BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF013F11

Length=754
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU42831.1|  hypothetical protein MIMGU_mgv1a003489mg                295   3e-92   Erythranthe guttata [common monkey flower]
ref|XP_009612399.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    292   9e-92   Nicotiana tomentosiformis
ref|XP_009612398.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    293   2e-91   Nicotiana tomentosiformis
ref|XP_009784852.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    291   2e-91   Nicotiana sylvestris
ref|XP_009784851.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    291   3e-91   Nicotiana sylvestris
ref|XP_009784850.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    291   5e-91   Nicotiana sylvestris
gb|AJD25227.1|  cytochrome P450 CYP97B34                                289   5e-90   Salvia miltiorrhiza [Chinese salvia]
ref|XP_006354415.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    287   2e-89   Solanum tuberosum [potatoes]
ref|XP_009347871.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     287   3e-89   Pyrus x bretschneideri [bai li]
ref|XP_008342307.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     286   4e-89   
ref|XP_010321037.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    285   2e-88   Solanum lycopersicum
ref|XP_004239253.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    284   3e-88   Solanum lycopersicum
ref|XP_010093134.1|  Cytochrome P450                                    284   3e-88   Morus notabilis
ref|XP_002308766.1|  hypothetical protein POPTR_0006s00800g             284   4e-88   Populus trichocarpa [western balsam poplar]
ref|XP_011100398.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     284   4e-88   Sesamum indicum [beniseed]
ref|XP_007158591.1|  hypothetical protein PHAVU_002G165400g             283   5e-88   Phaseolus vulgaris [French bean]
ref|XP_002520583.1|  cytochrome P450, putative                          282   8e-88   Ricinus communis
ref|XP_004147731.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    283   9e-88   Cucumis sativus [cucumbers]
ref|XP_004164429.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    281   3e-87   
gb|KEH27406.1|  cytochrome P450 family 97 protein                       277   3e-87   Medicago truncatula
ref|XP_007215027.1|  hypothetical protein PRUPE_ppa003405mg             281   4e-87   
gb|KDP42786.1|  hypothetical protein JCGZ_00485                         281   7e-87   Jatropha curcas
ref|XP_008451892.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    281   8e-87   
ref|XP_010680161.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     280   9e-87   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG14945.1|  Cytochrome P450, chloroplastic                          280   1e-86   Gossypium arboreum [tree cotton]
ref|XP_011002376.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     280   2e-86   Populus euphratica
ref|XP_003610974.1|  Cytochrome P450                                    278   8e-86   Medicago truncatula
ref|XP_010044825.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     278   1e-85   Eucalyptus grandis [rose gum]
ref|XP_010313051.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    278   1e-85   
gb|KJB10650.1|  hypothetical protein B456_001G213800                    275   1e-85   Gossypium raimondii
gb|KHN35086.1|  Cytochrome P450 97B2, chloroplastic                     277   2e-85   Glycine soja [wild soybean]
ref|NP_001235534.1|  cytochrome P450 97B2, chloroplastic                277   2e-85   
ref|XP_002266883.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     276   2e-85   Vitis vinifera
ref|XP_007049043.1|  Cytochrome P450 97B2 isoform 1                     277   3e-85   
gb|KJB10648.1|  hypothetical protein B456_001G213800                    276   5e-85   Gossypium raimondii
dbj|BAJ97821.1|  predicted protein                                      275   6e-85   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87287.1|  predicted protein                                      275   8e-85   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS51606.1|  Cytochrome P450 97B2, chloroplastic                     275   1e-84   Triticum urartu
ref|XP_002451628.1|  hypothetical protein SORBIDRAFT_04g004850          274   2e-84   Sorghum bicolor [broomcorn]
ref|XP_004951757.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    273   4e-84   Setaria italica
dbj|BAG90081.1|  unnamed protein product                                268   4e-84   Oryza sativa Japonica Group [Japonica rice]
gb|KDO64373.1|  hypothetical protein CISIN_1g014372mg                   269   5e-84   Citrus sinensis [apfelsine]
ref|XP_006429774.1|  hypothetical protein CICLE_v10011353mg             269   6e-84   
ref|XP_010233882.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    268   7e-84   Brachypodium distachyon [annual false brome]
ref|XP_007049044.1|  Cytochrome P450 97B2, chloroplastic isoform 2      273   8e-84   
ref|XP_010914244.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     273   8e-84   Elaeis guineensis
ref|XP_010260624.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    270   9e-84   
emb|CDP16026.1|  unnamed protein product                                273   1e-83   Coffea canephora [robusta coffee]
ref|XP_010440341.1|  PREDICTED: cytochrome P450 97B3, chloroplastic     271   3e-83   Camelina sativa [gold-of-pleasure]
ref|XP_008679919.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     270   9e-83   Zea mays [maize]
ref|XP_010260623.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    270   1e-82   Nelumbo nucifera [Indian lotus]
ref|XP_006429775.1|  hypothetical protein CICLE_v10011353mg             270   1e-82   
ref|XP_003570274.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    268   2e-82   Brachypodium distachyon [annual false brome]
ref|XP_006648355.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    268   3e-82   
ref|XP_006481375.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    270   3e-82   Citrus sinensis [apfelsine]
ref|XP_008809593.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     268   3e-82   Phoenix dactylifera
emb|CDY22733.1|  BnaA08g05630D                                          268   3e-82   Brassica napus [oilseed rape]
ref|XP_010435019.1|  PREDICTED: cytochrome P450 97B3, chloroplast...    268   5e-82   Camelina sativa [gold-of-pleasure]
ref|XP_009107829.1|  PREDICTED: cytochrome P450 97B3, chloroplastic     268   6e-82   Brassica rapa
emb|CDY09057.1|  BnaC08g10110D                                          268   6e-82   Brassica napus [oilseed rape]
gb|EAZ21913.1|  hypothetical protein OsJ_05566                          267   7e-82   Oryza sativa Japonica Group [Japonica rice]
gb|KFK33561.1|  hypothetical protein AALP_AA5G029500                    267   8e-82   Arabis alpina [alpine rockcress]
gb|EAY84668.1|  hypothetical protein OsI_06039                          267   1e-81   Oryza sativa Indica Group [Indian rice]
dbj|BAD26183.1|  putative cytochrome P450                               267   1e-81   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010532498.1|  PREDICTED: cytochrome P450 97B3, chloroplastic     266   2e-81   Tarenaya hassleriana [spider flower]
ref|XP_006414564.1|  hypothetical protein EUTSA_v10024764mg             266   4e-81   Eutrema salsugineum [saltwater cress]
ref|XP_006285060.1|  hypothetical protein CARUB_v10006369mg             265   6e-81   Capsella rubella
ref|XP_010495892.1|  PREDICTED: cytochrome P450 97B3, chloroplast...    265   7e-81   Camelina sativa [gold-of-pleasure]
emb|CAB10290.1|  cytochrome P450 like protein                           265   8e-81   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193247.2|  cytochrome P450 97B3                                  265   9e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009412060.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    259   2e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006854622.1|  hypothetical protein AMTR_s00030p00167800          259   2e-80   
ref|XP_002868224.1|  hypothetical protein ARALYDRAFT_493377             261   2e-79   
ref|XP_009412059.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    259   7e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004303949.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     259   2e-78   Fragaria vesca subsp. vesca
gb|AAT28222.1|  putative 97B2-like cytochrome P450                      258   4e-78   Ginkgo biloba [ginkgo]
ref|XP_008229650.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     258   5e-78   Prunus mume [ume]
ref|XP_006841947.1|  hypothetical protein AMTR_s00042p00221280          255   6e-77   
ref|XP_001769554.1|  predicted protein                                  250   6e-75   
ref|XP_002976141.1|  hypothetical protein SELMODRAFT_175360             236   3e-70   
ref|XP_002968239.1|  hypothetical protein SELMODRAFT_145597             236   5e-70   
gb|EMT03024.1|  Cytochrome P450 97B2                                    236   1e-69   
gb|KHN25634.1|  Cytochrome P450 97B2, chloroplastic                     219   2e-65   Glycine soja [wild soybean]
sp|Q43078.1|C97B1_PEA  RecName: Full=Cytochrome P450 97B1, chloro...    211   2e-60   Pisum sativum [garden pea]
ref|XP_011399626.1|  Cytochrome P450 97B2, chloroplastic                181   1e-52   Auxenochlorella protothecoides
gb|AFR36909.1|  chloroplast CYP97B                                      181   1e-49   Haematococcus lacustris
emb|CBJ27249.1|  Cytochrome P450                                        179   1e-48   Ectocarpus siliculosus
gb|AGK38423.1|  CYP97B1                                                 179   2e-48   Parachlorella kessleri
gb|AGK38421.1|  CYP97B1                                                 175   8e-47   Parachlorella kessleri
ref|XP_002955478.1|  hypothetical protein VOLCADRAFT_65884              174   1e-46   Volvox carteri f. nagariensis
gb|KIY95180.1|  hypothetical protein MNEG_12781                         159   8e-45   Monoraphidium neglectum
emb|CBJ27248.1|  Cytochrome P450                                        168   4e-44   Ectocarpus siliculosus
ref|XP_002292287.1|  predicted protein                                  167   7e-44   Thalassiosira pseudonana CCMP1335
gb|EWM30289.1|  cytochrome p450                                         164   3e-43   Nannochloropsis gaditana
ref|XP_005650550.1|  cytochrome P450                                    164   4e-43   Coccomyxa subellipsoidea C-169
gb|EJK63850.1|  hypothetical protein THAOC_15469                        164   5e-43   Thalassiosira oceanica
emb|CDY09055.1|  BnaC08g10090D                                          156   6e-43   Brassica napus [oilseed rape]
ref|XP_005845008.1|  hypothetical protein CHLNCDRAFT_138471             163   1e-42   Chlorella variabilis
gb|AAL73435.1|AF459441_1  cytochrome P450                               162   3e-42   Skeletonema costatum
ref|XP_001421212.1|  predicted protein                                  160   1e-41   Ostreococcus lucimarinus CCE9901
emb|CEG01697.1|  Cytochrome P450, conserved site                        158   6e-41   Ostreococcus tauri
ref|XP_005827896.1|  cytochrome P450                                    155   2e-40   Guillardia theta CCMP2712
gb|AHA51695.1|  P450-type beta-carotene hydroxylase CYP97B29            153   4e-39   Porphyra umbilicalis
ref|XP_003074608.1|  cytochrome P450 (ISS)                              152   5e-39   Ostreococcus tauri
ref|XP_003061074.1|  predicted protein                                  152   5e-39   Micromonas pusilla CCMP1545
ref|XP_007509002.1|  predicted protein                                  151   1e-38   Bathycoccus prasinos
ref|XP_005830096.1|  cytochrome P450                                    150   1e-38   Guillardia theta CCMP2712
ref|XP_005715216.1|  cytochrome P450 family 97G-CYP97G1                 151   1e-38   Chondrus crispus [carageen]
ref|XP_002178724.1|  lutein deficient 1-like protein                    152   2e-38   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002506798.1|  predicted protein                                  150   3e-38   Micromonas commoda
ref|XP_001415984.1|  predicted protein                                  150   3e-38   Ostreococcus lucimarinus CCE9901
ref|XP_002185035.1|  lut1-1                                             149   5e-38   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002185034.1|  lutein deficient 1-like protein                    149   7e-38   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_007514506.1|  predicted protein                                  148   2e-37   Bathycoccus prasinos
ref|XP_009032928.1|  hypothetical protein AURANDRAFT_19592              147   2e-37   Aureococcus anophagefferens
ref|XP_009034650.1|  hypothetical protein AURANDRAFT_21944              143   2e-37   Aureococcus anophagefferens
emb|CDY61653.1|  BnaCnng38160D                                          142   3e-37   Brassica napus [oilseed rape]
gb|ACF83994.1|  unknown                                                 135   1e-36   Zea mays [maize]
ref|XP_007145289.1|  hypothetical protein PHAVU_007G2265000g            137   2e-36   Phaseolus vulgaris [French bean]
gb|AGK38422.1|  CYP97B2                                                 144   4e-36   Parachlorella kessleri
ref|XP_002293604.1|  cytochrome P450                                    142   2e-35   Thalassiosira pseudonana CCMP1335
ref|XP_004516959.1|  PREDICTED: carotene epsilon-monooxygenase, c...    141   4e-35   Cicer arietinum [garbanzo]
ref|XP_005648231.1|  CYP97C3                                            141   4e-35   Coccomyxa subellipsoidea C-169
dbj|BAD94136.1|  Cytochrom P450 -like protein                           138   5e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003542540.1|  PREDICTED: carotene epsilon-monooxygenase, c...    140   8e-35   Glycine max [soybeans]
gb|AGN27239.1|  CYP97A1                                                 141   9e-35   Parachlorella kessleri
gb|KFK34549.1|  hypothetical protein AALP_AA5G160700                    140   1e-34   Arabis alpina [alpine rockcress]
ref|XP_002876190.1|  hypothetical protein ARALYDRAFT_485688             140   1e-34   
ref|XP_011397501.1|  Cytochrome P450 97B2, chloroplastic                140   1e-34   Auxenochlorella protothecoides
ref|XP_003537025.1|  PREDICTED: carotene epsilon-monooxygenase, c...    140   1e-34   Glycine max [soybeans]
gb|KHN36453.1|  Carotene epsilon-monooxygenase, chloroplastic           141   1e-34   Glycine soja [wild soybean]
ref|XP_005826161.1|  cytochrome P450                                    140   2e-34   Guillardia theta CCMP2712
ref|XP_001700492.1|  cytochrome P450, carotenoid hydroxylase            140   2e-34   Chlamydomonas reinhardtii
gb|AGI61105.1|  carotenoid hydroxylase                                  139   4e-34   Parachlorella kessleri
ref|XP_006391881.1|  hypothetical protein EUTSA_v10023482mg             135   4e-34   
ref|XP_002958826.1|  hypothetical protein VOLCADRAFT_100143             139   5e-34   Volvox carteri f. nagariensis
ref|XP_003574294.1|  PREDICTED: carotene epsilon-monooxygenase, c...    138   7e-34   Brachypodium distachyon [annual false brome]
ref|XP_001422903.1|  predicted protein                                  137   7e-34   Ostreococcus lucimarinus CCE9901
ref|XP_010504071.1|  PREDICTED: carotene epsilon-monooxygenase, c...    137   7e-34   Camelina sativa [gold-of-pleasure]
ref|XP_001420992.1|  predicted protein                                  137   8e-34   Ostreococcus lucimarinus CCE9901
ref|XP_010426945.1|  PREDICTED: carotene epsilon-monooxygenase, c...    137   8e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010515801.1|  PREDICTED: carotene epsilon-monooxygenase, c...    137   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_009125249.1|  PREDICTED: carotene epsilon-monooxygenase, c...    137   1e-33   Brassica rapa
gb|AAM13903.1|  putative cytochrome P450                                137   2e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CDY13314.1|  BnaC06g14430D                                          136   2e-33   Brassica napus [oilseed rape]
ref|NP_190881.2|  carotene epsilon-monooxygenase                        136   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003058421.1|  cytochrome P450 superfamily protein                138   2e-33   Micromonas pusilla CCMP1545
emb|CDX67558.1|  BnaA07g15980D                                          136   2e-33   
