P T
Sbjct  562  NVDSCENWLPRRVTSAWRIAGIVHALEGWNEHECGDMILDTQKVWKASLVHGFCPLT  618



>ref|XP_006365794.1| PREDICTED: protein ECERIFERUM 1-like [Solanum tuberosum]
Length=625

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 153/184 (83%), Gaps = 2/184 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGN-LSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLV  542
            LNSIPKGT+QVVL+   LSKVA +IALALCQ+G QV  L E+EYK LKAR  PEAA NLV
Sbjct  439  LNSIPKGTSQVVLQARRLSKVASAIALALCQRGIQVVTLDEEEYKGLKARFTPEAAANLV  498

Query  541  LTK-TYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHL  365
            L+K T  +KTWLV DGLS D+Q+KAPKGT FIP+S FPPKKV +DC YF+TPAMI PKHL
Sbjct  499  LSKSTCVSKTWLVDDGLSEDEQLKAPKGTLFIPYSPFPPKKVSEDCFYFSTPAMICPKHL  558

Query  364  ENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVS  185
            +N+DSCENWLPRRVMSA R+AGILH  EGWN +ECG+ MFD+ K+W+ASL HGF PFT+S
Sbjct  559  QNVDSCENWLPRRVMSASRIAGILHASEGWNEHECGDMMFDVDKVWKASLDHGFSPFTMS  618

Query  184  AATE  173
            +A E
Sbjct  619  SAIE  622



>gb|KCW76791.1| hypothetical protein EUGRSUZ_D011442, partial [Eucalyptus grandis]
Length=374

 Score =   268 bits (684),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            L SIPKGT+QV+LRGNL+K+AC+IA ALC +G QV V  +DE+++ K  LN +   NL+ 
Sbjct  195  LRSIPKGTSQVLLRGNLNKLACAIAHALCARGIQVNVASKDEHEKRKRSLNGKEGGNLIH  254

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            ++T+S K WLVGD L+ ++Q KAPKGT FIPFSQFPPK++RKDCLY  TPAMI PK   N
Sbjct  255  SRTFSQKIWLVGDELAEEEQKKAPKGTLFIPFSQFPPKQIRKDCLYHGTPAMIAPKSFNN  314

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            LDSCENWLPRRVMSAWRVAGI+H +EGWNVNECG+ MFDI K WEASL+HGFRP  +SA
Sbjct  315  LDSCENWLPRRVMSAWRVAGIVHALEGWNVNECGSMMFDIEKAWEASLQHGFRPLVLSA  373



>emb|CBI16758.3| unnamed protein product [Vitis vinifera]
Length=281

 Score =   264 bits (675),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 142/179 (79%), Gaps = 0/179 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQV+ RG LSKVA   A+ALCQ+G QV    E+E+K++K +LN +    L L
Sbjct  103  LNSIPKGTTQVLFRGKLSKVAYFTAIALCQKGIQVTTFREEEHKKIKMKLNTKLRDKLAL  162

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K Y+ K WLVGDGL+ ++Q+KAPKGT FIPFSQFPPK++RKDC Y  TPAM+ P   EN
Sbjct  163  SKNYAHKIWLVGDGLTEEEQLKAPKGTLFIPFSQFPPKRMRKDCFYHTTPAMMSPTSFEN  222

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            +DSCENWLPRR MSAWRVAGILH +EGWNV+ECG+ +FDI KIWEAS +HGFRP  + +
Sbjct  223  MDSCENWLPRRAMSAWRVAGILHALEGWNVHECGHTIFDIEKIWEASFQHGFRPLMIPS  281



>gb|AFV29812.1| sterol desaturase-like protein, partial [Senecio aethnensis]
 gb|AFV29813.1| sterol desaturase-like protein, partial [Senecio aethnensis]
 gb|AFV29816.1| sterol desaturase-like protein, partial [Senecio aethnensis]
 gb|AFV29826.1| sterol desaturase-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV29827.1| sterol desaturase-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV29828.1| sterol desaturase-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV29829.1| sterol desaturase-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV29830.1| sterol desaturase-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV29831.1| sterol desaturase-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV29832.1| sterol desaturase-like protein, partial [Senecio aethnensis x 
Senecio chrysanthemifolius]
 gb|AFV29833.1| sterol desaturase-like protein, partial [Senecio aethnensis x 
Senecio chrysanthemifolius]
 gb|AFV29834.1| sterol desaturase-like protein, partial [Senecio aethnensis x 
Senecio chrysanthemifolius]
 gb|AFV29835.1| sterol desaturase-like protein, partial [Senecio aethnensis x 
Senecio chrysanthemifolius]
Length=183

 Score =   260 bits (665),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARL-NPEAATNLV  542
            LNSIPK TTQVV RGN SKVA S+ALALC +G QVAV  + +Y++LK+ L + E    L+
Sbjct  13   LNSIPKDTTQVVFRGNFSKVANSLALALCHKGIQVAVSRQGDYQKLKSVLESTEDQDKLI  72

Query  541  LTKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            ++KTYS K WLVGDGLS ++++KA KGT  IP+S FPP KVRKDC Y++TPAM+ PKHLE
Sbjct  73   ISKTYSQKVWLVGDGLSKEEELKASKGTLIIPYSHFPPNKVRKDCFYYSTPAMLTPKHLE  132

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRH  209
            N+DSCENWLPRRVMSAWR+AGILHG+EGWNVNECGN MF+I KIW+ASL+H
Sbjct  133  NVDSCENWLPRRVMSAWRIAGILHGLEGWNVNECGNDMFNIDKIWQASLQH  183



>emb|CDP09363.1| unnamed protein product [Coffea canephora]
Length=611

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKG   +VL GNLSKVA SIALALCQ GT+V  + E EYK+LKARLNPEA +NLV 
Sbjct  431  LNSIPKGAAGIVLGGNLSKVAYSIALALCQAGTKVVAIREHEYKKLKARLNPEARSNLVQ  490

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K  + K W+VGDGL+ +DQMKA KGT FIPFS++PPKK+RKDC Y +TP+M+ PKHLEN
Sbjct  491  SKHCATKVWIVGDGLTEEDQMKASKGTTFIPFSRYPPKKMRKDCFYHHTPSMLAPKHLEN  550

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            LDSCENWLPRRVMSA RVAGILH +E WNVNECGN +F+I K+W+AS+ HGFRP  V++
Sbjct  551  LDSCENWLPRRVMSASRVAGILHVLENWNVNECGNMIFNIEKVWQASIHHGFRPLAVTS  609



>gb|AFV29804.1| sterol desaturase-like protein, partial [Senecio aethnensis]
 gb|AFV29805.1| sterol desaturase-like protein, partial [Senecio aethnensis]
 gb|AFV29814.1| sterol desaturase-like protein, partial [Senecio aethnensis]
 gb|AFV29815.1| sterol desaturase-like protein, partial [Senecio aethnensis]
 gb|AFV29836.1| sterol desaturase-like protein, partial [Senecio aethnensis x 
Senecio chrysanthemifolius]
Length=183

 Score =   259 bits (661),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARL-NPEAATNLV  542
            LNSIPK TTQVV RGN SKVA S+ALALC +G QVAV  + +Y++LK+ L + E    L+
Sbjct  13   LNSIPKDTTQVVFRGNFSKVANSLALALCHKGIQVAVSRQGDYQKLKSVLESTEDQDKLI  72

Query  541  LTKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            ++KTYS K WLVGDGLS ++++KA KGT  IP+S FPP KVRKDC Y++TPAM+ PKHLE
Sbjct  73   ISKTYSQKVWLVGDGLSKEEELKASKGTLIIPYSHFPPNKVRKDCFYYSTPAMLTPKHLE  132

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRH  209
            N+DSCENWLPRRVMSAWR+AGILHG+EGWN+NECGN MF+I KIW+ASL+H
Sbjct  133  NVDSCENWLPRRVMSAWRIAGILHGLEGWNMNECGNDMFNIDKIWQASLQH  183



>gb|AFV29806.1| sterol desaturase-like protein, partial [Senecio aethnensis]
 gb|AFV29807.1| sterol desaturase-like protein, partial [Senecio aethnensis]
 gb|AFV29808.1| sterol desaturase-like protein, partial [Senecio aethnensis]
 gb|AFV29809.1| sterol desaturase-like protein, partial [Senecio aethnensis]
 gb|AFV29810.1| sterol desaturase-like protein, partial [Senecio aethnensis]
 gb|AFV29811.1| sterol desaturase-like protein, partial [Senecio aethnensis]
 gb|AFV29817.1| sterol desaturase-like protein, partial [Senecio aethnensis]
 gb|AFV29818.1| sterol desaturase-like protein, partial [Senecio aethnensis]
 gb|AFV29819.1| sterol desaturase-like protein, partial [Senecio aethnensis]
 gb|AFV29837.1| sterol desaturase-like protein, partial [Senecio aethnensis x 
Senecio chrysanthemifolius]
 gb|AFV29842.1| sterol desaturase-like protein, partial [Senecio aethnensis x 
Senecio chrysanthemifolius]
 gb|AFV29843.1| sterol desaturase-like protein, partial [Senecio aethnensis x 
Senecio chrysanthemifolius]
Length=183

 Score =   259 bits (661),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 142/171 (83%), Gaps = 1/171 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARL-NPEAATNLV  542
            LNSIPK TTQVV RGN SKVA S+ALALC +G QVAV  + +Y++LK+ L + E     +
Sbjct  13   LNSIPKDTTQVVFRGNFSKVANSLALALCHKGIQVAVSRQGDYQKLKSVLESTEDQDKFI  72

Query  541  LTKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            ++KTYS K WLVGDGLS ++++KA KGT  IP+S FPP KVRKDC Y++TPAM+ PKHLE
Sbjct  73   ISKTYSQKVWLVGDGLSKEEELKASKGTLIIPYSHFPPNKVRKDCFYYSTPAMLTPKHLE  132

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRH  209
            N+DSCENWLPRRVMSAWR+AGILHG+EGWNVNECGN MF+I KIW+ASL+H
Sbjct  133  NVDSCENWLPRRVMSAWRIAGILHGLEGWNVNECGNDMFNIDKIWQASLQH  183



>gb|EYU40308.1| hypothetical protein MIMGU_mgv1a002952mg [Erythranthe guttata]
Length=622

 Score =   272 bits (696),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIPKGT +V +RGNLSKVA SIALALC+ G +V  L E+EYK+LKA L  EA  NL+L
Sbjct  442  VNSIPKGTNRVAIRGNLSKVAYSIALALCRGGIEVFTLHENEYKKLKANLGSEAGNNLIL  501

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K    KTWLVGDGLS ++QMKA KGT FIP+SQFPPKK+RKDC Y NTPAM+VPKHLEN
Sbjct  502  SKHNLPKTWLVGDGLSENEQMKASKGTIFIPYSQFPPKKIRKDCSYNNTPAMLVPKHLEN  561

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVS  185
            +DSCENWLPRRVMSAWR+AGI+H +EGW V+ECG+ MFDI KIW+A L  GFRP T S
Sbjct  562  VDSCENWLPRRVMSAWRIAGIVHAMEGWGVHECGDMMFDIEKIWQACLEQGFRPLTES  619



>gb|AFV29820.1| sterol desaturase-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV29821.1| sterol desaturase-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV29822.1| sterol desaturase-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV29823.1| sterol desaturase-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV29824.1| sterol desaturase-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV29825.1| sterol desaturase-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV29838.1| sterol desaturase-like protein, partial [Senecio aethnensis x 
Senecio chrysanthemifolius]
 gb|AFV29839.1| sterol desaturase-like protein, partial [Senecio aethnensis x 
Senecio chrysanthemifolius]
 gb|AFV29840.1| sterol desaturase-like protein, partial [Senecio aethnensis x 
Senecio chrysanthemifolius]
 gb|AFV29841.1| sterol desaturase-like protein, partial [Senecio aethnensis x 
Senecio chrysanthemifolius]
 gb|AFV29844.1| sterol desaturase-like protein, partial [Senecio aethnensis x 
Senecio chrysanthemifolius]
 gb|AFV29845.1| sterol desaturase-like protein, partial [Senecio aethnensis x 
Senecio chrysanthemifolius]
Length=183

 Score =   258 bits (660),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARL-NPEAATNLV  542
            LNSIPK TTQVV RGN SKVA S+ALALC +G QVAV  + +Y++LK+ L + E    L+
Sbjct  13   LNSIPKDTTQVVFRGNFSKVANSLALALCHKGIQVAVSRQGDYQKLKSVLESTEDQDKLI  72

Query  541  LTKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            ++KTYS K WLVGDGLS ++++KA KGT  IP+S FPP KVRKDC Y++TPAM+ PKHL+
Sbjct  73   ISKTYSQKVWLVGDGLSKEEELKASKGTLIIPYSHFPPNKVRKDCFYYSTPAMLTPKHLK  132

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRH  209
            N+DSCENWLPRRVMSAWR+AGILHG+EGWNVNECGN MF+I KIW+ASL+H
Sbjct  133  NVDSCENWLPRRVMSAWRIAGILHGLEGWNVNECGNDMFNIDKIWQASLQH  183



>ref|XP_010042043.1| PREDICTED: protein ECERIFERUM 1-like [Eucalyptus grandis]
Length=361

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            L SIPKGT+QV+L GNL+K+AC+IA ALC  G QV V  +DE+++LK  LN +   NL+ 
Sbjct  182  LRSIPKGTSQVLLGGNLNKLACAIAHALCATGIQVNVASKDEHEKLKRSLNGKEGGNLIH  241

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            ++T+S K WLVGD L+ ++Q KAPKGT FIPFSQFPPK++RKDCLY  TPAMI PK   N
Sbjct  242  SRTFSQKIWLVGDELAEEEQKKAPKGTLFIPFSQFPPKQIRKDCLYHGTPAMIAPKSFNN  301

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            LDSCENWLPRRVMSAWRVAGI+H +EGWNVNECG+ MFDI K WEASL+HGFRP  + A
Sbjct  302  LDSCENWLPRRVMSAWRVAGIVHALEGWNVNECGSMMFDIEKAWEASLQHGFRPLVLPA  360



>emb|CAN63491.1| hypothetical protein VITISV_032726 [Vitis vinifera]
Length=392

 Score =   262 bits (670),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQV+ RG LSKVA   ALALCQ+G QVA   E+EY  +  +LN +    L L
Sbjct  214  LNSIPKGTTQVLFRGKLSKVAYFTALALCQKGIQVATFHEEEYAXINMKLNTKLGGKLAL  273

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K Y+ K WLVGDGL+ ++Q+KAPKGT FIPFSQFPPK++RKDC Y  TPAM+ P   E+
Sbjct  274  SKNYAHKIWLVGDGLTEEEQLKAPKGTLFIPFSQFPPKRMRKDCFYHTTPAMMSPTSFED  333

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            +DSCENWLPRR MSAWRVAGILH +EGWNV+ECG+ +F+I KIWEASL+HGFRP  + +
Sbjct  334  MDSCENWLPRRAMSAWRVAGILHALEGWNVHECGHTIFNIEKIWEASLQHGFRPLMIPS  392



>ref|XP_002263787.2| PREDICTED: protein ECERIFERUM 1-like [Vitis vinifera]
Length=619

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 143/179 (80%), Gaps = 0/179 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQV+ RG LSKVA   ALALCQ+G QVA   E+EY ++  +LN +    L L
Sbjct  441  LNSIPKGTTQVLFRGKLSKVAYFTALALCQKGIQVATFHEEEYAKINMKLNTKLGGKLAL  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K Y+ K WLVGDGL+ ++Q+KAPKGT FIPFSQFPPK++RKDC Y  TPAM+ P   EN
Sbjct  501  SKNYAHKIWLVGDGLTKEEQLKAPKGTLFIPFSQFPPKRMRKDCFYHTTPAMMSPTSFEN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            +DSCENWLPRR MSAWRVAGILH +EGWNV+ECG+A+FDI KIWEASL+HGFRP  + +
Sbjct  561  MDSCENWLPRRAMSAWRVAGILHALEGWNVHECGHAIFDIEKIWEASLQHGFRPLMIPS  619



>emb|CAN83072.1| hypothetical protein VITISV_026148 [Vitis vinifera]
Length=312

 Score =   258 bits (660),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 144/178 (81%), Gaps = 1/178 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARL-NPEAATNLV  542
            LNSIPKGTTQV+ RGNL+KVA  IA ALCQ G QVA   +DEY++L   L N E  + L+
Sbjct  133  LNSIPKGTTQVLFRGNLTKVAYFIASALCQMGIQVATSHKDEYEQLNTNLKNVERESKLL  192

Query  541  LTKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            L+K+++ K WLVGDGL+ ++QMKA KG+ FIPFSQFPPK++RKDCLY  TPAM+ PK  +
Sbjct  193  LSKSFTEKIWLVGDGLTKEEQMKASKGSLFIPFSQFPPKRLRKDCLYHTTPAMMPPKSFQ  252

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            N+DSCENWLPRR MSA RVAG++H +EGWNV+ECGN MF+I KIWEASL HGFRP T+
Sbjct  253  NIDSCENWLPRRAMSASRVAGVIHALEGWNVHECGNTMFNIEKIWEASLHHGFRPLTI  310



>ref|XP_010052726.1| PREDICTED: protein ECERIFERUM 1-like [Eucalyptus grandis]
Length=620

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            L SIPKGT+QV+LRGNL+K+AC+IA ALC +G QV V  +DE+++ K  LN +   NL+ 
Sbjct  441  LRSIPKGTSQVLLRGNLNKLACAIAHALCARGIQVNVASKDEHEKRKRSLNGKEGGNLIH  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            ++T+S K WLVGD L+ ++Q KAPKGT FIPFSQFPPK++RKDCLY  TPAMI PK   N
Sbjct  501  SRTFSQKIWLVGDELAEEEQKKAPKGTLFIPFSQFPPKQIRKDCLYHGTPAMIAPKSFNN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            LDSCENWLPRRVMSAWRVAGI+H +EGWNVNECG+ MFDI K WEASL+HGFRP  +SA
Sbjct  561  LDSCENWLPRRVMSAWRVAGIVHALEGWNVNECGSMMFDIEKAWEASLQHGFRPLVLSA  619



>ref|XP_004252845.1| PREDICTED: protein ECERIFERUM 1 [Solanum lycopersicum]
Length=620

 Score =   266 bits (680),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 147/179 (82%), Gaps = 2/179 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLR-GNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLV  542
            LNSIPKGT+QVVL+ G LSKVA +IALALCQ+G QV  L E+EYK LKAR  PEAA NLV
Sbjct  439  LNSIPKGTSQVVLQAGRLSKVANAIALALCQRGIQVITLDEEEYKGLKARFTPEAAANLV  498

Query  541  LTK-TYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHL  365
            L K T  +KTWLV DGLS D+Q+KAPKGT FIP+S FPPKKVR+DC Y +TPAMI PKH+
Sbjct  499  LLKSTCVSKTWLVDDGLSEDEQLKAPKGTLFIPYSPFPPKKVREDCFYLSTPAMICPKHV  558

Query  364  ENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            +N+DSCENWLPRRVMSA R+AGILH  EGWN +ECG+ MFDI K+W+ASL HGF P  V
Sbjct  559  QNVDSCENWLPRRVMSASRIAGILHAFEGWNEHECGDMMFDIDKVWKASLDHGFSPLDV  617



>ref|XP_011093466.1| PREDICTED: protein ECERIFERUM 1-like [Sesamum indicum]
Length=620

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 143/176 (81%), Gaps = 0/176 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNS+PKGT QV+LRG LSKV+ SIALALC++G QV     DEY++LKA+L  EA  +LVL
Sbjct  441  LNSVPKGTKQVLLRGKLSKVSSSIALALCKRGIQVYTTSGDEYEKLKAKLGNEAGNSLVL  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K  S K WLVGD LS  +Q+KA KGT FIPFS FPPKK R DC+Y +TPAM+ PKHLEN
Sbjct  501  SKHNSPKIWLVGDDLSEVEQLKASKGTIFIPFSHFPPKKTRNDCVYLSTPAMLAPKHLEN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFT  191
            +DSCENWLPRRV+SAWR+AGILH +E WNV+ECGN MFDI +IW+ASL HGFRP T
Sbjct  561  VDSCENWLPRRVISAWRIAGILHALEEWNVHECGNMMFDIERIWQASLAHGFRPLT  616



>ref|XP_002265685.2| PREDICTED: protein ECERIFERUM 1-like [Vitis vinifera]
Length=619

 Score =   265 bits (676),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 142/179 (79%), Gaps = 0/179 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQV+ RG LSKVA   A+ALCQ+G QV    E+E+K++K +LN +    L L
Sbjct  441  LNSIPKGTTQVLFRGKLSKVAYFTAIALCQKGIQVTTFREEEHKKIKMKLNTKLRDKLAL  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K Y+ K WLVGDGL+ ++Q+KAPKGT FIPFSQFPPK++RKDC Y  TPAM+ P   EN
Sbjct  501  SKNYAHKIWLVGDGLTEEEQLKAPKGTLFIPFSQFPPKRMRKDCFYHTTPAMMSPTSFEN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            +DSCENWLPRR MSAWRVAGILH +EGWNV+ECG+ +FDI KIWEAS +HGFRP  + +
Sbjct  561  MDSCENWLPRRAMSAWRVAGILHALEGWNVHECGHTIFDIEKIWEASFQHGFRPLMIPS  619



>gb|KCW76795.1| hypothetical protein EUGRSUZ_D01146, partial [Eucalyptus grandis]
Length=234

 Score =   252 bits (643),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 145/179 (81%), Gaps = 0/179 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            L+SIPK T+QV+ RGNL+K+  +IA ALC +  QV V  +DE+++LK  L+ +   NL+L
Sbjct  55   LHSIPKETSQVLFRGNLNKLTYAIAHALCARDIQVYVASKDEHEKLKRSLDGKYGGNLIL  114

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            ++T+S + WLVGDGL+ ++Q KAPKGT FIPFSQFPPK++R+DCLY +TPAMI P+  +N
Sbjct  115  SRTFSQEIWLVGDGLAEEEQKKAPKGTLFIPFSQFPPKQIREDCLYHSTPAMIAPQSFDN  174

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            L SCENWLPRRVMSAWRVAGI+H +EGWN+NECG+ MFDI K W+ASL+HGFRP  + A
Sbjct  175  LHSCENWLPRRVMSAWRVAGIVHALEGWNMNECGSMMFDIEKAWKASLQHGFRPLALPA  233



>ref|XP_007041194.1| CER1 protein [Theobroma cacao]
 gb|EOX97025.1| CER1 protein [Theobroma cacao]
Length=555

 Score =   262 bits (669),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 147/177 (83%), Gaps = 1/177 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIP+ T QVVLRG LSKVA +IALALCQ+G +VA L +DEYK+L   +  +   NLVL
Sbjct  378  VNSIPEETRQVVLRGKLSKVAYAIALALCQKGVKVAALKDDEYKKLLKHVG-KFGDNLVL  436

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             + Y  K WLVGDGL+ ++Q+KAPKGT FIPFSQFPP+KVRKDC Y +TPAM+ PK +EN
Sbjct  437  AERYDPKIWLVGDGLTKEEQLKAPKGTIFIPFSQFPPRKVRKDCYYHSTPAMVAPKSIEN  496

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            + SCENWLPRR+MSAWRVAGI+HG+EGW+V+ECG+ +F IGK+WEA+L+HGFRP ++
Sbjct  497  MHSCENWLPRRIMSAWRVAGIIHGLEGWDVHECGHTIFGIGKVWEATLQHGFRPLSI  553



>emb|CBI16761.3| unnamed protein product [Vitis vinifera]
Length=631

 Score =   263 bits (673),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 140/173 (81%), Gaps = 0/173 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQV+ RG LSKVA   ALALCQ+G QVA   E+EY ++  +LN +    L L
Sbjct  441  LNSIPKGTTQVLFRGKLSKVAYFTALALCQKGIQVATFHEEEYAKINMKLNTKLGGKLAL  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K Y+ K WLVGDGL+ ++Q+KAPKGT FIPFSQFPPK++RKDC Y  TPAM+ P   EN
Sbjct  501  SKNYAHKIWLVGDGLTKEEQLKAPKGTLFIPFSQFPPKRMRKDCFYHTTPAMMSPTSFEN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFR  200
            +DSCENWLPRR MSAWRVAGILH +EGWNV+ECG+A+FDI KIWEASL+HGF+
Sbjct  561  MDSCENWLPRRAMSAWRVAGILHALEGWNVHECGHAIFDIEKIWEASLQHGFQ  613



>ref|XP_003633900.1| PREDICTED: protein ECERIFERUM 1-like [Vitis vinifera]
Length=619

 Score =   262 bits (670),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQV+ RG LSKVA   A+ALCQ+G QV    E+E+K++K +LN +    L L
Sbjct  441  LNSIPKGTTQVLFRGKLSKVAYFTAIALCQKGIQVTTFCEEEHKKIKMKLNTKLGDKLAL  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K Y+ K WLVGDGL+ ++Q+KAPKGT FIPFSQFPPK++RKDC Y  TPAM+ P   EN
Sbjct  501  SKNYAHKIWLVGDGLTEEEQLKAPKGTLFIPFSQFPPKRMRKDCFYHTTPAMMSPTSFEN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            +DSCENWLPRR MSAWRVAGILH +EGWNV+ECG+ +FDI KIWEAS +HGFR   + +
Sbjct  561  MDSCENWLPRRAMSAWRVAGILHALEGWNVHECGHTIFDIEKIWEASFQHGFRSLMIPS  619



>ref|XP_002265189.2| PREDICTED: protein ECERIFERUM 1 [Vitis vinifera]
 emb|CBI16762.3| unnamed protein product [Vitis vinifera]
Length=619

 Score =   262 bits (669),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQV+ RG LSKVA   ALALCQ+G QVA   E+EY  +  +LN +    L L
Sbjct  441  LNSIPKGTTQVLFRGKLSKVAYFTALALCQKGIQVATFHEEEYANINMKLNTKLGGKLAL  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K Y+ K WLVGDGL+ ++Q+KAPKGT FIPFSQFPPK++RKDC Y  TPAM+ P   E+
Sbjct  501  SKNYAHKIWLVGDGLTEEEQLKAPKGTLFIPFSQFPPKRMRKDCFYHTTPAMMSPTSFED  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            +DSCENWLPRR MSAWRVAGILH +EGWNV+ECG+ +F+I KIWEASL+HGFRP  + +
Sbjct  561  MDSCENWLPRRAMSAWRVAGILHALEGWNVHECGHTIFNIEKIWEASLQHGFRPLMIPS  619



>ref|XP_002320584.1| ECERIFERUM 1 family protein [Populus trichocarpa]
 gb|EEE98899.1| ECERIFERUM 1 family protein [Populus trichocarpa]
Length=622

 Score =   261 bits (667),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 145/183 (79%), Gaps = 1/183 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEA-ATNLV  542
            LNSIPKGTTQV+ RGNLSKVA ++ L LC++G QVAV  ED+YKRLK      +   NL+
Sbjct  439  LNSIPKGTTQVLHRGNLSKVAYAVVLNLCRRGIQVAVPYEDDYKRLKKSFGSRSDQNNLI  498

Query  541  LTKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            L+K YS KTWLVGDGL  +DQ KA +GT FIPFSQFPPKK+RKDC Y +TPAM  P  LE
Sbjct  499  LSKNYSIKTWLVGDGLKGEDQKKATEGTLFIPFSQFPPKKLRKDCFYHSTPAMAAPASLE  558

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            N+DSCENWLPRRVMSAWRVAGI+H +EGWN +ECG  M DI K+W+AS++HGF+P  ++A
Sbjct  559  NVDSCENWLPRRVMSAWRVAGIVHALEGWNEHECGYTMSDIDKVWQASIQHGFKPLVITA  618

Query  181  ATE  173
             ++
Sbjct  619  QSK  621



>ref|XP_010054530.1| PREDICTED: protein ECERIFERUM 1-like [Eucalyptus grandis]
Length=356

 Score =   251 bits (642),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 145/179 (81%), Gaps = 0/179 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            L+SIPK T+QV+ RGNL+K+  +IA ALC +  QV V  +DE+++LK  L+ +   NL+L
Sbjct  177  LHSIPKETSQVLFRGNLNKLTYAIAHALCARDIQVYVASKDEHEKLKRSLDGKYGGNLIL  236

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            ++T+S + WLVGDGL+ ++Q KAPKGT FIPFSQFPPK++R+DCLY +TPAMI P+  +N
Sbjct  237  SRTFSQEIWLVGDGLAEEEQKKAPKGTLFIPFSQFPPKQIREDCLYHSTPAMIAPQSFDN  296

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            L SCENWLPRRVMSAWRVAGI+H +EGWN+NECG+ MFDI K W+ASL+HGFRP  + A
Sbjct  297  LHSCENWLPRRVMSAWRVAGIVHALEGWNMNECGSMMFDIEKAWKASLQHGFRPLALPA  355



>ref|XP_007041196.1| CER1 protein [Theobroma cacao]
 gb|EOX97027.1| CER1 protein [Theobroma cacao]
Length=627

 Score =   259 bits (661),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 146/177 (82%), Gaps = 1/177 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIP+ T QVVLRG L KVA +IALALCQ+G +VA L +DEYK+L   +  +   NLVL
Sbjct  450  VNSIPEETRQVVLRGKLCKVAYAIALALCQKGVKVAALKDDEYKKLLKHVG-KFGDNLVL  508

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             + Y  K WLVGDGL+ ++Q+KAPKGT FIPFSQFPP+KVRKDC Y +TPAM+ PK +EN
Sbjct  509  AERYDPKIWLVGDGLTKEEQLKAPKGTIFIPFSQFPPRKVRKDCYYHSTPAMVAPKSIEN  568

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            + SCENWLPRR+MSAWRVAGI+HG+EGW+V+ECG+ +F IGK+WEA+L+HGFRP ++
Sbjct  569  MHSCENWLPRRIMSAWRVAGIIHGLEGWDVHECGHTIFGIGKVWEATLQHGFRPLSI  625



>ref|XP_007008729.1| Fatty acid hydroxylase superfamily isoform 1 [Theobroma cacao]
 gb|EOY17539.1| Fatty acid hydroxylase superfamily isoform 1 [Theobroma cacao]
Length=623

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 143/182 (79%), Gaps = 0/182 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQV+LRGNLSKVA ++A ALCQ+G QVAVL EDEY++L   L  ++  NLV+
Sbjct  441  LNSIPKGTTQVLLRGNLSKVAYAVAFALCQKGIQVAVLREDEYEKLNKSLGTKSEGNLVI  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K Y  KTWLVGD LS ++Q KA KGT FIPFSQFPPKK+RKDC Y  TPAM  P  LEN
Sbjct  501  SKGYFYKTWLVGDDLSEEEQRKATKGTLFIPFSQFPPKKLRKDCFYHTTPAMQTPMSLEN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            +DSCENWLPRRVMS WR+AGI+H +EGW  +ECG  M +I K+WEAS++HGF+P  V   
Sbjct  561  VDSCENWLPRRVMSVWRIAGIVHALEGWEEHECGYTMSNIEKVWEASVKHGFQPLRVPTQ  620

Query  178  TE  173
            ++
Sbjct  621  SK  622



>ref|XP_002262647.1| PREDICTED: protein ECERIFERUM 1 [Vitis vinifera]
 emb|CBI38119.3| unnamed protein product [Vitis vinifera]
Length=620

 Score =   257 bits (656),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 143/178 (80%), Gaps = 1/178 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARL-NPEAATNLV  542
            LNSIPKGTTQV+ RGNL+KVA  IA ALCQ   QVA    DEY++L  +L N E  + L+
Sbjct  441  LNSIPKGTTQVLFRGNLTKVAYFIASALCQMDIQVATSHGDEYEQLNTKLKNVECESKLL  500

Query  541  LTKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            L+K+++ K WLVGDGL+ ++Q+KA KGT FIPFSQFPPK++RKDCLY  TPAM+ PK  +
Sbjct  501  LSKSFTEKIWLVGDGLTKEEQIKASKGTLFIPFSQFPPKRLRKDCLYLTTPAMMSPKSFQ  560

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            N+DSCENWLPRR MSA RVAG++H +EGWNV+ECGN MF+I KIWEASL HGFRP T+
Sbjct  561  NIDSCENWLPRRAMSASRVAGVIHALEGWNVHECGNTMFNIEKIWEASLHHGFRPLTI  618



>ref|XP_007041192.1| CER1 protein [Theobroma cacao]
 gb|EOX97023.1| CER1 protein [Theobroma cacao]
Length=595

 Score =   255 bits (652),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 147/179 (82%), Gaps = 1/179 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIP+ T QVVLRG LSKVA +IALALCQ+G +VA L +DEYK+L   ++ +   NLVL
Sbjct  418  VNSIPEETRQVVLRGKLSKVAYAIALALCQKGVKVAALNDDEYKKLLEHVD-KFGDNLVL  476

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            T+ Y  K WLVGDGL+ ++Q+KA +GT FIPFSQFPP+KVR+DC Y +TPAM+ PK LEN
Sbjct  477  TERYDHKIWLVGDGLTPEEQLKASQGTIFIPFSQFPPRKVREDCYYHSTPAMVAPKSLEN  536

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            + SCENWLPR VMSAWRVAGI+HG+EGW+V+ECG+ +F I K+WEA+L+HGFRP ++ A
Sbjct  537  MHSCENWLPRMVMSAWRVAGIVHGLEGWDVHECGHTIFGIEKVWEATLQHGFRPLSILA  595



>ref|XP_007219469.1| hypothetical protein PRUPE_ppa021389mg [Prunus persica]
 gb|EMJ20668.1| hypothetical protein PRUPE_ppa021389mg [Prunus persica]
Length=218

 Score =   244 bits (623),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTT+V+LRGNL+KVA + A ALCQ+G QVA L + EY +L   LN    + LVL
Sbjct  36   LNSIPKGTTEVLLRGNLTKVAYATAFALCQKGIQVATLNQTEYLKLTKSLNV-TDSRLVL  94

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             ++Y+ K WLVGDGLS ++Q++APKGT F+PFSQFP KK+RKDC Y  TPAM  P  LEN
Sbjct  95   ARSYAQKIWLVGDGLSEEEQLRAPKGTLFVPFSQFPQKKLRKDCFYHYTPAMKTPPSLEN  154

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            + +CENWLPRRVMSAWR+AGI+H +EGW  +ECG  M +I K+W+A+L+HGF+P  +S  
Sbjct  155  VHACENWLPRRVMSAWRIAGIVHALEGWKEHECGYNMSNIDKVWQATLQHGFQPLMISTT  214

Query  178  TEPN  167
               N
Sbjct  215  HTKN  218



>ref|XP_002262785.1| PREDICTED: protein ECERIFERUM 1 [Vitis vinifera]
 emb|CBI38118.3| unnamed protein product [Vitis vinifera]
Length=620

 Score =   254 bits (650),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 144/178 (81%), Gaps = 1/178 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARL-NPEAATNLV  542
            LNSIPKGTTQV+ RGNL+KVA  IA ALCQ   QVA   +DEY++L  +L N E  + L+
Sbjct  441  LNSIPKGTTQVLFRGNLTKVAYFIASALCQMDIQVATSRKDEYEQLNTKLKNVECESKLL  500

Query  541  LTKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            L+K+++ K W+VGDGL+ ++QMKA  GT FIPFSQFPPK++RKDCLY  TPAM+ PK  +
Sbjct  501  LSKSFTEKIWVVGDGLTKEEQMKASTGTLFIPFSQFPPKRLRKDCLYHTTPAMMPPKSFQ  560

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            N+DSCENWLPRR MSA RVAG++H +EGWNV+ECGN MF++ KIWEASL+HGFRP TV
Sbjct  561  NIDSCENWLPRRAMSASRVAGVIHALEGWNVHECGNTMFNVEKIWEASLQHGFRPLTV  618



>ref|XP_010054531.1| PREDICTED: protein ECERIFERUM 1-like [Eucalyptus grandis]
 gb|KCW76798.1| hypothetical protein EUGRSUZ_D01149 [Eucalyptus grandis]
Length=620

 Score =   254 bits (650),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 145/177 (82%), Gaps = 0/177 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            L+SIPKGT QV+L+GNL+K++ +IA ALC +  QV V  +DE+++LK  LN +   NL+L
Sbjct  441  LHSIPKGTGQVLLKGNLNKLSYAIAHALCARDIQVNVASKDEHEKLKRSLNGKYRGNLIL  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            ++T+S + WLVGDG++ ++Q KAPKGT FIPFSQFPPK++RKDCLY +TPAM +P+  +N
Sbjct  501  SRTFSQEIWLVGDGIAEEEQKKAPKGTLFIPFSQFPPKQIRKDCLYHSTPAMTIPRSFDN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            L SCENWLPRRVMSAWRVAGI+H +EGWNVNECG  MFDI K WEASL+HGFRP  +
Sbjct  561  LHSCENWLPRRVMSAWRVAGIVHALEGWNVNECGIMMFDIEKAWEASLQHGFRPLAL  617



>gb|KJB76251.1| hypothetical protein B456_012G081600 [Gossypium raimondii]
 gb|KJB76253.1| hypothetical protein B456_012G081600 [Gossypium raimondii]
Length=589

 Score =   249 bits (636),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQVVLRG L KVAC++A ALCQ+  QV+VL EDEY++L   L  ++   LVL
Sbjct  407  LNSIPKGTTQVVLRGKLPKVACALAFALCQKRIQVSVLREDEYEKLDKLLGTKSEGKLVL  466

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K+Y+ KTWLVGDGLS  +Q KA KGT FIPFSQFPPKK+R DC Y  TPAM +P   EN
Sbjct  467  SKSYTCKTWLVGDGLSEVEQRKASKGTLFIPFSQFPPKKLRTDCFYHTTPAMQIPLAFEN  526

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            +DSCENWLPRRVMS WR+AG++H +EGW  +ECG    +I K+WEA+L+HGF+P  V
Sbjct  527  VDSCENWLPRRVMSIWRIAGLVHALEGWEEHECGYTTSNIEKVWEATLKHGFQPLKV  583



>ref|XP_011005107.1| PREDICTED: protein ECERIFERUM 1-like [Populus euphratica]
Length=622

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 142/178 (80%), Gaps = 1/178 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEA-ATNLV  542
            LNSIPKG+TQV+ RGNLSKVA ++AL LCQ+G QV V  ED+Y++LK      +   NL+
Sbjct  439  LNSIPKGSTQVLHRGNLSKVAYAVALNLCQRGIQVVVPCEDDYQKLKKSFGITSDQNNLI  498

Query  541  LTKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            L+K+YS KTWLVGDGL  +DQ KA +GT FIPFSQFPPKK+RKDC Y + PAM  P  LE
Sbjct  499  LSKSYSIKTWLVGDGLKEEDQKKAAEGTLFIPFSQFPPKKLRKDCFYHSIPAMAAPASLE  558

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            N+DSCENWLPRRVMSAWRVAGI+H +EGW+ +ECG+ M +I K+W+AS++HGF+P  +
Sbjct  559  NVDSCENWLPRRVMSAWRVAGIVHALEGWDEHECGSTMANIDKVWQASIQHGFKPLVI  616



>ref|XP_002526512.1| sterol desaturase, putative [Ricinus communis]
 gb|EEF35903.1| sterol desaturase, putative [Ricinus communis]
Length=622

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 141/183 (77%), Gaps = 1/183 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAV-LGEDEYKRLKARLNPEAATNLV  542
            LNSIPKGTTQ++ RG LSKVA ++ L LCQ+G QVA  L ED  K +KA  N E   N++
Sbjct  439  LNSIPKGTTQLLFRGRLSKVAFAVVLGLCQRGIQVATTLKEDYEKLIKASPNSECGKNVL  498

Query  541  LTKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            L+K YS KTWLV DGL  ++Q KA KGT FIP SQFPPKK R DC Y++TPA++ P  LE
Sbjct  499  LSKNYSLKTWLVDDGLREEEQKKASKGTVFIPVSQFPPKKARNDCFYYSTPAVVAPSALE  558

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            N+DSCENWLPRRVMSAWR AGI+HG+EGWNVNECG  MFD+ ++W+A+L HGF+P  +  
Sbjct  559  NVDSCENWLPRRVMSAWRAAGIVHGLEGWNVNECGYTMFDVDRVWQATLCHGFKPLLLIP  618

Query  181  ATE  173
            +T+
Sbjct  619  STQ  621



>ref|XP_010052731.1| PREDICTED: protein ECERIFERUM 1-like [Eucalyptus grandis]
 gb|KCW76801.1| hypothetical protein EUGRSUZ_D01152 [Eucalyptus grandis]
Length=627

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 139/179 (78%), Gaps = 0/179 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIPKGT QV+ RG L+KVA +IALALCQ+G QVA L E EYK LK   N +  +NL+L
Sbjct  442  VNSIPKGTVQVLFRGRLTKVAYAIALALCQRGIQVATLHEHEYKMLKKSFNHKCDSNLLL  501

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
                + K W+VGD ++ +DQ+KAPKGT FIP+SQFPPKK+R DC Y +TPAM+VP  LEN
Sbjct  502  QSGRAPKIWVVGDDVTEEDQLKAPKGTLFIPYSQFPPKKLRGDCFYCHTPAMVVPPSLEN  561

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            + SCENWLPRRVMSAWRVAGILH  EGW  NECG ++ DI K+W+ASL+HGF+P  + A
Sbjct  562  MHSCENWLPRRVMSAWRVAGILHAAEGWEENECGYSITDIDKVWQASLQHGFQPLGIPA  620



>gb|KJB67449.1| hypothetical protein B456_010G191200 [Gossypium raimondii]
Length=617

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 140/178 (79%), Gaps = 1/178 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQV+LRGNL++VA ++  ALCQ+G QV VL EDEY++L      ++  NLV+
Sbjct  434  LNSIPKGTTQVLLRGNLTEVAFAVTFALCQKGIQVIVLREDEYEKLDKSFGTKSEDNLVI  493

Query  538  TKTYSA-KTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            +K+YS+ K WLVGD L+ ++Q KA +GT FIPFSQFPPKK+RKDC Y  TPAM  P  LE
Sbjct  494  SKSYSSCKVWLVGDDLTEEEQRKATEGTLFIPFSQFPPKKLRKDCFYHTTPAMQTPMALE  553

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            N+DSCENWLPRRVMS WR+AGILH +EGW  +ECG  M +I K+WEA L+HGF+P TV
Sbjct  554  NVDSCENWLPRRVMSVWRIAGILHALEGWEEHECGYTMCNIDKVWEACLKHGFQPLTV  611



>ref|XP_006375527.1| hypothetical protein POPTR_0014s15110g [Populus trichocarpa]
 gb|ERP53324.1| hypothetical protein POPTR_0014s15110g [Populus trichocarpa]
Length=622

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 142/178 (80%), Gaps = 1/178 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEA-ATNLV  542
            LNSIPKGTT V+ RGNLSKVA ++AL LC++G QV V  ED+Y++LK      +   N++
Sbjct  439  LNSIPKGTTHVLHRGNLSKVAYAVALNLCRRGIQVVVPCEDDYQKLKKSFGITSDQNNMI  498

Query  541  LTKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            L+K+YS KTWLVGDGL+ +DQ KA +GT FIPFSQFPPKK+RKDC Y + PAM  P  LE
Sbjct  499  LSKSYSIKTWLVGDGLTEEDQKKAAEGTLFIPFSQFPPKKLRKDCFYHSIPAMAAPASLE  558

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            N+DSCENWLPRRVMSAWRVAGI+H +EGW+ +ECG+ M DI K+W+AS++HGF+P  +
Sbjct  559  NVDSCENWLPRRVMSAWRVAGIVHALEGWDEHECGSTMADIDKVWQASIQHGFKPLVI  616



>gb|KJB76257.1| hypothetical protein B456_012G081600 [Gossypium raimondii]
Length=631

 Score =   249 bits (636),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQVVLRG L KVAC++A ALCQ+  QV+VL EDEY++L   L  ++   LVL
Sbjct  449  LNSIPKGTTQVVLRGKLPKVACALAFALCQKRIQVSVLREDEYEKLDKLLGTKSEGKLVL  508

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K+Y+ KTWLVGDGLS  +Q KA KGT FIPFSQFPPKK+R DC Y  TPAM +P   EN
Sbjct  509  SKSYTCKTWLVGDGLSEVEQRKASKGTLFIPFSQFPPKKLRTDCFYHTTPAMQIPLAFEN  568

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            +DSCENWLPRRVMS WR+AG++H +EGW  +ECG    +I K+WEA+L+HGF+P  V
Sbjct  569  VDSCENWLPRRVMSIWRIAGLVHALEGWEEHECGYTTSNIEKVWEATLKHGFQPLKV  625



>gb|KJB67446.1| hypothetical protein B456_010G191100 [Gossypium raimondii]
Length=528

 Score =   246 bits (627),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 140/183 (77%), Gaps = 1/183 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQV+LRGNL+KVA ++A ALCQ+G QV VL EDEY++L   L  ++   LV 
Sbjct  345  LNSIPKGTTQVLLRGNLTKVAFAVAFALCQKGIQVTVLREDEYEKLDKSLGTKSEGKLVT  404

Query  538  TKTYSA-KTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            +K+YS+ K WLVGD L+ ++Q KA KGT FIPFSQ PPKK+RKDC Y  TPAM  P  LE
Sbjct  405  SKSYSSCKVWLVGDDLTEEEQRKANKGTLFIPFSQLPPKKLRKDCFYHTTPAMQTPTALE  464

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            N+DSCENWLPRRVMS WR+AGILH +EGW  +ECG  M +I K+WEA L+HGF+P  V  
Sbjct  465  NVDSCENWLPRRVMSVWRIAGILHALEGWEEHECGYTMSNIDKVWEACLKHGFQPLKVPT  524

Query  181  ATE  173
             ++
Sbjct  525  QSK  527



>ref|XP_008232308.1| PREDICTED: protein ECERIFERUM 1-like, partial [Prunus mume]
Length=594

 Score =   247 bits (631),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 142/184 (77%), Gaps = 1/184 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IPKGTTQV+LRGNL+KVA ++A ALCQ+G QVA L  DEY +L   L+    + L+L
Sbjct  412  LNTIPKGTTQVLLRGNLTKVAYAVAFALCQKGIQVATLHHDEYLKLTKSLSG-MESGLLL  470

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K+Y+ K WLVGDGLS ++Q++APKGT F+PFSQFPPKK+RKDC Y  TPAM  P  LEN
Sbjct  471  AKSYAHKVWLVGDGLSEEEQLRAPKGTLFVPFSQFPPKKLRKDCFYHYTPAMRTPISLEN  530

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            + +CENWLPRRVMSAWR+AGI+H +EGW  +ECG  M +I  +W+A+L+HGF+P  +S +
Sbjct  531  VHACENWLPRRVMSAWRIAGIVHALEGWKEHECGYNMSNIDNVWQATLQHGFQPLMISTS  590

Query  178  TEPN  167
               N
Sbjct  591  HTKN  594



>ref|XP_007220541.1| hypothetical protein PRUPE_ppa002903mg [Prunus persica]
 gb|EMJ21740.1| hypothetical protein PRUPE_ppa002903mg [Prunus persica]
Length=623

 Score =   248 bits (632),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 142/184 (77%), Gaps = 1/184 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IPKGTTQV+LRGNL+KVA ++A ALCQ+G Q+  L  DEY +L   L+    ++LVL
Sbjct  441  LNTIPKGTTQVLLRGNLTKVAHAVAFALCQKGIQITTLHHDEYLKLTKSLS-GMESSLVL  499

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K+Y+ K WLVGDGLS ++Q++APKGT F+PFSQFPPKK+RKDC Y  TPAM  P  LEN
Sbjct  500  AKSYAHKIWLVGDGLSEEEQLRAPKGTLFVPFSQFPPKKLRKDCFYHYTPAMKTPPSLEN  559

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            + +CENWLPRRVMSAWR+AGI+H +EGW  +ECG  M +I K+W+A+L+HGF+P  +S  
Sbjct  560  VHACENWLPRRVMSAWRIAGIVHALEGWKEHECGYNMSNIDKVWQATLQHGFQPLIISTT  619

Query  178  TEPN  167
               N
Sbjct  620  HTKN  623



>ref|XP_007218858.1| hypothetical protein PRUPE_ppa002770mg [Prunus persica]
 gb|EMJ20057.1| hypothetical protein PRUPE_ppa002770mg [Prunus persica]
Length=635

 Score =   248 bits (633),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 142/184 (77%), Gaps = 1/184 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IPKGTTQV+LRGNL+KVA ++A ALCQ+G Q+  L  DEY +L   L+    ++LVL
Sbjct  453  LNTIPKGTTQVLLRGNLTKVAHAVAFALCQKGIQITTLHHDEYLKLTKSLS-GMESSLVL  511

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K+Y+ K WLVGDGLS ++Q++APKGT F+PFSQFPPKK+RKDC Y  TPAM  P  LEN
Sbjct  512  AKSYAHKIWLVGDGLSEEEQLRAPKGTLFVPFSQFPPKKLRKDCFYHYTPAMKTPPSLEN  571

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            + +CENWLPRRVMSAWR+AGI+H +EGW  +ECG  M +I K+W+A+L+HGF+P  +S  
Sbjct  572  VHACENWLPRRVMSAWRIAGIVHALEGWKEHECGYNMSNIDKVWQATLQHGFQPLIISTT  631

Query  178  TEPN  167
               N
Sbjct  632  HTKN  635



>ref|XP_008338420.1| PREDICTED: protein ECERIFERUM 1-like [Malus domestica]
Length=623

 Score =   247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQVVLRGNL+KVA +IA AL Q+G Q+A L + E+ +L   LN    +NL++
Sbjct  441  LNSIPKGTTQVVLRGNLTKVAYAIAHALSQKGIQIATLHQAEHLKLTKSLN-GTESNLIV  499

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K+Y+ K WLVGDGL+  +QM+APKGT F+PFSQFPPKK+RKDC Y  TPAM  P  LEN
Sbjct  500  AKSYAQKIWLVGDGLTEKEQMRAPKGTLFVPFSQFPPKKLRKDCFYHYTPAMKTPASLEN  559

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            + SCENWLPRRVMSAWRVAGI+H +EGW  +ECG  M +  K+W+ASL HGF+P T+S +
Sbjct  560  VHSCENWLPRRVMSAWRVAGIVHALEGWKEHECGYTMSNSDKVWQASLVHGFQPLTISTS  619

Query  178  TEPN  167
               N
Sbjct  620  HTKN  623



>gb|KHG15491.1| Protein WAX2 -like protein [Gossypium arboreum]
Length=612

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 137/177 (77%), Gaps = 0/177 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQVVLRG L+KVAC++A  LCQ+  QV+VL EDEY++L   L  ++   LVL
Sbjct  430  LNSIPKGTTQVVLRGKLTKVACALAFTLCQKRIQVSVLREDEYEKLDKLLGTKSEGKLVL  489

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K+Y+ KTWLVGDGLS  +Q KA KGT FIPFSQFPPKK+R DC Y  TPAM  P   EN
Sbjct  490  SKSYTCKTWLVGDGLSEVEQKKASKGTLFIPFSQFPPKKLRTDCFYHTTPAMQTPLAFEN  549

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            +DSCENWLPRRVMS WR+AG++H +EGW  +ECG    +I K+WEA+++HGF+P  V
Sbjct  550  VDSCENWLPRRVMSVWRIAGLVHALEGWEEHECGYTTSNIEKVWEATVKHGFQPLRV  606



>gb|EPS60467.1| hypothetical protein M569_14337, partial [Genlisea aurea]
Length=623

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 139/175 (79%), Gaps = 1/175 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN++ K TTQV+L GNL+KVA +IA ALC +G +V  L E +YK LKA+++ +   NL L
Sbjct  450  LNAVHKDTTQVLLCGNLTKVAYAIASALCNKGIKVLALNEAQYKMLKAKID-DGGKNLAL  508

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
                + K WLVGDG++  +Q  APKG+ FIPFSQFPPKKVRKDC Y  TP+M+VPK+L+N
Sbjct  509  LAKDAPKIWLVGDGITEAEQAMAPKGSIFIPFSQFPPKKVRKDCTYHVTPSMVVPKYLQN  568

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPF  194
            LDSCENWLPRRVMSAWR+AGILHG EGWNVNECG  +FD+ +IWEASL+HGFRP 
Sbjct  569  LDSCENWLPRRVMSAWRIAGILHGAEGWNVNECGELVFDVNRIWEASLKHGFRPL  623



>ref|XP_009376851.1| PREDICTED: protein ECERIFERUM 1-like [Pyrus x bretschneideri]
Length=623

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQVVLRGNL+KVA +IA AL Q+G QVA L + E+ +L   LN    +NL++
Sbjct  441  LNSIPKGTTQVVLRGNLTKVAYAIAYALSQKGIQVATLYQAEHLKLTKSLN-GTKSNLIV  499

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K+Y+ K WLVGDGL+  +QM+APKGT F+PFSQFPPKK+RKDC Y  TPAM  P  LEN
Sbjct  500  AKSYAQKIWLVGDGLTEKEQMRAPKGTLFVPFSQFPPKKLRKDCFYHYTPAMKTPASLEN  559

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            + SCENWLPRRVMSAWRVAGI+H +EGW  +ECG  M +  K+W+ASL HGF+P T+  A
Sbjct  560  VHSCENWLPRRVMSAWRVAGIVHALEGWKEHECGYTMSNSDKVWQASLVHGFQPLTIITA  619

Query  178  TEPN  167
               N
Sbjct  620  HTKN  623



>gb|KJB67445.1| hypothetical protein B456_010G191100 [Gossypium raimondii]
Length=624

 Score =   246 bits (629),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 140/183 (77%), Gaps = 1/183 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQV+LRGNL+KVA ++A ALCQ+G QV VL EDEY++L   L  ++   LV 
Sbjct  441  LNSIPKGTTQVLLRGNLTKVAFAVAFALCQKGIQVTVLREDEYEKLDKSLGTKSEGKLVT  500

Query  538  TKTYSA-KTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            +K+YS+ K WLVGD L+ ++Q KA KGT FIPFSQ PPKK+RKDC Y  TPAM  P  LE
Sbjct  501  SKSYSSCKVWLVGDDLTEEEQRKANKGTLFIPFSQLPPKKLRKDCFYHTTPAMQTPTALE  560

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            N+DSCENWLPRRVMS WR+AGILH +EGW  +ECG  M +I K+WEA L+HGF+P  V  
Sbjct  561  NVDSCENWLPRRVMSVWRIAGILHALEGWEEHECGYTMSNIDKVWEACLKHGFQPLKVPT  620

Query  181  ATE  173
             ++
Sbjct  621  QSK  623



>ref|XP_008232261.1| PREDICTED: protein ECERIFERUM 1-like [Prunus mume]
Length=623

 Score =   245 bits (626),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTT+V+LRG L+KVA + ALALCQ+G QVA L + EY +L   LN    +  VL
Sbjct  441  LNSIPKGTTEVLLRGKLTKVAYATALALCQKGIQVATLHQTEYLKLTKSLN-VTESRFVL  499

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            T++Y+ K WLVGDGLS ++Q++APKGT F PFSQFPPKK+RKDC Y  TPAM  P  LEN
Sbjct  500  TRSYAQKIWLVGDGLSEEEQLRAPKGTLFFPFSQFPPKKLRKDCFYHYTPAMKTPTSLEN  559

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            + +CENWLPRRVMSAWR+AGI+H +EGW  +ECG  M +I K+W+A+L+HGF+P  +S  
Sbjct  560  VHACENWLPRRVMSAWRIAGIVHALEGWKEHECGYNMSNIDKVWQATLQHGFQPLMISTT  619

Query  178  TEPN  167
               N
Sbjct  620  HTKN  623



>ref|XP_011012757.1| PREDICTED: protein ECERIFERUM 1-like [Populus euphratica]
Length=622

 Score =   245 bits (626),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 141/182 (77%), Gaps = 1/182 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEA-ATNLV  542
            LNSIP+GTTQV+  GNLSKVA ++ L LC++G QVAV  ED+YK+LK      +   NL+
Sbjct  439  LNSIPEGTTQVLHIGNLSKVAYAVVLNLCRRGIQVAVPYEDDYKKLKKSFGIRSDQNNLI  498

Query  541  LTKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            L+K YS KTWLVGDGL  ++Q KA +GT FIPFSQFPP+K+R+DC Y + PAM  P  LE
Sbjct  499  LSKNYSIKTWLVGDGLKGENQKKATEGTLFIPFSQFPPQKLREDCFYHSIPAMAAPASLE  558

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            N+DSCENWLPRRVMSAWRVAGI+H +EGWN +ECG  M DI K+W+AS++HGF+P  ++ 
Sbjct  559  NVDSCENWLPRRVMSAWRVAGIVHALEGWNEHECGYTMSDIDKVWQASIQHGFKPLVITT  618

Query  181  AT  176
             +
Sbjct  619  QS  620



>gb|KJB67450.1| hypothetical protein B456_010G191300 [Gossypium raimondii]
Length=671

 Score =   246 bits (628),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 142/183 (78%), Gaps = 1/183 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQV+LRGNL+KVA ++A +LCQ+G QV VL EDEY++L   L  ++   LV+
Sbjct  488  LNSIPKGTTQVLLRGNLTKVAFAVAFSLCQKGIQVTVLREDEYEKLDKSLGTKSEGKLVI  547

Query  538  TKTYSA-KTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            +K+YS+ K WLVGD L+ ++Q KA KGT FIPFSQFP K +RKDC Y  TPAM  PK LE
Sbjct  548  SKSYSSCKVWLVGDDLTEEEQRKANKGTLFIPFSQFPLKNLRKDCFYHTTPAMQAPKALE  607

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            N+DSCENWLPRRVMS WR+AGILH +EGW  +ECG  + +I K+WEA L+HGF+P TV  
Sbjct  608  NVDSCENWLPRRVMSVWRIAGILHALEGWEEHECGYTISNIDKVWEACLKHGFQPLTVPT  667

Query  181  ATE  173
             ++
Sbjct  668  QSK  670



>ref|XP_006445500.1| hypothetical protein CICLE_v10019279mg [Citrus clementina]
 ref|XP_006464360.1| PREDICTED: protein ECERIFERUM 1-like [Citrus sinensis]
 gb|ESR58740.1| hypothetical protein CICLE_v10019279mg [Citrus clementina]
 gb|KDO85379.1| hypothetical protein CISIN_1g006722mg [Citrus sinensis]
Length=633

 Score =   245 bits (626),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 143/185 (77%), Gaps = 3/185 (2%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAA-TNLV  542
            +NSIPKGTTQVVLRG L+KVA +IA ALCQ+G QV  L EDE+++L+     ++   NL+
Sbjct  445  INSIPKGTTQVVLRGALTKVAYAIAFALCQKGIQVVTLREDEHEKLRKSFGAKSECNNLL  504

Query  541  LTKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPP--KKVRKDCLYFNTPAMIVPKH  368
            L+++YS K WLVG GL+ ++Q KA KGT FIPFSQFPP  KK+RKDC+Y  TPAM VP  
Sbjct  505  LSRSYSQKIWLVGKGLTEEEQSKAKKGTIFIPFSQFPPNDKKIRKDCMYHLTPAMAVPAA  564

Query  367  LENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
             EN+DSCENWLPRRVMSAWR+ GI+H +EGWN +ECG A+ +I  +WEA+LRHGF P T 
Sbjct  565  FENVDSCENWLPRRVMSAWRIGGIVHALEGWNEHECGYAISNIHNVWEAALRHGFHPLTA  624

Query  187  SAATE  173
            +  T+
Sbjct  625  TILTQ  629



>ref|XP_008245904.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Prunus mume]
Length=575

 Score =   244 bits (622),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 139/182 (76%), Gaps = 1/182 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IPKGTTQV+LRGNL+KVA ++A ALCQ+G QV  L +DEY +L    +    ++LVL
Sbjct  392  LNTIPKGTTQVLLRGNLTKVAYAVAFALCQKGIQVVTLHKDEYLKLTKSFS-STESSLVL  450

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K+Y+ K WLVGDGL+ ++Q++APKGT FIPFS FPPKK+RKDC Y   PAM  P  LEN
Sbjct  451  AKSYAHKIWLVGDGLTEEEQLRAPKGTLFIPFSHFPPKKLRKDCFYHYPPAMKTPTSLEN  510

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            + +CENWLPRRVMSAWR+AGI+H +EGW  +ECG  M +I K+W+A+++HGF+P  +S  
Sbjct  511  IHACENWLPRRVMSAWRIAGIVHALEGWKEHECGYTMSNIDKVWQATIQHGFQPLIISTT  570

Query  178  TE  173
              
Sbjct  571  NH  572



>gb|EPS71900.1| hypothetical protein M569_02856, partial [Genlisea aurea]
Length=619

 Score =   244 bits (624),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 138/176 (78%), Gaps = 2/176 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            L+SIPKGTTQ+VL G LSKVA S+AL LCQ G +V  + E+EYK+LK  ++ E   NL+L
Sbjct  442  LHSIPKGTTQLVLTGKLSKVAYSLALELCQGGIKVFTMYENEYKKLKQIVSNEYGNNLLL  501

Query  538  TK--TYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHL  365
            +K      KTWL+G+G+   +Q+KAPKGT FIPFS FPPK+ RKDC Y  TPAM+VPKHL
Sbjct  502  SKGSVPMTKTWLIGEGVCKKEQIKAPKGTTFIPFSHFPPKEWRKDCTYHTTPAMLVPKHL  561

Query  364  ENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
            EN+DSCENWLPRRVMSAWR+AGI+H +E WNVNE G  +FDI K WEA+LRHGF P
Sbjct  562  ENIDSCENWLPRRVMSAWRIAGIVHAMEQWNVNEFGKIVFDISKTWEATLRHGFIP  617



>ref|XP_007220536.1| hypothetical protein PRUPE_ppa002824mg [Prunus persica]
 gb|EMJ21735.1| hypothetical protein PRUPE_ppa002824mg [Prunus persica]
Length=629