gb|ACO53105.1|  epsilon carotene hydroxylase                            131   2e-33   Actinidia chinensis
gb|AID51468.1|  epsilon-ring carotene hydroxylase                       129   3e-33   Cucumis melo var. makuwa
ref|XP_006391882.1|  hypothetical protein EUTSA_v10023482mg             135   3e-33   
emb|CAB64216.1|  Cytochrom P450-like protein                            136   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009623194.1|  PREDICTED: carotene epsilon-monooxygenase, c...    134   4e-33   
gb|EJK46027.1|  hypothetical protein THAOC_35331                        135   4e-33   Thalassiosira oceanica
gb|EMS57747.1|  Cytochrome P450 97B2, chloroplastic                     135   4e-33   Triticum urartu
ref|XP_002506759.1|  predicted protein                                  135   5e-33   Micromonas commoda
emb|CEG00185.1|  Cytochrome P450, conserved site                        135   6e-33   Ostreococcus tauri
gb|AFP65826.1|  carotene epsilon-ring hydroxylase                       131   6e-33   Eriobotrya japonica [loquat]
emb|CDP15310.1|  unnamed protein product                                135   6e-33   Coffea canephora [robusta coffee]
ref|XP_003082726.1|  probable cytochrome P450 (ISS)                     136   7e-33   
ref|XP_006403722.1|  hypothetical protein EUTSA_v10010267mg             135   7e-33   Eutrema salsugineum [saltwater cress]
ref|XP_004983762.1|  PREDICTED: carotene epsilon-monooxygenase, c...    135   7e-33   Setaria italica
ref|XP_004983761.1|  PREDICTED: carotene epsilon-monooxygenase, c...    135   7e-33   Setaria italica
dbj|BAJ87296.1|  predicted protein                                      135   8e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_005761340.1|  hypothetical protein EMIHUDRAFT_471046             129   1e-32   Emiliania huxleyi CCMP1516
ref|XP_005849069.1|  hypothetical protein CHLNCDRAFT_51247              134   1e-32   Chlorella variabilis
ref|XP_003590442.1|  Cytochrome P450 monooxygenase CYP97C10             134   1e-32   
gb|AIX87504.1|  P450 carotenoid epsilon-ring hydroxylase                134   1e-32   Lycium barbarum [Duke of Argyll's teatree]
gb|AIX87528.1|  P450 carotenoid epsilon-ring hydroxylase                134   1e-32   Lycium ruthenicum
ref|XP_006339098.1|  PREDICTED: carotene epsilon-monooxygenase, c...    132   1e-32   
ref|NP_001065217.1|  Os10g0546600                                       134   2e-32   
ref|XP_009623193.1|  PREDICTED: carotene epsilon-monooxygenase, c...    133   2e-32   Nicotiana tomentosiformis
ref|XP_010241652.1|  PREDICTED: carotene epsilon-monooxygenase, c...    133   3e-32   Nelumbo nucifera [Indian lotus]
ref|XP_006662027.1|  PREDICTED: carotene epsilon-monooxygenase, c...    133   3e-32   Oryza brachyantha
ref|XP_009757367.1|  PREDICTED: carotene epsilon-monooxygenase, c...    133   4e-32   Nicotiana sylvestris
ref|XP_008462512.1|  PREDICTED: carotene epsilon-monooxygenase, c...    132   4e-32   Cucumis melo [Oriental melon]
ref|XP_010241651.1|  PREDICTED: carotene epsilon-monooxygenase, c...    133   5e-32   Nelumbo nucifera [Indian lotus]
gb|ABQ59243.1|  CYP97C3                                                 132   5e-32   Chlamydomonas reinhardtii
ref|XP_002503315.1|  predicted protein                                  133   8e-32   Micromonas commoda
ref|XP_008807069.1|  PREDICTED: LOW QUALITY PROTEIN: carotene eps...    132   9e-32   Phoenix dactylifera
ref|NP_001234058.1|  cytochrome P450-type monooxygenase 97C11           132   1e-31   
ref|XP_006339097.1|  PREDICTED: carotene epsilon-monooxygenase, c...    132   1e-31   Solanum tuberosum [potatoes]
ref|XP_008658121.1|  PREDICTED: carotene epsilon-monooxygenase, c...    132   1e-31   Zea mays [maize]
gb|AAK20054.1|AC025783_14  putative cytochrome P450 monooxygenase       132   1e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006491796.1|  PREDICTED: carotene epsilon-monooxygenase, c...    131   1e-31   Citrus sinensis [apfelsine]
ref|XP_010098846.1|  Carotene epsilon-monooxygenase                     132   1e-31   
ref|XP_011094564.1|  PREDICTED: carotene epsilon-monooxygenase, c...    131   2e-31   Sesamum indicum [beniseed]
gb|EEC67393.1|  hypothetical protein OsI_34547                          131   2e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_006428525.1|  hypothetical protein CICLE_v10011420mg             130   2e-31   Citrus clementina [clementine]
gb|KDO54336.1|  hypothetical protein CISIN_1g008564mg                   130   3e-31   Citrus sinensis [apfelsine]
ref|XP_005779653.1|  hypothetical protein EMIHUDRAFT_463287             131   3e-31   Emiliania huxleyi CCMP1516
ref|XP_011396817.1|  Cytochrome P450 97B3, chloroplastic                130   4e-31   Auxenochlorella protothecoides
gb|KDO54333.1|  hypothetical protein CISIN_1g008564mg                   130   4e-31   Citrus sinensis [apfelsine]
gb|KDO54334.1|  hypothetical protein CISIN_1g008564mg                   130   5e-31   Citrus sinensis [apfelsine]
gb|KDO54335.1|  hypothetical protein CISIN_1g008564mg                   130   5e-31   Citrus sinensis [apfelsine]
gb|KDO54337.1|  hypothetical protein CISIN_1g008564mg                   129   5e-31   Citrus sinensis [apfelsine]
ref|XP_009382396.1|  PREDICTED: carotene epsilon-monooxygenase, c...    129   6e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382395.1|  PREDICTED: carotene epsilon-monooxygenase, c...    129   6e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382394.1|  PREDICTED: carotene epsilon-monooxygenase, c...    129   6e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009375781.1|  PREDICTED: carotene epsilon-monooxygenase, c...    129   6e-31   
ref|XP_002467549.1|  hypothetical protein SORBIDRAFT_01g030050          129   7e-31   
ref|XP_002955547.1|  hypothetical protein VOLCADRAFT_83281              129   8e-31   Volvox carteri f. nagariensis
gb|KHG23674.1|  Cytochrome P450, chloroplastic                          129   8e-31   Gossypium arboreum [tree cotton]
ref|XP_008392557.1|  PREDICTED: carotene epsilon-monooxygenase, c...    129   8e-31   Malus domestica [apple tree]
ref|XP_007027524.1|  Cytochrome P450 superfamily protein isoform 2      127   9e-31   
gb|KJB46498.1|  hypothetical protein B456_007G372200                    129   9e-31   Gossypium raimondii
ref|XP_004156328.1|  PREDICTED: carotene epsilon-monooxygenase, c...    129   1e-30   
ref|XP_002519427.1|  cytochrome P450, putative                          129   1e-30   
ref|XP_004143287.1|  PREDICTED: carotene epsilon-monooxygenase, c...    129   1e-30   Cucumis sativus [cucumbers]
ref|XP_010907646.1|  PREDICTED: carotene epsilon-monooxygenase, c...    128   1e-30   
ref|XP_010907645.1|  PREDICTED: carotene epsilon-monooxygenase, c...    128   1e-30   Elaeis guineensis
ref|XP_010907643.1|  PREDICTED: carotene epsilon-monooxygenase, c...    129   1e-30   Elaeis guineensis
ref|XP_004516958.1|  PREDICTED: carotene epsilon-monooxygenase, c...    128   1e-30   
ref|XP_010546517.1|  PREDICTED: carotene epsilon-monooxygenase, c...    128   1e-30   Tarenaya hassleriana [spider flower]
gb|EYU41579.1|  hypothetical protein MIMGU_mgv1a004062mg                128   2e-30   Erythranthe guttata [common monkey flower]
ref|XP_011468004.1|  PREDICTED: carotene epsilon-monooxygenase, c...    127   3e-30   Fragaria vesca subsp. vesca
ref|XP_008241353.1|  PREDICTED: carotene epsilon-monooxygenase, c...    127   3e-30   Prunus mume [ume]
gb|AFQ31612.1|  CYP97C                                                  127   3e-30   Haematococcus lacustris
ref|XP_011018827.1|  PREDICTED: carotene epsilon-monooxygenase, c...    127   4e-30   Populus euphratica
ref|XP_003062894.1|  predicted protein                                  127   4e-30   Micromonas pusilla CCMP1545
ref|XP_004306170.1|  PREDICTED: carotene epsilon-monooxygenase, c...    127   4e-30   Fragaria vesca subsp. vesca
ref|XP_011018826.1|  PREDICTED: carotene epsilon-monooxygenase, c...    127   4e-30   Populus euphratica
ref|XP_006381359.1|  hypothetical protein POPTR_0006s12150g             127   5e-30   
gb|AGT63110.1|  plastid carotenoid epsilon-ring hydroxylase             127   5e-30   Haematococcus lacustris
ref|XP_007027523.1|  Cytochrome P450 superfamily protein isoform 1      126   6e-30   
emb|CBI30186.3|  unnamed protein product                                125   8e-30   Vitis vinifera
gb|KCW89308.1|  hypothetical protein EUGRSUZ_A01599                     126   8e-30   Eucalyptus grandis [rose gum]
ref|XP_007204192.1|  hypothetical protein PRUPE_ppa003701mg             126   9e-30   Prunus persica
gb|ACU20919.1|  unknown                                                 118   1e-29   Glycine max [soybeans]
ref|XP_010050328.1|  PREDICTED: carotene epsilon-monooxygenase, c...    126   1e-29   Eucalyptus grandis [rose gum]
ref|XP_002991812.1|  hypothetical protein SELMODRAFT_186370             125   2e-29   Selaginella moellendorffii
ref|XP_002992972.1|  hypothetical protein SELMODRAFT_187123             125   2e-29   Selaginella moellendorffii
emb|CAN65775.1|  hypothetical protein VITISV_030413                     125   2e-29   Vitis vinifera
ref|XP_002265015.1|  PREDICTED: carotene epsilon-monooxygenase, c...    125   2e-29   
gb|EPS64627.1|  hypothetical protein M569_10150                         126   2e-29   Genlisea aurea
ref|XP_002971637.1|  hypothetical protein SELMODRAFT_231778             124   3e-29   
gb|ADK60778.1|  putative mitochondrial cytochrome P450 monooxygenase    119   3e-29   Arachis diogoi
ref|XP_010683980.1|  PREDICTED: carotene epsilon-monooxygenase, c...    124   4e-29   Beta vulgaris subsp. vulgaris [field beet]
gb|AJB84623.1|  carotene epsilon-monooxygenase                          124   4e-29   Camellia sinensis [black tea]
ref|XP_002965693.1|  hypothetical protein SELMODRAFT_407294             124   5e-29   
ref|XP_006833028.1|  hypothetical protein AMTR_s00094p00105890          115   5e-29   
gb|ABB52076.1|  putative epsilon-ring carotene hydroxylase              123   1e-28   Daucus carota subsp. sativus
gb|KDP29211.1|  hypothetical protein JCGZ_16600                         123   1e-28   Jatropha curcas
gb|ABD97103.1|  cytochrome P450 monooxygenase CYP97C10                  121   3e-28   Glycine max [soybeans]
ref|XP_010674674.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    123   3e-28   Beta vulgaris subsp. vulgaris [field beet]
gb|AJD25228.1|  cytochrome P450 CYP97C28                                122   3e-28   Salvia miltiorrhiza [Chinese salvia]
gb|AJD25226.1|  cytochrome P450 CYP97A41                                122   4e-28   Salvia miltiorrhiza [Chinese salvia]
ref|XP_008218412.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    122   5e-28   Prunus mume [ume]
ref|XP_002512609.1|  cytochrome P450, putative                          122   6e-28   
ref|XP_003534527.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    121   9e-28   Glycine max [soybeans]
ref|XP_006428546.1|  hypothetical protein CICLE_v10011312mg             121   1e-27   Citrus clementina [clementine]
ref|XP_006428547.1|  hypothetical protein CICLE_v10011312mg             121   1e-27   Citrus clementina [clementine]
ref|XP_006649172.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    120   1e-27   Oryza brachyantha
ref|XP_004133753.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    121   1e-27   Cucumis sativus [cucumbers]
ref|XP_004170273.1|  PREDICTED: LOW QUALITY PROTEIN: protein LUTE...    121   1e-27   
ref|XP_007204988.1|  hypothetical protein PRUPE_ppa003455mg             120   1e-27   
gb|KHN29293.1|  Protein LUTEIN DEFICIENT 5, chloroplastic               121   2e-27   Glycine soja [wild soybean]
emb|CDY27131.1|  BnaA08g07690D                                          120   2e-27   Brassica napus [oilseed rape]
ref|XP_009108103.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    120   2e-27   Brassica rapa
ref|XP_002890950.1|  hypothetical protein ARALYDRAFT_473366             120   2e-27   
ref|XP_006833025.1|  hypothetical protein AMTR_s00094p00091950          112   2e-27   
ref|XP_008450166.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    120   2e-27   Cucumis melo [Oriental melon]
emb|CDY12360.1|  BnaC08g08450D                                          120   2e-27   Brassica napus [oilseed rape]
ref|XP_003552430.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    120   2e-27   Glycine max [soybeans]
ref|XP_004302135.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    120   2e-27   Fragaria vesca subsp. vesca
emb|CBI17673.3|  unnamed protein product                                120   3e-27   Vitis vinifera
ref|XP_006829190.1|  hypothetical protein AMTR_s00001p00271310          119   4e-27   Amborella trichopoda
ref|NP_001234049.1|  cytochrome P450-type monooxygenase 97A29           119   4e-27   Solanum lycopersicum
ref|XP_010245680.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    119   4e-27   Nelumbo nucifera [Indian lotus]
ref|XP_002279984.3|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    120   4e-27   Vitis vinifera
ref|XP_010245679.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    119   4e-27   Nelumbo nucifera [Indian lotus]
gb|KDP23307.1|  hypothetical protein JCGZ_23140                         119   5e-27   Jatropha curcas
ref|XP_006830626.1|  hypothetical protein AMTR_s00120p00092320          119   6e-27   
ref|XP_001783943.1|  predicted protein                                  118   7e-27   
ref|XP_006415302.1|  hypothetical protein EUTSA_v10007138mg             118   9e-27   Eutrema salsugineum [saltwater cress]
ref|XP_001698892.1|  cytochrome P450, carotenoid hydroxylase            119   1e-26   Chlamydomonas reinhardtii
ref|XP_010070132.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    118   1e-26   Eucalyptus grandis [rose gum]
ref|XP_007139751.1|  hypothetical protein PHAVU_008G056400g             118   1e-26   Phaseolus vulgaris [French bean]
ref|XP_009802494.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    118   1e-26   Nicotiana sylvestris
ref|XP_006340502.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    118   1e-26   
ref|XP_010111039.1|  Protein LUTEIN DEFICIENT 5                         117   2e-26   
ref|XP_005652354.1|  cytochrome P450                                    116   2e-26   
gb|EPS59936.1|  hypothetical protein M569_14868                         117   2e-26   
gb|AAG50718.1|AC079041_11  cytochrome P450, putative                    117   3e-26   
gb|EMS64313.1|  Cytochrome P450 97B2, chloroplastic                     116   3e-26   
ref|NP_564384.1|  protein LUTEIN DEFICIENT 5                            117   3e-26   
ref|XP_009346815.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    117   3e-26   
ref|XP_009627106.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    117   3e-26   
ref|XP_009346816.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    116   3e-26   
ref|XP_010499724.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    116   4e-26   
gb|ABC59096.1|  cytochrome P450 monooxygenase CYP97C10                  116   4e-26   
ref|XP_006304811.1|  hypothetical protein CARUB_v10012441mg             116   4e-26   
gb|ABC59110.1|  cytochrome P450 monooxygenase CYP97A10                  115   4e-26   
ref|XP_007029434.1|  Cytochrome P450, family 97, subfamily A, pol...    116   4e-26   
ref|XP_008646433.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    117   4e-26   
ref|XP_007029436.1|  Cytochrome P450, family 97, subfamily A, pol...    116   5e-26   
gb|KFK44941.1|  hypothetical protein AALP_AA1G322700                    116   5e-26   
ref|XP_007029435.1|  Cytochrome P450 97B2 isoform 2                     116   6e-26   
gb|EMT31539.1|  Cytochrome P450 97B2                                    116   6e-26   
ref|XP_008388780.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    116   6e-26   
ref|XP_010907644.1|  PREDICTED: carotene epsilon-monooxygenase, c...    115   6e-26   
ref|XP_008388781.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    116   7e-26   
ref|NP_001048526.1|  Os02g0817900                                       116   8e-26   
ref|XP_004954387.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    116   9e-26   
gb|EEE58048.1|  hypothetical protein OsJ_08883                          115   9e-26   
ref|XP_009337972.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    116   9e-26   
ref|XP_009337974.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    116   9e-26   
ref|XP_010461000.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    115   9e-26   
gb|EEC74248.1|  hypothetical protein OsI_09455                          115   1e-25   