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 140/178 (79%), Gaps = 1/178 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IPKGTTQV+LRGNL+KVA +IA ALCQ+G QV  L +DEY +L    +    ++LVL
Sbjct  441  LNTIPKGTTQVLLRGNLTKVAYAIAFALCQKGIQVVTLHKDEYLKLTKSFS-STESSLVL  499

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K+Y+ K WLVGDGLSA++Q++APKGT F+PFSQ PPKK+RKDC Y   PAM  P  LEN
Sbjct  500  AKSYAHKIWLVGDGLSAEEQLRAPKGTLFVPFSQLPPKKLRKDCFYHYPPAMKTPTSLEN  559

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVS  185
            + +CENWLPRRVMSAWR+AGI+H +EGW  +ECG  M ++ K+W+A+L+HGF+P  ++
Sbjct  560  IHACENWLPRRVMSAWRIAGIVHALEGWKEHECGYTMSNVDKVWQATLQHGFQPLIIT  617



>ref|XP_004307281.1| PREDICTED: protein ECERIFERUM 1-like [Fragaria vesca subsp. vesca]
Length=625

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 137/175 (78%), Gaps = 1/175 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTT+V+LRGNL+KVA ++A +LCQ+G QVA L + +Y +L    +    + LVL
Sbjct  441  LNSIPKGTTEVLLRGNLTKVAYALAFSLCQKGIQVATLHQSDYLKLTKSFS-ATESKLVL  499

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K+Y+AK WLVGDGLS ++Q+ APKGT F+PFSQ PPKK+RKDC Y  TPAM  P  LEN
Sbjct  500  AKSYAAKIWLVGDGLSKEEQLNAPKGTIFVPFSQLPPKKLRKDCYYHCTPAMKTPTSLEN  559

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPF  194
            + SCENWLPRRVMS WR+AGI+H +EGWN +ECG  M DI K+W+A+LRHGF+P 
Sbjct  560  IYSCENWLPRRVMSVWRIAGIVHALEGWNKHECGYTMSDINKVWQATLRHGFQPL  614



>ref|XP_008344085.1| PREDICTED: protein ECERIFERUM 1-like [Malus domestica]
Length=620

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 136/178 (76%), Gaps = 1/178 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQVV RGNL+KVA ++A AL Q+G QVA L EDEY +L   L+    ++LVL
Sbjct  441  LNSIPKGTTQVVFRGNLTKVAYALAFALYQKGIQVATLHEDEYLKLTKSLS-ATESSLVL  499

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             ++Y+ K WLVGDGL+  +Q+ AP+GT F+PFSQ PPKK+RKDC Y  TPAM +P  LEN
Sbjct  500  AESYAHKIWLVGDGLTEKEQLSAPRGTLFVPFSQLPPKKLRKDCFYHYTPAMKIPSSLEN  559

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVS  185
            + SCENWLPRRVMSAWR+AGI+H +EGW  +ECG  M D  K+W+ASLRHGF P   +
Sbjct  560  IYSCENWLPRRVMSAWRIAGIVHALEGWKEHECGYTMSDTDKVWQASLRHGFHPLVTT  617



>ref|XP_009337263.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Pyrus x bretschneideri]
Length=622

 Score =   243 bits (621),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 138/184 (75%), Gaps = 2/184 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQVVLRG L+KVA +IA AL Q+G QV VL + EY +L   L  E+  NLV+
Sbjct  440  LNSIPKGTTQVVLRGKLTKVAYAIAFALSQKGVQVGVLYQVEYLKLTKSLGTES--NLVV  497

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K+Y+ K WLV DGL+  +QM APKGT F+PFSQFPPKK+RKDC Y  TPAM  P  LEN
Sbjct  498  AKSYAQKIWLVDDGLTEKEQMSAPKGTLFVPFSQFPPKKLRKDCFYHYTPAMKTPTSLEN  557

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            + +CENWLPRRVMSAWRVAGI+H +EGW  ++CG  M +I K+W+ASL HGF+P T+S  
Sbjct  558  VHACENWLPRRVMSAWRVAGIVHALEGWKEHDCGYTMSNIDKVWQASLVHGFQPLTISTI  617

Query  178  TEPN  167
               N
Sbjct  618  HTKN  621



>ref|XP_008232283.1| PREDICTED: protein ECERIFERUM 1-like [Prunus mume]
Length=624

 Score =   243 bits (621),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 139/182 (76%), Gaps = 1/182 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IPKGTTQV+LRGNL+KVA ++A ALCQ+G QV  L +DEY +L    +    ++LVL
Sbjct  441  LNTIPKGTTQVLLRGNLTKVAYAVAFALCQKGIQVVTLHKDEYLKLTKSFS-STESSLVL  499

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K+Y+ K WLVGDGL+ ++Q++APKGT FIPFS FPPKK+RKDC Y   PAM  P  LEN
Sbjct  500  AKSYAHKIWLVGDGLTEEEQLRAPKGTLFIPFSHFPPKKLRKDCFYHYPPAMKTPTSLEN  559

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            + +CENWLPRRVMSAWR+AGI+H +EGW  +ECG  M +I K+W+A+++HGF+P  +S  
Sbjct  560  IHACENWLPRRVMSAWRIAGIVHALEGWKEHECGYTMSNIDKVWQATIQHGFQPLIISTT  619

Query  178  TE  173
              
Sbjct  620  NH  621



>ref|XP_008245903.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Prunus mume]
Length=624

 Score =   243 bits (621),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 139/182 (76%), Gaps = 1/182 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IPKGTTQV+LRGNL+KVA ++A ALCQ+G QV  L +DEY +L    +    ++LVL
Sbjct  441  LNTIPKGTTQVLLRGNLTKVAYAVAFALCQKGIQVVTLHKDEYLKLTKSFS-STESSLVL  499

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K+Y+ K WLVGDGL+ ++Q++APKGT FIPFS FPPKK+RKDC Y   PAM  P  LEN
Sbjct  500  AKSYAHKIWLVGDGLTEEEQLRAPKGTLFIPFSHFPPKKLRKDCFYHYPPAMKTPTSLEN  559

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            + +CENWLPRRVMSAWR+AGI+H +EGW  +ECG  M +I K+W+A+++HGF+P  +S  
Sbjct  560  IHACENWLPRRVMSAWRIAGIVHALEGWKEHECGYTMSNIDKVWQATIQHGFQPLIISTT  619

Query  178  TE  173
              
Sbjct  620  NH  621



>gb|KHG03871.1| Protein WAX2 -like protein [Gossypium arboreum]
Length=599

 Score =   243 bits (620),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 139/183 (76%), Gaps = 1/183 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQV+LRG+L+KVA ++A ALCQ+G QV +L EDEY++L   L  ++   LV 
Sbjct  416  LNSIPKGTTQVLLRGHLTKVAFAVAFALCQKGIQVTILREDEYEKLDKSLGTKSEGKLVT  475

Query  538  TKTYSA-KTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            +K+YS+ K W VGD L+ ++Q KA KGT FIPFSQ PPKK+RKDC Y  TPAM  P  LE
Sbjct  476  SKSYSSCKVWFVGDDLTEEEQRKANKGTLFIPFSQLPPKKLRKDCFYHTTPAMQTPTALE  535

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            N+DSCENWLPRRVMS WR+AGILH +EGW  +ECG  M +I K+WEA L+HGF+P  V  
Sbjct  536  NVDSCENWLPRRVMSVWRIAGILHALEGWEEHECGYTMSNIDKVWEACLKHGFQPLKVPT  595

Query  181  ATE  173
             ++
Sbjct  596  QSK  598



>gb|KHN30013.1| Protein WAX2 [Glycine soja]
Length=621

 Score =   243 bits (620),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 138/177 (78%), Gaps = 1/177 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQV+LRG L+K+A ++A  LCQQG QVA L ED+Y RLK   N  + TNL  
Sbjct  442  LNSIPKGTTQVLLRGKLTKIAYALAYTLCQQGVQVAALYEDDYVRLKKSFN-SSETNLAF  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            TK+ +  TWLVGDGL+ ++Q+KAPKGT FIP++QFPP+K RKDC Y  TPAM+ P  +EN
Sbjct  501  TKSSTQTTWLVGDGLTEEEQLKAPKGTLFIPYTQFPPRKYRKDCFYHCTPAMLAPCSVEN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            + SCE+WLPRR+MSAWR+AGI+H +EGW  +ECG+ M +I  +W ++L+HGF+P  V
Sbjct  561  IHSCEDWLPRRIMSAWRIAGIVHSLEGWTEHECGHTMHNIDNVWHSTLQHGFQPLPV  617



>ref|XP_011085187.1| PREDICTED: protein ECERIFERUM 1-like [Sesamum indicum]
Length=597

 Score =   243 bits (619),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 139/178 (78%), Gaps = 4/178 (2%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTT+++ RG+LSKVA +I  ALCQQG QVA   E+E    K +L+      +++
Sbjct  423  LNSIPKGTTEILFRGSLSKVAYAIVCALCQQGIQVATFYENE----KLKLSAVTQNKVIV  478

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K+++ K W+VGDG+S D+Q+ APKGT FIPFSQFPPKK R D  Y++TP+M+ P  L N
Sbjct  479  AKSFTQKVWIVGDGVSDDEQLNAPKGTLFIPFSQFPPKKTRNDAFYYHTPSMLAPPSLHN  538

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVS  185
            L SCENWLPRRVMSAWRVAGI+H +EGW+V+ECG+ +FD+ +I EA+LRHGFRP TVS
Sbjct  539  LHSCENWLPRRVMSAWRVAGIVHALEGWDVHECGDTIFDVKRILEAALRHGFRPTTVS  596



>ref|XP_009337266.1| PREDICTED: protein ECERIFERUM 1-like [Pyrus x bretschneideri]
Length=446

 Score =   238 bits (608),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 137/184 (74%), Gaps = 2/184 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQVV+RG L+KVA +IA AL Q+G QV VL + EY +    L  E+  NLV+
Sbjct  264  LNSIPKGTTQVVVRGKLTKVAYAIAFALSQKGVQVGVLHQAEYLKRTKSLGTES--NLVV  321

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K+Y+ K WLVGDGL+  +QM APKGT F+PFSQFPPKK+RKD  Y  TPAM  P  LE+
Sbjct  322  AKSYAQKIWLVGDGLTEKEQMSAPKGTLFVPFSQFPPKKLRKDFFYHYTPAMKTPTSLEH  381

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            + +CENWLPRRVMSAWRVAGI+H +EGW  ++CG  M +I K+W+ASL HGF+P T+S  
Sbjct  382  VHACENWLPRRVMSAWRVAGIVHALEGWKAHDCGYTMSNIDKVWQASLVHGFQPLTISTI  441

Query  178  TEPN  167
               N
Sbjct  442  HTKN  445



>gb|KJB76286.1| hypothetical protein B456_012G081500 [Gossypium raimondii]
Length=613

 Score =   243 bits (619),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 138/178 (78%), Gaps = 1/178 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPK TTQVVLRG L+KVAC++A ALCQ+  QV+VL EDEY++L   L  ++   LVL
Sbjct  430  LNSIPKRTTQVVLRGKLTKVACALAFALCQKRIQVSVLREDEYEKLDKLLGTKSEGKLVL  489

Query  538  TKTYSAKTWLVGDG-LSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            +K+Y+ KTWLVGDG LS  +Q KA KGT FIPFSQFPPKK+R DC Y  TPAM  P  LE
Sbjct  490  SKSYTFKTWLVGDGGLSEVEQRKASKGTLFIPFSQFPPKKLRTDCFYHTTPAMQTPLALE  549

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            N+DSCENWLPRRVMS WR+AG++H +EGW  +ECG    +I K+WEA+L+HGF+P  V
Sbjct  550  NVDSCENWLPRRVMSVWRIAGLVHALEGWEEHECGYTTSNIEKVWEATLKHGFQPLRV  607



>ref|XP_007218863.1| hypothetical protein PRUPE_ppa002893mg [Prunus persica]
 gb|EMJ20062.1| hypothetical protein PRUPE_ppa002893mg [Prunus persica]
Length=623

 Score =   243 bits (620),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTT+V+LRGNL+KVA + A ALCQ+G QVA L + EY +L   LN    + LVL
Sbjct  441  LNSIPKGTTEVLLRGNLTKVAYATAFALCQKGIQVATLNQTEYLKLTKSLN-VTDSRLVL  499

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             ++Y+ K WLVGDGLS ++Q++APKGT F+PFSQFP KK+RKDC Y  TPAM  P  LEN
Sbjct  500  ARSYAQKIWLVGDGLSEEEQLRAPKGTLFVPFSQFPQKKLRKDCFYHYTPAMKTPPSLEN  559

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            + +CENWLPRRVMSAWR+AGI+H +EGW  +ECG  M +I K+W+A+L+HGF+P  +S  
Sbjct  560  VHACENWLPRRVMSAWRIAGIVHALEGWKEHECGYNMSNIDKVWQATLQHGFQPLMISTT  619

Query  178  TEPN  167
               N
Sbjct  620  HTKN  623



>gb|KJB76287.1| hypothetical protein B456_012G081500 [Gossypium raimondii]
Length=631

 Score =   243 bits (620),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 138/178 (78%), Gaps = 1/178 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPK TTQVVLRG L+KVAC++A ALCQ+  QV+VL EDEY++L   L  ++   LVL
Sbjct  448  LNSIPKRTTQVVLRGKLTKVACALAFALCQKRIQVSVLREDEYEKLDKLLGTKSEGKLVL  507

Query  538  TKTYSAKTWLVGDG-LSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            +K+Y+ KTWLVGDG LS  +Q KA KGT FIPFSQFPPKK+R DC Y  TPAM  P  LE
Sbjct  508  SKSYTFKTWLVGDGGLSEVEQRKASKGTLFIPFSQFPPKKLRTDCFYHTTPAMQTPLALE  567

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            N+DSCENWLPRRVMS WR+AG++H +EGW  +ECG    +I K+WEA+L+HGF+P  V
Sbjct  568  NVDSCENWLPRRVMSVWRIAGLVHALEGWEEHECGYTTSNIEKVWEATLKHGFQPLRV  625



>ref|XP_009376850.1| PREDICTED: protein ECERIFERUM 1-like [Pyrus x bretschneideri]
Length=620

 Score =   243 bits (619),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 136/178 (76%), Gaps = 1/178 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            L+SIPKGTTQVV RGNL+KVA ++A AL Q+G QVA L EDEY +L   L+    ++LVL
Sbjct  441  LSSIPKGTTQVVFRGNLTKVAYALAFALYQKGIQVATLHEDEYLKLTKSLS-ATESSLVL  499

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             ++Y+ K WLVGDGL+  +Q+ AP+GT F+PFSQ PPKK+RKDC Y  TPAM +P  LEN
Sbjct  500  AESYAHKVWLVGDGLTEKEQLSAPRGTLFVPFSQLPPKKLRKDCFYHYTPAMKIPTSLEN  559

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVS  185
            + SCENWLPRRVMSAWR+AGI+H +EGW  +ECG  M D  K+W+ASLRHGF P   S
Sbjct  560  VYSCENWLPRRVMSAWRIAGIVHALEGWKEHECGYTMSDTDKVWQASLRHGFHPLVTS  617



>ref|XP_004133955.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis sativus]
 gb|KGN56665.1| hypothetical protein Csa_3G127760 [Cucumis sativus]
Length=624

 Score =   242 bits (618),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPK  TQV+LRG L+KVA +++ +LCQ+G QVAVL E+EY++L    N +  +N VL
Sbjct  441  LNSIPKSATQVLLRGKLTKVAYALSYSLCQRGIQVAVLHEEEYRKLNKSFNTKFESNPVL  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K YS   WLVGDGL+ ++QMKAPKGT FIPFSQ PPK VRKDC Y  TPAM  P+ +EN
Sbjct  501  SKGYSQNIWLVGDGLTNEEQMKAPKGTTFIPFSQLPPKIVRKDCFYHCTPAMKAPRSIEN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFT  191
            + SCENWLPRRVMSAWR+AG++H +EGW  +ECG  M +I ++W+A+LRHGF+P T
Sbjct  561  VHSCENWLPRRVMSAWRIAGVVHAMEGWTEHECGYTMSNIDQVWKATLRHGFQPVT  616



>gb|KEH17984.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=658

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIPKGTTQV+LRG L+KVA ++A  LCQQG Q+A + +D+Y +LK  L   + +N+V 
Sbjct  478  INSIPKGTTQVLLRGKLTKVAYALAYTLCQQGVQIATMNDDDYVKLKKALMHSSHSNIVN  537

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K+++   WLVGDGL+ ++Q+KAPKGT FIP+SQFPPKK RKDCLY  TPAM+ P  +EN
Sbjct  538  AKSFTQMIWLVGDGLTEEEQLKAPKGTLFIPYSQFPPKKHRKDCLYHYTPAMLTPTSIEN  597

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            + SCE+WLPRRVMSAWRVAGI+H +E WN +ECG  M ++ K+W ++L+HGF+P TV
Sbjct  598  VHSCEDWLPRRVMSAWRVAGIVHCLEEWNEHECGYNMINMDKVWPSALKHGFKPLTV  654



>ref|XP_010052747.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Eucalyptus grandis]
Length=620

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 138/179 (77%), Gaps = 0/179 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIPKGT QV+ RG L+KVA +IALALCQ+G QVA+L E EYK LK  LN +  +NL+L
Sbjct  435  VNSIPKGTVQVLFRGRLTKVAYAIALALCQRGIQVAILHEHEYKMLKKSLNHKCDSNLLL  494

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +  ++ K W+VG  +  +DQ+KAP+GT FIPFSQFPP+K+R DC Y +TPA++ P  LEN
Sbjct  495  SSGHAPKVWIVGADIMEEDQLKAPEGTLFIPFSQFPPEKLRGDCFYHHTPALVAPASLEN  554

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            + SCENWLPRRVMS WRVAGILH  EGW  +ECG ++ DI K W+ASL+HGF+P  + A
Sbjct  555  VHSCENWLPRRVMSTWRVAGILHAAEGWEEHECGYSITDIDKAWQASLQHGFQPLGLPA  613



>ref|XP_007041186.1| Fatty acid hydroxylase superfamily isoform 2 [Theobroma cacao]
 gb|EOX97017.1| Fatty acid hydroxylase superfamily isoform 2 [Theobroma cacao]
Length=620

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 139/179 (78%), Gaps = 1/179 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIP+ TTQV+L G +SKV  +IALALCQ+G QVA + EDEY++L+   + +   NLVL
Sbjct  443  VNSIPQETTQVLLTGRISKVGYAIALALCQKGVQVAAMNEDEYQKLQHS-DCQFGKNLVL  501

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             + Y  K WLVG+GL+  +Q+KA KGT F+PF+QFPPKK+ KDC Y  TPAM+ PK L+N
Sbjct  502  AENYDQKIWLVGEGLTDKEQLKATKGTVFVPFTQFPPKKLLKDCYYHTTPAMVAPKSLDN  561

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            + SCENWL RRVMSAWRVAGI+HG+EGWNV+ECG  MF + K+WEA+L HGF P ++S 
Sbjct  562  IHSCENWLARRVMSAWRVAGIVHGLEGWNVHECGQTMFSMDKVWEATLLHGFCPLSLSV  620



>ref|XP_007041185.1| Fatty acid hydroxylase superfamily isoform 1 [Theobroma cacao]
 gb|EOX97016.1| Fatty acid hydroxylase superfamily isoform 1 [Theobroma cacao]
Length=612

 Score =   241 bits (614),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 139/179 (78%), Gaps = 1/179 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIP+ TTQV+L G +SKV  +IALALCQ+G QVA + EDEY++L+   + +   NLVL
Sbjct  435  VNSIPQETTQVLLTGRISKVGYAIALALCQKGVQVAAMNEDEYQKLQHS-DCQFGKNLVL  493

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             + Y  K WLVG+GL+  +Q+KA KGT F+PF+QFPPKK+ KDC Y  TPAM+ PK L+N
Sbjct  494  AENYDQKIWLVGEGLTDKEQLKATKGTVFVPFTQFPPKKLLKDCYYHTTPAMVAPKSLDN  553

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            + SCENWL RRVMSAWRVAGI+HG+EGWNV+ECG  MF + K+WEA+L HGF P ++S 
Sbjct  554  IHSCENWLARRVMSAWRVAGIVHGLEGWNVHECGQTMFSMDKVWEATLLHGFCPLSLSV  612



>ref|XP_010052746.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Eucalyptus grandis]
 gb|KCW76818.1| hypothetical protein EUGRSUZ_D01172 [Eucalyptus grandis]
Length=627

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 138/179 (77%), Gaps = 0/179 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIPKGT QV+ RG L+KVA +IALALCQ+G QVA+L E EYK LK  LN +  +NL+L
Sbjct  442  VNSIPKGTVQVLFRGRLTKVAYAIALALCQRGIQVAILHEHEYKMLKKSLNHKCDSNLLL  501

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +  ++ K W+VG  +  +DQ+KAP+GT FIPFSQFPP+K+R DC Y +TPA++ P  LEN
Sbjct  502  SSGHAPKVWIVGADIMEEDQLKAPEGTLFIPFSQFPPEKLRGDCFYHHTPALVAPASLEN  561

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            + SCENWLPRRVMS WRVAGILH  EGW  +ECG ++ DI K W+ASL+HGF+P  + A
Sbjct  562  VHSCENWLPRRVMSTWRVAGILHAAEGWEEHECGYSITDIDKAWQASLQHGFQPLGLPA  620



>ref|XP_008232262.1| PREDICTED: protein ECERIFERUM 1-like [Prunus mume]
Length=623

 Score =   241 bits (614),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 140/184 (76%), Gaps = 1/184 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IPKGTTQV+LRGNL+KVA ++A ALCQ+G QV +L  DEY +L   L+    + LVL
Sbjct  441  LNTIPKGTTQVLLRGNLTKVAYAVAFALCQKGIQVTILHHDEYLKLTKSLS-GMESGLVL  499

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K+Y+ K WLVGDGLS ++Q++APKGT F+PFSQF PKK+RKDC Y  TPAM  P  LEN
Sbjct  500  AKSYAHKIWLVGDGLSEEEQLRAPKGTLFVPFSQFAPKKLRKDCFYHYTPAMKTPTSLEN  559

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            + +CENWLPRRVMSAWR+AGI+H +EG   +ECG  M +I  +W+A+L+HGF+P  VS +
Sbjct  560  VHTCENWLPRRVMSAWRIAGIVHALEGRKEHECGYNMSNIDNVWQATLQHGFQPLMVSTS  619

Query  178  TEPN  167
               N
Sbjct  620  HTKN  623



>ref|XP_008364777.1| PREDICTED: protein ECERIFERUM 1-like [Malus domestica]
Length=623

 Score =   241 bits (614),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 137/184 (74%), Gaps = 2/184 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQVVLRG L+KVA +IA AL Q+G Q+  L + EY +L   L+ E+  NLV+
Sbjct  441  LNSIPKGTTQVVLRGKLTKVAYAIAYALSQKGVQIXTLYQXEYLKLTKSLDTES--NLVV  498

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K+Y+ K WLVGDGL+  +Q  APKGT F+PFSQFPPKK+RKDC Y  TPAM  P  LEN
Sbjct  499  AKSYAQKVWLVGDGLTEKEQXSAPKGTLFVPFSQFPPKKLRKDCFYHYTPAMKTPTSLEN  558

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            + +CENWLPRRVMSAWRVAGI H +EGW  ++CG  M +I K+W+ASL HGF+P T++  
Sbjct  559  VHACENWLPRRVMSAWRVAGIXHALEGWKEHDCGYTMSNIDKVWQASLVHGFQPLTINTI  618

Query  178  TEPN  167
               N
Sbjct  619  HTKN  622



>emb|CBI16760.3| unnamed protein product [Vitis vinifera]
Length=2763

 Score =   249 bits (636),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 133/166 (80%), Gaps = 0/166 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQV+ RG LSKVA   A+ALCQ+G QV    E+E+K++K +LN +    L L
Sbjct  441  LNSIPKGTTQVLFRGKLSKVAYFTAIALCQKGIQVTTFCEEEHKKIKMKLNTKLGDKLAL  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K Y+ K WLVGDGL+ ++Q+KAPKGT FIPFSQFPPK++RKDC Y  TPAM+ P   EN
Sbjct  501  SKNYAHKIWLVGDGLTEEEQLKAPKGTLFIPFSQFPPKRMRKDCFYHTTPAMMSPTSFEN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEA  221
            +DSCENWLPRR MSAWRVAGILH +EGWNV+ECG+ +FDI KIWEA
Sbjct  561  MDSCENWLPRRAMSAWRVAGILHALEGWNVHECGHTIFDIEKIWEA  606


 Score =   115 bits (288),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  718   LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
             LNSIPKGTTQV+ RG LSKVA   ALALCQ+G QVA   E+EY ++  +LN +    L L
Sbjct  2659  LNSIPKGTTQVLFRGKLSKVAYFTALALCQKGIQVATFHEEEYAKINMKLNTKLGGKLAL  2718

Query  538   TKTYSAKTWLVGDGLSADDQMKAPKGTFFI  449
             +K Y+ K WLVGDGL+ ++Q+KAPKGT FI
Sbjct  2719  SKNYAHKIWLVGDGLTKEEQLKAPKGTLFI  2748



>ref|XP_009586962.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana tomentosiformis]
Length=617

 Score =   240 bits (613),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 136/178 (76%), Gaps = 2/178 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQV LRGNL+K+A SIA +LCQ+G QVA L E +Y++LK  L      N VL
Sbjct  441  LNSIPKGTTQVFLRGNLTKIAFSIASSLCQRGIQVATLYESDYEKLK--LATSCQGNFVL  498

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +KT+  K W+VGDGL+ ++QMKA KGT F PFSQ PPKK R DC Y + PAM+ P  L+N
Sbjct  499  SKTFDQKIWVVGDGLTEEEQMKAAKGTLFFPFSQLPPKKARHDCFYHHPPAMLAPPSLQN  558

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVS  185
            L +CENWLPRR MSA RVAGI+H +EGW+V+ECG+ M DI KIWEASL+HGF+P   +
Sbjct  559  LHACENWLPRRAMSAPRVAGIVHALEGWDVHECGDNMIDIDKIWEASLKHGFKPLAFA  616



>gb|KJB76256.1| hypothetical protein B456_012G081600 [Gossypium raimondii]
Length=642

 Score =   241 bits (614),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 138/188 (73%), Gaps = 11/188 (6%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQVVLRG L KVAC++A ALCQ+  QV+VL EDEY++L   L  ++   LVL
Sbjct  449  LNSIPKGTTQVVLRGKLPKVACALAFALCQKRIQVSVLREDEYEKLDKLLGTKSEGKLVL  508

Query  538  TKTYSAK-----------TWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNT  392
            +K+Y+ K           TWLVGDGLS  +Q KA KGT FIPFSQFPPKK+R DC Y  T
Sbjct  509  SKSYTCKVPKPVLNYHFKTWLVGDGLSEVEQRKASKGTLFIPFSQFPPKKLRTDCFYHTT  568

Query  391  PAMIVPKHLENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLR  212
            PAM +P   EN+DSCENWLPRRVMS WR+AG++H +EGW  +ECG    +I K+WEA+L+
Sbjct  569  PAMQIPLAFENVDSCENWLPRRVMSIWRIAGLVHALEGWEEHECGYTTSNIEKVWEATLK  628

Query  211  HGFRPFTV  188
            HGF+P  V
Sbjct  629  HGFQPLKV  636



>ref|XP_010691969.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=469

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 134/181 (74%), Gaps = 1/181 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGT+Q+V RG LSKVA SI  ALC +G QV+ L   EY++LK RL  E   NL L
Sbjct  289  LNSIPKGTSQIVFRGRLSKVAYSIVSALCHKGIQVSTLRSVEYEKLKNRLPTEDCNNLAL  348

Query  538  T-KTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            + K+ + K WLVG+ L+  +Q  A KGT FIPFSQFPPKK R+DC Y NTP+++ PK   
Sbjct  349  SVKSCNQKVWLVGEDLTEHEQSMASKGTIFIPFSQFPPKKTREDCFYMNTPSLMAPKIFG  408

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            NL SCENWLPRRV+SAWRVAGILH +EGWNVNECG+ + DI K+W A L+HGFRP   S+
Sbjct  409  NLHSCENWLPRRVISAWRVAGILHALEGWNVNECGDTIIDIDKVWGACLQHGFRPSMTSS  468

Query  181  A  179
             
Sbjct  469  T  469



>gb|KDP28917.1| hypothetical protein JCGZ_14688 [Jatropha curcas]
Length=571

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 137/180 (76%), Gaps = 0/180 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGT Q++L G+ SKVA  +  ALCQ+G QV    + +Y+++K  L  E  +NL+L
Sbjct  386  LNSIPKGTAQLLLTGSPSKVAFGVVSALCQRGIQVKTALKKDYEKVKTSLGSEYHSNLLL  445

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K YS KTWLV + LS ++Q KA KGT FIP SQFPPKK+R DC Y  TPAM+ P  LEN
Sbjct  446  SKDYSVKTWLVDERLSEEEQKKATKGTLFIPLSQFPPKKLRNDCFYHTTPAMVAPASLEN  505

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            +DSCENWLPRRVMSAWRVAGI+H +E W V+ECG +M+ I K+W+A+LRHGF+P ++ +A
Sbjct  506  VDSCENWLPRRVMSAWRVAGIVHALEEWKVDECGYSMYHIDKVWQAALRHGFKPLSIVSA  565



>ref|XP_007015845.1| CER1 protein [Theobroma cacao]
 gb|EOY33464.1| CER1 protein [Theobroma cacao]
Length=618

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 132/179 (74%), Gaps = 1/179 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN IPK TTQV+LRG +SK AC +  ALCQ+G QV  L ED+YK+L  + + +  +NLVL
Sbjct  441  LNCIPKETTQVLLRGRISKDACLLVQALCQKGIQVVTLQEDDYKKL-LKYDNKLESNLVL  499

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +  Y  K WLVGDGL+  +Q KAPKGT FIPFS FPP ++RKDC Y  TPAM  PK +EN
Sbjct  500  SARYDVKVWLVGDGLTDKEQSKAPKGTLFIPFSIFPPNQIRKDCYYHTTPAMEAPKSVEN  559

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            + SCE+WLPRRVMSA RVAGI+H  EGW VNECG   F I K+WEASL HGFRP ++S 
Sbjct  560  MHSCEDWLPRRVMSASRVAGIIHASEGWEVNECGGTTFSIDKVWEASLEHGFRPLSIST  618



>ref|XP_008438253.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis melo]
Length=624