ref|XP_008364063.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    115   1e-25   
ref|XP_010478597.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    115   1e-25   
gb|EMS57431.1|  Cytochrome P450 97B2, chloroplastic                     114   1e-25   
ref|XP_004492816.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    115   1e-25   
ref|XP_007513609.1|  predicted protein                                  115   1e-25   
gb|EYU39507.1|  hypothetical protein MIMGU_mgv1a003045mg                115   1e-25   
gb|KJB82186.1|  hypothetical protein B456_013G180200                    115   1e-25   
ref|XP_010540722.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    115   1e-25   
ref|XP_001781608.1|  predicted protein                                  115   1e-25   
ref|XP_008370918.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    113   2e-25   
gb|KJB82185.1|  hypothetical protein B456_013G180200                    115   2e-25   
gb|KJB82184.1|  hypothetical protein B456_013G180200                    114   2e-25   
ref|XP_011077088.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    114   2e-25   
ref|XP_003624118.1|  Cytochrome P450                                    114   3e-25   
ref|XP_003570402.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    114   3e-25   
emb|CDP04239.1|  unnamed protein product                                114   3e-25   
gb|AIX87503.1|  P450 carotenoid beta-ring hydroxylase                   114   3e-25   
gb|AES80336.2|  cytochrome P450 family monooxygenase                    114   4e-25   
ref|XP_010264030.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    114   5e-25   
gb|AFU10536.1|  chloroplast cytochrome P450 monooxygenase 97A3          113   6e-25   
gb|AIX87527.1|  P450 carotenoid beta-ring hydroxylase                   112   9e-25   
ref|XP_011013175.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    112   1e-24   
ref|XP_009386597.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    112   1e-24   
ref|XP_002454784.1|  hypothetical protein SORBIDRAFT_04g037300          111   4e-24   
ref|XP_008789534.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    111   5e-24   
gb|AEQ20873.1|  epsilon-carotene hydroxylase                            102   7e-24   
ref|XP_010940645.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...    108   3e-23   
ref|XP_009341091.1|  PREDICTED: LOW QUALITY PROTEIN: carotene eps...    105   1e-22   
emb|CEF99083.1|  Cytochrome P450, conserved site                        101   8e-21   
ref|WP_015803319.1|  cytochrome P450                                  99.0    2e-20   
ref|XP_001419574.1|  predicted protein                                  100   2e-20   
gb|KJB82188.1|  hypothetical protein B456_013G180200                  97.1    3e-19   
gb|EYU39508.1|  hypothetical protein MIMGU_mgv1a003045mg              96.3    5e-19   
gb|EJK60667.1|  hypothetical protein THAOC_18940                      89.7    5e-19   
ref|XP_007510564.1|  predicted protein                                96.3    5e-19   
dbj|BAJ91518.1|  predicted protein                                    95.9    7e-19   
gb|KIZ06958.1|  hypothetical protein MNEG_0987                        89.7    2e-18   
ref|XP_010019089.1|  PREDICTED: cytochrome P450 4V2-like              90.1    3e-18   
ref|XP_002506185.1|  predicted protein                                93.6    4e-18   
ref|XP_003056711.1|  predicted protein                                93.2    6e-18   
ref|XP_009582591.1|  PREDICTED: cytochrome P450 4V2-like              89.4    6e-18   
ref|WP_037979442.1|  cytochrome P450                                  92.0    8e-18   
gb|EMC80620.1|  Cytochrome P450 4V2                                   90.5    8e-18   
ref|XP_003763211.1|  PREDICTED: cytochrome P450 3A5-like              90.5    9e-18   
ref|XP_009867596.1|  PREDICTED: cytochrome P450 4V2-like              88.6    9e-18   
ref|WP_009154628.1|  cytochrome P450                                  91.7    1e-17   
ref|XP_001959879.1|  GF11817                                          92.0    1e-17   
ref|WP_035290705.1|  hypothetical protein                             90.5    1e-17   
ref|XP_011412813.1|  PREDICTED: cytochrome P450 4F22-like             91.3    2e-17   
ref|WP_035868092.1|  cytochrome P450                                  90.9    2e-17   
ref|WP_013020288.1|  cytochrome P450                                  90.9    2e-17   
ref|WP_037968823.1|  cytochrome P450                                  90.9    2e-17   
ref|XP_010172881.1|  PREDICTED: cytochrome P450 4V2                   91.3    2e-17   
gb|KFZ48513.1|  Cytochrome P450 4V2                                   91.3    2e-17   
ref|WP_033201907.1|  cytochrome P450                                  90.5    2e-17   
ref|XP_003205823.1|  PREDICTED: cytochrome P450 4V2                   91.3    2e-17   
ref|XP_006263919.1|  PREDICTED: cytochrome P450 4B1-like              86.3    2e-17   
ref|WP_026672938.1|  hypothetical protein                             90.5    3e-17   
ref|WP_015152944.1|  cytochrome P450                                  90.5    3e-17   
gb|ABA27087.1|  TO103-3                                               84.7    3e-17   
gb|EWC58123.1|  cytochrome P450                                       90.1    3e-17   
ref|NP_001001879.1|  cytochrome P450, family 4, subfamily V, poly...  90.9    3e-17   
ref|WP_016546059.1|  cytochrome P450                                  90.1    3e-17   
ref|WP_043466649.1|  cytochrome P450                                  90.1    3e-17   
ref|XP_005500270.1|  PREDICTED: cytochrome P450 4V2-like isoform X2   90.1    3e-17   
ref|XP_010209107.1|  PREDICTED: cytochrome P450 4V2                   90.5    3e-17   
ref|XP_009960179.1|  PREDICTED: cytochrome P450 4V2                   90.5    3e-17   
gb|KFP28925.1|  Cytochrome P450 4V2                                   90.5    3e-17   
gb|KFQ05492.1|  Cytochrome P450 4V2                                   90.5    4e-17   
dbj|BAP54527.1|  cytochrome P450                                      89.7    4e-17   
ref|NP_610473.1|  Cyp4p3                                              90.1    4e-17   
ref|WP_042816376.1|  cytochrome P450                                  89.0    8e-17   
ref|WP_040006741.1|  cytochrome P450                                  89.0    8e-17   
emb|CCH55669.1|  cyc2                                                 89.0    9e-17   
ref|XP_005500269.1|  PREDICTED: cytochrome P450 4V2-like isoform X1   89.4    9e-17   
ref|WP_018618424.1|  cytochrome P450                                  89.0    9e-17   
ref|WP_019943955.1|  cytochrome P450                                  88.6    9e-17   
ref|XP_009981146.1|  PREDICTED: cytochrome P450 4V2                   89.0    9e-17   
gb|KFQ40732.1|  Cytochrome P450 4V2                                   89.4    1e-16   
ref|WP_026308546.1|  cytochrome P450                                  88.6    1e-16   
ref|XP_010190788.1|  PREDICTED: cytochrome P450 4V2                   89.0    1e-16   
gb|KFQ59985.1|  Cytochrome P450 4V2                                   87.0    1e-16   
ref|WP_006975851.1|  cytochrome P450 family protein                   88.6    1e-16   
gb|KFV58947.1|  Cytochrome P450 4V2                                   89.0    1e-16   
ref|XP_009478507.1|  PREDICTED: cytochrome P450 4V2-like              86.7    1e-16   
ref|XP_009816577.1|  PREDICTED: cytochrome P450 4V2                   89.0    1e-16   
ref|XP_009563950.1|  PREDICTED: cytochrome P450 4V2                   89.0    1e-16   
gb|KFO79690.1|  Cytochrome P450 4V2                                   89.0    1e-16   
ref|XP_010080484.1|  PREDICTED: thromboxane-A synthase-like           84.0    1e-16   
ref|WP_005040564.1|  cytochrome P450                                  86.7    1e-16   
ref|XP_010290117.1|  PREDICTED: cytochrome P450 4V2                   88.6    1e-16   
gb|KFV14223.1|  Thromboxane-A synthase                                83.6    1e-16   
gb|KFQ79651.1|  Cytochrome P450 4V2                                   88.6    1e-16   
gb|KFQ43026.1|  Thromboxane-A synthase                                84.3    2e-16   
ref|XP_005243199.1|  PREDICTED: cytochrome P450 4V2-like              88.6    2e-16   
gb|EAU67465.1|  cytochrome P450 4A5                                   87.0    2e-16   
ref|WP_019989847.1|  cytochrome P450                                  87.8    2e-16   
ref|XP_002138545.1|  GA24833                                          88.2    2e-16   
ref|XP_002408834.1|  cytochrome P450, putative                        85.5    2e-16   
ref|XP_009328930.1|  PREDICTED: cytochrome P450 4V2                   88.2    2e-16   
ref|XP_006015961.1|  PREDICTED: cytochrome P450 4V2-like              87.8    2e-16   
ref|XP_009924714.1|  PREDICTED: cytochrome P450 4V2                   85.9    2e-16   
gb|KFW71810.1|  Cytochrome P450 4V2                                   88.2    2e-16   
ref|WP_017949162.1|  cytochrome P450                                  87.8    2e-16   
ref|XP_007498482.1|  PREDICTED: cytochrome P450 3A24-like isoform X2  87.0    3e-16   
ref|XP_009473113.1|  PREDICTED: cytochrome P450 4V2                   87.8    3e-16   
ref|WP_031075083.1|  cytochrome P450                                  87.8    3e-16   
ref|WP_037839946.1|  cytochrome P450                                  87.8    3e-16   
ref|XP_009275655.1|  PREDICTED: cytochrome P450 4V2                   87.8    3e-16   
gb|AFW58030.1|  putative cytochrome P450 superfamily protein          87.8    3e-16   
ref|XP_003081246.1|  putative cytochrome P450 monooxygenase (ISS)     88.2    3e-16   
gb|KFV96946.1|  Cytochrome P450 4V2                                   87.8    3e-16   
ref|XP_006274266.1|  PREDICTED: cytochrome P450 4V2-like              87.8    3e-16   
gb|KFM06228.1|  Cytochrome P450 4V2                                   87.8    3e-16   
ref|XP_010147968.1|  PREDICTED: cytochrome P450 4V2                   87.8    3e-16   
gb|KFR08758.1|  Cytochrome P450 4V2                                   87.8    3e-16   
ref|XP_009900520.1|  PREDICTED: cytochrome P450 4V2                   87.8    3e-16   
ref|XP_008946210.1|  PREDICTED: cytochrome P450 4V2                   87.8    3e-16   
gb|KFV68658.1|  Cytochrome P450 4V2                                   87.8    3e-16   
ref|WP_031168551.1|  cytochrome P450                                  87.0    3e-16   
ref|WP_020161050.1|  MULTISPECIES: cytochrome P450                    87.0    3e-16   
gb|ACZ89696.1|  cytochrome P450 family protein                        87.4    3e-16   
ref|XP_010298276.1|  PREDICTED: cytochrome P450 4V2                   87.4    3e-16   
gb|KFO04478.1|  Cytochrome P450 4V2                                   87.4    4e-16   
gb|KFV42202.1|  Cytochrome P450 4V2                                   87.4    4e-16   
ref|WP_043653476.1|  cytochrome P450                                  87.0    4e-16   
ref|XP_004452069.1|  PREDICTED: cytochrome P450 3A29-like isoform 1   87.4    4e-16   
gb|AGT57865.1|  cytochrome P450 4aa1                                  84.0    4e-16   
ref|XP_009962626.1|  PREDICTED: cytochrome P450 4V2                   87.4    4e-16   
ref|XP_005149111.1|  PREDICTED: cytochrome P450 4V2-like              87.4    4e-16   
ref|XP_008490073.1|  PREDICTED: cytochrome P450 4V2                   87.4    4e-16   
ref|WP_033267262.1|  cytochrome P450                                  87.0    4e-16   
ref|XP_009081963.1|  PREDICTED: cytochrome P450 4V2                   87.4    4e-16   
ref|WP_013374206.1|  cytochrome P450                                  86.7    5e-16   
ref|XP_009640714.1|  PREDICTED: cytochrome P450 4V2                   87.0    5e-16   
ref|XP_010000770.1|  PREDICTED: cytochrome P450 4V2                   87.0    5e-16   
ref|XP_003801475.1|  PREDICTED: cytochrome P450 4X1-like              87.0    5e-16   
gb|KFP18953.1|  Cytochrome P450 4V2                                   87.0    5e-16   
ref|NP_001073465.1|  cytochrome P450, family 4, subfamily V, poly...  87.0    5e-16   
gb|EID75083.1|  cytochrome P450                                       86.7    5e-16   
ref|WP_002703072.1|  cytochrome P450 family protein                   86.7    5e-16   
dbj|BAH55628.1|  cytochrome P450                                      86.7    6e-16   
ref|XP_008923000.1|  PREDICTED: cytochrome P450 4V2                   87.0    6e-16   
gb|KFW81676.1|  Cytochrome P450 4V2                                   87.0    6e-16   
ref|WP_039952671.1|  MULTISPECIES: cytochrome P450                    86.7    6e-16   
ref|XP_009938493.1|  PREDICTED: cytochrome P450 4V2 isoform X2        87.0    6e-16   
ref|WP_006078525.1|  cytochrome P450                                  85.1    6e-16   
gb|KFA88208.1|  cytochrome P450                                       86.3    6e-16   
ref|XP_009938492.1|  PREDICTED: cytochrome P450 4V2 isoform X1        86.7    7e-16   
gb|KFQ21330.1|  Cytochrome P450 4V2                                   86.7    7e-16   
gb|KFV82217.1|  Cytochrome P450 4V2                                   86.7    7e-16   
ref|XP_006015877.1|  PREDICTED: cytochrome P450 4A12A-like            85.9    7e-16   
ref|XP_010399874.1|  PREDICTED: cytochrome P450 4V2 isoform X4        86.7    7e-16   
ref|XP_002033066.1|  GM21113                                          86.7    7e-16   
ref|XP_009675001.1|  PREDICTED: cytochrome P450 4V2                   86.7    7e-16   
ref|WP_043194054.1|  cytochrome P450                                  86.3    7e-16   
ref|XP_007498481.1|  PREDICTED: cytochrome P450 3A24-like isoform X1  86.3    8e-16   
ref|WP_031155589.1|  cytochrome P450                                  86.3    8e-16   
ref|XP_010399871.1|  PREDICTED: cytochrome P450 4V2 isoform X2        86.3    9e-16   
ref|XP_010399870.1|  PREDICTED: cytochrome P450 4V2 isoform X1        86.3    9e-16   
gb|KFO65043.1|  Cytochrome P450 4V2                                   86.3    9e-16   
ref|WP_033096672.1|  cytochrome P450                                  85.9    9e-16   
ref|WP_030265702.1|  cytochrome P450                                  85.9    9e-16   
ref|XP_005045213.1|  PREDICTED: cytochrome P450 4V2-like              86.3    9e-16   
ref|WP_043409540.1|  cytochrome P450                                  85.9    9e-16   
ref|XP_010399873.1|  PREDICTED: cytochrome P450 4V2 isoform X3        86.3    1e-15   
ref|WP_039587214.1|  cytochrome P450                                  85.9    1e-15   
ref|WP_024100881.1|  cytochrome P450                                  85.9    1e-15   
ref|XP_008639675.1|  PREDICTED: cytochrome P450 4V2                   86.3    1e-15   
ref|WP_015163087.1|  cytochrome P450                                  85.9    1e-15   
ref|WP_030217492.1|  cytochrome P450                                  85.9    1e-15   
ref|WP_036452601.1|  cytochrome P450                                  85.9    1e-15   
ref|WP_011727218.1|  cytochrome P450                                  85.9    1e-15   
ref|WP_028184984.1|  cytochrome P450                                  85.5    1e-15   
gb|ELQ91665.1|  cytochrome P450                                       85.9    1e-15   
ref|XP_002018192.1|  GL17580                                          85.9    1e-15   
ref|WP_024755714.1|  cytochrome P450                                  85.5    1e-15   
ref|WP_030027329.1|  cytochrome P450                                  85.5    1e-15   
ref|XP_005009034.1|  PREDICTED: cytochrome P450 4V2-like              85.9    1e-15   
ref|WP_018810455.1|  cytochrome P450                                  85.5    1e-15   
ref|XP_002191071.1|  PREDICTED: cytochrome P450 4V2-like              85.5    1e-15   
ref|WP_018219304.1|  cytochrome P450                                  85.5    1e-15   
ref|WP_007457480.1|  cytochrome P450                                  85.5    1e-15   
gb|KGL73289.1|  Cytochrome P450 4V2                                   85.9    1e-15   
ref|XP_003507508.2|  PREDICTED: cytochrome P450 4V2 isoform X1        82.8    1e-15   
ref|XP_005517737.1|  PREDICTED: cytochrome P450 4V2-like              85.9    1e-15   
ref|XP_010142523.1|  PREDICTED: cytochrome P450 4V2                   85.9    1e-15   
gb|KFO84157.1|  Cytochrome P450 4V2                                   85.5    2e-15   
ref|WP_036255934.1|  hypothetical protein                             85.1    2e-15   
ref|WP_010986516.1|  cytochrome P450                                  85.5    2e-15   
ref|WP_018465663.1|  hypothetical protein                             85.1    2e-15   



>gb|EYU42831.1| hypothetical protein MIMGU_mgv1a003489mg [Erythranthe guttata]
Length=582

 Score =   295 bits (754),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL+PD+LPGGYNGDKDGY+IPAG+DIFISVYNLHRSPYFWD PN+FEPERFQV+K S
Sbjct  427  IRRSLKPDKLPGGYNGDKDGYSIPAGSDIFISVYNLHRSPYFWDNPNDFEPERFQVQKSS  486

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            E+EGWAGFDPSRSPGALYPNE+ISDFAFLPFGGGPRKCVGDQFALMES +ALAMLLQKFD
Sbjct  487  EVEGWAGFDPSRSPGALYPNEVISDFAFLPFGGGPRKCVGDQFALMESTVALAMLLQKFD  546

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            ++L+G+P+SV+LVTGATIHTKNGLWC+L+KR
Sbjct  547  VNLRGSPDSVELVTGATIHTKNGLWCQLRKR  577



>ref|XP_009612399.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Nicotiana 
tomentosiformis]
Length=546

 Score =   292 bits (748),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL+ D+LPGGYNGDKDGY IPAGTD+F+SVYNLHRSPYFWDKPNEFEPERF V KES
Sbjct  393  IRRSLKSDKLPGGYNGDKDGYEIPAGTDVFLSVYNLHRSPYFWDKPNEFEPERFLVPKES  452

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
             IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES IALAMLLQKFD
Sbjct  453  SIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLLQKFD  512

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            ++L+G+PESV+LVTGATIHTK GLWCKLKKR
Sbjct  513  VELRGSPESVELVTGATIHTKTGLWCKLKKR  543



>ref|XP_009612398.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Nicotiana 
tomentosiformis]
Length=582

 Score =   293 bits (749),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL+ D+LPGGYNGDKDGY IPAGTD+F+SVYNLHRSPYFWDKPNEFEPERF V KES
Sbjct  429  IRRSLKSDKLPGGYNGDKDGYEIPAGTDVFLSVYNLHRSPYFWDKPNEFEPERFLVPKES  488

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
             IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES IALAMLLQKFD
Sbjct  489  SIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLLQKFD  548

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            ++L+G+PESV+LVTGATIHTK GLWCKLKKR
Sbjct  549  VELRGSPESVELVTGATIHTKTGLWCKLKKR  579



>ref|XP_009784852.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X3 [Nicotiana 
sylvestris]
Length=548

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL+ D+LPGGYNGDKDGY IPAGTD+F+SVYNLHRSPY WDKPNEFEPERF V KES
Sbjct  395  IRRSLKSDKLPGGYNGDKDGYEIPAGTDVFLSVYNLHRSPYLWDKPNEFEPERFLVPKES  454

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
             IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES IALAMLLQKFD
Sbjct  455  SIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLLQKFD  514

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
            ++L+G+PESV+LVTGATIHTK GLWCKLKKR +V
Sbjct  515  VELRGSPESVELVTGATIHTKTGLWCKLKKRSNV  548



>ref|XP_009784851.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Nicotiana 
sylvestris]
Length=574

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL+ D+LPGGYNGDKDGY IPAGTD+F+SVYNLHRSPY WDKPNEFEPERF V KES
Sbjct  421  IRRSLKSDKLPGGYNGDKDGYEIPAGTDVFLSVYNLHRSPYLWDKPNEFEPERFLVPKES  480

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
             IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES IALAMLLQKFD
Sbjct  481  SIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLLQKFD  540

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
            ++L+G+PESV+LVTGATIHTK GLWCKLKKR +V
Sbjct  541  VELRGSPESVELVTGATIHTKTGLWCKLKKRSNV  574



>ref|XP_009784850.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Nicotiana 
sylvestris]
Length=584

 Score =   291 bits (746),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL+ D+LPGGYNGDKDGY IPAGTD+F+SVYNLHRSPY WDKPNEFEPERF V KES
Sbjct  431  IRRSLKSDKLPGGYNGDKDGYEIPAGTDVFLSVYNLHRSPYLWDKPNEFEPERFLVPKES  490

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
             IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES IALAMLLQKFD
Sbjct  491  SIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLLQKFD  550

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
            ++L+G+PESV+LVTGATIHTK GLWCKLKKR +V
Sbjct  551  VELRGSPESVELVTGATIHTKTGLWCKLKKRSNV  584



>gb|AJD25227.1| cytochrome P450 CYP97B34 [Salvia miltiorrhiza]
Length=582

 Score =   289 bits (739),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL+PD+LPGGYNGD+DGY+IPAGTD+FISVYNLHRSPYFWD PN+FEPERFQV+K S
Sbjct  427  IRRSLKPDRLPGGYNGDEDGYSIPAGTDLFISVYNLHRSPYFWDNPNDFEPERFQVQKPS  486

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            +++GWAGFDPSRSPGALYPNEII+DFAFLPFGGGPRKCVGDQFALMES +ALA LLQKFD
Sbjct  487  QVDGWAGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCVGDQFALMESTVALAALLQKFD  546

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  297
            ++L+G+PESV+LVTGATIHTK+G+WC+LKKRL
Sbjct  547  VNLRGSPESVELVTGATIHTKSGMWCQLKKRL  578



>ref|XP_006354415.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Solanum 
tuberosum]
Length=573

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 145/155 (94%), Gaps = 1/155 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL  D LPGGYNGDK+GY IPAGTD+F+SVYNLHRSPYFWDKPNEFEPERF V+KES
Sbjct  419  IRRSLTSDILPGGYNGDKNGYEIPAGTDVFLSVYNLHRSPYFWDKPNEFEPERFLVQKES  478

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            + IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES IALAMLLQKF
Sbjct  479  QGIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLLQKF  538

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
            D++LKG+PE V+LVTGATIHTK GLWCKLKKR +V
Sbjct  539  DVELKGSPEDVELVTGATIHTKTGLWCKLKKRSNV  573



>ref|XP_009347871.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Pyrus x bretschneideri]
Length=577

 Score =   287 bits (734),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL+PD+LPGGYNG KDGYA+PAGTD+FISVYNLHRSPYFWD PNEFEPERF V K+S
Sbjct  423  IRRSLKPDKLPGGYNGAKDGYAVPAGTDLFISVYNLHRSPYFWDNPNEFEPERFLVEKKS  482

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
             +EGWAGFDPSRSPGALYPNEII+DFAFLPFGGGPRKCVGDQFALMES +ALAMLLQKF 
Sbjct  483  HVEGWAGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCVGDQFALMESTVALAMLLQKFT  542

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
            ++LKG+P+SV+ VTGAT+HTKNGLWCKL+KR D+
Sbjct  543  VELKGSPDSVEQVTGATLHTKNGLWCKLQKRSDI  576



>ref|XP_008342307.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Malus domestica]
Length=577

 Score =   286 bits (733),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL+PD+LPGGYNG KDGYA+PAGTD+FISVYNLHRSPYFWD PNEFEPERF V K+S
Sbjct  423  IRRSLKPDKLPGGYNGAKDGYAVPAGTDLFISVYNLHRSPYFWDNPNEFEPERFLVEKKS  482

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
             +EGWAGFDPSRSPGALYPNEII+DFAFLPFGGGPRKCVGDQFALMES +ALAMLLQKF 
Sbjct  483  HVEGWAGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCVGDQFALMESTVALAMLLQKFT  542

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
            ++LKG+P+SV+ VTGAT+HTKNGLWCKL+KR D+
Sbjct  543  VELKGSPDSVEQVTGATLHTKNGLWCKLQKRSDI  576



>ref|XP_010321037.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Solanum 
lycopersicum]
Length=573

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL  D LPGGYNGDK+GY IPAGTD+F+SVYNLHRSPYFWDKPNEFEPERF V+KES
Sbjct  419  IRRSLTSDILPGGYNGDKNGYEIPAGTDVFLSVYNLHRSPYFWDKPNEFEPERFLVQKES  478

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            + IEGW GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES IALAMLLQKF
Sbjct  479  QGIEGWGGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLLQKF  538

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
            D++LKG+PE V+LVTGATIHTK GLWCKLKKR ++
Sbjct  539  DVELKGSPEDVELVTGATIHTKTGLWCKLKKRSNI  573



>ref|XP_004239253.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Solanum 
lycopersicum]
Length=578

 Score =   284 bits (727),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL  D LPGGYNGDK+GY IPAGTD+F+SVYNLHRSPYFWDKPNEFEPERF V+KES
Sbjct  424  IRRSLTSDILPGGYNGDKNGYEIPAGTDVFLSVYNLHRSPYFWDKPNEFEPERFLVQKES  483

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            + IEGW GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES IALAMLLQKF
Sbjct  484  QGIEGWGGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLLQKF  543

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
            D++LKG+PE V+LVTGATIHTK GLWCKLKKR ++
Sbjct  544  DVELKGSPEDVELVTGATIHTKTGLWCKLKKRSNI  578



>ref|XP_010093134.1| Cytochrome P450 [Morus notabilis]
 gb|EXB53586.1| Cytochrome P450 [Morus notabilis]
Length=581

 Score =   284 bits (727),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL+ D+LPGGYNGDK+GY IP GTDIFISVYNLHRSPYFWD+PNEFEPERF V K+ 
Sbjct  426  IRRSLKSDKLPGGYNGDKNGYEIPVGTDIFISVYNLHRSPYFWDRPNEFEPERFLVEKKG  485

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            E IEGW GFDPSRSPGALYPNEIISDF+FLPFGGGPRKCVGDQFALMES +ALAMLLQKF
Sbjct  486  ECIEGWDGFDPSRSPGALYPNEIISDFSFLPFGGGPRKCVGDQFALMESTVALAMLLQKF  545

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
            D++LKG+PESV+LVTGATIHTKNGLWCKL+KR  V
Sbjct  546  DVELKGSPESVELVTGATIHTKNGLWCKLRKRSHV  580



>ref|XP_002308766.1| hypothetical protein POPTR_0006s00800g [Populus trichocarpa]
 gb|EEE92289.1| hypothetical protein POPTR_0006s00800g [Populus trichocarpa]
Length=579

 Score =   284 bits (726),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL+PD LPGGY GDKDGYAIPAGTDIF+SVYNLHRSPYFWD PNEFEPERF V + +
Sbjct  424  IRRSLKPDVLPGGYKGDKDGYAIPAGTDIFVSVYNLHRSPYFWDNPNEFEPERFLVTRNN  483

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            + IEGW+GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES IAL +LLQKF
Sbjct  484  DGIEGWSGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALTLLLQKF  543

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
            D++L+G+PE V+LVTGATIHTKNGLWC+LKKR DV
Sbjct  544  DVELRGSPEEVELVTGATIHTKNGLWCRLKKRSDV  578



>ref|XP_011100398.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Sesamum indicum]
Length=577

 Score =   284 bits (726),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL  D LPGGYNG+KDGYAIP GTD+F+SVYNLHRSP+FWD PN+FEPERF ++K S
Sbjct  423  IRRSLMSDTLPGGYNGNKDGYAIPPGTDLFVSVYNLHRSPHFWDNPNDFEPERFLMQKLS  482

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES IALAMLLQKFD
Sbjct  483  QLEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLLQKFD  542

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            + LKG+PESV+LVTGATIHTKNGLWC+LKKR
Sbjct  543  VSLKGSPESVELVTGATIHTKNGLWCQLKKR  573



>ref|XP_007158591.1| hypothetical protein PHAVU_002G165400g [Phaseolus vulgaris]
 gb|ESW30585.1| hypothetical protein PHAVU_002G165400g [Phaseolus vulgaris]
Length=576

 Score =   283 bits (725),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KE  576
            IRRSL+ D LPGG+ GDKDGYAIPAGTD+FISVYNLHRSPYFWD+P+EFEPERF V+ K 
Sbjct  421  IRRSLKSDVLPGGHKGDKDGYAIPAGTDLFISVYNLHRSPYFWDRPHEFEPERFLVQNKN  480

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
             EIEGW+GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES +AL MLLQ F
Sbjct  481  EEIEGWSGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALTMLLQNF  540

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
            D++LKGTPESV+LVTGATIHTKNGLWCKLKKR D+
Sbjct  541  DVELKGTPESVELVTGATIHTKNGLWCKLKKRSDL  575



>ref|XP_002520583.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF41816.1| cytochrome P450, putative [Ricinus communis]
Length=555

 Score =   282 bits (722),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 143/155 (92%), Gaps = 1/155 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQV-RKE  576
            IRR+L+ D LPGGY GD +GYAIP GTDIFISVYNLHRSPYFW+ PNEFEPERF V RK 
Sbjct  400  IRRALKTDVLPGGYKGDNNGYAIPEGTDIFISVYNLHRSPYFWNSPNEFEPERFLVQRKS  459

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
             EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES +ALAMLLQKF
Sbjct  460  DEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALAMLLQKF  519

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
            D++LKG+PESV+LVTGATIHTKNGLWCKLKKR +V
Sbjct  520  DVELKGSPESVELVTGATIHTKNGLWCKLKKRSNV  554



>ref|XP_004147731.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Cucumis 
sativus]
 gb|KGN53488.1| hypothetical protein Csa_4G056760 [Cucumis sativus]
Length=580

 Score =   283 bits (724),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 146/155 (94%), Gaps = 1/155 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L+PD LPGGYNGDK+GYAIPAGTDIFISVYNLHRSPYFW+ P EFEPERFQV++ S
Sbjct  425  IRRALKPDTLPGGYNGDKNGYAIPAGTDIFISVYNLHRSPYFWENPQEFEPERFQVKRAS  484

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            E IEGW GFDPSRSPGALYPNEI+SDF+FLPFGGGPRKCVGDQFALMES IALAMLLQKF
Sbjct  485  EGIEGWDGFDPSRSPGALYPNEIVSDFSFLPFGGGPRKCVGDQFALMESTIALAMLLQKF  544

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
            D++L+G+PESV+LVTGATIHTK+GLWCKL++R  V
Sbjct  545  DVELRGSPESVELVTGATIHTKSGLWCKLRRRSQV  579



>ref|XP_004164429.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Cucumis 
sativus]
Length=580