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 137/174 (79%), Gaps = 0/174 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPK  TQV+LRG L+KVA +++ +LCQ+G QVAVL E+EY++L    N +  ++ VL
Sbjct  441  LNSIPKSATQVLLRGKLTKVAYALSYSLCQRGIQVAVLHEEEYRKLNKSFNTKFESSPVL  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K YS   WLVGDGL+ ++QMKAPKGT FIPFSQ PP+ VRKDC Y  TPAM  P+ +EN
Sbjct  501  SKGYSQNIWLVGDGLTNEEQMKAPKGTTFIPFSQLPPRIVRKDCFYHCTPAMKAPRSIEN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
            + SCENWLPRRVMSAWR+AG++H +EGW  +ECG  M +I ++W+A+LRHGF+P
Sbjct  561  VHSCENWLPRRVMSAWRIAGVVHAMEGWTEHECGYTMSNIDQVWKATLRHGFQP  614



>ref|XP_003529007.1| PREDICTED: protein ECERIFERUM 1-like [Glycine max]
Length=624

 Score =   238 bits (607),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIPK   QV+L G  +KV+ +IA ALC++GT+V  + +DEY +L+ R++ E+  NLV 
Sbjct  441  VNSIPKEARQVLLCGKPNKVSYAIASALCERGTKVTTMYKDEYDKLQLRISNESKKNLVF  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
              +Y+AK WLVGD     +Q KAPKG+ FIP SQFPPKK+RKDC Y +TPAMI P  L N
Sbjct  501  PGSYTAKIWLVGDQCDEVEQKKAPKGSLFIPISQFPPKKLRKDCFYHSTPAMIAPPSLVN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVS  185
            +DSCENWLPRRVMSAWRVAGILH +E W VNECGN MF + KIW+ASL+HGFRP  ++
Sbjct  561  VDSCENWLPRRVMSAWRVAGILHALECWKVNECGNVMFSVEKIWQASLQHGFRPLKIT  618



>ref|XP_009797701.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana sylvestris]
Length=617

 Score =   238 bits (606),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 136/178 (76%), Gaps = 2/178 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIP GTT+V+LRGNL+KVA SIA +LCQ+G QVA + + +Y++LK  L      N VL
Sbjct  441  LNSIPTGTTKVLLRGNLTKVAISIASSLCQRGIQVAAMYKSDYEKLK--LATSCQVNFVL  498

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +KT+  K W+VGDGL+ ++QMKA KGT F PFSQ PPKK R DC Y + PAM+ P  L+N
Sbjct  499  SKTFDQKIWVVGDGLTVEEQMKAAKGTLFFPFSQLPPKKARHDCFYHHPPAMLAPSSLQN  558

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVS  185
            L +CENWLPRR MSA RVAGI+H +EGW+V+ECG+ M DI KIWEASL+HGF+P   +
Sbjct  559  LHACENWLPRRAMSAPRVAGIVHALEGWDVHECGDKMIDIDKIWEASLKHGFKPLAFA  616



>ref|XP_009337262.1| PREDICTED: protein ECERIFERUM 1-like [Pyrus x bretschneideri]
Length=623

 Score =   238 bits (606),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 137/184 (74%), Gaps = 2/184 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQVVLRG L+KVA +IA AL Q+G QVA L + EY +L   L  E+  NLV+
Sbjct  441  LNSIPKGTTQVVLRGKLTKVAYAIAHALSQKGVQVATLYQTEYLKLTKSLGTES--NLVV  498

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K+Y+ K WLVGDGL+  +QM APKG  F+PFSQFPPKK+R+DC Y  TPAM  P  LEN
Sbjct  499  AKSYAQKIWLVGDGLTEKEQMSAPKGALFVPFSQFPPKKLRRDCFYHYTPAMKTPTSLEN  558

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            + +CENWLPRRVMSA RVAGI+H +EGW  ++CG  M +I K+W+ASL HGF+P T+S  
Sbjct  559  VHACENWLPRRVMSASRVAGIVHALEGWKEHDCGYTMSNIDKVWQASLVHGFQPLTISTI  618

Query  178  TEPN  167
               N
Sbjct  619  HTKN  622



>ref|XP_004510148.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Cicer arietinum]
Length=512

 Score =   235 bits (599),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 135/178 (76%), Gaps = 0/178 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPK   QV+L G L KV+ +I  ALC++GT+V  +  D+Y+ L+ RL+ E+  NLV 
Sbjct  331  LNSIPKEANQVLLCGRLDKVSYAIVNALCERGTKVTTMYTDDYENLQLRLSSESKKNLVS  390

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
                S+K WLVGD     +Q KAPKG+ FIPFSQFPPKK+RKDC Y +TPAMI P  L N
Sbjct  391  PGFNSSKIWLVGDQCDEVEQKKAPKGSLFIPFSQFPPKKLRKDCFYGSTPAMITPPDLVN  450

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVS  185
            +DSCENWLPRRVMSAWR+AGILH +EGWN++ECG +MF I K+W+ASL+HGFRP  ++
Sbjct  451  VDSCENWLPRRVMSAWRIAGILHALEGWNIHECGESMFSIEKVWKASLQHGFRPLKIN  508



>ref|XP_008375723.1| PREDICTED: protein ECERIFERUM 1-like [Malus domestica]
Length=623

 Score =   237 bits (605),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 134/179 (75%), Gaps = 2/179 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQVVLRG L+KVA +IA AL Q+G Q+  L   EY +L   L  E+  NLV+
Sbjct  441  LNSIPKGTTQVVLRGKLTKVAYAIAYALSQKGVQIXTLYXAEYLKLTXSLXTES--NLVV  498

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K+ + K WLVGDGL+  +QM APKGT F+PFSQFPPKK+RKDC Y  TPAM  P  LEN
Sbjct  499  AKSXAQKIWLVGDGLTEKEQMSAPKGTLFVPFSQFPPKKLRKDCXYHYTPAMKTPTSLEN  558

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            + +CENWLPRRVMSAWRVAGI+H +EGW  ++CG  M +I K W+ASL HGF+P T+S 
Sbjct  559  VHACENWLPRRVMSAWRVAGIVHALEGWKEHDCGYTMSNIDKFWQASLVHGFQPLTIST  617



>ref|XP_007134354.1| hypothetical protein PHAVU_010G040500g [Phaseolus vulgaris]
 gb|ESW06348.1| hypothetical protein PHAVU_010G040500g [Phaseolus vulgaris]
Length=622

 Score =   237 bits (604),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 135/179 (75%), Gaps = 1/179 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IPKGTTQV+LRG L+KVA  +A  L QQ  QVA L ED+Y RLK      + TNL  
Sbjct  441  LNTIPKGTTQVLLRGKLTKVAYGLAFTLSQQNVQVATLYEDDYVRLKKSFK-SSETNLTF  499

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +KT +   WLVGD +S ++Q+KAPKGT FIP++QFPPKK RKDC Y  TPAM+ P  LEN
Sbjct  500  SKTSTQTVWLVGDEVSEEEQLKAPKGTLFIPYTQFPPKKYRKDCFYHCTPAMLAPPSLEN  559

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            + SCE+WLPRRVMSAWR+AGI+H +EGWN +ECG+ M +I K+W+++L+HGF+P  +  
Sbjct  560  IHSCEDWLPRRVMSAWRIAGIVHSLEGWNEHECGHTMNNIDKVWDSTLQHGFKPIPIQV  618



>gb|KDO85390.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=376

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 138/180 (77%), Gaps = 5/180 (3%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLS--KVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNL  545
            +NS+PK T  V+LRG ++  KVA ++A +LCQ G +VA + +D+Y++LK R+  EA  NL
Sbjct  193  VNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNL  252

Query  544  VLTKTYSA---KTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVP  374
            VL+ +Y+A   K WLVGD L+  +Q +APKGT FIP++Q PP+K+RKDC Y +TPAMI+P
Sbjct  253  VLSTSYAAHKTKIWLVGDDLTGKEQARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMIIP  312

Query  373  KHLENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPF  194
              L N+ SCENWL RRVMSAWR+AGI+H +EGW++NECG  M DI ++W ASLRHGFRP 
Sbjct  313  PSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTMCDIHQVWHASLRHGFRPL  372



>ref|XP_010691968.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=620

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 134/181 (74%), Gaps = 1/181 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGT+Q+V RG LSKVA SI  ALC +G QV+ L   EY++LK RL  E   NL L
Sbjct  440  LNSIPKGTSQIVFRGRLSKVAYSIVSALCHKGIQVSTLRSVEYEKLKNRLPTEDCNNLAL  499

Query  538  T-KTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            + K+ + K WLVG+ L+  +Q  A KGT FIPFSQFPPKK R+DC Y NTP+++ PK   
Sbjct  500  SVKSCNQKVWLVGEDLTEHEQSMASKGTIFIPFSQFPPKKTREDCFYMNTPSLMAPKIFG  559

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            NL SCENWLPRRV+SAWRVAGILH +EGWNVNECG+ + DI K+W A L+HGFRP   S+
Sbjct  560  NLHSCENWLPRRVISAWRVAGILHALEGWNVNECGDTIIDIDKVWGACLQHGFRPSMTSS  619

Query  181  A  179
             
Sbjct  620  T  620



>gb|EYU40309.1| hypothetical protein MIMGU_mgv1a003047mg [Erythranthe guttata]
Length=612

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 135/174 (78%), Gaps = 3/174 (2%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTT+++ RG+LSK+A +I  ALCQQG +VA   E+E  +LK    P A T +V 
Sbjct  440  LNSIPKGTTEILFRGSLSKIAFAIVSALCQQGIKVATFYENE--KLKLSTMPHA-TKVVT  496

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            ++ Y+   W+VGDG + D+Q KAPKGT FIPFSQFPPKK R D +Y  TP++I P  L+N
Sbjct  497  SENYTQMIWIVGDGFTEDEQKKAPKGTLFIPFSQFPPKKARNDVVYRQTPSLIAPPSLKN  556

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
            L+SCENWLPRR MSAWRVAGILH +EGWNV+ECG+ +F+  KIWEA+L+HGFRP
Sbjct  557  LNSCENWLPRRAMSAWRVAGILHALEGWNVHECGDDIFEFKKIWEAALKHGFRP  610



>gb|EYU40310.1| hypothetical protein MIMGU_mgv1a003047mg [Erythranthe guttata]
Length=608

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 135/174 (78%), Gaps = 3/174 (2%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTT+++ RG+LSK+A +I  ALCQQG +VA   E+E  +LK    P A T +V 
Sbjct  436  LNSIPKGTTEILFRGSLSKIAFAIVSALCQQGIKVATFYENE--KLKLSTMPHA-TKVVT  492

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            ++ Y+   W+VGDG + D+Q KAPKGT FIPFSQFPPKK R D +Y  TP++I P  L+N
Sbjct  493  SENYTQMIWIVGDGFTEDEQKKAPKGTLFIPFSQFPPKKARNDVVYRQTPSLIAPPSLKN  552

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
            L+SCENWLPRR MSAWRVAGILH +EGWNV+ECG+ +F+  KIWEA+L+HGFRP
Sbjct  553  LNSCENWLPRRAMSAWRVAGILHALEGWNVHECGDDIFEFKKIWEAALKHGFRP  606



>gb|KDO42773.1| hypothetical protein CISIN_1g041887mg [Citrus sinensis]
Length=223

 Score =   224 bits (571),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 135/178 (76%), Gaps = 2/178 (1%)
 Frame = -2

Query  715  NSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAAT-NLVL  539
            NSIP GTTQVV+RG L+KVA + A ALCQ+G QV  L EDE+++L      ++ + NL++
Sbjct  42   NSIPDGTTQVVIRGILTKVAYATAFALCQKGIQVVTLREDEHEKLIRSFGGKSESKNLLV  101

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPP-KKVRKDCLYFNTPAMIVPKHLE  362
            +++Y  K WLVG+GL+ ++Q KA +GT F+PFSQFPP KK RKDC Y  TPAM  P  LE
Sbjct  102  SRSYCQKIWLVGNGLTEEEQSKAERGTMFVPFSQFPPAKKRRKDCTYHLTPAMATPAALE  161

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            N+DSCENWLPRRVMSAWR+ GI+H +EGWN +ECG  + ++  +W+A+LRHGF P T+
Sbjct  162  NVDSCENWLPRRVMSAWRIGGIVHALEGWNEHECGYTISNVDTVWDAALRHGFVPLTI  219



>ref|XP_004308720.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Fragaria vesca 
subsp. vesca]
Length=614

 Score =   235 bits (600),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 134/175 (77%), Gaps = 1/175 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQV+L GNL+KVA ++A +LCQ+  QV    + EY +L   LN      +V 
Sbjct  437  LNSIPKGTTQVLLIGNLTKVAYALAFSLCQRDIQVVTSHQAEYLKLTKSLNATEG-KVVH  495

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             ++Y+ K WLVGDGLS  +Q+ APKGT F+PFSQFPPKK+R+DC Y  TPAM +PK LEN
Sbjct  496  DRSYAQKIWLVGDGLSKKEQLSAPKGTIFVPFSQFPPKKLRRDCFYHYTPAMKIPKSLEN  555

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPF  194
            + SCENWLPRRVMSAWR+AGI+H +EGWN +ECG  M +I K+W+A+LRHGF+P 
Sbjct  556  VYSCENWLPRRVMSAWRIAGIVHAMEGWNEHECGYTMSNIDKVWQATLRHGFQPL  610



>ref|XP_007015842.1| CER1 protein isoform 1 [Theobroma cacao]
 gb|EOY33461.1| CER1 protein isoform 1 [Theobroma cacao]
Length=618

 Score =   235 bits (599),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 131/179 (73%), Gaps = 1/179 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN IPK TTQV+LRG +SK AC +  ALCQ+G QV  L ED+YK+L  + + +  +NLV 
Sbjct  441  LNCIPKETTQVLLRGRISKDACLLVQALCQKGIQVVTLQEDDYKKL-LKYDNKLESNLVP  499

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +  Y  K WLVGDGL+  +Q KAPKGT FIPFS FPP ++RKDC Y  TPAM  PK +EN
Sbjct  500  SARYDVKVWLVGDGLTDKEQSKAPKGTLFIPFSIFPPNQIRKDCYYHTTPAMEAPKSVEN  559

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            + SCE+WLPRRVMSA RVAGI+H  EGW VNECG   F I K+WEASL HGFRP ++S 
Sbjct  560  MHSCEDWLPRRVMSASRVAGIIHASEGWEVNECGGTTFSIDKVWEASLEHGFRPLSIST  618



>ref|XP_004510150.1| PREDICTED: protein ECERIFERUM 1-like [Cicer arietinum]
Length=626

 Score =   235 bits (599),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 134/177 (76%), Gaps = 0/177 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IPKGTTQV+LRG L+KVA +IA  LCQQG QVA + ED+Y  LK  L   +  NLV 
Sbjct  442  LNTIPKGTTQVLLRGKLTKVAYAIAFTLCQQGIQVATMHEDDYVNLKKSLTNSSDENLVK  501

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K  +   WLVGDG + ++QMKAPKGT FIP+SQFPPKK RKDC Y  TP+M+ P  +EN
Sbjct  502  EKNCTQTVWLVGDGFTEEEQMKAPKGTLFIPYSQFPPKKHRKDCSYHYTPSMLTPTSIEN  561

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            + SCE+WLPRRVMSA R+AGILH +EGW+ +ECG  M ++ K+W ++L+HGF+P TV
Sbjct  562  VHSCEDWLPRRVMSACRIAGILHSLEGWSEHECGYKMNNVDKVWHSALQHGFQPLTV  618



>gb|KHN40120.1| Protein WAX2 [Glycine soja]
Length=627

 Score =   235 bits (599),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 135/178 (76%), Gaps = 0/178 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPK  +QV+L G  +KV+ +I  ALC++GT+V  + +DEY +L+ R+  E+  NLV 
Sbjct  441  LNSIPKEASQVLLCGKPNKVSYAIVSALCERGTKVTTMYKDEYDKLQLRIPNESKDNLVF  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
              +Y AK WL+GD  +  DQ KAPKG+ FIP SQFPPKK+RKDC Y  TPAMI P  L N
Sbjct  501  PGSYPAKIWLLGDQCNEVDQRKAPKGSLFIPISQFPPKKLRKDCFYHCTPAMIAPPCLVN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVS  185
            +DSCENWLPRRVMSAWRVAGILH +EGWNVNECGN MF + KI +ASL+HGFRP  ++
Sbjct  561  VDSCENWLPRRVMSAWRVAGILHALEGWNVNECGNVMFSVEKIRQASLQHGFRPLKIN  618



>ref|XP_009337264.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Pyrus x bretschneideri]
Length=616

 Score =   234 bits (598),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 135/184 (73%), Gaps = 8/184 (4%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQVVLRG L+KVA +IA AL Q+G QV      EY +L   L  E+  NLV+
Sbjct  440  LNSIPKGTTQVVLRGKLTKVAYAIAFALSQKGVQV------EYLKLTKSLGTES--NLVV  491

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K+Y+ K WLV DGL+  +QM APKGT F+PFSQFPPKK+RKDC Y  TPAM  P  LEN
Sbjct  492  AKSYAQKIWLVDDGLTEKEQMSAPKGTLFVPFSQFPPKKLRKDCFYHYTPAMKTPTSLEN  551

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            + +CENWLPRRVMSAWRVAGI+H +EGW  ++CG  M +I K+W+ASL HGF+P T+S  
Sbjct  552  VHACENWLPRRVMSAWRVAGIVHALEGWKEHDCGYTMSNIDKVWQASLVHGFQPLTISTI  611

Query  178  TEPN  167
               N
Sbjct  612  HTKN  615



>ref|XP_004510147.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Cicer arietinum]
Length=622

 Score =   234 bits (598),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 135/178 (76%), Gaps = 0/178 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPK   QV+L G L KV+ +I  ALC++GT+V  +  D+Y+ L+ RL+ E+  NLV 
Sbjct  441  LNSIPKEANQVLLCGRLDKVSYAIVNALCERGTKVTTMYTDDYENLQLRLSSESKKNLVS  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
                S+K WLVGD     +Q KAPKG+ FIPFSQFPPKK+RKDC Y +TPAMI P  L N
Sbjct  501  PGFNSSKIWLVGDQCDEVEQKKAPKGSLFIPFSQFPPKKLRKDCFYGSTPAMITPPDLVN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVS  185
            +DSCENWLPRRVMSAWR+AGILH +EGWN++ECG +MF I K+W+ASL+HGFRP  ++
Sbjct  561  VDSCENWLPRRVMSAWRIAGILHALEGWNIHECGESMFSIEKVWKASLQHGFRPLKIN  618



>gb|KDO85389.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=474

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 138/180 (77%), Gaps = 5/180 (3%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLS--KVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNL  545
            +NS+PK T  V+LRG ++  KVA ++A +LCQ G +VA + +D+Y++LK R+  EA  NL
Sbjct  291  VNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNL  350

Query  544  VLTKTYSA---KTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVP  374
            VL+ +Y+A   K WLVGD L+  +Q +APKGT FIP++Q PP+K+RKDC Y +TPAMI+P
Sbjct  351  VLSTSYAAHKTKIWLVGDDLTGKEQARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMIIP  410

Query  373  KHLENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPF  194
              L N+ SCENWL RRVMSAWR+AGI+H +EGW++NECG  M DI ++W ASLRHGFRP 
Sbjct  411  PSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTMCDIHQVWHASLRHGFRPL  470



>ref|XP_003626834.1| gl1-like protein [Medicago truncatula]
 gb|AET01310.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=622

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 133/178 (75%), Gaps = 0/178 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPK   QV L G L KV+ +I  ALC++GT+V  +  D+++ L+ RL+ ++  NLV 
Sbjct  441  LNSIPKEENQVFLCGRLDKVSYAIVNALCERGTKVTTMYRDDHENLQLRLSSKSQKNLVF  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
              + SAK WLVGD     +Q KAPKG+ F+PFSQFPPKK RKDC Y +TPAMI P +L N
Sbjct  501  PGSNSAKIWLVGDQCEEVEQKKAPKGSLFVPFSQFPPKKFRKDCFYLSTPAMITPPNLAN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVS  185
            + SCENWLPRRVMSAWR+AGILH +EGW+V+ECG  MF I KIW+ASL+HGFRP  +S
Sbjct  561  VHSCENWLPRRVMSAWRIAGILHALEGWDVHECGEVMFSIDKIWQASLQHGFRPLKIS  618



>ref|XP_003530144.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Glycine max]
Length=625

 Score =   233 bits (595),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 138/182 (76%), Gaps = 1/182 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIP GTTQV+LRG L+KVA +IA  LCQQG QVA + +D+Y +LK   +     N ++
Sbjct  441  LNSIPNGTTQVLLRGKLTKVAYTIAFTLCQQGVQVATMHKDDYVKLKNSFS-SFGKNFII  499

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K+Y+ KTWLVG+GL+ ++Q+KAPKGT FI +SQFPP K RKDC Y  TPAM+VP  ++N
Sbjct  500  EKSYTQKTWLVGEGLTEEEQLKAPKGTLFITYSQFPPIKYRKDCSYHFTPAMLVPSSIQN  559

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            + SCENWLPR+VMSAWR+AGI+H +EGW+ +EC   M +I K+W ++L+HGF+P +V   
Sbjct  560  VHSCENWLPRKVMSAWRIAGIVHCLEGWSEHECNYTMHNIDKVWRSTLQHGFQPLSVPIN  619

Query  178  TE  173
             E
Sbjct  620  KE  621



>ref|XP_007041184.1| Fatty acid hydroxylase superfamily [Theobroma cacao]
 gb|EOX97015.1| Fatty acid hydroxylase superfamily [Theobroma cacao]
Length=1331

 Score =   239 bits (611),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 138/178 (78%), Gaps = 1/178 (1%)
 Frame = -2

Query  718   LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
             +NSIPK TTQV+L G +SKV  +IALALCQ+G QVA + EDEY++L+   + +   NLVL
Sbjct  1154  VNSIPKETTQVLLTGRISKVGYAIALALCQKGVQVAAMNEDEYQKLQDS-DCQFGKNLVL  1212

Query  538   TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
              + Y  K WLVG+GL+  +Q+KA KGT  IPF+QFPPKK+ KDC Y  TPAM+ PK L+N
Sbjct  1213  AENYDQKIWLVGEGLTDKEQLKATKGTVLIPFTQFPPKKLLKDCYYHTTPAMVAPKSLDN  1272

Query  358   LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVS  185
             + SCENWL RRV+SAWRVAGI+HG+EGWNV+ECG  MF + K+WEA+L HGF P ++S
Sbjct  1273  IHSCENWLARRVISAWRVAGIVHGLEGWNVHECGQTMFSMDKVWEATLHHGFCPLSLS  1330


 Score =   236 bits (602),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 135/172 (78%), Gaps = 1/172 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIPK TTQV+L G +SKV  +IALALCQ+G QVA + EDEY++L+     +   NLVL
Sbjct  417  VNSIPKETTQVLLTGRISKVGYAIALALCQKGVQVAAMNEDEYQKLQHS-GCQFGKNLVL  475

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             + Y  K WLVG+GL+  +Q++A KG+ FIPF+QFPPKK+ KDC Y  TPA++ PK L+N
Sbjct  476  AENYDQKIWLVGEGLTDKEQLRATKGSVFIPFTQFPPKKLLKDCYYHTTPALVAPKSLDN  535

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGF  203
            + SCENWL RRVMSAWRVAGI+HG+EGWNV+ECG  MF + K+WEA+LRHG+
Sbjct  536  IHSCENWLARRVMSAWRVAGIVHGLEGWNVHECGQTMFSMDKVWEATLRHGY  587


 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = -2

Query  499  GLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLENLDSCENWLPRRVM  320
            GL+  +Q+KA +GT FIPFSQFPP+KVRKDC Y +TPAM+ PK L+N+ SCE   P  ++
Sbjct  593  GLTQKEQLKAAQGTIFIPFSQFPPRKVRKDCYYRSTPAMVAPKSLKNMHSCEMISPLFIL  652

Query  319  SAWRVAGILHG  287
              +  A  ++G
Sbjct  653  PIFLFASQING  663



>gb|KDO85388.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=529

 Score =   230 bits (587),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 138/180 (77%), Gaps = 5/180 (3%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLS--KVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNL  545
            +NS+PK T  V+LRG ++  KVA ++A +LCQ G +VA + +D+Y++LK R+  EA  NL
Sbjct  346  VNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNL  405

Query  544  VLTKTYSA---KTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVP  374
            VL+ +Y+A   K WLVGD L+  +Q +APKGT FIP++Q PP+K+RKDC Y +TPAMI+P
Sbjct  406  VLSTSYAAHKTKIWLVGDDLTGKEQARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMIIP  465

Query  373  KHLENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPF  194
              L N+ SCENWL RRVMSAWR+AGI+H +EGW++NECG  M DI ++W ASLRHGFRP 
Sbjct  466  PSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTMCDIHQVWHASLRHGFRPL  525



>ref|XP_010255638.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Nelumbo nucifera]
Length=713

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 137/175 (78%), Gaps = 1/175 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIP+GT QV+LRG  +K A +I+  LCQ+G QVA++ ++++ RLK RL  E  +NL L
Sbjct  535  LNSIPQGTKQVLLRGRTTKTAIAISRVLCQRGIQVAMIDKNQFDRLKLRLPTELWSNLFL  594

Query  538  TKTYSAKTWLVGDG-LSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            +  Y+ K WLVG+G L  ++Q + P+GT FIPFSQFPPK+VR DC+Y+ TPA+ +PK LE
Sbjct  595  STNYNYKVWLVGEGALKDEEQRQLPEGTHFIPFSQFPPKRVRSDCIYYTTPALRIPKALE  654

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
            N+ SCENWLPRRVMSAWRVAGI+H +EGW+ +ECG+ + D+ K+W ASLRHGF P
Sbjct  655  NVHSCENWLPRRVMSAWRVAGIVHALEGWDEHECGDTVLDVDKVWTASLRHGFLP  709



>ref|XP_006464363.1| PREDICTED: protein ECERIFERUM 1-like isoform X3 [Citrus sinensis]
Length=611

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 138/180 (77%), Gaps = 5/180 (3%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLS--KVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNL  545
            +NS+PK T  V+LRG ++  KVA ++A +LCQ G +VA + +D+Y++LK R+  EA  NL
Sbjct  428  VNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNL  487

Query  544  VLTKTYSA---KTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVP  374
            VL+ +Y+A   K WLVGD L+  +Q +APKGT FIP++Q PP+K+RKDC Y +TPAMI+P
Sbjct  488  VLSTSYAAHKTKIWLVGDDLTGKEQARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMIIP  547

Query  373  KHLENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPF  194
              L N+ SCENWL RRVMSAWR+AGI+H +EGW++NECG  M DI ++W ASLRHGFRP 
Sbjct  548  PSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTMCDIHQVWHASLRHGFRPL  607



>ref|XP_009788099.1| PREDICTED: protein CER1-like 1, partial [Nicotiana sylvestris]
Length=130

 Score =   216 bits (549),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 111/130 (85%), Gaps = 1/130 (1%)
 Frame = -2

Query  616  VAVLGEDEYKRLKARLNPEAATNLVLTKTYS-AKTWLVGDGLSADDQMKAPKGTFFIPFS  440
            V  L E+EYKRL  +L PEAATNLVL+K+Y+ +KTWLVGDGLS D+Q+K PKGT FIP+S
Sbjct  1    VVTLDEEEYKRLNTKLTPEAATNLVLSKSYNVSKTWLVGDGLSEDEQLKTPKGTLFIPYS  60

Query  439  QFPPKKVRKDCLYFNTPAMIVPKHLENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNEC  260
            QFPP K RKDC YF+TPAMI PKHLEN+DSCENWLPRRVMSAWR+AGILH +EGW  +EC
Sbjct  61   QFPPSKARKDCFYFSTPAMIPPKHLENIDSCENWLPRRVMSAWRIAGILHALEGWKEHEC  120

Query  259  GNAMFDIGKI  230
            GN MFDI K+
Sbjct  121  GNMMFDIDKV  130



>gb|KDO85387.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=639

 Score =   230 bits (586),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 138/180 (77%), Gaps = 5/180 (3%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLS--KVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNL  545
            +NS+PK T  V+LRG ++  KVA ++A +LCQ G +VA + +D+Y++LK R+  EA  NL
Sbjct  456  VNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNL  515

Query  544  VLTKTYSA---KTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVP  374
            VL+ +Y+A   K WLVGD L+  +Q +APKGT FIP++Q PP+K+RKDC Y +TPAMI+P
Sbjct  516  VLSTSYAAHKTKIWLVGDDLTGKEQARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMIIP  575

Query  373  KHLENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPF  194
              L N+ SCENWL RRVMSAWR+AGI+H +EGW++NECG  M DI ++W ASLRHGFRP 
Sbjct  576  PSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTMCDIHQVWHASLRHGFRPL  635



>ref|XP_011469549.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Fragaria vesca 
subsp. vesca]
Length=618

 Score =   229 bits (585),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 134/179 (75%), Gaps = 5/179 (3%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQV+L GNL+KVA ++A +LCQ+  QV    + EY +L   LN      +V 
Sbjct  437  LNSIPKGTTQVLLIGNLTKVAYALAFSLCQRDIQVVTSHQAEYLKLTKSLNATEG-KVVH  495

Query  538  TKTYSAK----TWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPK  371
             ++Y+ K     WLVGDGLS  +Q+ APKGT F+PFSQFPPKK+R+DC Y  TPAM +PK
Sbjct  496  DRSYAQKFAMQIWLVGDGLSKKEQLSAPKGTIFVPFSQFPPKKLRRDCFYHYTPAMKIPK  555

Query  370  HLENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPF  194
             LEN+ SCENWLPRRVMSAWR+AGI+H +EGWN +ECG  M +I K+W+A+LRHGF+P 
Sbjct  556  SLENVYSCENWLPRRVMSAWRIAGIVHAMEGWNEHECGYTMSNIDKVWQATLRHGFQPL  614



>ref|XP_006464361.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Citrus sinensis]
 gb|KDO85380.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=639

 Score =   229 bits (585),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 138/180 (77%), Gaps = 5/180 (3%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLS--KVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNL  545
            +NS+PK T  V+LRG ++  KVA ++A +LCQ G +VA + +D+Y++LK R+  EA  NL
Sbjct  456  VNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNL  515

Query  544  VLTKTYSA---KTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVP  374
            VL+ +Y+A   K WLVGD L+  +Q +APKGT FIP++Q PP+K+RKDC Y +TPAMI+P
Sbjct  516  VLSTSYAAHKTKIWLVGDDLTGKEQARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMIIP  575

Query  373  KHLENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPF  194
              L N+ SCENWL RRVMSAWR+AGI+H +EGW++NECG  M DI ++W ASLRHGFRP 
Sbjct  576  PSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTMCDIHQVWHASLRHGFRPL  635



>ref|XP_006354618.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Solanum tuberosum]
Length=589

 Score =   229 bits (583),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 127/180 (71%), Gaps = 33/180 (18%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIP+GT+QVVLRG+LSKVA SIALALCQ   Q                          
Sbjct  442  LNSIPEGTSQVVLRGSLSKVANSIALALCQGEIQ--------------------------  475

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
                   TWLVGDGLS D+Q+KAPKGT FIPFSQFP +KVRKDC YFNTPAMI PKHLEN
Sbjct  476  -------TWLVGDGLSDDEQLKAPKGTLFIPFSQFPLRKVRKDCFYFNTPAMIAPKHLEN  528