 Score =   281 bits (720),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 146/155 (94%), Gaps = 1/155 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L+PD LPGGYNGDK+GYAIPAGTDIFISVYNLHRSPYFW+ P EFEPERFQV++ S
Sbjct  425  IRRALKPDTLPGGYNGDKNGYAIPAGTDIFISVYNLHRSPYFWENPQEFEPERFQVKRAS  484

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            E IEGW GFDPSRSPGALYPNEI+SDF+FLPFGGGPRKCVGDQFALMES IALA+LLQKF
Sbjct  485  EGIEGWDGFDPSRSPGALYPNEIVSDFSFLPFGGGPRKCVGDQFALMESTIALALLLQKF  544

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
            D++L+G+PESV+LVTGATIHTK+GLWCKL++R  V
Sbjct  545  DVELRGSPESVELVTGATIHTKSGLWCKLRRRSQV  579



>gb|KEH27406.1| cytochrome P450 family 97 protein [Medicago truncatula]
Length=426

 Score =   277 bits (708),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 139/152 (91%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KE  576
            IRRSL+ D LPGG+ GDKDGY IPAGTD+FISVYNLHRSPYFWD+P++FEPERF V  K 
Sbjct  271  IRRSLKSDVLPGGHKGDKDGYTIPAGTDVFISVYNLHRSPYFWDRPDDFEPERFLVENKN  330

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
             EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES +AL MLLQ F
Sbjct  331  EEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALTMLLQNF  390

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++LKGTPESV+LVTGATIHTKNGLWC L+KR
Sbjct  391  DVELKGTPESVELVTGATIHTKNGLWCNLRKR  422



>ref|XP_007215027.1| hypothetical protein PRUPE_ppa003405mg [Prunus persica]
 gb|EMJ16226.1| hypothetical protein PRUPE_ppa003405mg [Prunus persica]
Length=577

 Score =   281 bits (720),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            +RRSL+ D LPGGYNG+KDGY IPAGTDIF+SVYNLHRSPYFWD PNEFEPERF V K+S
Sbjct  423  VRRSLKSDTLPGGYNGEKDGYVIPAGTDIFLSVYNLHRSPYFWDNPNEFEPERFLVPKKS  482

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            E+EGWAGFDPSR PGALYP+EI +DFAFLPFGGGPRKCVGDQFALMES +ALAMLLQKF 
Sbjct  483  EVEGWAGFDPSRIPGALYPSEITADFAFLPFGGGPRKCVGDQFALMESTVALAMLLQKFT  542

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
            ++LKG+PESV+ VTGATIHTKNGLWCKL+KR DV
Sbjct  543  VELKGSPESVEQVTGATIHTKNGLWCKLRKRSDV  576



>gb|KDP42786.1| hypothetical protein JCGZ_00485 [Jatropha curcas]
Length=583

 Score =   281 bits (718),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 140/152 (92%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQV-RKE  576
            IRR+L+ D LPGGY G KDGYAIP GTDIFISVYNLHRSPYFWD PNEFEPERF V RK 
Sbjct  432  IRRALKSDVLPGGYKGSKDGYAIPKGTDIFISVYNLHRSPYFWDLPNEFEPERFLVQRKS  491

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
             EIEGW GFDPSRSPGALYPNEII+DFAFLPFGGGPRKCVGDQFALMES +ALAMLLQKF
Sbjct  492  EEIEGWTGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCVGDQFALMESTVALAMLLQKF  551

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++LKG+PESV+LVTGATIHTKNGLWCKL+KR
Sbjct  552  DVELKGSPESVELVTGATIHTKNGLWCKLRKR  583



>ref|XP_008451892.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 97B2, chloroplastic 
[Cucumis melo]
Length=580

 Score =   281 bits (718),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 145/155 (94%), Gaps = 1/155 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L+PD LPGGYNGDK+GYAIPAGTDIFISVYNLHRSPYFW+ P EFEPERFQV++ S
Sbjct  425  IRRALKPDTLPGGYNGDKNGYAIPAGTDIFISVYNLHRSPYFWENPQEFEPERFQVKRAS  484

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            E IEGW GFDPSRSPGALYPNEI+SDF+FLPFGGGPRKCVGDQFALMES IALA LLQKF
Sbjct  485  EGIEGWDGFDPSRSPGALYPNEIVSDFSFLPFGGGPRKCVGDQFALMESTIALAXLLQKF  544

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
            D++L+G+PESV+LVTGATIHTK+GLWCKL++R  V
Sbjct  545  DVELRGSPESVELVTGATIHTKSGLWCKLRRRSQV  579



>ref|XP_010680161.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=574

 Score =   280 bits (717),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 142/155 (92%), Gaps = 1/155 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L+PD LPGGY G KDGY IP GTDIFISVYNLHRSPY WDKP+EFEPERF V ++S
Sbjct  419  IRRTLKPDLLPGGYKGQKDGYQIPTGTDIFISVYNLHRSPYLWDKPHEFEPERFLVERKS  478

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            E IEGW GFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES IALAMLLQKF
Sbjct  479  EDIEGWNGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLLQKF  538

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
            D+ LKG+P+SV+LVTGATIHTKNGLWCKL+KR +V
Sbjct  539  DVTLKGSPDSVELVTGATIHTKNGLWCKLRKRANV  573



>gb|KHG14945.1| Cytochrome P450, chloroplastic [Gossypium arboreum]
Length=576

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 143/152 (94%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L    LPGGY GDKDGY IPAGTDIFISVYNLHRSPYFWD+P++F PERFQV+KES
Sbjct  421  IRRALEEVVLPGGYKGDKDGYTIPAGTDIFISVYNLHRSPYFWDQPHDFVPERFQVQKES  480

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            E IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES +ALAMLLQKF
Sbjct  481  EGIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALAMLLQKF  540

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+G+PESV+LVTGATIHTKNGLWCKLK+R
Sbjct  541  DVELRGSPESVELVTGATIHTKNGLWCKLKRR  572



>ref|XP_011002376.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Populus euphratica]
Length=585

 Score =   280 bits (715),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 142/155 (92%), Gaps = 1/155 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL+PD LPGGY GDKDGYAI AGTDIF+SVYNLHRSPYFWD PNEFEPERF V + S
Sbjct  430  IRRSLKPDVLPGGYKGDKDGYAIRAGTDIFVSVYNLHRSPYFWDNPNEFEPERFLVTRNS  489

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            + IEGW+GFDPSRSPGALYPNE+ISDFAFLPFGGGPRKCVGDQFALMES  AL +LLQKF
Sbjct  490  DGIEGWSGFDPSRSPGALYPNEVISDFAFLPFGGGPRKCVGDQFALMESTTALTLLLQKF  549

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
            D++L+G+PE V+LVTGATIHTKNGLWC+LKKR DV
Sbjct  550  DVELRGSPEEVELVTGATIHTKNGLWCRLKKRSDV  584



>ref|XP_003610974.1| Cytochrome P450 [Medicago truncatula]
 gb|AES93932.1| cytochrome P450 family 97 protein [Medicago truncatula]
Length=574

 Score =   278 bits (710),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 139/152 (91%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KE  576
            IRRSL+ D LPGG+ GDKDGY IPAGTD+FISVYNLHRSPYFWD+P++FEPERF V  K 
Sbjct  419  IRRSLKSDVLPGGHKGDKDGYTIPAGTDVFISVYNLHRSPYFWDRPDDFEPERFLVENKN  478

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
             EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES +AL MLLQ F
Sbjct  479  EEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALTMLLQNF  538

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++LKGTPESV+LVTGATIHTKNGLWC L+KR
Sbjct  539  DVELKGTPESVELVTGATIHTKNGLWCNLRKR  570



>ref|XP_010044825.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Eucalyptus grandis]
 gb|KCW88536.1| hypothetical protein EUGRSUZ_A00911 [Eucalyptus grandis]
 gb|KCW88537.1| hypothetical protein EUGRSUZ_A00911 [Eucalyptus grandis]
 gb|KCW88538.1| hypothetical protein EUGRSUZ_A00911 [Eucalyptus grandis]
Length=584

 Score =   278 bits (710),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 145/154 (94%), Gaps = 1/154 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L+ DQLPGGY GDK+GYAIPAGTDIFISVYNLHRSPYFWD+P++FEPERF  +++S
Sbjct  427  IRRALKSDQLPGGYRGDKNGYAIPAGTDIFISVYNLHRSPYFWDRPSDFEPERFLTQRKS  486

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            E +EGWAGFDPSRSPGALYPNEI+SDFAFLPFGGGPRKCVGDQFALMES +ALAMLLQKF
Sbjct  487  EGVEGWAGFDPSRSPGALYPNEIVSDFAFLPFGGGPRKCVGDQFALMESTVALAMLLQKF  546

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLD  294
            D++LKG+ +SV+LVTGATIHTKNGLWC ++KR D
Sbjct  547  DVELKGSADSVELVTGATIHTKNGLWCNIRKRSD  580



>ref|XP_010313051.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 97B2, chloroplastic-like 
[Solanum lycopersicum]
Length=585

 Score =   278 bits (710),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 141/155 (91%), Gaps = 1/155 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL  D LPGGYNGDK+GY IPAGTD+F+SVYNLHRSPYFWDKPNEFEP RF V+KES
Sbjct  431  IRRSLTSDILPGGYNGDKNGYEIPAGTDVFLSVYNLHRSPYFWDKPNEFEPXRFLVQKES  490

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGW GFDPSRS GALYPNEIISDFAFLPFGGGPRKCVGDQFALMES IALAMLLQKF
Sbjct  491  RGIEGWGGFDPSRSRGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTIALAMLLQKF  550

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
            D++LKG+PE V+LVTGATIHTK GLWCKLKKR ++
Sbjct  551  DVELKGSPEDVELVTGATIHTKTGLWCKLKKRSNI  585



>gb|KJB10650.1| hypothetical protein B456_001G213800 [Gossypium raimondii]
Length=498

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 142/152 (93%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L    LPGGY GDKDGY IPAGTDIFISVYNLHRSPYFWD+P++F PERF+V+KES
Sbjct  343  IRRALEEVVLPGGYKGDKDGYTIPAGTDIFISVYNLHRSPYFWDQPHDFVPERFRVQKES  402

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            E IE WAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES +ALAMLLQKF
Sbjct  403  EGIEEWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALAMLLQKF  462

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+G+PESV+LVTGATIHTKNGLWCKLK+R
Sbjct  463  DVELRGSPESVELVTGATIHTKNGLWCKLKRR  494



>gb|KHN35086.1| Cytochrome P450 97B2, chloroplastic [Glycine soja]
Length=576

 Score =   277 bits (709),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 141/152 (93%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KE  576
            IRRSL+ D LPGG+ G+KDGYAIPAGTD+FISVYNLHRSPYFWD+P++FEPERF V+ K 
Sbjct  421  IRRSLKSDVLPGGHKGEKDGYAIPAGTDVFISVYNLHRSPYFWDRPDDFEPERFLVQNKN  480

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
             EIEGWAG DPSRSPGALYPNE+ISDFAFLPFGGGPRKCVGDQFALMES +AL MLLQ F
Sbjct  481  EEIEGWAGLDPSRSPGALYPNEVISDFAFLPFGGGPRKCVGDQFALMESTVALTMLLQNF  540

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++LKGTPESV+LVTGATIHTKNG+WC+LKKR
Sbjct  541  DVELKGTPESVELVTGATIHTKNGMWCRLKKR  572



>ref|NP_001235534.1| cytochrome P450 97B2, chloroplastic [Glycine max]
 sp|O48921.1|C97B2_SOYBN RecName: Full=Cytochrome P450 97B2, chloroplastic; Flags: Precursor 
[Glycine max]
 gb|AAB94586.1| CYP97B2p [Glycine max]
Length=576

 Score =   277 bits (708),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 141/152 (93%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KE  576
            IRRSL+ D LPGG+ G+KDGYAIPAGTD+FISVYNLHRSPYFWD+P++FEPERF V+ K 
Sbjct  421  IRRSLKSDVLPGGHKGEKDGYAIPAGTDVFISVYNLHRSPYFWDRPDDFEPERFLVQNKN  480

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
             EIEGWAG DPSRSPGALYPNE+ISDFAFLPFGGGPRKCVGDQFALMES +AL MLLQ F
Sbjct  481  EEIEGWAGLDPSRSPGALYPNEVISDFAFLPFGGGPRKCVGDQFALMESTVALTMLLQNF  540

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++LKGTPESV+LVTGATIHTKNG+WC+LKKR
Sbjct  541  DVELKGTPESVELVTGATIHTKNGMWCRLKKR  572



>ref|XP_002266883.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Vitis vinifera]
 emb|CBI34117.3| unnamed protein product [Vitis vinifera]
Length=572

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL+ D LPGGY G KDG++IPAGTDIF+SVYNLHRSPYFWD+P+EFEPERF V + S
Sbjct  418  IRRSLKSDALPGGYKGKKDGHSIPAGTDIFLSVYNLHRSPYFWDRPHEFEPERFLVPRNS  477

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            +IEGW+GFDPSRSPGALYPNEI++DFAFLPFGGGPRKCVGDQFALMES IAL MLLQKFD
Sbjct  478  DIEGWSGFDPSRSPGALYPNEIVADFAFLPFGGGPRKCVGDQFALMESTIALTMLLQKFD  537

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
            ++LKG PESV+LVTGATIHTKNGLWC++ KR D+
Sbjct  538  VELKGGPESVELVTGATIHTKNGLWCRMMKRSDL  571



>ref|XP_007049043.1| Cytochrome P450 97B2 isoform 1 [Theobroma cacao]
 gb|EOX93200.1| Cytochrome P450 97B2 isoform 1 [Theobroma cacao]
Length=622

 Score =   277 bits (709),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 143/152 (94%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L+ D +PGGY GDKDGY IPAGTDIF+SVYNLHRSPYFWD+P++F PERF V K+S
Sbjct  467  IRRALKADVIPGGYKGDKDGYKIPAGTDIFLSVYNLHRSPYFWDQPHDFVPERFLVEKKS  526

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            E IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKC+GDQFALMES +ALAMLLQKF
Sbjct  527  EGIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCIGDQFALMESTVALAMLLQKF  586

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++LKG+PESV+LVTGATIHTKNG+WCKL+KR
Sbjct  587  DVELKGSPESVELVTGATIHTKNGMWCKLRKR  618



>gb|KJB10648.1| hypothetical protein B456_001G213800 [Gossypium raimondii]
Length=579

 Score =   276 bits (705),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 142/152 (93%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L    LPGGY GDKDGY IPAGTDIFISVYNLHRSPYFWD+P++F PERF+V+KES
Sbjct  424  IRRALEEVVLPGGYKGDKDGYTIPAGTDIFISVYNLHRSPYFWDQPHDFVPERFRVQKES  483

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            E IE WAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES +ALAMLLQKF
Sbjct  484  EGIEEWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALAMLLQKF  543

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+G+PESV+LVTGATIHTKNGLWCKLK+R
Sbjct  544  DVELRGSPESVELVTGATIHTKNGLWCKLKRR  575



>dbj|BAJ97821.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=572

 Score =   275 bits (704),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 143/152 (94%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQV-RKE  576
            IRRSLRPD+LPGGYNG K+GY IPAGTDIF+S+YNLHRSPYFWD+PNEFEPERF V +K+
Sbjct  420  IRRSLRPDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDRPNEFEPERFTVPKKD  479

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGWAGFDP RSPGA+YPNEII+DFAFLPFGGGPRKCVGDQFAL+ES +ALA+LLQKF
Sbjct  480  ENIEGWAGFDPDRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALALLLQKF  539

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+G+P+ V++VTGATIHTKNGLWC+L+KR
Sbjct  540  DVELRGSPDEVEMVTGATIHTKNGLWCRLRKR  571



>dbj|BAJ87287.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=572

 Score =   275 bits (704),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 143/152 (94%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQV-RKE  576
            IRRSLRPD+LPGGYNG K+GY IPAGTDIF+S+YNLHRSPYFWD+PNEFEPERF V +K+
Sbjct  420  IRRSLRPDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDRPNEFEPERFTVPKKD  479