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            +DSCENWLPRRVMSAWRVAGI+H +EGWN ++CG  M D+ K+W+ASL HGF   T ++A
Sbjct  529  VDSCENWLPRRVMSAWRVAGIVHALEGWNEHDCGEMMIDVEKVWKASLSHGFCSLTKTSA  588



>ref|XP_006445499.1| hypothetical protein CICLE_v10019265mg [Citrus clementina]
 gb|ESR58739.1| hypothetical protein CICLE_v10019265mg [Citrus clementina]
Length=639

 Score =   229 bits (585),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 138/180 (77%), Gaps = 5/180 (3%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLS--KVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNL  545
            +NS+PK T  V+LRG ++  KVA ++A +LCQ G +VA + +D+Y++LK R+  EA  NL
Sbjct  456  VNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNL  515

Query  544  VLTKTYSA---KTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVP  374
            VL+ +Y+A   K WLVGD L+  +Q +APKGT FIP++Q PP+K+RKDC Y +TPAMI+P
Sbjct  516  VLSTSYAAHKTKIWLVGDDLTGKEQARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMIIP  575

Query  373  KHLENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPF  194
              L N+ SCENWL RRVMSAWR+AGI+H +EGW++NECG  M DI ++W ASLRHGFRP 
Sbjct  576  PSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTMCDIHQVWHASLRHGFRPL  635



>ref|XP_010097746.1| Protein WAX2 [Morus notabilis]
 gb|EXB70701.1| Protein WAX2 [Morus notabilis]
Length=618

 Score =   229 bits (584),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 140/181 (77%), Gaps = 5/181 (3%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPE-AATNLV  542
            LN+IPKGTTQV+L G L+KVA +IA ALC +G QVA   EDE+ +LK   N E + +NLV
Sbjct  433  LNNIPKGTTQVLLIGKLTKVAYAIAYALCHKGIQVASSSEDEFVKLKKSQNDEDSKSNLV  492

Query  541  LTKTYS-AKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHL  365
            ++K YS  + WLVGDGL+ ++Q KA KGT F+PFSQFPPKK+R+DC Y +TPAM+ PK L
Sbjct  493  ISKYYSRHQIWLVGDGLTEEEQSKASKGTIFVPFSQFPPKKLRRDCFYHHTPAMLTPKTL  552

Query  364  ENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDI---GKIWEASLRHGFRPF  194
            EN+ +CENWLPRR MSAWRVAGI+H + GW+ +ECG  + ++    K+WEASLRHGF+P 
Sbjct  553  ENIHACENWLPRRAMSAWRVAGIVHALAGWDEHECGFNITNVCNFEKVWEASLRHGFQPL  612

Query  193  T  191
            +
Sbjct  613  S  613



>ref|XP_010920316.1| PREDICTED: protein ECERIFERUM 1-like [Elaeis guineensis]
Length=618

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 129/176 (73%), Gaps = 0/176 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNS+P GT Q++L GN+SKVA +IA  LC +G QV +  + E+  LK ++    A+ L L
Sbjct  441  LNSVPAGTKQILLTGNVSKVARAIAFTLCNRGIQVMMTKKQEFHILKLQMPESTASYLTL  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            + TYS + W+VGDGL   +Q +AP GT FIPFSQFPPKK+ KDC Y  TPAM +P+ LEN
Sbjct  501  SNTYSPQVWIVGDGLDDTEQRRAPTGTRFIPFSQFPPKKLNKDCTYNTTPAMKIPETLEN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFT  191
            + SCENWLPRRVMSAWR+AGI+H +EGW+ +ECG  M DI KIW A+L HGF P T
Sbjct  561  MHSCENWLPRRVMSAWRIAGIVHALEGWSAHECGETMLDIEKIWSATLHHGFLPLT  616



>ref|XP_010691966.1| PREDICTED: protein ECERIFERUM 1-like [Beta vulgaris subsp. vulgaris]
Length=619

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 131/175 (75%), Gaps = 1/175 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIP GT+QV+ RG LSKVA SI   LC +G QVA + + EY++LK  L  E  +NL L
Sbjct  440  LNSIPVGTSQVLFRGRLSKVAYSIVCTLCHRGIQVATIRKVEYEKLKKALTVEDGSNLAL  499

Query  538  T-KTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            + K  + K W+VG+ L+  +Q  A KGT FIPF+QFPPKK RKDC Y NTP+M+ P    
Sbjct  500  SSKGCNQKVWIVGEDLNEQEQSMASKGTIFIPFTQFPPKKTRKDCFYLNTPSMVAPTCFG  559

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
            NL SCENWLPRRV+SAWRVAGILHG+EGW+VNE G+ +FD+ K+WEAS +HGFRP
Sbjct  560  NLHSCENWLPRRVISAWRVAGILHGLEGWDVNEWGDRLFDVDKVWEASFQHGFRP  614



>ref|XP_006464362.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Citrus sinensis]
 gb|KDO85381.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=638

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 137/179 (77%), Gaps = 4/179 (2%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLS--KVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNL  545
            +NS+PK T  V+LRG ++  KVA ++A +LCQ G +VA + +D+Y++LK R+  EA  NL
Sbjct  456  VNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNL  515

Query  544  VLTKTYSAK--TWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPK  371
            VL+ +Y+A    WLVGD L+  +Q +APKGT FIP++Q PP+K+RKDC Y +TPAMI+P 
Sbjct  516  VLSTSYAAHKTIWLVGDDLTGKEQARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMIIPP  575

Query  370  HLENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPF  194
             L N+ SCENWL RRVMSAWR+AGI+H +EGW++NECG  M DI ++W ASLRHGFRP 
Sbjct  576  SLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTMCDIHQVWHASLRHGFRPL  634



>gb|KJB09060.1| hypothetical protein B456_001G122000 [Gossypium raimondii]
Length=659

 Score =   228 bits (582),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 132/179 (74%), Gaps = 1/179 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPK TTQV+LRG +SK    +  ALCQ+G +V  + EDEYK+L  + + +  +NL L
Sbjct  482  LNSIPKETTQVLLRGRVSKDVYVLVQALCQKGIKVLTVQEDEYKKL-LKFDNKLQSNLFL  540

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            ++ Y  K WLVGDGL+  +Q KAPKGT FIPFS FPPKKVRKDC Y  TPAM+ P  +EN
Sbjct  541  SERYDTKVWLVGDGLTDKEQFKAPKGTIFIPFSIFPPKKVRKDCYYHTTPAMVAPASVEN  600

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            L SCE+WLPRR MSA RVAGI+H  EG++VNECG  +F + K+WEASL +GFRP  +S 
Sbjct  601  LHSCEDWLPRRAMSASRVAGIIHASEGFDVNECGGTIFSVDKVWEASLENGFRPLPIST  659



>ref|XP_007134355.1| hypothetical protein PHAVU_010G040600g [Phaseolus vulgaris]
 gb|ESW06349.1| hypothetical protein PHAVU_010G040600g [Phaseolus vulgaris]
Length=625

 Score =   227 bits (579),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 134/178 (75%), Gaps = 0/178 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPK  TQV+L G  +K++ +IA ALC++GT+V  + ++EY  L+ RL+ E+  NLV 
Sbjct  441  LNSIPKEATQVLLCGKPNKISYAIASALCERGTKVTTMSKEEYDNLELRLSNESKKNLVF  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
              +Y+AK WLVG+  +  +Q KAPK + FIP SQFPPKK+R+DC Y  TPAMI P  L N
Sbjct  501  PGSYTAKIWLVGEQCNEAEQKKAPKESLFIPISQFPPKKLRRDCYYHITPAMIAPPSLVN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVS  185
            +DSCENWLPRRVMSA RVAGI+H +EGWNV+ECGN  F   KIW+ASL HGFRPF ++
Sbjct  561  VDSCENWLPRRVMSASRVAGIVHALEGWNVHECGNFTFSAEKIWQASLHHGFRPFKIN  618



>ref|XP_003625020.1| Protein WAX2 [Medicago truncatula]
 gb|AES81238.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=615

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 131/174 (75%), Gaps = 3/174 (2%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IPKGT QV+LRG  +KVA +IA ALC++  QVAVL +DE   L+ R++ E+   LV+
Sbjct  438  LNNIPKGTNQVLLRGKFNKVAFAIANALCRKNVQVAVLYKDELMDLRQRVSKES---LVV  494

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +   + K WLVGD     +QM+APKG+ FIPFS FPPKK+RKDC Y  TPAMI P    N
Sbjct  495  SPINTPKIWLVGDEWDEYEQMEAPKGSLFIPFSHFPPKKMRKDCFYHYTPAMITPTTFMN  554

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
              SCENWLPRRVMSAWR+AGI+H +EGWNV+ECG+ +  I K+WEAS+RHGF+P
Sbjct  555  SHSCENWLPRRVMSAWRIAGIIHALEGWNVHECGDTILSIEKVWEASIRHGFQP  608



>ref|XP_004307280.1| PREDICTED: protein ECERIFERUM 1-like [Fragaria vesca subsp. vesca]
Length=623

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 136/180 (76%), Gaps = 1/180 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IPK TTQVVL GN +KVA +IA AL Q+G +VA + +DEY +L   L+   +T +VL
Sbjct  441  LNNIPKETTQVVLTGNFTKVAYAIAFALSQRGIEVATIYKDEYLKLTKSLSATKST-VVL  499

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K  ++K WLVGDGLS   Q++APKGT F+PF+QFP K++R+DC Y   PAM +PK +EN
Sbjct  500  AKGSASKIWLVGDGLSKQTQLQAPKGTIFVPFTQFPLKELRRDCFYHCPPAMKIPKSIEN  559

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            + SCENWLPRRVMSAWR+AGI+H  EGWN +ECG AM DI K+WEA+LR GF+P   +A 
Sbjct  560  VYSCENWLPRRVMSAWRIAGIVHASEGWNEHECGYAMSDIDKVWEATLRLGFQPLIPNAT  619



>gb|KHN40121.1| Protein WAX2 [Glycine soja]
Length=624

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 135/176 (77%), Gaps = 1/176 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IPKGTTQV+L G L+KVA ++A ALCQ+G +VA + + +Y+RLK  L   + +NL++
Sbjct  441  LNNIPKGTTQVLLMGKLTKVAYALAFALCQRGVKVATMHKHDYERLKKSLT-NSESNLII  499

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K Y+  TWLV D L+ ++Q+KAP G  FIP+SQFPP+K RKDC Y  TPAM++P  +EN
Sbjct  500  AKGYTQMTWLVEDQLTEEEQLKAPTGALFIPYSQFPPRKYRKDCFYHCTPAMLIPSCVEN  559

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFT  191
            + SCE+WLPRRVMSAWR+AGI+H +E W+ NEC   M +I K+W ++L+HGF+P T
Sbjct  560  VHSCEDWLPRRVMSAWRIAGIVHSLERWSTNECNYKMHNIDKVWRSTLQHGFQPLT  615



>ref|XP_010255640.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=627

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 138/177 (78%), Gaps = 1/177 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IPKGT QV+LRG   K+  +IAL LCQ+G QVAV  +D+ ++LK RL  E  +NL L
Sbjct  441  LNTIPKGTKQVLLRGKPYKIVSAIALYLCQKGVQVAVACKDDLEKLKLRLPKELWSNLSL  500

Query  538  TKTYSAKTWLVGDG-LSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            + +YS K WLV +G +++++Q KAPKGT FIPFS FPPKKVRKDC+Y+NTPAM +PK  E
Sbjct  501  SSSYSQKVWLVDEGVITSEEQRKAPKGTHFIPFSHFPPKKVRKDCIYYNTPAMAIPKAFE  560

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFT  191
            N+ SCENWLPRRVMSAWR+AGI+H +EGW  +ECG  M D+ K++ A+LRHGF P +
Sbjct  561  NVHSCENWLPRRVMSAWRIAGIVHALEGWKEHECGETMLDVHKVYVAALRHGFLPLS  617



>ref|XP_003625022.1| Protein WAX2 [Medicago truncatula]
 gb|ABD28316.1| Sterol desaturase [Medicago truncatula]
 gb|AES81240.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=617

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 127/174 (73%), Gaps = 1/174 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IPKGT QV+LRG  +KVA  IA ALC++  QV VL +DE K L+ R+N     NL L
Sbjct  438  LNNIPKGTNQVLLRGKFNKVAFVIANALCKKNVQVVVLYKDELKELEQRINTSKG-NLAL  496

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +   + K WLVGD     +QM+APKG+ FIPFS FPPKK+RKDC Y  TPAMI P    N
Sbjct  497  SPFNTPKIWLVGDEWDEYEQMEAPKGSLFIPFSHFPPKKMRKDCFYHYTPAMITPTTFMN  556

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
              SCENWLPRRVMSAWR+AGI+H +EGWNV+ECG+ +    K+WEAS+RHGF+P
Sbjct  557  SHSCENWLPRRVMSAWRIAGIIHALEGWNVHECGDTILSTEKVWEASIRHGFQP  610



>ref|XP_010276564.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=620

 Score =   224 bits (572),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 138/175 (79%), Gaps = 1/175 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPK T Q++LRGN+SK A +I+ ALC++G QVA++ + ++ +LK +L  E   NLVL
Sbjct  441  LNSIPKETKQLLLRGNVSKTAIAISKALCRRGVQVAMVDKVDFDKLKLQLPTELWRNLVL  500

Query  538  TKTYSAKTWLVGDGLSADDQMK-APKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            + +Y+ K WLV D +S +++ K AP+GT FIPFSQFP K++R DC+Y+ TPA+++PK LE
Sbjct  501  STSYNYKVWLVEDRVSREEEQKQAPEGTHFIPFSQFPLKRIRNDCVYYTTPALLIPKALE  560

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
            N+ SCENWLPRRVMSAWRVAGI+H +EGW  +ECG+ + D+ K+W A+LRHGF P
Sbjct  561  NVHSCENWLPRRVMSAWRVAGIVHALEGWEEHECGDTVLDVDKVWNATLRHGFLP  615



>ref|XP_006480707.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Citrus sinensis]
Length=592

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 135/178 (76%), Gaps = 2/178 (1%)
 Frame = -2

Query  715  NSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAAT-NLVL  539
            NSIP GTTQVV+RG L+KVA + A ALCQ+G QV  L EDE+++L      ++ + NL++
Sbjct  411  NSIPDGTTQVVIRGILTKVAYATAFALCQKGIQVVTLREDEHEKLIRSFGGKSESKNLLV  470

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPP-KKVRKDCLYFNTPAMIVPKHLE  362
            +++Y  K WLVG+GL+ ++Q KA +GT F+PFSQFPP KK RKDC Y  TPAM  P  LE
Sbjct  471  SRSYCQKIWLVGNGLTEEEQSKAERGTMFVPFSQFPPAKKRRKDCTYHLTPAMATPAALE  530

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            N+DSCENWLPRRVMSAWR+ GI+H +EGWN +ECG  + ++  +W+A+LRHGF P T+
Sbjct  531  NVDSCENWLPRRVMSAWRIGGIVHALEGWNEHECGYTISNVDTVWDAALRHGFLPLTI  588



>ref|XP_002526511.1| sterol desaturase, putative [Ricinus communis]
 gb|EEF35902.1| sterol desaturase, putative [Ricinus communis]
Length=617

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 132/177 (75%), Gaps = 5/177 (3%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIPKGT QV+L G  +KVA +IA ALC +GTQ+ VL E+ Y ++  +        +++
Sbjct  443  INSIPKGTMQVLLNGKFNKVAKAIASALCLRGTQIVVLDEEGYGKVGLQ-----NEKVMV  497

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +K+Y  K WLVGD +S  +Q++APKGT FIPF+QFP +++RKDC Y  TPAM+ P  L N
Sbjct  498  SKSYDQKIWLVGDEISEKEQLQAPKGTLFIPFTQFPIRRIRKDCFYQITPAMLSPDSLHN  557

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            LDSCENWLPRR MSAWR+AGI+H +E W VNECG ++F I ++WEASL HGFRP ++
Sbjct  558  LDSCENWLPRRAMSAWRIAGIIHALEEWKVNECGESIFSIHRVWEASLHHGFRPLSI  614



>gb|KEH23596.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=522

 Score =   222 bits (565),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 129/177 (73%), Gaps = 2/177 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IPKGT QV+LRG  +KVA +IA ALC++  QV VL +DE K L+ R+  +   NL L
Sbjct  343  LNNIPKGTNQVLLRGKFNKVAFAIANALCKKNVQVVVLYKDELKELEQRVVTKG--NLAL  400

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            ++    K WLVGD    D+Q+KAP+G+ FIPFS FPPKK+RK C Y  TPAMI P    N
Sbjct  401  SQVNIPKIWLVGDEWDEDEQLKAPEGSLFIPFSHFPPKKMRKCCFYHFTPAMITPATFMN  460

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
              SCENWLPRRVMSAWR+AGI+H +EGWNV+ECG+ +    K+WEAS+RHGF+P  +
Sbjct  461  SHSCENWLPRRVMSAWRIAGIIHALEGWNVHECGDTILSTEKVWEASIRHGFQPLKI  517



>ref|XP_003606194.1| Protein WAX2 [Medicago truncatula]
Length=576

 Score =   223 bits (568),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 128/177 (72%), Gaps = 1/177 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IP GT QV+LRG  +KVA +I  ALC +  QV VL  DE K L+ R+     + L L
Sbjct  399  LNNIPNGTNQVLLRGKFNKVALAITNALCSKNVQVTVLYRDELKELERRVTVSNGS-LAL  457

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            ++  ++K WLVGD    D+QM+A +G+ FIPFS FPPKK+RK C Y  TPAMI P  L N
Sbjct  458  SQINTSKIWLVGDDWDEDEQMQASEGSLFIPFSHFPPKKMRKGCFYHYTPAMITPTALIN  517

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            L SCENWLPRRVMSAWR+AGI+H +E WNV+ECG+ +FDI K+WEAS+RHGF P  +
Sbjct  518  LHSCENWLPRRVMSAWRIAGIIHALERWNVHECGDTVFDIEKVWEASIRHGFLPLKI  574



>ref|XP_006428971.1| hypothetical protein CICLE_v10011291mg [Citrus clementina]
 ref|XP_006480706.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Citrus sinensis]
 gb|ESR42211.1| hypothetical protein CICLE_v10011291mg [Citrus clementina]
Length=627

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 135/178 (76%), Gaps = 2/178 (1%)
 Frame = -2

Query  715  NSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAAT-NLVL  539
            NSIP GTTQVV+RG L+KVA + A ALCQ+G QV  L EDE+++L      ++ + NL++
Sbjct  446  NSIPDGTTQVVIRGILTKVAYATAFALCQKGIQVVTLREDEHEKLIRSFGGKSESKNLLV  505

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPP-KKVRKDCLYFNTPAMIVPKHLE  362
            +++Y  K WLVG+GL+ ++Q KA +GT F+PFSQFPP KK RKDC Y  TPAM  P  LE
Sbjct  506  SRSYCQKIWLVGNGLTEEEQSKAERGTMFVPFSQFPPAKKRRKDCTYHLTPAMATPAALE  565

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            N+DSCENWLPRRVMSAWR+ GI+H +EGWN +ECG  + ++  +W+A+LRHGF P T+
Sbjct  566  NVDSCENWLPRRVMSAWRIGGIVHALEGWNEHECGYTISNVDTVWDAALRHGFLPLTI  623



>ref|NP_001146661.1| uncharacterized protein LOC100280261 [Zea mays]
 gb|ACL54484.1| unknown [Zea mays]
 gb|AFW68612.1| CER1 [Zea mays]
Length=619

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 134/175 (77%), Gaps = 1/175 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NS+P+GT QVVL GN+SKVA ++A ALC++  +V +  + +Y  LK  +  +AA NL+ 
Sbjct  441  VNSVPQGTDQVVLAGNISKVARAVAAALCRKNIKVVMTNKQDYHFLKPNMAEDAAENLLF  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKD-CLYFNTPAMIVPKHLE  362
            +KT +AK WL+GDGL A +Q KA KGT FIP+SQFPP+  RKD C Y  TPAM+VPK L+
Sbjct  501  SKTTTAKVWLIGDGLDASEQFKAQKGTQFIPYSQFPPRMARKDTCTYSTTPAMVVPKTLQ  560

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
            N+ SCENWLPRRVMSAWR+AG++H +EGWN +ECG+ + D+ K+W  +L HGFRP
Sbjct  561  NVHSCENWLPRRVMSAWRIAGMVHALEGWNEHECGDIVLDMEKMWSGALLHGFRP  615



>gb|KHG12604.1| Protein WAX2 -like protein [Gossypium arboreum]
Length=619

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 132/179 (74%), Gaps = 1/179 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIP+ TTQV+LRG +S+    +  ALCQ+G +V  + ED+YK+L  + + +  +NL L
Sbjct  442  LNSIPEETTQVLLRGRVSEDVYVLVQALCQKGIKVLTVQEDKYKKL-LKFDNKLQSNLFL  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            ++ Y  K WLVGDGL+  +Q KAPKGT FIPFS FPPKKVRKDC Y  TPAM+ P  +EN
Sbjct  501  SERYDTKVWLVGDGLTDKEQFKAPKGTIFIPFSIFPPKKVRKDCYYHTTPAMVAPASVEN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            L SCE+WLPRR MSA RVAGI+H  EG++VNECG  +F + K+WEASL +GFRP  +S 
Sbjct  561  LHSCEDWLPRRAMSASRVAGIIHASEGFDVNECGGTIFSVDKVWEASLENGFRPLPIST  619



>gb|AES88391.2| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=615

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 128/177 (72%), Gaps = 1/177 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IP GT QV+LRG  +KVA +I  ALC +  QV VL  DE K L+ R+     + L L
Sbjct  438  LNNIPNGTNQVLLRGKFNKVALAITNALCSKNVQVTVLYRDELKELERRVTVSNGS-LAL  496

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            ++  ++K WLVGD    D+QM+A +G+ FIPFS FPPKK+RK C Y  TPAMI P  L N
Sbjct  497  SQINTSKIWLVGDDWDEDEQMQASEGSLFIPFSHFPPKKMRKGCFYHYTPAMITPTALIN  556

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            L SCENWLPRRVMSAWR+AGI+H +E WNV+ECG+ +FDI K+WEAS+RHGF P  +
Sbjct  557  LHSCENWLPRRVMSAWRIAGIIHALERWNVHECGDTVFDIEKVWEASIRHGFLPLKI  613



>ref|XP_004168237.1| PREDICTED: protein ECERIFERUM 1-like, partial [Cucumis sativus]
Length=598

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 132/177 (75%), Gaps = 1/177 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +N+IPK TT+V+LRGNLSKVA +IA ALCQ G QVA L E+E+K+LK+++   +  NLVL
Sbjct  420  INTIPKATTKVLLRGNLSKVAYAIADALCQLGFQVATLYENEHKKLKSKVTTNS-NNLVL  478

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K  + K W+VGDGL   +Q+ APKGT FIP+SQFPP+++RKDC Y  TP+M VP   +N
Sbjct  479  AKITTHKIWIVGDGLEEFEQLNAPKGTIFIPYSQFPPQRLRKDCYYHITPSMRVPSSFQN  538

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            +DSCENWLPRRVMSAWR+AGILH +EG   +ECG  M  +   W ASL +GF P  +
Sbjct  539  IDSCENWLPRRVMSAWRMAGILHALEGREGHECGETMLSLDDAWRASLENGFLPLEI  595



>ref|XP_003574037.1| PREDICTED: protein ECERIFERUM 1-like [Brachypodium distachyon]
Length=621

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 134/175 (77%), Gaps = 1/175 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIPKGT QV+L GN+SKVA ++A ALC++  +V +  + +Y  LK  +   +A+NLVL
Sbjct  443  VNSIPKGTNQVILAGNISKVALAVASALCKKNVKVILTNKQDYHSLKPNIPQNSASNLVL  502

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKD-CLYFNTPAMIVPKHLE  362
            + T SAK W++G+GL A +Q+KA KGT FIP+SQFPP+ VRKD C Y  TPAM VPK ++
Sbjct  503  SNTDSAKVWVIGEGLDAAEQLKAEKGTQFIPYSQFPPRMVRKDCCTYLTTPAMSVPKTMQ  562

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
            NL SCENWLPRRVMSAWR+AGI+H +EGW  +ECG+ + D+ K+W A++ HGF P
Sbjct  563  NLHSCENWLPRRVMSAWRIAGIVHALEGWKEDECGDTVLDMEKVWSAAVMHGFSP  617



>ref|XP_010936012.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Elaeis guineensis]
Length=624

 Score =   223 bits (567),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 133/174 (76%), Gaps = 0/174 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNS+PKGT  ++L G LSK+A  ++L+LC++G QV ++ +DEY+ LK +L PE    LV 
Sbjct  441  LNSVPKGTKSILLVGKLSKMAYFLSLSLCKRGVQVEMVQKDEYEILKLQLPPELHGRLVF  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            + +Y+++ WLVGDG++  +Q++A KG  FIPF+QFPPK VRKDC+Y  TPAM+VPK  EN
Sbjct  501  SDSYTSEVWLVGDGVTDQEQLRARKGIRFIPFTQFPPKLVRKDCIYHCTPAMVVPKAYEN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
            L +CENWLPRRVMSAWRVAGI+H +E WN +ECG+ +  + K W A+L HGF P
Sbjct  561  LHTCENWLPRRVMSAWRVAGIIHALEEWNAHECGDVVTGVEKAWHAALAHGFLP  614



>ref|XP_004145021.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis sativus]
 ref|XP_004153200.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis sativus]
 gb|KGN46281.1| hypothetical protein Csa_6G079750 [Cucumis sativus]
Length=618

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 133/179 (74%), Gaps = 1/179 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +N+IPK TT+V+LRGNLSKVA +IA ALCQ G QVA L E+E+K+LK+++   +  NLVL
Sbjct  440  INTIPKATTKVLLRGNLSKVAYAIADALCQLGFQVATLYENEHKKLKSKVTTNS-NNLVL  498

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K  + K W+VGDGL   +Q+ APKGT FIP+SQFPP+++RKDC Y  TP+M VP   +N
Sbjct  499  AKITTHKIWIVGDGLEEFEQLNAPKGTIFIPYSQFPPQRLRKDCYYHITPSMRVPSSFQN  558

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            +DSCENWLPRRVMSAWR+AGILH +EG   +ECG  M  +   W ASL +GF P  + +
Sbjct  559  IDSCENWLPRRVMSAWRMAGILHALEGREGHECGETMLSLDDAWRASLENGFLPLEIPS  617



>ref|XP_008460068.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis melo]
 gb|ADN34102.1| sterol desaturase [Cucumis melo subsp. melo]
Length=618

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 135/179 (75%), Gaps = 1/179 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +N+IPK TT+V+LRGNLSKVA ++A ALCQ G QVA L E+E+K+LK+++   +  NLVL
Sbjct  440  VNTIPKATTKVLLRGNLSKVAYAVADALCQLGFQVATLYENEHKKLKSKVTANS-NNLVL  498

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K  + K W+VGDGL   +Q+ APKGT FIP+SQFPPK++RKDC Y  TP+M VP   +N
Sbjct  499  AKITTHKIWIVGDGLEEFEQLNAPKGTIFIPYSQFPPKRLRKDCYYHVTPSMRVPSSFQN  558

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            +DSCENWLPRRVMSAWR+AGILH +EG   +ECG  M  + + W ASL++GF P  + +
Sbjct  559  IDSCENWLPRRVMSAWRMAGILHVLEGREGHECGETMLSLEEAWRASLQNGFLPLEIPS  617



>ref|XP_010936011.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Elaeis guineensis]
Length=638

 Score =   223 bits (567),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 133/174 (76%), Gaps = 0/174 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNS+PKGT  ++L G LSK+A  ++L+LC++G QV ++ +DEY+ LK +L PE    LV 
Sbjct  455  LNSVPKGTKSILLVGKLSKMAYFLSLSLCKRGVQVEMVQKDEYEILKLQLPPELHGRLVF  514

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            + +Y+++ WLVGDG++  +Q++A KG  FIPF+QFPPK VRKDC+Y  TPAM+VPK  EN
Sbjct  515  SDSYTSEVWLVGDGVTDQEQLRARKGIRFIPFTQFPPKLVRKDCIYHCTPAMVVPKAYEN  574

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
            L +CENWLPRRVMSAWRVAGI+H +E WN +ECG+ +  + K W A+L HGF P
Sbjct  575  LHTCENWLPRRVMSAWRVAGIIHALEEWNAHECGDVVTGVEKAWHAALAHGFLP  628



>gb|ACG35856.1| CER1 [Zea mays]
Length=619

 Score =   221 bits (564),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 133/175 (76%), Gaps = 1/175 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NS+P+GT QVVL GN+SKVA ++A ALC++  +V +  + +Y  LK  +  +AA NL+ 
Sbjct  441  VNSVPQGTDQVVLAGNISKVARAVAAALCRKNIKVVMTNKQDYHFLKPNMAEDAAENLLF  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKD-CLYFNTPAMIVPKHLE  362
            +KT +AK WL+GD L A +Q KA KGT FIP+SQFPP+  RKD C Y  TPAM+VPK L+
Sbjct  501  SKTTTAKVWLIGDRLDASEQFKAQKGTQFIPYSQFPPRMARKDTCTYSTTPAMVVPKTLQ  560

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
            N+ SCENWLPRRVMSAWR+AG++H +EGWN +ECG+ + D+ K+W  +L HGFRP
Sbjct  561  NVHSCENWLPRRVMSAWRIAGMVHALEGWNEHECGDIVLDMEKVWSGALLHGFRP  615



>ref|XP_003625024.1| Protein WAX2 [Medicago truncatula]
 gb|ABN07985.1| Sterol desaturase [Medicago truncatula]
 gb|AES81242.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=617

 Score =   221 bits (563),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 129/177 (73%), Gaps = 2/177 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IPKGT QV+LRG  +KVA +IA ALC++  QV VL +DE K L+ R+  +   NL L
Sbjct  438  LNNIPKGTNQVLLRGKFNKVAFAIANALCKKNVQVVVLYKDELKELEQRVVTKG--NLAL  495

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            ++    K WLVGD    D+Q+KAP+G+ FIPFS FPPKK+RK C Y  TPAMI P    N
Sbjct  496  SQVNIPKIWLVGDEWDEDEQLKAPEGSLFIPFSHFPPKKMRKCCFYHFTPAMITPATFMN  555

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
              SCENWLPRRVMSAWR+AGI+H +EGWNV+ECG+ +    K+WEAS+RHGF+P  +
Sbjct  556  SHSCENWLPRRVMSAWRIAGIIHALEGWNVHECGDTILSTEKVWEASIRHGFQPLKI  612



>ref|XP_006661851.1| PREDICTED: protein ECERIFERUM 1-like [Oryza brachyantha]
Length=635

 Score =   221 bits (564),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 131/175 (75%), Gaps = 1/175 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIP+GT QV+L GN+SKVA ++A ALC++  +V +  + +Y  LK  +    A NL+ 
Sbjct  457  VNSIPEGTDQVILAGNISKVARAVAQALCKKNVKVTMTNKQDYHLLKPEMPETVADNLLF  516