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGWAGFDP RSPGA+YPNEII+DFAFLPFGGGPRKCVGDQFAL+ES +ALA+LLQKF
Sbjct  480  ENIEGWAGFDPDRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALALLLQKF  539

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+G+P+ V++VTGATIHTKNGLWC+L+KR
Sbjct  540  DVELRGSPDEVEMVTGATIHTKNGLWCRLRKR  571



>gb|EMS51606.1| Cytochrome P450 97B2, chloroplastic [Triticum urartu]
Length=571

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 142/152 (93%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQV-RKE  576
            IRRSLRPD+LPGGYNG K+GY IPAGTDIF+S+YNLHRSPYFWD+PNEFEPERF V +K+
Sbjct  419  IRRSLRPDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDRPNEFEPERFTVPKKD  478

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGWAGFDP RSPGA+YPNEII+DFAFLPFGGGPRKCVGDQFAL+ES +ALA+LLQKF
Sbjct  479  ENIEGWAGFDPDRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALALLLQKF  538

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+G+P  V++VTGATIHTKNGLWC+L+KR
Sbjct  539  DVELRGSPNEVEMVTGATIHTKNGLWCRLRKR  570



>ref|XP_002451628.1| hypothetical protein SORBIDRAFT_04g004850 [Sorghum bicolor]
 gb|EES04604.1| hypothetical protein SORBIDRAFT_04g004850 [Sorghum bicolor]
Length=573

 Score =   274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 143/152 (94%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQV-RKE  576
            IRRSLRPD+LPGGYNG K+GY IPAGTDIF+S+YNLHRSPYFWD+PNEFEPERF V +K+
Sbjct  421  IRRSLRPDKLPGGYNGAKEGYEIPAGTDIFVSIYNLHRSPYFWDRPNEFEPERFSVPKKD  480

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGW+GFDP RSPGA+YPNEII+DFAFLPFGGGPRKCVGDQFAL+ES +ALA+LL+KF
Sbjct  481  ESIEGWSGFDPDRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALALLLRKF  540

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+G+P+ V++VTGATIHTKNGLWC+L+KR
Sbjct  541  DVELRGSPDEVEMVTGATIHTKNGLWCRLRKR  572



>ref|XP_004951757.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Setaria 
italica]
Length=568

 Score =   273 bits (698),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 143/152 (94%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQV-RKE  576
            IRRSLRPD+LPGGYNG K+GY IPAGTDIF+S+YNLHRSPYFWD+PNEFEPERF V +K+
Sbjct  415  IRRSLRPDKLPGGYNGAKEGYEIPAGTDIFVSIYNLHRSPYFWDRPNEFEPERFSVPKKD  474

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGW+GFDP RSPGA+YPNEII+DFAFLPFGGGPRKCVGDQFAL+ES +ALA+LL+KF
Sbjct  475  ESIEGWSGFDPERSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALALLLRKF  534

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+G+P+ V++VTGATIHTKNGLWC+L++R
Sbjct  535  DVELRGSPDEVEMVTGATIHTKNGLWCRLRRR  566



>dbj|BAG90081.1| unnamed protein product [Oryza sativa Japonica Group]
Length=391

 Score =   268 bits (685),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 143/152 (94%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQV-RKE  576
            IRR+LRPD+LPGGYNG K+GY IPAGTDIF+S+YNLHRSPYFWD+P+EFEPERF V +K+
Sbjct  239  IRRALRPDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDRPDEFEPERFSVPKKD  298

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGWAGFDP RSPGA+YPNEI++DFAFLPFGGGPRKCVGDQFAL+ES +ALA+LLQKF
Sbjct  299  ESIEGWAGFDPDRSPGAMYPNEILADFAFLPFGGGPRKCVGDQFALLESTVALALLLQKF  358

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+G+P+ V++VTGATIHTK+GLWC++++R
Sbjct  359  DVELRGSPDEVEMVTGATIHTKSGLWCRVRRR  390



>gb|KDO64373.1| hypothetical protein CISIN_1g014372mg [Citrus sinensis]
Length=426

 Score =   269 bits (687),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 142/152 (93%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERF-QVRKE  576
            IRR+++PD LPGGY GDKDGY +PAGTDIF+S+YNLHRSPYFWD+P+EFEPERF + RK+
Sbjct  271  IRRTIKPDVLPGGYRGDKDGYPVPAGTDIFLSIYNLHRSPYFWDRPHEFEPERFLKPRKD  330

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGW+GFDPSRSPGALYPNEI+SD+AFL FGGGPRKCVGDQFA+MES + LAMLLQKF
Sbjct  331  VGIEGWSGFDPSRSPGALYPNEIVSDYAFLGFGGGPRKCVGDQFAVMESTVGLAMLLQKF  390

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            DI+LKG+PESV+LVTGATIHTKNGLWCKL++R
Sbjct  391  DIELKGSPESVELVTGATIHTKNGLWCKLRER  422



>ref|XP_006429774.1| hypothetical protein CICLE_v10011353mg [Citrus clementina]
 gb|ESR43014.1| hypothetical protein CICLE_v10011353mg [Citrus clementina]
Length=426

 Score =   269 bits (687),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 142/152 (93%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERF-QVRKE  576
            IRR+++PD LPGGY GDKDGY +PAGTDIF+S+YNLHRSPYFWD+P+EFEPERF + RK+
Sbjct  271  IRRTIKPDVLPGGYRGDKDGYPVPAGTDIFLSIYNLHRSPYFWDRPHEFEPERFLKPRKD  330

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGW+GFDPSRSPGALYPNEI+SD+AFL FGGGPRKCVGDQFA+MES + LAMLLQKF
Sbjct  331  VGIEGWSGFDPSRSPGALYPNEIVSDYAFLGFGGGPRKCVGDQFAVMESTVGLAMLLQKF  390

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            DI+LKG+PESV+LVTGATIHTKNGLWCKL++R
Sbjct  391  DIELKGSPESVELVTGATIHTKNGLWCKLRER  422



>ref|XP_010233882.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Brachypodium 
distachyon]
Length=422

 Score =   268 bits (686),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 140/152 (92%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+LRPD+LPGGYNG K+GY IPAGTDIF+S+YNLHRSPYFWD+PNEFEPERF V K  
Sbjct  270  IRRALRPDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDRPNEFEPERFTVPKMD  329

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            E IEGW+GFDP RSPGA+YPNEII+DFAFLPFGGGPRKCVGDQFAL+ES +ALAMLL KF
Sbjct  330  ENIEGWSGFDPGRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALAMLLGKF  389

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+G+P+ V++VTGATIHTKNGLWC+L KR
Sbjct  390  DVELRGSPDEVEMVTGATIHTKNGLWCRLMKR  421



>ref|XP_007049044.1| Cytochrome P450 97B2, chloroplastic isoform 2 [Theobroma cacao]
 gb|EOX93201.1| Cytochrome P450 97B2, chloroplastic isoform 2 [Theobroma cacao]
Length=582

 Score =   273 bits (697),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 143/153 (93%), Gaps = 2/153 (1%)
 Frame = -3

Query  752  IRRSLRPDQLP-GGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKE  576
            IRR+L+ D +P GGY GDKDGY IPAGTDIF+SVYNLHRSPYFWD+P++F PERF V K+
Sbjct  426  IRRALKADVIPAGGYKGDKDGYKIPAGTDIFLSVYNLHRSPYFWDQPHDFVPERFLVEKK  485

Query  575  SE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQK  399
            SE IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKC+GDQFALMES +ALAMLLQK
Sbjct  486  SEGIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCIGDQFALMESTVALAMLLQK  545

Query  398  FDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            FD++LKG+PESV+LVTGATIHTKNG+WCKL+KR
Sbjct  546  FDVELKGSPESVELVTGATIHTKNGMWCKLRKR  578



>ref|XP_010914244.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Elaeis guineensis]
Length=574

 Score =   273 bits (697),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 143/152 (94%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L+PD+LPGGY GD++GY IPAGTDIF+SVYNLHRSPYFW++PNEFEPERF V K+S
Sbjct  418  IRRALKPDKLPGGYKGDENGYKIPAGTDIFLSVYNLHRSPYFWERPNEFEPERFLVTKKS  477

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            E I+GWAGFDP RSPGA+YPNEII+DFAFLPFGGGPRKCVGDQFAL+ES IALAMLLQK+
Sbjct  478  EGIDGWAGFDPDRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTIALAMLLQKY  537

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            DI+LKG+P+ V+ VTGATIHTKNGLWCKLK+R
Sbjct  538  DIELKGSPDEVEPVTGATIHTKNGLWCKLKRR  569



>ref|XP_010260624.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Nelumbo 
nucifera]
Length=481

 Score =   270 bits (690),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 142/157 (90%), Gaps = 2/157 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL PD LPGGY GDK+GY IPAGTD+F+SVYNLHRSPYFWD+P+EFEPERF V ++S
Sbjct  319  IRRSLVPDVLPGGYKGDKEGYPIPAGTDLFVSVYNLHRSPYFWDRPHEFEPERFLVPRKS  378

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            E IEGWAGFDP RS GALYPNEIISDFAFLPFGGGPRKCVGDQFALMES +AL +LLQKF
Sbjct  379  EGIEGWAGFDPCRSAGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALVLLLQKF  438

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLD-VC  288
             ++LKG+PESV+LVTGATIHTK+GLWCKL+KR   VC
Sbjct  439  TVELKGSPESVELVTGATIHTKSGLWCKLRKRASTVC  475



>emb|CDP16026.1| unnamed protein product [Coffea canephora]
Length=599

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 143/155 (92%), Gaps = 1/155 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL+ D+LPGG+ GD +GYAIPAGTDIF+SVYN+HRSPY WD PN+FEPERF V++ S
Sbjct  442  IRRSLKSDKLPGGHKGDNNGYAIPAGTDIFLSVYNVHRSPYLWDNPNDFEPERFLVKRVS  501

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            + IEGWAGFDPSRSPGALYPNEI+SDFAFLPFGGGPRKCVGDQFA MES IALAMLLQ+F
Sbjct  502  QGIEGWAGFDPSRSPGALYPNEIMSDFAFLPFGGGPRKCVGDQFAFMESTIALAMLLQEF  561

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
            DI+LKG+PESV++VTGATIHTKNGLWC+L KR D+
Sbjct  562  DIELKGSPESVEIVTGATIHTKNGLWCRLMKRQDI  596



>ref|XP_010440341.1| PREDICTED: cytochrome P450 97B3, chloroplastic [Camelina sativa]
Length=578

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 139/152 (91%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L+P+ LPGGY G+K GY +P GTDIFISVYNLHRSPYFWD P+EFEPERF   KES
Sbjct  425  IRRTLKPETLPGGYKGEKSGYQVPKGTDIFISVYNLHRSPYFWDNPHEFEPERFLRTKES  484

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGWAGFDPSRSPGALYPNEII+DFAFLPFGGGPRKC+GDQFALMES +ALAMLLQKF
Sbjct  485  NGIEGWAGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTVALAMLLQKF  544

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+G+PESV+LV+GATIH KNG+WCKLKKR
Sbjct  545  DVELRGSPESVELVSGATIHAKNGMWCKLKKR  576



>ref|XP_008679919.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Zea mays]
 gb|ADL28271.1| carotene beta-ring hydroxylase [Zea mays]
 gb|AFP28222.1| beta-carotene hydroxylase [synthetic construct]
 gb|AFW66346.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=572

 Score =   270 bits (689),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 142/152 (93%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQV-RKE  576
            IRRSLRPD+LPGG NG K+GY IPAGTDIF+SVYNLHRSPYFWD+PNEFEPERF V +K+
Sbjct  420  IRRSLRPDKLPGGCNGAKEGYEIPAGTDIFVSVYNLHRSPYFWDRPNEFEPERFSVPKKD  479

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGW+GFDP RSPGA+YPNEII+DFAFLPFGGGPRKCVGDQFAL+ES +ALA+LL+KF
Sbjct  480  ESIEGWSGFDPDRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALALLLRKF  539

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+G+P+ V++VTGATIHTKNGLWC+L++R
Sbjct  540  DVELRGSPDEVEMVTGATIHTKNGLWCRLRRR  571



>ref|XP_010260623.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Nelumbo 
nucifera]
Length=587

 Score =   270 bits (690),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 142/157 (90%), Gaps = 2/157 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL PD LPGGY GDK+GY IPAGTD+F+SVYNLHRSPYFWD+P+EFEPERF V ++S
Sbjct  425  IRRSLVPDVLPGGYKGDKEGYPIPAGTDLFVSVYNLHRSPYFWDRPHEFEPERFLVPRKS  484

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            E IEGWAGFDP RS GALYPNEIISDFAFLPFGGGPRKCVGDQFALMES +AL +LLQKF
Sbjct  485  EGIEGWAGFDPCRSAGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALVLLLQKF  544

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLD-VC  288
             ++LKG+PESV+LVTGATIHTK+GLWCKL+KR   VC
Sbjct  545  TVELKGSPESVELVTGATIHTKSGLWCKLRKRASTVC  581



>ref|XP_006429775.1| hypothetical protein CICLE_v10011353mg [Citrus clementina]
 gb|ESR43015.1| hypothetical protein CICLE_v10011353mg [Citrus clementina]
Length=582

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 142/152 (93%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERF-QVRKE  576
            IRR+++PD LPGGY GDKDGY +PAGTDIF+S+YNLHRSPYFWD+P+EFEPERF + RK+
Sbjct  427  IRRTIKPDVLPGGYRGDKDGYPVPAGTDIFLSIYNLHRSPYFWDRPHEFEPERFLKPRKD  486

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGW+GFDPSRSPGALYPNEI+SD+AFL FGGGPRKCVGDQFA+MES + LAMLLQKF
Sbjct  487  VGIEGWSGFDPSRSPGALYPNEIVSDYAFLGFGGGPRKCVGDQFAVMESTVGLAMLLQKF  546

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            DI+LKG+PESV+LVTGATIHTKNGLWCKL++R
Sbjct  547  DIELKGSPESVELVTGATIHTKNGLWCKLRER  578



>ref|XP_003570274.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Brachypodium 
distachyon]
Length=569

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 140/152 (92%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+LRPD+LPGGYNG K+GY IPAGTDIF+S+YNLHRSPYFWD+PNEFEPERF V K  
Sbjct  417  IRRALRPDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDRPNEFEPERFTVPKMD  476

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            E IEGW+GFDP RSPGA+YPNEII+DFAFLPFGGGPRKCVGDQFAL+ES +ALAMLL KF
Sbjct  477  ENIEGWSGFDPGRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALAMLLGKF  536

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+G+P+ V++VTGATIHTKNGLWC+L KR
Sbjct  537  DVELRGSPDEVEMVTGATIHTKNGLWCRLMKR  568



>ref|XP_006648355.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Oryza brachyantha]
Length=543

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 141/152 (93%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+LRPD+LPGGYNG K+GY IPAGTDIF+S+YNLHRSPYFWD+PNEFEPERF V K  
Sbjct  391  IRRALRPDKLPGGYNGAKEGYDIPAGTDIFLSIYNLHRSPYFWDRPNEFEPERFSVPKMD  450

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            E IEGWAGFDP RSPGA+YPNEII+DFAFLPFGGGPRKCVGDQFAL+ES +ALA+LLQKF
Sbjct  451  ESIEGWAGFDPDRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALALLLQKF  510

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+G+P  V++VTGATIHTK+GLWC++++R
Sbjct  511  DVELRGSPNEVEMVTGATIHTKSGLWCRVRRR  542



>ref|XP_006481375.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Citrus sinensis]
Length=619

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 142/152 (93%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERF-QVRKE  576
            IRR+++PD LPGGY GDKDGY +PAGTDIF+S+YNLHRSPYFWD+P+EFEPERF + RK+
Sbjct  464  IRRTIKPDVLPGGYRGDKDGYPVPAGTDIFLSIYNLHRSPYFWDRPHEFEPERFLKPRKD  523

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGW+GFDPSRSPGALYPNEI+SD+AFL FGGGPRKCVGDQFA+MES + LAMLLQKF
Sbjct  524  VGIEGWSGFDPSRSPGALYPNEIVSDYAFLGFGGGPRKCVGDQFAVMESTVGLAMLLQKF  583

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            DI+LKG+PESV+LVTGATIHTKNGLWCKL++R
Sbjct  584  DIELKGSPESVELVTGATIHTKNGLWCKLRER  615



>ref|XP_008809593.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Phoenix dactylifera]
Length=572

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 142/152 (93%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L+PD+LPGGY GD++GY IPAGTDIF+SVYNLHRSP+FWD+PNEFEPERF V K+S
Sbjct  416  IRRALKPDKLPGGYKGDENGYKIPAGTDIFLSVYNLHRSPHFWDRPNEFEPERFLVPKKS  475

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            E IEGWAGFDP RS GA+YPNEII+DFAFLPFGGGPRKCVGDQFAL+ES +ALAMLLQK+
Sbjct  476  EDIEGWAGFDPDRSAGAIYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALAMLLQKY  535

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            DI+LKG+P+ V+ VTGATIHTKNGLWCKLK+R
Sbjct  536  DIELKGSPDDVEPVTGATIHTKNGLWCKLKRR  567



>emb|CDY22733.1| BnaA08g05630D [Brassica napus]
Length=566

 Score =   268 bits (685),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 139/152 (91%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L+P+ LPGGY G+K+G+ +P GTDIFISVYNLHRSPYFWD P EFEPERF  +KES
Sbjct  413  IRRTLKPETLPGGYKGEKEGHKVPKGTDIFISVYNLHRSPYFWDNPQEFEPERFLRKKES  472

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGWAGFDPSRSPGALYPNEII+DFAFLPFGGGPRKC+GDQFALMES +ALAMLLQKF
Sbjct  473  NGIEGWAGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTVALAMLLQKF  532

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+G PESV+LV+GATIH KNG+WCKLK+R
Sbjct  533  DVELRGPPESVELVSGATIHAKNGMWCKLKRR  564



>ref|XP_010435019.1| PREDICTED: cytochrome P450 97B3, chloroplastic-like [Camelina 
sativa]
Length=579

 Score =   268 bits (685),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 139/152 (91%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L+P+ LPGGY G+K G+ +P GTDIFISVYNLHRSPYFWD P++FEPERF   KES
Sbjct  426  IRRTLKPETLPGGYKGEKSGHQVPKGTDIFISVYNLHRSPYFWDNPHDFEPERFLRTKES  485

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGWAGFDPSRSPGALYPNEII+DFAFLPFGGGPRKC+GDQFALMES +ALAMLLQKF
Sbjct  486  NGIEGWAGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTVALAMLLQKF  545

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+G+PESV+LV+GATIH KNG+WCKLKKR
Sbjct  546  DVELRGSPESVELVSGATIHAKNGMWCKLKKR  577



>ref|XP_009107829.1| PREDICTED: cytochrome P450 97B3, chloroplastic [Brassica rapa]
Length=578

 Score =   268 bits (685),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 139/152 (91%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L+P+ LPGGY G+K+G+ +P GTDIFISVYNLHRSPYFWD P EFEPERF  +KES
Sbjct  425  IRRTLKPETLPGGYKGEKEGHKVPKGTDIFISVYNLHRSPYFWDNPQEFEPERFLRKKES  484

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGWAGFDPSRSPGALYPNEII+DFAFLPFGGGPRKC+GDQFALMES +ALAMLLQKF
Sbjct  485  NGIEGWAGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTVALAMLLQKF  544

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+G PESV+LV+GATIH KNG+WCKLK+R
Sbjct  545  DVELRGPPESVELVSGATIHAKNGMWCKLKRR  576



>emb|CDY09057.1| BnaC08g10110D [Brassica napus]
Length=565

 Score =   268 bits (684),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 138/152 (91%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L+P+ LPGGY G+K+G+ +P GTDIFISVYNLHRSPYFWD P EFEPERF   KES
Sbjct  412  IRRTLKPETLPGGYKGEKEGHKVPKGTDIFISVYNLHRSPYFWDNPQEFEPERFLRTKES  471

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGWAGFDPSRSPGALYPNEII+DFAFLPFGGGPRKC+GDQFALMES +ALAMLLQKF
Sbjct  472  NGIEGWAGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTVALAMLLQKF  531

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+G PESV+LV+GATIH KNG+WCKLK+R
Sbjct  532  DVELRGPPESVELVSGATIHAKNGMWCKLKRR  563



>gb|EAZ21913.1| hypothetical protein OsJ_05566 [Oryza sativa Japonica Group]
Length=557

 Score =   267 bits (682),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 143/152 (94%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQV-RKE  576
            IRR+LRPD+LPGGYNG K+GY IPAGTDIF+S+YNLHRSPYFWD+P+EFEPERF V +K+
Sbjct  405  IRRALRPDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDRPDEFEPERFSVPKKD  464

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGWAGFDP RSPGA+YPNEI++DFAFLPFGGGPRKCVGDQFAL+ES +ALA+LLQKF
Sbjct  465  ESIEGWAGFDPDRSPGAMYPNEILADFAFLPFGGGPRKCVGDQFALLESTVALALLLQKF  524

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+G+P+ V++VTGATIHTK+GLWC++++R
Sbjct  525  DVELRGSPDEVEMVTGATIHTKSGLWCRVRRR  556



>gb|KFK33561.1| hypothetical protein AALP_AA5G029500 [Arabis alpina]
Length=577

 Score =   267 bits (683),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 139/152 (91%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L+P+ LPGGY G+K+G+ +P GTDIFISVYNLHRSPYFWD P+EFEPERF   KES
Sbjct  424  IRRTLKPETLPGGYKGEKEGHKVPKGTDIFISVYNLHRSPYFWDNPHEFEPERFLRTKES  483

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGWAGFDPSRSPGALYPNEI+SDFAFLPFGGGPRKC+GDQFALMES +ALAML QKF
Sbjct  484  NGIEGWAGFDPSRSPGALYPNEIVSDFAFLPFGGGPRKCIGDQFALMESTVALAMLFQKF  543

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+G+PESV+LV+GATIH KNG+WCKLK+R
Sbjct  544  DVELRGSPESVELVSGATIHAKNGMWCKLKRR  575



>gb|EAY84668.1| hypothetical protein OsI_06039 [Oryza sativa Indica Group]
Length=571

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 143/152 (94%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQV-RKE  576
            IRR+LRPD+LPGGYNG K+GY IPAGTDIF+S+YNLHRSPYFWD+P+EFEPERF V +K+
Sbjct  419  IRRALRPDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDRPDEFEPERFSVPKKD  478

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGWAGFDP RSPGA+YPNEI++DFAFLPFGGGPRKCVGDQFAL+ES +ALA+LLQKF
Sbjct  479  ESIEGWAGFDPDRSPGAMYPNEILADFAFLPFGGGPRKCVGDQFALLESTVALALLLQKF  538

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+G+P+ V++VTGATIHTK+GLWC++++R
Sbjct  539  DVELRGSPDEVEMVTGATIHTKSGLWCRVRRR  570



>dbj|BAD26183.1| putative cytochrome P450 [Oryza sativa Japonica Group]
Length=571

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 143/152 (94%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQV-RKE  576
            IRR+LRPD+LPGGYNG K+GY IPAGTDIF+S+YNLHRSPYFWD+P+EFEPERF V +K+
Sbjct  419  IRRALRPDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDRPDEFEPERFSVPKKD  478

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGWAGFDP RSPGA+YPNEI++DFAFLPFGGGPRKCVGDQFAL+ES +ALA+LLQKF
Sbjct  479  ESIEGWAGFDPDRSPGAMYPNEILADFAFLPFGGGPRKCVGDQFALLESTVALALLLQKF  538

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+G+P+ V++VTGATIHTK+GLWC++++R
Sbjct  539  DVELRGSPDEVEMVTGATIHTKSGLWCRVRRR  570



>ref|XP_010532498.1| PREDICTED: cytochrome P450 97B3, chloroplastic [Tarenaya hassleriana]
Length=585

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 140/152 (92%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL+PD LPGGYNG+K+G+ IP GTDIFISVYNLHRSPYFWD P++FEPERF  ++ES
Sbjct  431  IRRSLKPDILPGGYNGEKEGHRIPRGTDIFISVYNLHRSPYFWDSPDDFEPERFLRKRES  490

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            + IEGWAGFDPSRSPGALYPNE+ISDFA LPFGGGPRKC+GDQFALMES  ALA+LLQKF
Sbjct  491  DGIEGWAGFDPSRSPGALYPNEVISDFALLPFGGGPRKCIGDQFALMESTAALALLLQKF  550

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+G PESV+LV+GATIH KNGLWCKLK+R
Sbjct  551  DVELRGPPESVELVSGATIHAKNGLWCKLKRR  582



>ref|XP_006414564.1| hypothetical protein EUTSA_v10024764mg [Eutrema salsugineum]
 gb|ESQ56017.1| hypothetical protein EUTSA_v10024764mg [Eutrema salsugineum]
Length=581

 Score =   266 bits (679),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 139/152 (91%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L+ + LPGGY G+K+G+ +P GTDIFISVYNLHRSPYFWD P+EFEPERF   KES
Sbjct  428  IRRTLKAETLPGGYKGEKEGHKVPKGTDIFISVYNLHRSPYFWDNPDEFEPERFLRTKES  487

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGWAGFDPSRSPGALYPNEII+DFAFLPFGGGPRKC+GDQFALMES +ALAMLLQKF
Sbjct  488  NGIEGWAGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTVALAMLLQKF  547

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+G+PESV+LV+GATIH KNG+WCKLK+R
Sbjct  548  DVELRGSPESVELVSGATIHAKNGMWCKLKRR  579



>ref|XP_006285060.1| hypothetical protein CARUB_v10006369mg [Capsella rubella]
 gb|EOA17958.1| hypothetical protein CARUB_v10006369mg [Capsella rubella]
Length=576

 Score =   265 bits (677),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 139/152 (91%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L+ + LPGGY G+K+G+ +P GTDIFISVYNLHRSPYFWD P++FEPERF   KES
Sbjct  423  IRRTLKAETLPGGYKGEKEGHKVPKGTDIFISVYNLHRSPYFWDNPHDFEPERFLRTKES  482

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKC+GDQFALMES +ALAMLLQKF
Sbjct  483  NGIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCIGDQFALMESTVALAMLLQKF  542

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+GTPESV+LV+GATIH K+G+WCKLK+R
Sbjct  543  DVELRGTPESVELVSGATIHAKDGMWCKLKRR  574



>ref|XP_010495892.1| PREDICTED: cytochrome P450 97B3, chloroplastic-like [Camelina 
sativa]
Length=579

 Score =   265 bits (677),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 137/152 (90%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L+ + LPGGY G+K G+ +P GTDIFISVYNLHRSPYFWD P+EFEPERF   KES
Sbjct  426  IRRTLKSETLPGGYKGEKSGHQVPKGTDIFISVYNLHRSPYFWDNPHEFEPERFLRTKES  485

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGWAGFDPSRSPGALYPNEII+DFAFLPFGGGPRKC+GDQFALMES +ALAMLLQKF
Sbjct  486  NGIEGWAGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTVALAMLLQKF  545

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+G PESV+LV+GATIH KNG+WCKLKKR
Sbjct  546  DVELRGPPESVELVSGATIHAKNGMWCKLKKR  577



>emb|CAB10290.1| cytochrome P450 like protein [Arabidopsis thaliana]
 emb|CAB78553.1| cytochrome P450 like protein [Arabidopsis thaliana]
Length=576

 Score =   265 bits (676),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 139/152 (91%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L+P+ LPGG+ G+K+G+ +P GTDIFISVYNLHRSPYFWD P++FEPERF   KES
Sbjct  423  IRRTLKPETLPGGHKGEKEGHKVPKGTDIFISVYNLHRSPYFWDNPHDFEPERFLRTKES  482

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGWAGFDPSRSPGALYPNEII+DFAFLPFGGGPRKC+GDQFALMES +ALAML QKF
Sbjct  483  NGIEGWAGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTVALAMLFQKF  542

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+GTPESV+LV+GATIH KNG+WCKLK+R
Sbjct  543  DVELRGTPESVELVSGATIHAKNGMWCKLKRR  574



>ref|NP_193247.2| cytochrome P450 97B3 [Arabidopsis thaliana]
 sp|O23365.2|C97B3_ARATH RecName: Full=Cytochrome P450 97B3, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL32753.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAO00942.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AEE83557.1| cytochrome P450 97B3 [Arabidopsis thaliana]
Length=580

 Score =   265 bits (677),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 139/152 (91%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L+P+ LPGG+ G+K+G+ +P GTDIFISVYNLHRSPYFWD P++FEPERF   KES
Sbjct  427  IRRTLKPETLPGGHKGEKEGHKVPKGTDIFISVYNLHRSPYFWDNPHDFEPERFLRTKES  486

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGWAGFDPSRSPGALYPNEII+DFAFLPFGGGPRKC+GDQFALMES +ALAML QKF
Sbjct  487  NGIEGWAGFDPSRSPGALYPNEIIADFAFLPFGGGPRKCIGDQFALMESTVALAMLFQKF  546

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+GTPESV+LV+GATIH KNG+WCKLK+R
Sbjct  547  DVELRGTPESVELVSGATIHAKNGMWCKLKRR  578



>ref|XP_009412060.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=422

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 136/152 (89%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L+ D+LPGGY G  DGYAIPAG DIFISV+NLHRSPYFWD+PNEFEPERF   K S
Sbjct  270  IRRALKADKLPGGYMGCDDGYAIPAGADIFISVFNLHRSPYFWDRPNEFEPERFLAPKPS  329

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            E I GWAG+DP RSPGA+YPNEI SDFAF+PFGGGPRKCVGDQFAL+ES IALA+LLQKF
Sbjct  330  EGIAGWAGYDPGRSPGAMYPNEITSDFAFIPFGGGPRKCVGDQFALLESTIALALLLQKF  389

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D+ L+G+P+ V+LVTGATIHTKNGLWCKLKKR
Sbjct  390  DVLLRGSPDEVELVTGATIHTKNGLWCKLKKR  421



>ref|XP_006854622.1| hypothetical protein AMTR_s00030p00167800 [Amborella trichopoda]
 gb|ERN16089.1| hypothetical protein AMTR_s00030p00167800 [Amborella trichopoda]
Length=440

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSLRPD LPGG  GDK+GY+IPAGT+I +SVYNLHR  YFWD+P+EFEPERF   K+S
Sbjct  283  IRRSLRPDILPGGLTGDKNGYSIPAGTEICLSVYNLHRCHYFWDRPHEFEPERFLRPKKS  342

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            E+EGWAGFDP RSPGALYPNEIISDFAFLPFGGGPRKC+GDQFALMES IALA+LL +FD
Sbjct  343  EVEGWAGFDPQRSPGALYPNEIISDFAFLPFGGGPRKCLGDQFALMESTIALALLLHRFD  402

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            ++L+  PES++ VTGATIHTK+GLWCKL+KR
Sbjct  403  VELRDPPESMEAVTGATIHTKDGLWCKLRKR  433



>ref|XP_002868224.1| hypothetical protein ARALYDRAFT_493377 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44483.1| hypothetical protein ARALYDRAFT_493377 [Arabidopsis lyrata subsp. 
lyrata]
Length=571

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 138/152 (91%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L+P+ LPGGY G+K+G+ +P GTDIFISVYNLHRSPYFWD P++FEPERF   KES
Sbjct  418  IRRTLKPETLPGGYKGEKEGHKVPKGTDIFISVYNLHRSPYFWDNPHDFEPERFLRTKES  477

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGWAGFDPS S GALYPNEIISDFAFLPFGGGPRKC+GDQFALMES +ALAMLLQKF
Sbjct  478  NGIEGWAGFDPSCSLGALYPNEIISDFAFLPFGGGPRKCIGDQFALMESTVALAMLLQKF  537