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKD-CLYFNTPAMIVPKHLE  362
             KT +AK WL+GDGL A +Q +A KGT FIP+SQFPPK VRKD C Y  TPAM VPK L+
Sbjct  517  LKTGTAKVWLIGDGLDASEQFRAKKGTMFIPYSQFPPKMVRKDSCSYSTTPAMTVPKTLQ  576

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
            N+ SCENWLPRRVMSAWR+AGILH +EGW+ NECG+ + D+ K+W A++ HGF P
Sbjct  577  NVHSCENWLPRRVMSAWRIAGILHALEGWDENECGDKVLDMEKVWSAAIMHGFCP  631



>emb|CDP09364.1| unnamed protein product [Coffea canephora]
Length=616

 Score =   221 bits (562),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 136/176 (77%), Gaps = 2/176 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IPKGTT+V+L GNL+KVA S+ALALC++G QV +  + E+++LK  +  ++   +VL
Sbjct  432  LNNIPKGTTEVLLVGNLTKVARSVALALCERGIQVNISSQYEFEKLKQSVASQSNL-VVL  490

Query  538  TKTYSA-KTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            +K+ +A KTWLVGDGL+   Q+ APKG  FIPFS FPPKKVR DC Y +TPAM+ P  L+
Sbjct  491  SKSVAAYKTWLVGDGLTEKQQLNAPKGALFIPFSTFPPKKVRSDCSYLHTPAMLAPASLQ  550

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPF  194
            NLDSCENWLPRR +SA R AGI+H +EGW  +ECG  M ++ ++W+A+L+HGFRP 
Sbjct  551  NLDSCENWLPRRALSAVRAAGIVHALEGWTEHECGENMLNVEEVWQAALKHGFRPL  606



>ref|XP_002464501.1| hypothetical protein SORBIDRAFT_01g019590 [Sorghum bicolor]
 gb|EER91499.1| hypothetical protein SORBIDRAFT_01g019590 [Sorghum bicolor]
Length=619

 Score =   221 bits (562),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 133/175 (76%), Gaps = 1/175 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIP+GT QVVL GN+SKVA ++A ALC++  +V +  + +Y  LK  +  +AA NL+ 
Sbjct  441  MNSIPQGTDQVVLAGNISKVARAVATALCRKNIKVVMTNKQDYHFLKPSMAEDAAENLLF  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKD-CLYFNTPAMIVPKHLE  362
            +KT +AK WL+G+GL A +Q KA KGT FIP+SQFPP+  RKD C Y  TPAM VPK L+
Sbjct  501  SKTATAKVWLIGEGLDASEQFKAHKGTQFIPYSQFPPRMARKDTCTYSITPAMAVPKTLQ  560

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
            N+ SCENWLPRRVMSAWR+AG++H +EGWN +ECG+ + D+ K+W  +L HGFRP
Sbjct  561  NVHSCENWLPRRVMSAWRIAGMVHALEGWNEHECGDIVLDMEKVWSGALLHGFRP  615



>ref|XP_010496479.1| PREDICTED: protein CER1-like 1 [Camelina sativa]
Length=367

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 132/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +N+IPK TT++V RGNL+KVA ++  ALCQ+G +V +L ++E+ +L   +      NLVL
Sbjct  184  VNNIPKETTEIVFRGNLTKVASAVVFALCQKGVKVVLLRKEEHIKL---IKSGVVKNLVL  240

Query  538  TKT---YSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKH  368
            +     YS   WLVGDG+  ++QMKA +GT F+PFS FPPKK+RKDC Y +TPAM VPK 
Sbjct  241  STNKSYYSPTVWLVGDGIEKEEQMKAKEGTLFVPFSHFPPKKLRKDCFYHSTPAMRVPKS  300

Query  367  LENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNA--MFDIGKIWEASLRHGFRPF  194
             +N+DSCENWL RRVMSAW++ GI+H +EGW  ++CGN    F +  IWEA+LRHGF+P 
Sbjct  301  AQNIDSCENWLGRRVMSAWKIGGIVHALEGWEEHDCGNTCNFFRLHTIWEAALRHGFQPL  360

Query  193  TV  188
             +
Sbjct  361  IL  362



>gb|KHN13741.1| Protein WAX2 [Glycine soja]
Length=399

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 126/163 (77%), Gaps = 1/163 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIP GTTQV+LRG L+KVA +IA  LCQQG QVA + +D+Y +LK   +     NL++
Sbjct  238  LNSIPNGTTQVLLRGKLTKVAYTIAFTLCQQGVQVATMHKDDYVKLKNSFS-SFGKNLII  296

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K+Y+ KTWLVG+GL+ ++Q+KAPKGT FI +SQFPP K RKDC Y  TPAM+VP  ++N
Sbjct  297  EKSYTQKTWLVGEGLTEEEQLKAPKGTLFITYSQFPPIKYRKDCSYHFTPAMLVPSSIQN  356

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKI  230
            + SCENWLPR+VMSAWR+AGI+H +EGW+ +EC   M +I K+
Sbjct  357  VHSCENWLPRKVMSAWRIAGIVHCLEGWSEHECNYTMHNIDKV  399



>ref|XP_010480305.1| PREDICTED: protein CER1-like 1 isoform X1 [Camelina sativa]
Length=629

 Score =   219 bits (558),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 134/182 (74%), Gaps = 8/182 (4%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIPKGTT+VV RGN++K+A +I  +L Q+G +V VL E+EY +L   +   A  NLVL
Sbjct  446  VNSIPKGTTEVVFRGNITKIASAIVFSLSQKGIKVVVLREEEYTKL---IKSGADENLVL  502

Query  538  TKT---YSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKH  368
              +   YS+  WLVGDGL  ++QMKA +GT FIPFSQFPP K+RKDC Y +TPAM+VPK 
Sbjct  503  FSSNNCYSSTVWLVGDGLGKEEQMKAKEGTLFIPFSQFPPDKLRKDCFYHSTPAMLVPKC  562

Query  367  LENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNA--MFDIGKIWEASLRHGFRPF  194
             +N+DSCENWL RRVMSAWR+ G++H +EGW  ++CGN    F +  IWEA+LRH F+P 
Sbjct  563  AQNIDSCENWLGRRVMSAWRIGGVVHALEGWEEHDCGNTCNFFRLHAIWEAALRHDFQPL  622

Query  193  TV  188
             +
Sbjct  623  QL  624



>ref|XP_008438252.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis melo]
Length=635

 Score =   219 bits (559),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 137/197 (70%), Gaps = 17/197 (9%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKAR-----------  572
            LN+IPK  TQV+L G ++K+AC+I  +L ++G Q+ VL E  YK+L  R           
Sbjct  439  LNNIPKFATQVLLIGKVTKLACAIYHSLSKRGIQIVVLNEQNYKKLINRKPSNNNNANII  498

Query  571  -----LNPEAATNLVLTKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDC  407
                  N E AT L+L+   S   WLVGDG+  ++Q+KAPKGT FIPFSQFPPK +RKDC
Sbjct  499  NNNNNNNFEEAT-LLLSTASSQNIWLVGDGIRDEEQLKAPKGTTFIPFSQFPPKILRKDC  557

Query  406  LYFNTPAMIVPKHLENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIW  227
             Y  TPA+ VP  L+NL SCENWLPRRVMSAWRVAGI+H +EGW  +ECG+A+FD+ ++W
Sbjct  558  FYHYTPALKVPSSLQNLHSCENWLPRRVMSAWRVAGIVHAMEGWTEHECGDAIFDVEQVW  617

Query  226  EASLRHGFRPFTVSAAT  176
             ASLRHGF+P  + A T
Sbjct  618  LASLRHGFQPLEMPATT  634



>ref|XP_004982905.1| PREDICTED: protein ECERIFERUM 1-like [Setaria italica]
Length=619

 Score =   219 bits (558),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 132/175 (75%), Gaps = 1/175 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIP GT QVVL GN+SKVA ++A ALC++  +V +  + +Y  LK  +  +AA N V 
Sbjct  441  VNSIPHGTDQVVLAGNISKVARAVAAALCKKNVKVVMTNKQDYHFLKPNMPVDAADNFVF  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKD-CLYFNTPAMIVPKHLE  362
            +KT +AK WL+G+GL A +Q KA KGT FIP+SQ PP+ VRKD C Y  TPAM VPK L+
Sbjct  501  SKTATAKVWLLGEGLDASEQFKAQKGTQFIPYSQLPPRMVRKDSCTYSTTPAMAVPKTLQ  560

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
            N+ SCENWLPRRVMSAWR+AG++H +EGWN +ECG+ + D+ K+W A++ HGFRP
Sbjct  561  NVHSCENWLPRRVMSAWRIAGMVHALEGWNDHECGDIVLDMEKVWSAAILHGFRP  615



>ref|XP_010480306.1| PREDICTED: protein CER1-like 1 isoform X2 [Camelina sativa]
Length=625

 Score =   219 bits (558),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 134/182 (74%), Gaps = 8/182 (4%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIPKGTT+VV RGN++K+A +I  +L Q+G +V VL E+EY +L   +   A  NLVL
Sbjct  442  VNSIPKGTTEVVFRGNITKIASAIVFSLSQKGIKVVVLREEEYTKL---IKSGADENLVL  498

Query  538  TKT---YSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKH  368
              +   YS+  WLVGDGL  ++QMKA +GT FIPFSQFPP K+RKDC Y +TPAM+VPK 
Sbjct  499  FSSNNCYSSTVWLVGDGLGKEEQMKAKEGTLFIPFSQFPPDKLRKDCFYHSTPAMLVPKC  558

Query  367  LENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNA--MFDIGKIWEASLRHGFRPF  194
             +N+DSCENWL RRVMSAWR+ G++H +EGW  ++CGN    F +  IWEA+LRH F+P 
Sbjct  559  AQNIDSCENWLGRRVMSAWRIGGVVHALEGWEEHDCGNTCNFFRLHAIWEAALRHDFQPL  618

Query  193  TV  188
             +
Sbjct  619  QL  620



>ref|XP_003574039.1| PREDICTED: protein ECERIFERUM 1-like [Brachypodium distachyon]
Length=619

 Score =   219 bits (558),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 132/174 (76%), Gaps = 1/174 (1%)
 Frame = -2

Query  715  NSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVLT  536
            NSIP+GT QVVL GN+SKVA ++A ALC+   +V +  + +Y  LK ++  +AA NL+L+
Sbjct  442  NSIPQGTDQVVLAGNISKVARAVATALCKNNIKVIMSNKQDYHFLKPKIPEDAADNLILS  501

Query  535  KTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKD-CLYFNTPAMIVPKHLEN  359
            KT  AK W++G+GL   +Q +APKGT FIP+S FPP+ VRKD C Y  TPAM VPK L+N
Sbjct  502  KTSIAKVWVIGEGLDTAEQFRAPKGTHFIPYSPFPPRAVRKDCCTYSTTPAMGVPKTLQN  561

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
            + SCENWLPRRVMSAWR+AGI+H +EGWN +ECG+ + D+ KIW A++ HGF P
Sbjct  562  VHSCENWLPRRVMSAWRIAGIIHALEGWNEHECGDTVLDMDKIWSAAILHGFCP  615



>ref|XP_010276559.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=624

 Score =   219 bits (558),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 139/182 (76%), Gaps = 4/182 (2%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGN-LSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLV  542
            LNSIP+GTTQV+LRG   SK+  +IA +LCQ+G QV V  +D+ ++LK RL  E  +NLV
Sbjct  441  LNSIPQGTTQVLLRGKPASKIVYAIASSLCQRGVQVVVTSKDDIEKLKLRLPKELWSNLV  500

Query  541  LTKTYSAKTWLVGDG-LSADDQMKAPKGTFFIPFSQFPPKKVRK-DCLYFNTPAMIVPKH  368
            ++ +Y+ K WLV D  ++ ++Q +APKGT FIPFSQF PKK+R  DC+Y++TPAM +PK 
Sbjct  501  VSSSYTQKVWLVDDAVMTREEQKRAPKGTHFIPFSQFSPKKLRSNDCVYYHTPAMAIPKA  560

Query  367  LENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECG-NAMFDIGKIWEASLRHGFRPFT  191
            LEN+ SCENWLPRRVMSA R+AGI+H +EGW  +ECG N + D+ KIW A+LRHGF P  
Sbjct  561  LENVHSCENWLPRRVMSARRIAGIIHALEGWEEHECGDNMLIDVQKIWVAALRHGFLPLP  620

Query  190  VS  185
            +S
Sbjct  621  LS  622



>gb|ABG66132.1| CER1 protein, putative, expressed [Oryza sativa Japonica Group]
Length=595

 Score =   218 bits (555),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 131/175 (75%), Gaps = 1/175 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIP+GT QV+L GN+SKVA ++A ALC++  +V +  + +Y  LK  +    A NL  
Sbjct  417  VNSIPQGTDQVILAGNVSKVARAVAQALCKKNIKVTMTNKQDYHLLKPEIPETVADNLSF  476

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKD-CLYFNTPAMIVPKHLE  362
            +KT +AK WL+GDGL + +Q +A KGT FIP+SQFPPK VRKD C Y  TPAM VPK L+
Sbjct  477  SKTGTAKVWLIGDGLDSAEQFRAQKGTLFIPYSQFPPKMVRKDSCSYSTTPAMAVPKTLQ  536

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
            N+ SCENWLPRRVMSAWR+AGILH +EGWN +ECG+ + D+ K+W A++ HGF P
Sbjct  537  NVHSCENWLPRRVMSAWRIAGILHALEGWNEHECGDKVLDMDKVWSAAIMHGFCP  591



>gb|EEC67150.1| hypothetical protein OsI_33995 [Oryza sativa Indica Group]
Length=621

 Score =   219 bits (557),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 131/175 (75%), Gaps = 1/175 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIP+GT QV+L GN+SKVA ++A ALC++  +V +  + +Y  LK  +    A NL  
Sbjct  443  VNSIPQGTDQVILAGNVSKVARAVAQALCKKNIKVTMTNKQDYHLLKPEIPETVADNLSF  502

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKD-CLYFNTPAMIVPKHLE  362
            +KT +AK WL+GDGL + +Q +A KGT FIP+SQFPPK VRKD C Y  TPAM VPK L+
Sbjct  503  SKTGTAKVWLIGDGLDSAEQFRAQKGTLFIPYSQFPPKMVRKDSCSYSTTPAMAVPKTLQ  562

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
            N+ SCENWLPRRVMSAWR+AGILH +EGWN +ECG+ + D+ K+W A++ HGF P
Sbjct  563  NVHSCENWLPRRVMSAWRIAGILHALEGWNEHECGDKVLDMDKVWSAAIMHGFCP  617



>ref|NP_001064826.1| Os10g0471100 [Oryza sativa Japonica Group]
 gb|AAG21908.1|AC026815_12 putative CER1 [Oryza sativa Japonica Group]
 gb|AAP54228.1| CER1 protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF26740.1| Os10g0471100 [Oryza sativa Japonica Group]
 gb|EEE51118.1| hypothetical protein OsJ_31858 [Oryza sativa Japonica Group]
Length=621

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 131/175 (75%), Gaps = 1/175 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIP+GT QV+L GN+SKVA ++A ALC++  +V +  + +Y  LK  +    A NL  
Sbjct  443  VNSIPQGTDQVILAGNVSKVARAVAQALCKKNIKVTMTNKQDYHLLKPEIPETVADNLSF  502

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKD-CLYFNTPAMIVPKHLE  362
            +KT +AK WL+GDGL + +Q +A KGT FIP+SQFPPK VRKD C Y  TPAM VPK L+
Sbjct  503  SKTGTAKVWLIGDGLDSAEQFRAQKGTLFIPYSQFPPKMVRKDSCSYSTTPAMAVPKTLQ  562

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
            N+ SCENWLPRRVMSAWR+AGILH +EGWN +ECG+ + D+ K+W A++ HGF P
Sbjct  563  NVHSCENWLPRRVMSAWRIAGILHALEGWNEHECGDKVLDMDKVWSAAIMHGFCP  617



>ref|XP_006306552.1| hypothetical protein CARUB_v10012639mg [Capsella rubella]
 gb|EOA39450.1| hypothetical protein CARUB_v10012639mg [Capsella rubella]
Length=626

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 135/183 (74%), Gaps = 9/183 (5%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIP+GT +VV RGNL+KVA ++  +L Q+G +V +L E+EY +L   +   A  NLVL
Sbjct  442  VNSIPEGTKEVVFRGNLTKVASAVVFSLSQKGVKVVMLHEEEYNKL---IKSGADKNLVL  498

Query  538  TKT----YSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPK  371
            + +    YS+  WLVGDGL  ++QMKA +GT FIPFSQFPP+K+RKDC Y +TPAM+VPK
Sbjct  499  STSNNNCYSSTVWLVGDGLGKEEQMKAKEGTLFIPFSQFPPEKLRKDCFYHSTPAMLVPK  558

Query  370  HLENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNA--MFDIGKIWEASLRHGFRP  197
              +N+DSCENWL RRVMSAWR+ GI+H +EGW  ++CGN    F +  IWEA+LRH F+P
Sbjct  559  SAQNIDSCENWLGRRVMSAWRIGGIVHALEGWEEHDCGNTCNFFRLHAIWEAALRHEFQP  618

Query  196  FTV  188
              +
Sbjct  619  LLL  621



>gb|AES88379.2| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=600

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 129/177 (73%), Gaps = 1/177 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IPKGT QV+LRG  +KVA +I  ALC +  QV VL  DE K L+ R+     + L L
Sbjct  417  LNNIPKGTNQVLLRGKFNKVALAIINALCSKNVQVTVLYRDELKELERRVAVSDGS-LAL  475

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +   + KTWLVG+    D+QM+A +G+ FIPFS FPPKK++K CLY  TPAMI P  L N
Sbjct  476  SPINTPKTWLVGEDWDEDEQMQASEGSLFIPFSHFPPKKMQKGCLYHYTPAMITPTTLVN  535

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            L SCENWLPRRVMSAWR+AGI+H +EGW+ +ECG+ +F+I K+WEAS+RHG+ P  +
Sbjct  536  LHSCENWLPRRVMSAWRIAGIIHALEGWDAHECGDTVFNIEKVWEASIRHGYLPLKI  592



>ref|XP_003606182.1| Protein WAX2 [Medicago truncatula]
Length=594

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 129/177 (73%), Gaps = 1/177 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IPKGT QV+LRG  +KVA +I  ALC +  QV VL  DE K L+ R+     + L L
Sbjct  411  LNNIPKGTNQVLLRGKFNKVALAIINALCSKNVQVTVLYRDELKELERRVAVSDGS-LAL  469

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +   + KTWLVG+    D+QM+A +G+ FIPFS FPPKK++K CLY  TPAMI P  L N
Sbjct  470  SPINTPKTWLVGEDWDEDEQMQASEGSLFIPFSHFPPKKMQKGCLYHYTPAMITPTTLVN  529

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            L SCENWLPRRVMSAWR+AGI+H +EGW+ +ECG+ +F+I K+WEAS+RHG+ P  +
Sbjct  530  LHSCENWLPRRVMSAWRIAGIIHALEGWDAHECGDTVFNIEKVWEASIRHGYLPLKI  586



>ref|XP_003521032.2| PREDICTED: protein ECERIFERUM 1-like [Glycine max]
Length=684

 Score =   218 bits (555),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 124/163 (76%), Gaps = 0/163 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPK  +QV+L G  +KV+ +I  ALC++GT+V  + +DEY +L+ R+  E+  NLV 
Sbjct  441  LNSIPKEASQVLLCGKPNKVSYAIVSALCERGTKVTTMYKDEYDKLQLRIPNESKDNLVF  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
              +Y AK WL+GD  +  DQ KAPKG+ FIP SQFPPKK+RKDC Y +TPAMI P  L N
Sbjct  501  PGSYPAKIWLLGDQCNEVDQRKAPKGSLFIPISQFPPKKLRKDCFYHSTPAMIAPPSLVN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKI  230
            +DSCENWLPRRVMSAWRVAGILH +EGWNVNECGN MF + KI
Sbjct  561  VDSCENWLPRRVMSAWRVAGILHALEGWNVNECGNVMFSVEKI  603



>ref|XP_010511349.1| PREDICTED: protein CER1-like 1 [Camelina sativa]
Length=629

 Score =   217 bits (552),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 133/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIPKGTT+VV RGNL+K+A +I  +L  +G +V VL E+EY +L   +   A  NLVL
Sbjct  446  VNSIPKGTTEVVFRGNLTKIASAIVFSLSHKGIKVVVLREEEYTKL---IKSGADENLVL  502

Query  538  TKT---YSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKH  368
              +   YS+  WLVGDGL  ++QMKA +GT FIPFSQFPP K+RKDC Y +TPA++VPK 
Sbjct  503  FSSNNCYSSTVWLVGDGLGKEEQMKAKEGTLFIPFSQFPPAKLRKDCFYHSTPALLVPKS  562

Query  367  LENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNA--MFDIGKIWEASLRHGFRPF  194
             +++DSCENWL RRVMSAWR+ GI+H +EGW  ++CGN    F +  IWEA+LRH F+P 
Sbjct  563  AQSIDSCENWLGRRVMSAWRIGGIVHALEGWEEHDCGNTCNFFRLHAIWEAALRHDFQPL  622

Query  193  TV  188
             +
Sbjct  623  QL  624



>dbj|BAF01865.1| CER1 protein [Arabidopsis thaliana]
Length=373

 Score =   211 bits (536),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 133/180 (74%), Gaps = 5/180 (3%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NS+PK TT VV+ GNL+KVA +IA ALCQ+G QV+ L  DEY+++++ +  E   +LV 
Sbjct  189  INSVPKATTSVVMTGNLTKVAYTIASALCQRGVQVSTLRLDEYEKIRSCVPQECRDHLVY  248

Query  538  TKT---YSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKH  368
              +    S K WLVG+G + ++Q KA KGT FIPFSQFP K++R+DC+Y  TPA+IVPK 
Sbjct  249  LTSEALSSNKVWLVGEGTTREEQEKATKGTLFIPFSQFPLKQLRRDCIYHTTPALIVPKS  308

Query  367  LENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMF--DIGKIWEASLRHGFRPF  194
            L N+ SCENWLPR+ MSA RVAGILH +EGW ++ECG ++   D+ ++WEA L HGF+P 
Sbjct  309  LVNVHSCENWLPRKAMSATRVAGILHALEGWEMHECGTSLLLSDLDQVWEACLSHGFQPL  368



>emb|CDY07774.1| BnaA03g17370D [Brassica napus]
Length=527

 Score =   214 bits (546),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 127/181 (70%), Gaps = 2/181 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            ++SIP  T +V+ RG ++K+  +I ++LCQ G +V VL E+E+  L   +      NLVL
Sbjct  343  VHSIPVDTREVLFRGRITKIGRAIVISLCQNGIKVMVLREEEHSMLNGFIGGHCKENLVL  402

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            T  YS   WLVGDGLS +DQ KA KGT FIPFSQFPP K+RKDC Y  TPAMI+P   +N
Sbjct  403  TTNYSPMIWLVGDGLSKEDQKKARKGTLFIPFSQFPPSKLRKDCFYHTTPAMIIPDAAQN  462

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECG--NAMFDIGKIWEASLRHGFRPFTVS  185
            +DSCENWL RRVMSAWRV GI+H +EGW  +ECG    M +  ++WEA+LRHGF+P  + 
Sbjct  463  IDSCENWLGRRVMSAWRVGGIVHALEGWEEHECGLEVPMANPPRVWEAALRHGFKPLVLP  522

Query  184  A  182
            +
Sbjct  523  S  523



>gb|EMT15822.1| Protein WAX2 [Aegilops tauschii]
Length=401

 Score =   211 bits (537),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 132/175 (75%), Gaps = 1/175 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +++IP+GT QV+L G +SKVA S+A ALC++  +V V  + EY  LK  +      NLVL
Sbjct  223  IHTIPQGTNQVILAGKISKVARSVAAALCKKNVKVIVTNKQEYHLLKPCIPENEDGNLVL  282

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKD-CLYFNTPAMIVPKHLE  362
            + T +A+ WL+G+GL   +Q++AP+GT FIPFSQFPPK  RKD C Y  TPAM VP+ ++
Sbjct  283  STTSTAEVWLIGEGLDDAEQLRAPRGTEFIPFSQFPPKMARKDCCTYAMTPAMGVPESMQ  342

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
            N+ SCENWLPRRVMSAWRVAGI+H +EGW+ +ECG+A+ ++ K+W A++ HGFRP
Sbjct  343  NVHSCENWLPRRVMSAWRVAGIVHALEGWSEDECGDAVLNLEKVWSAAIMHGFRP  397



>ref|XP_010414810.1| PREDICTED: protein CER1-like 1 isoform X1 [Camelina sativa]
Length=629

 Score =   216 bits (550),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 131/182 (72%), Gaps = 8/182 (4%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIP GTT+VV RGNL+K+A +I  +L Q+G +V VL E+EY +L   +   A  NLVL
Sbjct  446  VNSIPTGTTEVVFRGNLTKIASAIVFSLSQKGIKVVVLREEEYTKL---IKSGADENLVL  502

Query  538  TKT---YSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKH  368
              +   YS+  WLVGDGL  ++QMKA +GT FIPFSQFPP K+RKDC Y  TPAM+VPK 
Sbjct  503  FSSNNCYSSTVWLVGDGLGKEEQMKAKEGTLFIPFSQFPPDKLRKDCFYHPTPAMLVPKS  562

Query  367  LENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNA--MFDIGKIWEASLRHGFRPF  194
             +N+DSCENWL RRVMSAWR+ GI+H +EGW  ++CGN      +  IWEA+LRH F+P 
Sbjct  563  AQNIDSCENWLGRRVMSAWRIGGIVHALEGWEEHDCGNTCKFLRLHAIWEAALRHDFQPL  622

Query  193  TV  188
             +
Sbjct  623  QL  624



>ref|XP_010414811.1| PREDICTED: protein CER1-like 1 isoform X2 [Camelina sativa]
Length=625

 Score =   216 bits (550),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 131/182 (72%), Gaps = 8/182 (4%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIP GTT+VV RGNL+K+A +I  +L Q+G +V VL E+EY +L   +   A  NLVL
Sbjct  442  VNSIPTGTTEVVFRGNLTKIASAIVFSLSQKGIKVVVLREEEYTKL---IKSGADENLVL  498

Query  538  TKT---YSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKH  368
              +   YS+  WLVGDGL  ++QMKA +GT FIPFSQFPP K+RKDC Y  TPAM+VPK 
Sbjct  499  FSSNNCYSSTVWLVGDGLGKEEQMKAKEGTLFIPFSQFPPDKLRKDCFYHPTPAMLVPKS  558

Query  367  LENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNA--MFDIGKIWEASLRHGFRPF  194
             +N+DSCENWL RRVMSAWR+ GI+H +EGW  ++CGN      +  IWEA+LRH F+P 
Sbjct  559  AQNIDSCENWLGRRVMSAWRIGGIVHALEGWEEHDCGNTCKFLRLHAIWEAALRHDFQPL  618

Query  193  TV  188
             +
Sbjct  619  QL  620



>ref|XP_008796440.1| PREDICTED: uncharacterized protein LOC103711898 [Phoenix dactylifera]
Length=2179

 Score =   222 bits (566),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -2

Query  718   LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
             LNS+P+G   ++L GNLSK+A  ++L LC++G QV  + +D+Y+ LK +L PE   +LVL
Sbjct  1999  LNSVPQGINSILLVGNLSKMAYFLSLTLCKRGVQVETVQKDKYELLKLQLPPELHGHLVL  2058

Query  538   TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             + +Y+++ WLVGDG++  +Q++A KG  FIPF+QFPPK VRKDC+Y  TPAM+VP+  EN
Sbjct  2059  SDSYASEVWLVGDGVTDQEQLRASKGIRFIPFTQFPPKLVRKDCIYHCTPAMVVPRTYEN  2118

Query  358   LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPF  194
             L +CENWLPRRVMSAWRVAGI+H +E WN +ECG+ +  + K W A+L HGF PF
Sbjct  2119  LHTCENWLPRRVMSAWRVAGIVHALEEWNGHECGDTVTGVEKAWHAALAHGFLPF  2173


 Score =   219 bits (559),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNS+P+G   ++L GNLSK+A  ++L LC++G QV  + +D+Y+ LK +L PE   +LVL
Sbjct  441  LNSVPQGINSILLVGNLSKMAYFLSLTLCKRGVQVETVQKDKYELLKLQLPPELHGHLVL  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            + +Y+++ WLVGDG++  +Q++A KG  FIPF+QFPPK VRKDC+Y  TPAM+VP+  EN
Sbjct  501  SDSYASEVWLVGDGVTDQEQLRASKGIRFIPFTQFPPKLVRKDCIYHCTPAMVVPRTYEN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPF  194
            L +CENWLPR VMSAWRVAGI+H +E WN +ECG+ +  + K W A+L HGF PF
Sbjct  561  LHTCENWLPRSVMSAWRVAGIVHALEEWNGHECGDTVTGVEKAWHAALAHGFLPF  615



>ref|XP_004171948.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis sativus]
Length=464

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 132/194 (68%), Gaps = 13/194 (7%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAAT----  551
            LN+IPK  TQV+L G ++K+A +I  +L ++G Q+ VL E  YKRL  + +         
Sbjct  269  LNNIPKFATQVLLIGKVTKLAFAIYHSLSKRGIQIVVLNEQNYKRLNRKPSNYNYNTNIN  328

Query  550  ---------NLVLTKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYF  398
                      L+L+   S   WLVG+G+  ++Q+KAPKGT FIPFSQFPPK +RKDC Y 
Sbjct  329  NNNNNFEEPTLLLSTASSQNIWLVGEGVRDEEQLKAPKGTTFIPFSQFPPKVLRKDCFYH  388

Query  397  NTPAMIVPKHLENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEAS  218
             TPA+  P  L+NL SCENWLPRRVMSAWRVAGI+H +EGW  +ECG+AMFD+ ++W AS
Sbjct  389  YTPALKAPPSLQNLHSCENWLPRRVMSAWRVAGIVHAMEGWTEHECGDAMFDVEQVWLAS  448

Query  217  LRHGFRPFTVSAAT  176
            L+HGF+P  +  +T
Sbjct  449  LQHGFQPLEIMPST  462



>ref|XP_010539481.1| PREDICTED: protein CER1-like 2 [Tarenaya hassleriana]
Length=707

 Score =   216 bits (551),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 131/177 (74%), Gaps = 2/177 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +N IP+ T++VV RG L+KVA +   AL Q+G +V VL  +E++RL   +    + N+VL
Sbjct  528  VNGIPRETSEVVFRGKLTKVAYATVFALIQRGVKVMVLRAEEHRRLVEFVGVSCSENIVL  587

Query  538  TKTYSAKTWLVG-DGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
             +T S + WLVG DGLS +++  A +GT FIPFSQFPPKK RKDC Y  TP+M +P+  +
Sbjct  588  MRTNSPRIWLVGGDGLSREEETMAKEGTLFIPFSQFPPKKTRKDCHYHPTPSMYIPESAQ  647

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNA-MFDIGKIWEASLRHGFRPF  194
            N+DSCENWLPRRVMSAWRV GI+H +EGW  +ECG+A  FDI ++WEA+LRHGFRP 
Sbjct  648  NVDSCENWLPRRVMSAWRVGGIVHALEGWEEHECGHAFFFDIDRVWEAALRHGFRPL  704



>ref|XP_006410962.1| hypothetical protein EUTSA_v10016375mg [Eutrema salsugineum]
 gb|ESQ52415.1| hypothetical protein EUTSA_v10016375mg [Eutrema salsugineum]
Length=628

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 132/181 (73%), Gaps = 2/181 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            ++S+P GT +V+ RG ++KVA +I  +LCQ G +V VL E+E++ L   L  +   NLVL
Sbjct  438  VHSVPVGTREVLFRGQITKVARAIVSSLCQNGIKVLVLREEEHRMLAELLGGDCKENLVL  497

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            T+ YS   WLVGDGLS ++Q  A KGT F+PFSQFPP K+RKDC Y  TPAMI+P   +N
Sbjct  498  TRNYSPTIWLVGDGLSKEEQKMAGKGTRFLPFSQFPPTKLRKDCFYHTTPAMIIPDSAQN  557

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECG--NAMFDIGKIWEASLRHGFRPFTVS  185
            +DSCENWL RRVMSAWRV GI+H +EGW  +ECG  N++ +  K+WEA+LR+GF+P  + 
Sbjct  558  IDSCENWLGRRVMSAWRVGGIVHALEGWEEHECGLHNSILNPPKVWEAALRNGFKPLVLP  617

Query  184  A  182
            +
Sbjct  618  S  618



>ref|XP_009133199.1| PREDICTED: protein CER1-like 2 [Brassica rapa]
Length=622

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 127/181 (70%), Gaps = 2/181 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            ++SIP  T +V+ RG ++K+  +I ++LCQ G +V VL E+E+  L   +      NLVL
Sbjct  438  VHSIPVDTREVLFRGRITKIGRAIVISLCQNGIKVMVLREEEHSMLNGFIGGHCKENLVL  497

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            T  YS   WLVGDGLS +DQ KA KGT FIPFSQFPP K+RKDC Y  TPAMI+P   +N
Sbjct  498  TTNYSPMIWLVGDGLSKEDQKKARKGTLFIPFSQFPPSKLRKDCFYHTTPAMIIPDAAQN  557

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECG--NAMFDIGKIWEASLRHGFRPFTVS  185
            +DSCENWL RRVMSAWRV GI+H +EGW  +ECG    M +  ++WEA+LRHGF+P  + 
Sbjct  558  IDSCENWLGRRVMSAWRVGGIVHALEGWEEHECGLEVPMANPPRVWEAALRHGFKPLVLP  617

Query  184  A  182
            +
Sbjct  618  S  618



>ref|XP_007041187.1| Fatty acid hydroxylase superfamily isoform 3, partial [Theobroma 
cacao]
 gb|EOX97018.1| Fatty acid hydroxylase superfamily isoform 3, partial [Theobroma 
cacao]
Length=556

 Score =   213 bits (542),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 122/155 (79%), Gaps = 1/155 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIP+ TTQV+L G +SKV  +IALALCQ+G QVA + EDEY++L+   + +   NLVL
Sbjct  403  VNSIPQETTQVLLTGRISKVGYAIALALCQKGVQVAAMNEDEYQKLQHS-DCQFGKNLVL  461

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             + Y  K WLVG+GL+  +Q+KA KGT F+PF+QFPPKK+ KDC Y  TPAM+ PK L+N
Sbjct  462  AENYDQKIWLVGEGLTDKEQLKATKGTVFVPFTQFPPKKLLKDCYYHTTPAMVAPKSLDN  521

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGN  254
            + SCENWL RRVMSAWRVAGI+HG+EGWNV+ECG 
Sbjct  522  IHSCENWLARRVMSAWRVAGIVHGLEGWNVHECGQ  556



>ref|XP_010496698.1| PREDICTED: protein ECERIFERUM 1-like [Camelina sativa]
Length=386

 Score =   208 bits (530),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 131/180 (73%), Gaps = 5/180 (3%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NS+ K T  VV+ G+L+KVA +IA ALCQ+G QV+ L  DEY++L++ +  E    LV 
Sbjct  202  INSVSKATKNVVMTGHLTKVAYTIASALCQRGVQVSTLRLDEYEKLRSCIPQECRDYLVY  261

Query  538  TKT---YSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKH  368
              +    S K WLVG+G ++++Q KA KGT FIPFSQFP K++RKDC+Y  TPA+IVPK 
Sbjct  262  QTSEVLSSNKVWLVGEGTTSEEQEKATKGTLFIPFSQFPLKQLRKDCIYHTTPALIVPKS  321

Query  367  LENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMF--DIGKIWEASLRHGFRPF  194
            L N+ SCENWLPR+ MSA RVAGILH +EGW V+ECG ++   D+ ++WEA L HGF+P 
Sbjct  322  LANIHSCENWLPRKAMSATRVAGILHALEGWEVHECGTSLLPSDLDQVWEACLSHGFQPL  381



>ref|XP_010493027.1| PREDICTED: protein CER1-like 1 [Camelina sativa]
Length=629

 Score =   214 bits (544),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 131/180 (73%), Gaps = 8/180 (4%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIPKGTT+VV RGNL+KVA ++  +L ++  +V VL E+EY +L       A  NLVL
Sbjct  446  VNSIPKGTTEVVFRGNLTKVASAVVFSLSEKSVKVVVLCEEEYTKLS---ESGADKNLVL  502

Query  538  TKTY---SAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKH  368
            + +    S+  WLVGDGL  ++QMKA +GT FIPFSQFPP K+RKDC Y +TPAM+VPK 
Sbjct  503  STSNNCCSSTVWLVGDGLRKEEQMKAKEGTLFIPFSQFPPDKLRKDCFYHSTPAMLVPKS  562

Query  367  LENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNA--MFDIGKIWEASLRHGFRPF  194
             +N+DSCENWL RRVMSAWR+ GI+H +EGW  ++CGN    F +  IWEA+LRH F+P 
Sbjct  563  AQNIDSCENWLGRRVMSAWRIGGIVHALEGWEEHDCGNTCNFFRLRAIWEAALRHDFQPL  622



>ref|XP_006857470.1| hypothetical protein AMTR_s00067p00188650 [Amborella trichopoda]
 gb|ERN18937.1| hypothetical protein AMTR_s00067p00188650 [Amborella trichopoda]
Length=621

 Score =   214 bits (544),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 129/174 (74%), Gaps = 0/174 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN IP GT +V++RG L+K   + ALAL ++ T++ V+  +EY+ LK R+  +  + + L
Sbjct  441  LNGIPHGTQKVLIRGCLTKTLFTTALALLERRTKIVVIRTEEYENLKMRIPSKYQSGISL  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +  Y  K WLVG+ L A++Q +A +GT FIPF+QFPP+ VR+DC+Y  TPA+++P+ LE+
Sbjct  501  SNNYDTKVWLVGEDLRAEEQSRANRGTLFIPFTQFPPRAVREDCIYHTTPALVIPRTLED  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
            + SCENWLPRRVMSAWRVAGI+H +EGW+ +ECGN   D+ K+W  +L HGF+P
Sbjct  561  VHSCENWLPRRVMSAWRVAGIVHALEGWDSHECGNMTLDVEKVWSTTLSHGFKP  614



>ref|NP_850932.2| protein ECERIFERUM 1 [Arabidopsis thaliana]
 dbj|BAE98972.1| CER1 protein [Arabidopsis thaliana]
 gb|AEE27400.1| protein ECERIFERUM 1 [Arabidopsis thaliana]
Length=461

 Score =   210 bits (534),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 133/180 (74%), Gaps = 5/180 (3%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NS+PK TT VV+ GNL+KVA +IA ALCQ+G QV+ L  DEY+++++ +  E   +LV 
Sbjct  277  INSVPKATTSVVMTGNLTKVAYTIASALCQRGVQVSTLRLDEYEKIRSCVPQECRDHLVY  336

Query  538  TKT---YSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKH  368
              +    S K WLVG+G + ++Q KA KGT FIPFSQFP K++R+DC+Y  TPA+IVPK 
Sbjct  337  LTSEALSSNKVWLVGEGTTREEQEKATKGTLFIPFSQFPLKQLRRDCIYHTTPALIVPKS  396

Query  367  LENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMF--DIGKIWEASLRHGFRPF  194
            L N+ SCENWLPR+ MSA RVAGILH +EGW ++ECG ++   D+ ++WEA L HGF+P 
Sbjct  397  LVNVHSCENWLPRKAMSATRVAGILHALEGWEMHECGTSLLLSDLDQVWEACLSHGFQPL  456



>ref|XP_010512796.1| PREDICTED: protein ECERIFERUM 1-like, partial [Camelina sativa]
Length=326

 Score =   206 bits (524),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 131/180 (73%), Gaps = 5/180 (3%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NS+ K T  VV+ G+L+KVA +IA ALCQ+G +V+ L  DEY++L++ +  E    LV 
Sbjct  142  INSVSKATQNVVMTGHLTKVAYTIASALCQRGVKVSTLRLDEYEKLRSCIPQECRDYLVY  201

Query  538  TKT---YSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKH  368
              +    S K WLVG+G ++++Q KA KGT FIPFSQFP K++RKDC+Y  TPA+IVPK 
Sbjct  202  QTSEVLSSNKVWLVGEGTTSEEQEKATKGTLFIPFSQFPLKQLRKDCIYHTTPALIVPKS  261

Query  367  LENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMF--DIGKIWEASLRHGFRPF  194
            L N+ SCENWLPR+ MSA RVAGILH +EGW V+ECG ++   D+ ++WEA L HGF+P 
Sbjct  262  LANIHSCENWLPRKAMSATRVAGILHALEGWEVHECGTSLLPSDLDQVWEAFLSHGFQPL  321



>gb|KGN56666.1| hypothetical protein Csa_3G127770 [Cucumis sativus]
Length=608

 Score =   213 bits (542),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 128/174 (74%), Gaps = 1/174 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IPK  TQV+L G ++K+A ++  +L ++G Q+ VL E  YK+L    N    T LVL
Sbjct  430  LNNIPKFATQVLLTGKITKLAFALYRSLSKRGIQIGVLNEQLYKKLNKVSNNYEGT-LVL  488

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K +S   WLVG+GL+ ++Q+KAPKGT FIPFSQFPPK VRKDC Y  TPAM  P  LEN
Sbjct  489  AKGHSHHIWLVGEGLTDEEQLKAPKGTTFIPFSQFPPKIVRKDCFYHCTPAMKAPPSLEN  548

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
            + SCENWLPRRVMSAWR+AG++H +EGW  +ECG  M DI ++W+A+L HGF+P
Sbjct  549  MHSCENWLPRRVMSAWRIAGVVHAMEGWTEHECGYGMSDIDRVWKATLGHGFQP  602



>ref|XP_010255641.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=623

 Score =   213 bits (543),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 133/176 (76%), Gaps = 1/176 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGT QV++RG LSKV  +I+L LC++G QVAV  +D++++LK +L  E ++ L+L
Sbjct  443  LNSIPKGTQQVLIRGKLSKVVSAISLLLCRRGIQVAVASKDDFEKLKLQLPAELSSLLIL  502

Query  538  TKTYSAKTWLVGDGLSAD-DQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            + +Y  K WLV +    D +Q KA +GT+FIP SQ P KKVRKDC+Y+NTPAM +PK  E
Sbjct  503  SSSYKQKVWLVDNETMTDKEQQKAVEGTYFIPLSQLPLKKVRKDCVYYNTPAMAIPKAFE  562

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPF  194
            N+ SCENWLPRRVMSAWR+ GI+H +EG + +ECG+ + D+ K+W A+L HGF P 
Sbjct  563  NVHSCENWLPRRVMSAWRIGGIVHALEGLDAHECGDTILDVEKVWRAALHHGFLPL  618



>ref|XP_004493412.1| PREDICTED: protein ECERIFERUM 1-like [Cicer arietinum]
Length=620

 Score =   213 bits (542),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 125/177 (71%), Gaps = 1/177 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IPKGT QV+LRG  +KVA +IA AL  +  QV VL EDE K L+ R+     ++ +L
Sbjct  434  LNNIPKGTNQVLLRGKFNKVAFAIANALSTKNVQVGVLYEDELKELEQRVIVSKGSSTIL  493

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
                + K WLVGD    ++QMKA +GT FIPFSQFPPKK+RK C Y  TPAM+ P    N
Sbjct  494  PID-TPKIWLVGDEWDENEQMKAAEGTLFIPFSQFPPKKMRKRCFYHYTPAMVTPPTFTN  552

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
              SCENWLPRRVMSAWR+ GI+H +EGWNV+ECG+ +    K+WEA++RHGF+P  +
Sbjct  553  SHSCENWLPRRVMSAWRIGGIIHALEGWNVHECGSTILSTDKVWEATIRHGFQPLKI  609



>ref|XP_010496697.1| PREDICTED: protein CER1-like 1 [Camelina sativa]
Length=629

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 132/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +N+IPK TT++V RGNL+KVA ++  ALCQ+G +V +L ++E+ +L   +      NLVL
Sbjct  446  VNNIPKETTEIVFRGNLTKVASAVVFALCQKGVKVVLLRKEEHIKL---IQSGVVKNLVL  502

Query  538  TKT---YSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKH  368
            +     YS K WLVGDG+  ++QMKA +GT F+PFS FPPKK+RKDC Y +TPAM VPK 
Sbjct  503  STNKSYYSPKVWLVGDGIEKEEQMKAKEGTLFVPFSHFPPKKLRKDCFYHSTPAMRVPKS  562

Query  367  LENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNA--MFDIGKIWEASLRHGFRPF  194
             +N+DSCENWL RRVMSAW++ GI+H +EGW  ++CGN    F +  IWEA+LRH F+P 
Sbjct  563  AQNIDSCENWLGRRVMSAWKIGGIVHALEGWEEHDCGNTCNFFRLHTIWEAALRHDFQPL  622

Query  193  TV  188
             +
Sbjct  623  IL  624



>ref|XP_008438263.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Cucumis melo]
Length=620

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 128/180 (71%), Gaps = 1/180 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IPK  TQV+L G  +K+A ++  +L ++G Q+ VL E  YK+L    N    T LVL
Sbjct  438  LNNIPKFATQVLLTGKFTKLAFALYHSLSKRGIQIGVLNEQHYKKLNKASNNYEGT-LVL  496

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             + +S   WLVG+GL+ ++Q+KAPKGT FIPFSQFPPK +RKDC Y  TPAM  P  LEN
Sbjct  497  AEGHSHNIWLVGEGLTDEEQLKAPKGTTFIPFSQFPPKILRKDCFYHCTPAMKAPPSLEN  556

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            + SCENWLPRRVMSAWR+AG++H +EGW  +ECG  M DI ++W+A+L HGF+P     A
Sbjct  557  MHSCENWLPRRVMSAWRIAGVVHAMEGWTEHECGYGMSDIDRVWKATLGHGFQPLDTPIA  616



>gb|EPS65064.1| hypothetical protein M569_09713, partial [Genlisea aurea]
Length=618

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 130/173 (75%), Gaps = 3/173 (2%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIPKGTT+++ RG L K A +I  AL ++G Q+A + E+E  +L  R        +++
Sbjct  443  INSIPKGTTEIMFRGKLCKTAHAIIGALLEKGIQIAAMYENERLKLAGRFT---GREVIV  499

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K+++ K W+VG+GL+ ++Q+KAPKG  FIP+SQFPPK+ R+D +Y  TP+M+ P  L+N
Sbjct  500  PKSFTQKVWIVGEGLTKEEQLKAPKGAVFIPYSQFPPKQARRDAVYCLTPSMMAPPSLKN  559

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFR  200
            L SCENWLPRR MSAWRVAGILH +E WNV+E G+A+FD  KIWEA+L+HGFR
Sbjct  560  LHSCENWLPRRAMSAWRVAGILHAIEEWNVDEYGDAIFDHNKIWEAALKHGFR  612



>ref|XP_008361247.1| PREDICTED: protein ECERIFERUM 1-like [Malus domestica]
Length=561

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 119/153 (78%), Gaps = 2/153 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQVVLRG L+KVA +IA AL Q+G Q+A L + EY +L   L+ E+  NLV+
Sbjct  408  LNSIPKGTTQVVLRGKLTKVAYAIAYALSQKGVQIATLYQAEYLKLTKSLDTES--NLVV  465

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             K+Y+ K WLVGDGL+  +QM APKGT F+PFSQFPPKK+RKDC Y  TPAM  P  LEN
Sbjct  466  AKSYAQKIWLVGDGLTEKEQMSAPKGTLFVPFSQFPPKKLRKDCFYHYTPAMKTPTSLEN  525

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNEC  260
            + +CENWLPRRVMSAWRVAGI+H +EGW  ++ 
Sbjct  526  VHACENWLPRRVMSAWRVAGIVHALEGWKEHDL  558



>ref|XP_008438264.1| PREDICTED: protein ECERIFERUM 1-like isoform X3 [Cucumis melo]
Length=493

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 129/181 (71%), Gaps = 2/181 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IPK  TQV+L G  +K+A ++  +L ++G Q+ VL E  YK+L    N    T LVL
Sbjct  310  LNNIPKFATQVLLTGKFTKLAFALYHSLSKRGIQIGVLNEQHYKKLNKASNNYEGT-LVL  368

Query  538  TKTYSA-KTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
             + +S  + WLVG+GL+ ++Q+KAPKGT FIPFSQFPPK +RKDC Y  TPAM  P  LE
Sbjct  369  AEGHSHNQIWLVGEGLTDEEQLKAPKGTTFIPFSQFPPKILRKDCFYHCTPAMKAPPSLE  428

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            N+ SCENWLPRRVMSAWR+AG++H +EGW  +ECG  M DI ++W+A+L HGF+P     
Sbjct  429  NMHSCENWLPRRVMSAWRIAGVVHAMEGWTEHECGYGMSDIDRVWKATLGHGFQPLDTPI  488

Query  181  A  179
            A
Sbjct  489  A  489



>gb|KDO85382.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=627

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 130/177 (73%), Gaps = 11/177 (6%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLS--KVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNL  545
            +NS+PK T  V+LRG ++  KVA ++A +LCQ G +VA + +D+Y++LK R+  EA  NL
Sbjct  456  VNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNL  515

Query  544  VLTKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHL  365
            VL+ +Y+A            +Q +APKGT FIP++Q PP+K+RKDC Y +TPAMI+P  L
Sbjct  516  VLSTSYAAH---------KTEQARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMIIPPSL  566

Query  364  ENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPF  194
             N+ SCENWL RRVMSAWR+AGI+H +EGW++NECG  M DI ++W ASLRHGFRP 
Sbjct  567  SNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTMCDIHQVWHASLRHGFRPL  623



>ref|XP_006418509.1| hypothetical protein EUTSA_v10009534mg [Eutrema salsugineum]
 gb|ESQ36862.1| hypothetical protein EUTSA_v10009534mg [Eutrema salsugineum]
Length=615

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 133/179 (74%), Gaps = 5/179 (3%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NS+PK TT VV+ GNL+KVA +IA ALCQ+G QV+ L  DEY++L++ +  E   +LV 
Sbjct  431  INSVPKSTTSVVMTGNLTKVAYTIASALCQRGVQVSTLFPDEYEKLRSSVPRECRGHLVH  490

Query  538  TKT---YSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKH  368
              +    S+K WLVG+G + +DQ KA  GT FIPFSQFP K++RKDC+Y  TPA+IVPK 
Sbjct  491  LTSEAFSSSKVWLVGEGTTREDQEKATNGTLFIPFSQFPLKQLRKDCIYHTTPALIVPKS  550

Query  367  LENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMF--DIGKIWEASLRHGFRP  197
            L N+ SCENWLPR+ MSA RVAGILH VEGW ++ECG ++   D+ ++WEA L HGF+P
Sbjct  551  LVNIHSCENWLPRKAMSATRVAGILHAVEGWEMHECGASVLLSDLDQVWEACLSHGFQP  609



>ref|XP_006306971.1| hypothetical protein CARUB_v10008547mg [Capsella rubella]
 gb|EOA39869.1| hypothetical protein CARUB_v10008547mg [Capsella rubella]
Length=647

 Score =   211 bits (538),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 134/179 (75%), Gaps = 4/179 (2%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NS+PK TT VV+ GNL+KVA SIA ALCQ+G QV+ L  DEY++L++ +  E   +LV 
Sbjct  464  INSVPKTTTNVVMTGNLTKVAYSIASALCQRGVQVSTLRLDEYEKLRSCVPQECRDHLVY  523

Query  538  TKT---YSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKH  368
              T    S K WLVG+G + ++Q KA KGT FIPFSQFP K++R+DC+Y  TPA+IVPK 
Sbjct  524  LTTDSLSSKKVWLVGEGTTREEQEKATKGTLFIPFSQFPLKQLRRDCIYHTTPALIVPKS  583

Query  367  LENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMF-DIGKIWEASLRHGFRPF  194
            L N+ SCENWLPR+ MSA RVAGILH +EGW+++ECG ++  D+ ++W+A L HGF+P 
Sbjct  584  LVNIHSCENWLPRKAMSATRVAGILHALEGWDMHECGTSLLSDLDQVWDACLSHGFQPL  642



>gb|KGN56664.1| hypothetical protein Csa_3G127750 [Cucumis sativus]
Length=634

 Score =   211 bits (537),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 132/194 (68%), Gaps = 13/194 (7%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAAT----  551
            LN+IPK  TQV+L G ++K+A +I  +L ++G Q+ VL E  YKRL  + +         
Sbjct  439  LNNIPKFATQVLLIGKVTKLAFAIYHSLSKRGIQIVVLNEQNYKRLNRKPSNYNYNTNIN  498

Query  550  ---------NLVLTKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYF  398
                      L+L+   S   WLVG+G+  ++Q+KAPKGT FIPFSQFPPK +RKDC Y 
Sbjct  499  NNNNNFEEPTLLLSTASSQNIWLVGEGVRDEEQLKAPKGTTFIPFSQFPPKVLRKDCFYH  558

Query  397  NTPAMIVPKHLENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEAS  218
             TPA+  P  L+NL SCENWLPRRVMSAWRVAGI+H +EGW  +ECG+AMFD+ ++W AS
Sbjct  559  YTPALKAPPSLQNLHSCENWLPRRVMSAWRVAGIVHAMEGWTEHECGDAMFDVEQVWLAS  618

Query  217  LRHGFRPFTVSAAT  176
            L+HGF+P  +  +T
Sbjct  619  LQHGFQPLEIMPST  632



>ref|XP_004134362.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis sativus]
Length=634

 Score =   211 bits (537),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 132/194 (68%), Gaps = 13/194 (7%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAAT----  551
            LN+IPK  TQV+L G ++K+A +I  +L ++G Q+ VL E  YKRL  + +         
Sbjct  439  LNNIPKFATQVLLIGKVTKLAFAIYHSLSKRGIQIVVLNEQNYKRLNRKPSNYNYNTNIN  498

Query  550  ---------NLVLTKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYF  398
                      L+L+   S   WLVG+G+  ++Q+KAPKGT FIPFSQFPPK +RKDC Y 
Sbjct  499  NNNNNFEEPTLLLSTASSQNIWLVGEGVRDEEQLKAPKGTTFIPFSQFPPKVLRKDCFYH  558

Query  397  NTPAMIVPKHLENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEAS  218
             TPA+  P  L+NL SCENWLPRRVMSAWRVAGI+H +EGW  +ECG+AMFD+ ++W AS
Sbjct  559  YTPALKAPPSLQNLHSCENWLPRRVMSAWRVAGIVHAMEGWTEHECGDAMFDVEQVWLAS  618

Query  217  LRHGFRPFTVSAAT  176
            L+HGF+P  +  +T
Sbjct  619  LQHGFQPLEIMPST  632



>ref|XP_008369652.1| PREDICTED: protein ECERIFERUM 1-like [Malus domestica]
Length=483

 Score =   208 bits (529),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 120/157 (76%), Gaps = 1/157 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPK TTQVVLRGNL+KVA +IA AL Q+G QVA L +DEY +L   L+    ++LVL
Sbjct  322  LNSIPKRTTQVVLRGNLTKVAYAIAYALSQKGIQVATLHQDEYIKLTKSLS-ATESSLVL  380

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             ++++ K WLVGDGL+  +Q+ AP GT F+PFSQ PPKK+RKDC Y  TPAM +P  LEN
Sbjct  381  AESHAHKIWLVGDGLTEKEQLSAPSGTLFVPFSQLPPKKLRKDCFYHYTPAMKIPTSLEN  440

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAM  248
            + SCENWLPRRVMSAWR+AGI+  ++GW  ++C N M
Sbjct  441  VHSCENWLPRRVMSAWRIAGIVQALDGWKEHDCDNTM  477



>ref|XP_010247895.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=623

 Score =   211 bits (536),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 132/176 (75%), Gaps = 1/176 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGT QV++RG LSKV  +I+L LC++G QVAV  +D++++LK +L  E ++ L+L
Sbjct  443  LNSIPKGTQQVLIRGKLSKVVSAISLLLCRRGIQVAVASKDDFEKLKLQLPAELSSLLIL  502

Query  538  TKTYSAKTWLVGDGLSAD-DQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
            + +Y  K WLV +    D +Q KA +GT+FIP SQ P KKVRKDC+Y+NTPAM +PK   
Sbjct  503  SSSYKQKVWLVDNETMTDKEQQKAVEGTYFIPLSQLPLKKVRKDCVYYNTPAMAIPKAFV  562

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPF  194
            N+ SCENWLPRRVMSAWR+ GI+H +EG + +ECG+ + D+ K+W A+L HGF P 
Sbjct  563  NVHSCENWLPRRVMSAWRIGGIVHALEGLDAHECGDTILDVEKVWRAALHHGFLPL  618



>ref|XP_010479268.1| PREDICTED: protein CER1-like 1 [Camelina sativa]
 ref|XP_010496715.1| PREDICTED: protein CER1-like 1 [Camelina sativa]
Length=630

 Score =   211 bits (536),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 131/182 (72%), Gaps = 8/182 (4%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +N+IPK TT++V RGNL+KVA ++  ALCQ+G +V +L ++E+ +L   +      NLVL
Sbjct  447  VNNIPKETTEIVFRGNLTKVASAVVFALCQKGVKVVLLRKEEHIKL---IKSGVVKNLVL  503

Query  538  TKT---YSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKH  368
            +     YS   WLVGDG+  ++QMKA +GT F+PFS FPPKK+RKDC Y +TPAM VPK 
Sbjct  504  STNKSYYSPTVWLVGDGIEKEEQMKAKEGTLFVPFSHFPPKKLRKDCFYHSTPAMRVPKS  563

Query  367  LENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNA--MFDIGKIWEASLRHGFRPF  194
             +N+DSCENWL RRVMSAW++ GI+H +EGW  ++CGN    F +  IWEA+LRH F+P 
Sbjct  564  AQNIDSCENWLGRRVMSAWKIGGIVHALEGWEEHDCGNTCNFFRLHTIWEAALRHDFQPL  623

Query  193  TV  188
             +
Sbjct  624  IL  625



>gb|EAY87991.1| hypothetical protein OsI_09413 [Oryza sativa Indica Group]
Length=635

 Score =   210 bits (535),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 130/175 (74%), Gaps = 0/175 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN IP+GT  V+L GN +K++  + L+LC++  QV ++ ++ Y+ LK +L PE   +LVL
Sbjct  445  LNMIPQGTKDVLLLGNANKISLVLTLSLCKREIQVRMVNKELYECLKQQLQPEMQEHLVL  504

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +++YS+K WLVGDG++ ++QMKA KG+ F+P+SQFPP K R DC+Y  TPA++VP+  EN
Sbjct  505  SRSYSSKVWLVGDGVTDEEQMKAQKGSHFVPYSQFPPNKARNDCVYHCTPALLVPESFEN  564

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPF  194
            L  CENWLPRRVMSAWR AGI+H +E W+ +ECG  +  + K W A+L  GFRP+
Sbjct  565  LHVCENWLPRRVMSAWRAAGIVHALEKWDGHECGGRVTGVQKAWSAALARGFRPY  619



>ref|XP_006375521.1| hypothetical protein POPTR_0014s15050g [Populus trichocarpa]
 gb|ERP53318.1| hypothetical protein POPTR_0014s15050g [Populus trichocarpa]
Length=588

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 120/180 (67%), Gaps = 33/180 (18%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIPKGTTQV+ RGNLSKVA ++AL LCQ+G Q                          
Sbjct  439  MNSIPKGTTQVLHRGNLSKVAYAVALNLCQRGIQ--------------------------  472

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
                   TWLVGDGL  +DQ KA +GT FIPFSQFPPKK+RKDC Y + P M  P  LEN
Sbjct  473  -------TWLVGDGLKEEDQKKAAEGTLFIPFSQFPPKKLRKDCFYHSIPVMAAPASLEN  525

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSAA  179
            +DSCENWLPRRVMSAWRVAGI+H +EGW+ +ECG+ M DI K+W+AS++HGF+P     A
Sbjct  526  VDSCENWLPRRVMSAWRVAGIVHALEGWDEHECGSTMADIDKVWQASIQHGFKPLLSYVA  585



>ref|XP_009410811.1| PREDICTED: protein ECERIFERUM 1-like [Musa acuminata subsp. malaccensis]
Length=620

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 128/176 (73%), Gaps = 1/176 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLR-GNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLV  542
            L+SIPKGT  V+L  GN+SK+A S+ LALCQ   QV ++  D++  LK RL  +    LV
Sbjct  441  LHSIPKGTQSVLLLVGNVSKMALSLCLALCQIDIQVEMVQRDKFNLLKQRLPTQLQKYLV  500

Query  541  LTKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
             +  Y +KTWL+G+G+S  +Q  A +G  FIP+SQFPP+ VR+DC+Y  TPAM+VPK  +
Sbjct  501  FSGKYRSKTWLLGNGVSDQEQRNASEGIHFIPYSQFPPRVVREDCIYHCTPAMLVPKAYQ  560

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPF  194
            NL +CENWLPRRVMSAWRVAGI+H +E WN NECG  + +I  +W A+LRHGF P+
Sbjct  561  NLHACENWLPRRVMSAWRVAGIVHALEQWNKNECGETVSNIETMWRAALRHGFLPY  616



>ref|XP_006375524.1| hypothetical protein POPTR_0014s15080g [Populus trichocarpa]
 gb|ERP53321.1| hypothetical protein POPTR_0014s15080g [Populus trichocarpa]
Length=584

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 119/175 (68%), Gaps = 33/175 (19%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQV+ RGNLSKVA ++AL LCQ+G Q                          
Sbjct  439  LNSIPKGTTQVLHRGNLSKVAYAVALNLCQRGIQ--------------------------  472

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
                   TWLVGDGL  +DQ +A +GT FIPFSQFPPKK+RKDC Y + P M  P  LEN
Sbjct  473  -------TWLVGDGLKEEDQKQAAEGTLFIPFSQFPPKKLRKDCFYHSIPVMAAPASLEN  525

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPF  194
            +DSCENWLPRRVMSAWRVAGI+H +EGW+ +ECG+ M DI K+W+AS++HGF+P 
Sbjct  526  VDSCENWLPRRVMSAWRVAGIVHALEGWDEHECGSTMADIDKVWQASIQHGFKPL  580



>ref|NP_171721.3| protein CER1-like 1 [Arabidopsis thaliana]
 sp|F4HVX7.1|CERL1_ARATH RecName: Full=Protein CER1-like 1 [Arabidopsis thaliana]
 gb|AEE27399.1| protein CER1-like 1 [Arabidopsis thaliana]
Length=627

 Score =   209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 130/180 (72%), Gaps = 8/180 (4%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +N+IPK  T++V RGNL+KVA ++  ALCQ+G +V VL E+E+ +L   +      NLVL
Sbjct  446  INNIPKEATEIVFRGNLTKVASAVVFALCQKGVKVVVLREEEHSKL---IKSGVDKNLVL  502

Query  538  TKT---YSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKH  368
            + +   YS K WLVGDG+  ++QMKA +GT F+PFS FPP K+RKDC Y +TPAM VPK 
Sbjct  503  STSNSYYSPKVWLVGDGIENEEQMKAKEGTLFVPFSHFPPNKLRKDCFYQSTPAMRVPKS  562

Query  367  LENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNA--MFDIGKIWEASLRHGFRPF  194
             +N+DSCENWL RRVMSAW++ GI+H +EGW  ++CGN   +  +  IWEA+LRH F+P 
Sbjct  563  AQNIDSCENWLGRRVMSAWKIGGIVHALEGWEEHDCGNTCNVLRLHAIWEAALRHDFQPL  622



>gb|AAC24373.1| CER1-like protein [Arabidopsis thaliana]
Length=604

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 130/180 (72%), Gaps = 8/180 (4%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +N+IPK  T++V RGNL+KVA ++  ALCQ+G +V VL E+E+ +L   +      NLVL
Sbjct  423  INNIPKEATEIVFRGNLTKVASAVVFALCQKGVKVVVLREEEHSKL---IKSGVDKNLVL  479

Query  538  TKT---YSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKH  368
            + +   YS K WLVGDG+  ++QMKA +GT F+PFS FPP K+RKDC Y +TPAM VPK 
Sbjct  480  STSNSYYSPKVWLVGDGIENEEQMKAKEGTLFVPFSHFPPNKLRKDCFYQSTPAMRVPKS  539

Query  367  LENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNA--MFDIGKIWEASLRHGFRPF  194
             +N+DSCENWL RRVMSAW++ GI+H +EGW  ++CGN   +  +  IWEA+LRH F+P 
Sbjct  540  AQNIDSCENWLGRRVMSAWKIGGIVHALEGWEEHDCGNTCNVLRLHAIWEAALRHDFQPL  599



>ref|NP_973742.1| protein CER1-like 1 [Arabidopsis thaliana]
 gb|AEE27398.1| protein CER1-like 1 [Arabidopsis thaliana]
Length=623

 Score =   209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 130/180 (72%), Gaps = 8/180 (4%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +N+IPK  T++V RGNL+KVA ++  ALCQ+G +V VL E+E+ +L   +      NLVL
Sbjct  442  INNIPKEATEIVFRGNLTKVASAVVFALCQKGVKVVVLREEEHSKL---IKSGVDKNLVL  498

Query  538  TKT---YSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKH  368
            + +   YS K WLVGDG+  ++QMKA +GT F+PFS FPP K+RKDC Y +TPAM VPK 
Sbjct  499  STSNSYYSPKVWLVGDGIENEEQMKAKEGTLFVPFSHFPPNKLRKDCFYQSTPAMRVPKS  558

Query  367  LENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNA--MFDIGKIWEASLRHGFRPF  194
             +N+DSCENWL RRVMSAW++ GI+H +EGW  ++CGN   +  +  IWEA+LRH F+P 
Sbjct  559  AQNIDSCENWLGRRVMSAWKIGGIVHALEGWEEHDCGNTCNVLRLHAIWEAALRHDFQPL  618



>ref|XP_008438262.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Cucumis melo]
Length=621

 Score =   209 bits (531),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 129/181 (71%), Gaps = 2/181 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN+IPK  TQV+L G  +K+A ++  +L ++G Q+ VL E  YK+L    N    T LVL
Sbjct  438  LNNIPKFATQVLLTGKFTKLAFALYHSLSKRGIQIGVLNEQHYKKLNKASNNYEGT-LVL  496

Query  538  TKTYSA-KTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLE  362
             + +S  + WLVG+GL+ ++Q+KAPKGT FIPFSQFPPK +RKDC Y  TPAM  P  LE
Sbjct  497  AEGHSHNQIWLVGEGLTDEEQLKAPKGTTFIPFSQFPPKILRKDCFYHCTPAMKAPPSLE  556

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTVSA  182
            N+ SCENWLPRRVMSAWR+AG++H +EGW  +ECG  M DI ++W+A+L HGF+P     
Sbjct  557  NMHSCENWLPRRVMSAWRIAGVVHAMEGWTEHECGYGMSDIDRVWKATLGHGFQPLDTPI  616

Query  181  A  179
            A
Sbjct  617  A  617



>ref|XP_010509285.1| PREDICTED: protein CER1-like 2 [Camelina sativa]
Length=630

 Score =   209 bits (531),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 128/181 (71%), Gaps = 2/181 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            L+SIP GT +V+ RG ++KVA +I  +LCQ   +V VL ++E+  L   L      NLVL
Sbjct  438  LHSIPIGTKEVLFRGQVTKVARAIVFSLCQNAIKVMVLRKEEHSMLAEFLADSCKENLVL  497

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            T  Y+   WLVGDG+S  +Q  A +GT F+PFSQFPP K+RKDC+Y  TPAMI+P   +N
Sbjct  498  TTNYNPMIWLVGDGVSTKEQKMAKEGTLFLPFSQFPPDKLRKDCVYHTTPAMIIPHSAQN  557

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECG--NAMFDIGKIWEASLRHGFRPFTVS  185
            +DSCENWL RRVMSAWRV GI+H +EGW  +ECG  N++ +  ++WEA+LR+GF+P   S
Sbjct  558  IDSCENWLGRRVMSAWRVGGIVHSLEGWEEHECGLDNSILNSPRVWEAALRNGFQPLRTS  617

Query  184  A  182
            +
Sbjct  618  S  618



>gb|EMS58604.1| Protein WAX2 [Triticum urartu]
Length=619

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 130/175 (74%), Gaps = 1/175 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +++IP+GT QV+L G +SKVA S+A ALC++  +V +  + EY  LK  +    A NL+L
Sbjct  441  IDTIPRGTNQVILAGKISKVARSVAAALCKKNVKVIMTNKQEYHLLKPCIPENEAGNLLL  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKD-CLYFNTPAMIVPKHLE  362
            + T + + WL+G+GL A +Q +AP+GT FIPFSQFPPK  RKD C Y  TPAM VP+ ++
Sbjct  501  STTSTTEVWLIGEGLDAAEQFRAPQGTKFIPFSQFPPKMARKDCCTYAMTPAMGVPESMQ  560

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
            N+ SCENWLPR VMSAWRVAGI+H +EGW+ +ECG+ + D+ K+W A++ HGFRP
Sbjct  561  NVHSCENWLPRMVMSAWRVAGIVHALEGWSEDECGDTVLDLEKVWSAAIMHGFRP  615



>emb|CAA65200.1| CER1-like [Arabidopsis thaliana]
Length=623

 Score =   209 bits (531),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 130/180 (72%), Gaps = 8/180 (4%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +N+IPK  T++V RGNL+KVA ++  ALCQ+G +V VL E+E+ +L   +      NLVL
Sbjct  442  INNIPKEATEIVFRGNLTKVASAVVFALCQKGVKVVVLREEEHSKL---IKSGVDKNLVL  498

Query  538  TKT---YSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKH  368
            + +   YS K WLVGDG+  ++QMKA +GT F+PFS FPP K+RKDC Y +TPAM VPK 
Sbjct  499  STSNSYYSPKVWLVGDGIENEEQMKAKEGTLFVPFSHFPPNKLRKDCFYQSTPAMRVPKS  558

Query  367  LENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNA--MFDIGKIWEASLRHGFRPF  194
             +N+DSCENWL RRVMSAW++ GI+H +EGW  ++CGN   +  +  IWEA+LRH F+P 
Sbjct  559  AQNIDSCENWLGRRVMSAWKIGGIVHALEGWEEHDCGNTCNVLRLHAIWEAALRHDFQPL  618



>gb|AAB87721.1| maize gl1 homolog [Arabidopsis thaliana]
Length=625

 Score =   208 bits (530),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 131/180 (73%), Gaps = 5/180 (3%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NS+PK TT VV+ GNL+KVA +IA ALCQ+G QV+ L  DEY+++++ +  E   +LV 
Sbjct  441  INSVPKATTSVVMTGNLTKVAYTIASALCQRGVQVSTLRLDEYEKIRSCVPQECRDHLVY  500

Query  538  TKT---YSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKH  368
              +    S K WLVG+G + ++Q KA KGT FIPFSQFP K++R DC+Y  TPA+IVPK 
Sbjct  501  LTSEALSSNKVWLVGEGTTREEQEKATKGTLFIPFSQFPLKQLRSDCIYHTTPALIVPKS  560

Query  367  LENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMF--DIGKIWEASLRHGFRPF  194
            L N+ SCENWLPR+ MSA RVAGILH +EGW  +ECG ++   D+ K+WEA L HGF+P 
Sbjct  561  LVNVHSCENWLPRKAMSATRVAGILHALEGWETHECGTSLLLSDLDKVWEACLSHGFQPL  620



>ref|NP_171723.2| protein ECERIFERUM 1 [Arabidopsis thaliana]
 sp|F4HVY0.1|CER1_ARATH RecName: Full=Protein ECERIFERUM 1 [Arabidopsis thaliana]
 gb|AEE27401.1| protein ECERIFERUM 1 [Arabidopsis thaliana]
Length=625

 Score =   208 bits (530),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 133/180 (74%), Gaps = 5/180 (3%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NS+PK TT VV+ GNL+KVA +IA ALCQ+G QV+ L  DEY+++++ +  E   +LV 
Sbjct  441  INSVPKATTSVVMTGNLTKVAYTIASALCQRGVQVSTLRLDEYEKIRSCVPQECRDHLVY  500

Query  538  TKT---YSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKH  368
              +    S K WLVG+G + ++Q KA KGT FIPFSQFP K++R+DC+Y  TPA+IVPK 
Sbjct  501  LTSEALSSNKVWLVGEGTTREEQEKATKGTLFIPFSQFPLKQLRRDCIYHTTPALIVPKS  560

Query  367  LENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMF--DIGKIWEASLRHGFRPF  194
            L N+ SCENWLPR+ MSA RVAGILH +EGW ++ECG ++   D+ ++WEA L HGF+P 
Sbjct  561  LVNVHSCENWLPRKAMSATRVAGILHALEGWEMHECGTSLLLSDLDQVWEACLSHGFQPL  620



>ref|XP_004253318.1| PREDICTED: protein CER1-like 2 [Solanum lycopersicum]
Length=613

 Score =   208 bits (529),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 125/178 (70%), Gaps = 3/178 (2%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            L+SIP GT +V+ RG ++KVA +I  +LCQ   +V VL ++E+  L   L+ +   NLVL
Sbjct  429  LHSIPVGTKEVLFRGQITKVARAIVFSLCQNAIKVMVLRKEEHSMLAEFLDDKCKENLVL  488

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            T  Y    WLVGDGLS  +Q  A  GT F+PFSQFPPK +RKDC Y  TPAMI+P   +N
Sbjct  489  TTNYYPMIWLVGDGLSTKEQKMAKDGTLFLPFSQFPPKTLRKDCFYHTTPAMIIPHSAQN  548

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECG---NAMFDIGKIWEASLRHGFRPF  194
            +DSCENWL RRVMSAWRV GI+H +EGW  +ECG   N++ +  ++WEA+LR+GF+P 
Sbjct  549  IDSCENWLGRRVMSAWRVGGIVHALEGWKEHECGLDDNSIINPPRVWEAALRNGFQPL  606



>dbj|BAK00236.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=619

 Score =   208 bits (529),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 131/175 (75%), Gaps = 1/175 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +++IP+GT QV+L G +SKVA S+A ALC++  +V +  + EY  LK  +    A NLVL
Sbjct  441  IHAIPRGTNQVILAGRISKVARSVAAALCKKNVKVIMTNKQEYHLLKPCIPENEADNLVL  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKD-CLYFNTPAMIVPKHLE  362
            + T +A+ WL+G+GL A +Q +AP+GT FIP+SQFPPK  RKD C Y  TPAM VP+ ++
Sbjct  501  STTSTAEVWLIGEGLDAPEQSRAPQGTKFIPYSQFPPKMARKDCCTYAMTPAMGVPESMQ  560

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
            N+ SCENWLPR+VMSAWRVAGI+H +EGW+ +ECG+ +  + K+W A++ HGFRP
Sbjct  561  NVHSCENWLPRKVMSAWRVAGIVHALEGWSEDECGDTVLGLEKVWSAAIMHGFRP  615



>emb|CDX74937.1| BnaA05g06830D [Brassica napus]
Length=619

 Score =   207 bits (528),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 128/182 (70%), Gaps = 2/182 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            ++SIP GT +V+ RG ++KVA +I ++LCQ G +V VL E+E+  L   L      NLVL
Sbjct  429  VHSIPVGTREVLFRGQVTKVARAIVISLCQNGIKVMVLREEEHCMLAGYLGGHCKENLVL  488

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            T  YS   WLVGDGLS ++Q  A KGT F+PFSQFPP ++RKDC Y  TPAMI+P   +N
Sbjct  489  TTNYSPMIWLVGDGLSKEEQKMATKGTRFLPFSQFPPTQLRKDCFYHTTPAMIIPDSAQN  548

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECG--NAMFDIGKIWEASLRHGFRPFTVS  185
            +DSCENWL RRVMSAWRV GI+H +EGW  +ECG    + +  ++WEA+LR+GF+P  + 
Sbjct  549  IDSCENWLGRRVMSAWRVGGIVHALEGWEEHECGLDGPVVNPPRVWEAALRNGFKPLVLP  608

Query  184  AA  179
            + 
Sbjct  609  SV  610



>gb|EMS58603.1| hypothetical protein TRIUR3_05201 [Triticum urartu]
Length=416

 Score =   203 bits (517),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 135/175 (77%), Gaps = 1/175 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIP G  QVVL GN+SKVAC++A ALC++  +V +  + +Y  L+ ++  +AA NL+L
Sbjct  238  VNSIPHGADQVVLSGNISKVACAVAAALCKKNIKVIITNKQDYHFLQPKIPEDAADNLLL  297

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKD-CLYFNTPAMIVPKHLE  362
            +KT  AK W++G+G  A +Q++APKGT FIP+SQFPP+  RKD C Y  TPAM VPK L+
Sbjct  298  SKTGMAKVWIIGEGADATEQLRAPKGTRFIPYSQFPPRMARKDGCTYSTTPAMSVPKTLQ  357

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
            N+ SCENWLPRRVMSAWRVAGI+H +EGW+ +ECG+ + D+ K+W A+L HGFRP
Sbjct  358  NVHSCENWLPRRVMSAWRVAGIVHALEGWDEHECGDTVLDMDKVWSAALLHGFRP  412



>ref|NP_001048490.1| Os02g0814200 [Oryza sativa Japonica Group]
 dbj|BAD21663.1| putative CER1 [Oryza sativa Japonica Group]
 dbj|BAD22402.1| putative CER1 [Oryza sativa Japonica Group]
 dbj|BAF10404.1| Os02g0814200 [Oryza sativa Japonica Group]
 gb|EAZ25056.1| hypothetical protein OsJ_08848 [Oryza sativa Japonica Group]
 dbj|BAG90785.1| unnamed protein product [Oryza sativa Japonica Group]
Length=635

 Score =   208 bits (529),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 129/175 (74%), Gaps = 0/175 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LN IP+GT  V+L GN +K++  + L+LC++  QV ++ ++ Y+ LK +L PE   +LVL
Sbjct  445  LNMIPQGTKDVLLLGNANKISLVLTLSLCKREIQVRMVNKELYECLKQQLQPEMQEHLVL  504

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            + +YS+K WLVGDG++ ++QMKA KG+ F+P+SQFPP K R DC+Y  TPA++VP+  EN
Sbjct  505  SCSYSSKVWLVGDGVTDEEQMKAQKGSHFVPYSQFPPNKARNDCVYHCTPALLVPESFEN  564

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPF  194
            L  CENWLPRRVMSAWR AGI+H +E W+ +ECG  +  + K W A+L  GFRP+
Sbjct  565  LHVCENWLPRRVMSAWRAAGIVHALEKWDGHECGGRVTGVQKAWSAALARGFRPY  619



>ref|XP_009143457.1| PREDICTED: protein CER1-like 2 [Brassica rapa]
Length=628

 Score =   208 bits (529),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 128/182 (70%), Gaps = 2/182 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            ++SIP GT +V+ RG ++KVA +I ++LCQ G +V VL E+E+  L   L      NLVL
Sbjct  438  VHSIPVGTREVLFRGQVTKVARAIVISLCQNGIKVMVLREEEHCTLAGYLGGHCKENLVL  497

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            T  YS   WLVGDGLS ++Q  A KGT F+PFSQFPP ++RKDC Y  TPAMI+P   +N
Sbjct  498  TTNYSPMIWLVGDGLSKEEQKMATKGTRFLPFSQFPPTQLRKDCFYHTTPAMIIPDSAQN  557

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECG--NAMFDIGKIWEASLRHGFRPFTVS  185
            +DSCENWL RRVMSAWRV GI+H +EGW  +ECG    + +  ++WEA+LR+GF+P  + 
Sbjct  558  IDSCENWLGRRVMSAWRVGGIVHALEGWEEHECGLDGPVVNPPRVWEAALRNGFKPLVLP  617

Query  184  AA  179
            + 
Sbjct  618  SV  619



>gb|ABF51011.1| putative aldehyde decarbonylase enzyme CER1;1 [Hordeum vulgare]
Length=618

 Score =   207 bits (528),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 131/175 (75%), Gaps = 1/175 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +++IP+GT QV+L G +SKVA S+A ALC++  +V +  + EY  LK  +    A NLVL
Sbjct  440  IHAIPRGTNQVILAGRISKVARSVAAALCKKNVKVIMTNKQEYHLLKPCIPENEADNLVL  499

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKD-CLYFNTPAMIVPKHLE  362
            + T +A+ WL+G+GL A +Q +AP+GT FIP+SQFPPK  RKD C Y  TPAM VP+ ++
Sbjct  500  STTSTAEVWLIGEGLDAPEQSRAPQGTKFIPYSQFPPKMARKDCCTYAMTPAMGVPESMQ  559

Query  361  NLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRP  197
            N+ SCENWLPR+VMSAWRVAGI+H +EGW+ +ECG+ +  + K+W A++ HGFRP
Sbjct  560  NVHSCENWLPRKVMSAWRVAGIVHALEGWSEDECGDTVLGLEKVWSAAIMHGFRP  614



>gb|AAC23640.1| CER1-like protein [Arabidopsis thaliana]
Length=635

 Score =   208 bits (529),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 125/178 (70%), Gaps = 3/178 (2%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            L+SIP GT +V+ RG ++KVA +I  +LCQ   +V VL ++E+  L   L+ +   NLVL
Sbjct  451  LHSIPVGTKEVLFRGQITKVARAIVFSLCQNAIKVMVLRKEEHSMLAEFLDDKCKENLVL  510

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            T  Y    WLVGDGLS  +Q  A  GT F+PFSQFPPK +RKDC Y  TPAMI+P   +N
Sbjct  511  TTNYYPMIWLVGDGLSTKEQKMAKDGTLFLPFSQFPPKTLRKDCFYHTTPAMIIPHSAQN  570

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECG---NAMFDIGKIWEASLRHGFRPF  194
            +DSCENWL RRVMSAWRV GI+H +EGW  +ECG   N++ +  ++WEA+LR+GF+P 
Sbjct  571  IDSCENWLGRRVMSAWRVGGIVHALEGWKEHECGLDDNSIINPPRVWEAALRNGFQPL  628



>ref|XP_011466125.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Fragaria vesca 
subsp. vesca]
Length=596

 Score =   207 bits (527),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 120/160 (75%), Gaps = 1/160 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQV+L G L+KVA ++A +LCQ+  QV  + + EY +L   LN      +V 
Sbjct  437  LNSIPKGTTQVLLIGYLTKVAYALAFSLCQRDIQVVTVHQAEYLKLTKSLNATEG-KVVH  495

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             ++Y+ K WLVGDG S  +Q+ APKGT F+PFSQFPPKK+R+DC Y  TPAM +PK LEN
Sbjct  496  DRSYAQKIWLVGDGSSKKEQLSAPKGTIFVPFSQFPPKKLRRDCFYHYTPAMKIPKSLEN  555

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDI  239
            + SCENWLPRRVMSAWR+AGI+H +EGWN +ECG  M +I
Sbjct  556  VYSCENWLPRRVMSAWRIAGIVHALEGWNEHECGYTMSNI  595



>ref|XP_011466122.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Fragaria vesca 
subsp. vesca]
 ref|XP_011466123.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Fragaria vesca 
subsp. vesca]
 ref|XP_011466124.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Fragaria vesca 
subsp. vesca]
Length=598

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 120/160 (75%), Gaps = 1/160 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIPKGTTQV+L G L+KVA ++A +LCQ+  QV  + + EY +L   LN      +V 
Sbjct  439  LNSIPKGTTQVLLIGYLTKVAYALAFSLCQRDIQVVTVHQAEYLKLTKSLNATEG-KVVH  497

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
             ++Y+ K WLVGDG S  +Q+ APKGT F+PFSQFPPKK+R+DC Y  TPAM +PK LEN
Sbjct  498  DRSYAQKIWLVGDGSSKKEQLSAPKGTIFVPFSQFPPKKLRRDCFYHYTPAMKIPKSLEN  557

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDI  239
            + SCENWLPRRVMSAWR+AGI+H +EGWN +ECG  M +I
Sbjct  558  VYSCENWLPRRVMSAWRIAGIVHALEGWNEHECGYTMSNI  597



>gb|KFK36660.1| hypothetical protein AALP_AA4G153400 [Arabis alpina]
Length=625

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 124/177 (70%), Gaps = 1/177 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            ++SIP GT +V+ RG ++KVA +I  +LCQ G +V VL E+E+  L   L+     NL+L
Sbjct  438  VHSIPIGTREVLFRGQITKVARAIVFSLCQNGIKVMVLREEEHCVLAEFLDESCKENLML  497

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            T  YS   WLVGDGLS DDQ  A KGT F+PFSQFPP +++KDC Y  TPAMI+P   +N
Sbjct  498  TTNYSPTIWLVGDGLSKDDQKMAKKGTRFLPFSQFPPTEIQKDCFYHTTPAMIIPDSAQN  557

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPFTV  188
            +DSCENWL RRVMSAWRV GI+H +EGW  +ECG        +WEA+LR+GF+P  +
Sbjct  558  IDSCENWLGRRVMSAWRVGGIVHALEGWEEHECG-LHNSTKSVWEAALRNGFQPLVL  613



>ref|XP_009384064.1| PREDICTED: protein ECERIFERUM 1-like [Musa acuminata subsp. malaccensis]
Length=625

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 124/175 (71%), Gaps = 0/175 (0%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            LNSIP  T +V L GNLSKVA  +A  LCQ+  +V +  + EY  LK+++    A  L+L
Sbjct  441  LNSIPPETKKVALCGNLSKVAYRVASVLCQRCVEVIITRKHEYYMLKSQIPESIAGYLLL  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            +  ++ + WLVGDGL   +Q  APKGT F+P+S FPPKKVRKDC Y  TPAM +P  +EN
Sbjct  501  SNNHNTQVWLVGDGLEDVEQRTAPKGTLFVPYSSFPPKKVRKDCTYCTTPAMKIPDTVEN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMFDIGKIWEASLRHGFRPF  194
            + SCENWLPRRVMSA RVAGI+H +EGW+ +ECG+   DI K+W A+LRHGF P 
Sbjct  561  MHSCENWLPRRVMSASRVAGIVHALEGWDSHECGDKTQDIDKMWSAALRHGFLPL  615



>ref|NP_001184890.1| protein ECERIFERUM 1 [Arabidopsis thaliana]
 gb|AEE27402.1| protein ECERIFERUM 1 [Arabidopsis thaliana]
Length=630

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 133/184 (72%), Gaps = 10/184 (5%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NS+PK TT VV+ GNL+KVA +IA ALCQ+G QV+ L  DEY+++++ +  E   +LV 
Sbjct  441  INSVPKATTSVVMTGNLTKVAYTIASALCQRGVQVSTLRLDEYEKIRSCVPQECRDHLVY  500

Query  538  --------TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAM  383
                     K +  K WLVG+G + ++Q KA KGT FIPFSQFP K++R+DC+Y  TPA+
Sbjct  501  LTSEALSSNKGFWVKVWLVGEGTTREEQEKATKGTLFIPFSQFPLKQLRRDCIYHTTPAL  560

Query  382  IVPKHLENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNAMF--DIGKIWEASLRH  209
            IVPK L N+ SCENWLPR+ MSA RVAGILH +EGW ++ECG ++   D+ ++WEA L H
Sbjct  561  IVPKSLVNVHSCENWLPRKAMSATRVAGILHALEGWEMHECGTSLLLSDLDQVWEACLSH  620

Query  208  GFRP  197
            GF+P
Sbjct  621  GFQP  624



>ref|XP_010517047.1| PREDICTED: protein CER1-like 2 isoform X2 [Camelina sativa]
Length=586

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 127/179 (71%), Gaps = 2/179 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            L+SIP  T +V+ RG ++KVA +I  +LCQ   +V VL ++E+  L   L+     NLVL
Sbjct  401  LHSIPVRTREVLFRGQVTKVARAIVFSLCQNAIKVMVLRKEEHSMLAEFLDDSCKENLVL  460

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            T  Y+   WLVGDG+S  +Q  A +GT F+PFSQFPP K+RKDC+Y  TPAMI+P   +N
Sbjct  461  TTNYNPMIWLVGDGVSTKEQKMAKEGTLFLPFSQFPPDKLRKDCVYHTTPAMIIPHSAQN  520

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECG--NAMFDIGKIWEASLRHGFRPFTV  188
            +DSCENWL RRVMSAWRV GI+H +EGW  +ECG  N++ +  ++WEA+LR+GF+P  V
Sbjct  521  IDSCENWLGRRVMSAWRVGGIVHSLEGWEEHECGLDNSVLNSPRVWEAALRNGFQPLRV  579



>ref|XP_006306997.1| hypothetical protein CARUB_v10008574mg [Capsella rubella]
 gb|EOA39895.1| hypothetical protein CARUB_v10008574mg [Capsella rubella]
Length=629

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 129/180 (72%), Gaps = 8/180 (4%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
             N+IP  TT+VVLRGNL+KVA  +  ALC++G +V VL E+E+ +L   +      NLVL
Sbjct  446  FNNIPTETTEVVLRGNLTKVASVVVFALCRKGVKVVVLKEEEHSKL---IKSGIVKNLVL  502

Query  538  TKT--YSAKT-WLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKH  368
            + +  Y++ T WLVGDG+  ++QMKA +GT F+PFS FPP K+RKDC Y +TPAM VPK 
Sbjct  503  STSNNYNSPTVWLVGDGIEKEEQMKAKEGTLFVPFSHFPPNKLRKDCFYHSTPAMRVPKS  562

Query  367  LENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNA--MFDIGKIWEASLRHGFRPF  194
             +N+DSCENWL RRVMSAW+V GI+H +EGW  ++CGN    F +  IWEA+LRH F P 
Sbjct  563  AQNIDSCENWLERRVMSAWKVGGIVHALEGWEEHDCGNTYNFFRLHAIWEAALRHDFEPL  622



>gb|KFK42593.1| hypothetical protein AALP_AA1G015500 [Arabis alpina]
Length=628

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 127/179 (71%), Gaps = 7/179 (4%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            +NSIPKGT +VV RGN +KVA +   AL Q+  +V VL E+E+ +L   +      N+VL
Sbjct  446  VNSIPKGTREVVFRGNPTKVALAAVFALSQRDVKVVVLREEEHSKL---IRSGVVKNMVL  502

Query  538  -TKTYSAKT-WLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHL  365
             T  Y + T WLVGDG+  ++QMKA +GT FIPFSQFPP K+R DC Y +TPAM+VPK  
Sbjct  503  ATSNYESPTVWLVGDGIEKEEQMKAKEGTLFIPFSQFPPNKLRNDCFYLSTPAMLVPKSA  562

Query  364  ENLDSCENWLPRRVMSAWRVAGILHGVEGWNVNECGNA--MFDIGKIWEASLRHGFRPF  194
            EN+DSCENWL RRVMSAWRV GI+H +EGW  ++CGN    F +  IWEA+LRH F+P 
Sbjct  563  ENIDSCENWLGRRVMSAWRVGGIVHALEGWEEHDCGNTCNFFRLHAIWEAALRHDFQPL  621



>ref|XP_010505369.1| PREDICTED: protein CER1-like 2 [Camelina sativa]
Length=634

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 128/181 (71%), Gaps = 2/181 (1%)
 Frame = -2

Query  718  LNSIPKGTTQVVLRGNLSKVACSIALALCQQGTQVAVLGEDEYKRLKARLNPEAATNLVL  539
            L+SIP  T +V+ RG ++KVA +I  +LCQ   +V VL ++E+  L   L+     NLVL
Sbjct  441  LHSIPVRTREVLFRGQVTKVARAIVFSLCQNAIKVMVLRKEEHSMLAEFLDDSCKENLVL  500

Query  538  TKTYSAKTWLVGDGLSADDQMKAPKGTFFIPFSQFPPKKVRKDCLYFNTPAMIVPKHLEN  359
            T  Y+   WLVGDG+S  +Q  A +GT F+PFSQFPP K+RKDC+Y  TPAMI+P   +N
Sbjct  501  TTNYNPMIWLVGDGVSTKEQKMAKEGTMFLPFSQFPPDKLRKDCVYHTTPAMIIPHSAQN  560

Query  358  LDSCENWLPRRVMSAWRVAGILHGVEGWNVNECG--NAMFDIGKIWEASLRHGFRPFTVS  185
            +DSCENWL RRVMSAWRV GI+H +EGW  +ECG  N++ +  ++WEA+LR+GF+P   S
Sbjct  561  IDSCENWLGRRVMSAWRVGGIVHSLEGWEEHECGLDNSILNSPRVWEAALRNGFQPLRTS  620

Query  184  A  182
            +
Sbjct  621  S  621



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680