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L+G+PESV+LV+GATIH KNG+WCKLK+R
Sbjct  538  DVELRGSPESVELVSGATIHAKNGMWCKLKRR  569



>ref|XP_009412059.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=574

 Score =   259 bits (663),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 136/152 (89%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L+ D+LPGGY G  DGYAIPAG DIFISV+NLHRSPYFWD+PNEFEPERF   K S
Sbjct  422  IRRALKADKLPGGYMGCDDGYAIPAGADIFISVFNLHRSPYFWDRPNEFEPERFLAPKPS  481

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            E I GWAG+DP RSPGA+YPNEI SDFAF+PFGGGPRKCVGDQFAL+ES IALA+LLQKF
Sbjct  482  EGIAGWAGYDPGRSPGAMYPNEITSDFAFIPFGGGPRKCVGDQFALLESTIALALLLQKF  541

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D+ L+G+P+ V+LVTGATIHTKNGLWCKLKKR
Sbjct  542  DVLLRGSPDEVELVTGATIHTKNGLWCKLKKR  573



>ref|XP_004303949.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Fragaria vesca 
subsp. vesca]
 ref|XP_011467680.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=572

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL+PD LPGGY G+K GY IPAGTDIFISVYNLHRSPY+WD+PN FEPERF V+K S
Sbjct  418  IRRSLKPDTLPGGYKGEKGGYKIPAGTDIFISVYNLHRSPYYWDRPNVFEPERFSVQKNS  477

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            EIEGWAGFDPSRSPGA YPNEI++DF+FLPFGGGPRKCVGDQFAL+ES ++LAMLLQKF+
Sbjct  478  EIEGWAGFDPSRSPGAYYPNEIMADFSFLPFGGGPRKCVGDQFALLESTVSLAMLLQKFN  537

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
            ++L+G+PESV LVTGATIHTKNG+WCKL KR DV
Sbjct  538  VELRGSPESVGLVTGATIHTKNGMWCKLSKRSDV  571



>gb|AAT28222.1| putative 97B2-like cytochrome P450 [Ginkgo biloba]
Length=586

 Score =   258 bits (659),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 137/152 (90%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+LR D +PGGY GDKDGY IP GTDIFISVYNLHRSPYFWD+P+EF PERF + K++
Sbjct  427  IRRALRQDTIPGGYRGDKDGYLIPKGTDIFISVYNLHRSPYFWDQPHEFRPERFLIPKDN  486

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            + IEGWAGFDP RS GALYPNE+++DFAFLPFGGGPRKCVGDQFALMES + LAMLLQKF
Sbjct  487  KGIEGWAGFDPYRSQGALYPNEVLADFAFLPFGGGPRKCVGDQFALMESTVGLAMLLQKF  546

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            +++LK  PES+++VTGATIHT+NGLWCK+K+R
Sbjct  547  EVELKDPPESLRIVTGATIHTQNGLWCKIKRR  578



>ref|XP_008229650.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Prunus mume]
Length=577

 Score =   258 bits (658),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 133/154 (86%), Gaps = 2/154 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            +RRSL+ D LPGGYN        PAGTDIF+SVYNLHRSPYFWD PNEFEPERF V K+S
Sbjct  425  VRRSLKSDTLPGGYNXXX--XXSPAGTDIFLSVYNLHRSPYFWDNPNEFEPERFLVPKKS  482

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            E+EGWAGFDPSR PGALYP EI +DFAFLPFGGGPRKCVGDQFALMES + LAMLLQKF 
Sbjct  483  EVEGWAGFDPSRIPGALYPGEITADFAFLPFGGGPRKCVGDQFALMESTVTLAMLLQKFT  542

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
            ++LKG+PESV+ VTGATIHTKNGLWCKL+KR DV
Sbjct  543  VELKGSPESVEQVTGATIHTKNGLWCKLRKRSDV  576



>ref|XP_006841947.1| hypothetical protein AMTR_s00042p00221280 [Amborella trichopoda]
 gb|ERN03622.1| hypothetical protein AMTR_s00042p00221280 [Amborella trichopoda]
Length=589

 Score =   255 bits (651),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 135/152 (89%), Gaps = 1/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQ-VRKE  576
            IRR+LR D LPGG+ GDKDGYAIPAGTDIFISVYNLHRSPYFW++P+EFEPERF   RK 
Sbjct  427  IRRTLRLDTLPGGFKGDKDGYAIPAGTDIFISVYNLHRSPYFWEQPHEFEPERFLGPRKG  486

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGWAGFDPSRSPGALY NEI++DFAFLPFGGGPRKCVGDQFALMES +ALAMLL+KF
Sbjct  487  EGIEGWAGFDPSRSPGALYSNEIVADFAFLPFGGGPRKCVGDQFALMESTVALAMLLRKF  546

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            +++L+  P+ V+LVTGATIHTK GLWC LK R
Sbjct  547  NVELRDPPDQVELVTGATIHTKAGLWCNLKFR  578



>ref|XP_001769554.1| predicted protein [Physcomitrella patens]
 gb|EDQ65715.1| predicted protein [Physcomitrella patens]
Length=586

 Score =   250 bits (638),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 134/156 (86%), Gaps = 1/156 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL+PD LPGG+ GD +GY+IP G D+FISVYNLHRSPYFWD+P +F PERF   K S
Sbjct  428  IRRSLQPDTLPGGHKGDPNGYSIPKGVDLFISVYNLHRSPYFWDEPEKFNPERFLKAKLS  487

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            + IEGWAGFDP R  GALYPNE+++DFAFLPFGGG RKCVGDQFALMES +ALAMLLQKF
Sbjct  488  DGIEGWAGFDPKRGQGALYPNEVMADFAFLPFGGGARKCVGDQFALMESTVALAMLLQKF  547

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDVC  288
            +++L+G+PE V+LVTGATIHTK+GLWCKL +R  + 
Sbjct  548  EVELRGSPEDVELVTGATIHTKDGLWCKLSRRKSIT  583



>ref|XP_002976141.1| hypothetical protein SELMODRAFT_175360 [Selaginella moellendorffii]
 gb|EFJ23046.1| hypothetical protein SELMODRAFT_175360 [Selaginella moellendorffii]
Length=541

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 131/152 (86%), Gaps = 2/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRK-E  576
            IRRSL+PD+LPGG+ GD DGY+IP GTDIFISV+NLHRSPYFW+ P  F+PERF  R+ +
Sbjct  389  IRRSLQPDKLPGGHKGDPDGYSIPKGTDIFISVFNLHRSPYFWENPESFDPERFLRRRVD  448

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            S I GWAG DP++  G LYPNEI++DFAFLPFGGGPRKCVGDQFA ME+ I LA+LL+KF
Sbjct  449  SSIPGWAGIDPTKLQG-LYPNEIMADFAFLPFGGGPRKCVGDQFAFMEATIGLAVLLRKF  507

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             ++L+G+P+ V+LVTGAT+HTKNGLWCKL KR
Sbjct  508  SVELRGSPQEVELVTGATLHTKNGLWCKLSKR  539



>ref|XP_002968239.1| hypothetical protein SELMODRAFT_145597, partial [Selaginella 
moellendorffii]
 gb|EFJ30493.1| hypothetical protein SELMODRAFT_145597, partial [Selaginella 
moellendorffii]
Length=563

 Score =   236 bits (602),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 131/152 (86%), Gaps = 2/152 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRK-E  576
            IRRSL+PD+LPGG+ GD DGY+IP GTDIFISV+NLHRSPYFW+ P  F+PERF  R+ +
Sbjct  413  IRRSLQPDKLPGGHKGDPDGYSIPKGTDIFISVFNLHRSPYFWENPESFDPERFLRRRVD  472

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            S I GWAG DP++  G LYPNEI++DFAFLPFGGGPRKCVGDQFA ME+ I LA+LL+KF
Sbjct  473  SSIPGWAGIDPTKLQG-LYPNEIMADFAFLPFGGGPRKCVGDQFAFMEATIGLAVLLRKF  531

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             ++L+G+P+ V+LVTGAT+HTKNGLWCKL KR
Sbjct  532  SVELRGSPQEVELVTGATLHTKNGLWCKLSKR  563



>gb|EMT03024.1| Cytochrome P450 97B2 [Aegilops tauschii]
Length=605

 Score =   236 bits (602),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 124/134 (93%), Gaps = 1/134 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQV-RKE  576
            IRRSLRPD+LPGGYNG K+GY IPAGTDIF+S+YNLHRSPYFWD PNEFEPERF V +K+
Sbjct  400  IRRSLRPDKLPGGYNGAKEGYEIPAGTDIFLSIYNLHRSPYFWDSPNEFEPERFTVPKKD  459

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGWAGFDP RSPGA+YPNEII+DFAFLPFGGGPRKCVGDQFAL+ES +ALA+LLQKF
Sbjct  460  ENIEGWAGFDPDRSPGAMYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALALLLQKF  519

Query  395  DIDLKGTPESVKLV  354
            D++L+G+P+ V+++
Sbjct  520  DVELRGSPDEVEMI  533



>gb|KHN25634.1| Cytochrome P450 97B2, chloroplastic [Glycine soja]
Length=353

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 112/124 (90%), Gaps = 1/124 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KE  576
            IRRSL+ D LPGG+ GDKDGYAIPAGTD+FISVYNLHRSPYFWD+P++FEPERF V+ K 
Sbjct  226  IRRSLKSDVLPGGHKGDKDGYAIPAGTDVFISVYNLHRSPYFWDRPHDFEPERFLVQNKN  285

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
             EIEGW G DPSRSPGALYPNE+ISDFAFLPFGGGPRKCVGDQFALMES +AL +LLQ F
Sbjct  286  EEIEGWGGLDPSRSPGALYPNEVISDFAFLPFGGGPRKCVGDQFALMESTVALTLLLQNF  345

Query  395  DIDL  384
            D++L
Sbjct  346  DVEL  349



>sp|Q43078.1|C97B1_PEA RecName: Full=Cytochrome P450 97B1, chloroplastic; AltName: Full=Cytochrome 
P450 97A2; Flags: Precursor [Pisum sativum]
 emb|CAA89260.1| cytochrome P450 [Pisum sativum]
Length=552

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 105/114 (92%), Gaps = 1/114 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL+PD LPGG+ GDKDGY IPAGTD+FISVYNLHRSPYFWD+PN+FEPERF V+  +
Sbjct  430  IRRSLKPDVLPGGHKGDKDGYTIPAGTDVFISVYNLHRSPYFWDRPNDFEPERFLVQNNN  489

Query  572  -EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALA  414
             E+EGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMES +AL 
Sbjct  490  EEVEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESTVALV  543



>ref|XP_011399626.1| Cytochrome P450 97B2, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM26688.1| Cytochrome P450 97B2, chloroplastic [Auxenochlorella protothecoides]
Length=205

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 110/152 (72%), Gaps = 4/152 (3%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L PD LPGG  GD  GY I  G D+FIS +NLHRSP+ WD P +F+PER+  ++ S
Sbjct  37   IRRALAPDVLPGGLYGDAAGYPIGKGADLFISTWNLHRSPHLWDDPEDFKPERWSAKRAS  96

Query  572  EI-EGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
             I E WAG+ P ++  ALYPNE+ SDFAF+PFGGG RKCVGDQFA++E+ +ALAM L+++
Sbjct  97   PIPEKWAGYAPLQAASALYPNEVASDFAFIPFGGGARKCVGDQFAMLEATVALAMTLRRY  156

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
               L   P    L +GATIHT +GL C +++R
Sbjct  157  SFSLAADP---GLASGATIHTAHGLRCSVQRR  185



>gb|AFR36909.1| chloroplast CYP97B, partial [Haematococcus pluvialis]
Length=539

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 106/156 (68%), Gaps = 2/156 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L PD LP G  GD  GY I  G D FISV+NLHRSP+ W  P+ F PERF     +
Sbjct  366  IRRALAPDTLPPGLKGDPAGYPIGKGADPFISVWNLHRSPHLWKDPDTFRPERFSEPHSN  425

Query  572  EIEG--WAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQK  399
               G  WAG+ P  SPGALYPNE+ SDFAF+PFGGG RKC+GDQFAL E+ +ALA+LL+ 
Sbjct  426  PAFGSAWAGYRPDASPGALYPNEVTSDFAFIPFGGGARKCIGDQFALFEATVALALLLRD  485

Query  398  FDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
            F   L  +PE V + TGATIHT NGL  K+  R  V
Sbjct  486  FTFKLAVSPEQVGMATGATIHTANGLPMKITIRRAV  521



>emb|CBJ27249.1| Cytochrome P450 [Ectocarpus siliculosus]
Length=574

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 115/153 (75%), Gaps = 2/153 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L  D+LP G +GD     I  G D+F+++YNLHRS  FW+ PN+F+PERF+   ++
Sbjct  394  IRRALESDELPPG-SGDGHRPKITRGVDLFLAIYNLHRSEDFWENPNKFDPERFERPFQN  452

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            + +EGWAGF+P    G LYPNEI SDFA+LPFGGG RKCVGDQFA+MES ++LAML ++F
Sbjct  453  KGVEGWAGFNPDLLEGKLYPNEIASDFAYLPFGGGQRKCVGDQFAMMESVVSLAMLTRRF  512

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  297
            + +L   PE V   TGATIHT+NGL  ++KKR+
Sbjct  513  EFELMIKPEEVGFYTGATIHTRNGLPMRVKKRV  545



>gb|AGK38423.1| CYP97B1 [Parachlorella kessleri]
Length=607

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 108/153 (71%), Gaps = 2/153 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L  D LP G NGD +GY I  G D+FIS +NLHRSP+ W  P+ F PERF  R E+
Sbjct  438  IRRALGDDVLPAGLNGDPNGYPIGKGADLFISSWNLHRSPHLWKDPDTFRPERFAERFEN  497

Query  572  -EIEG-WAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQK  399
               EG WAG+DP     +LYPNE+ SDFA LPFGGG RKCVGDQFA+ME+ +AL MLL++
Sbjct  498  PAFEGRWAGYDPELQGNSLYPNEVASDFALLPFGGGIRKCVGDQFAIMEATVALTMLLRR  557

Query  398  FDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            F   L G+ + V + TGATIHT NGL   +++R
Sbjct  558  FRFRLAGSAKDVGMATGATIHTANGLKVTVQRR  590



>gb|AGK38421.1| CYP97B1 [Parachlorella kessleri]
Length=607

 Score =   175 bits (443),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 107/153 (70%), Gaps = 2/153 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L  D LP G NGD +GY I  G D+FIS +NLHRSP+ W  P+ F PERF  R E+
Sbjct  438  IRRALGDDVLPAGLNGDPNGYPIGKGADLFISSWNLHRSPHLWKDPDTFRPERFAERFEN  497

Query  572  -EIEGW-AGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQK  399
               EG  AG+DP     +LYPNE+ SDFA LPFGGG RKCVGDQFA+ME+ +AL MLL++
Sbjct  498  PAFEGRRAGYDPELQGNSLYPNEVASDFALLPFGGGIRKCVGDQFAIMEATVALTMLLRR  557

Query  398  FDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            F   L G+ + V + TGATIHT NGL   +++R
Sbjct  558  FRFRLAGSAKDVGMATGATIHTANGLKVTVRRR  590



>ref|XP_002955478.1| hypothetical protein VOLCADRAFT_65884 [Volvox carteri f. nagariensis]
 gb|EFJ43549.1| hypothetical protein VOLCADRAFT_65884 [Volvox carteri f. nagariensis]
Length=641

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 106/153 (69%), Gaps = 2/153 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERF-QVRKE  576
            IRR+L  D LPGG  GD  GY I  G D+FISV+NLHRSPY W  P+ F P+RF +    
Sbjct  463  IRRALGEDVLPGGLRGDPAGYPIGTGADLFISVWNLHRSPYLWKDPDTFRPDRFFESYSN  522

Query  575  SEIEG-WAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQK  399
             + EG WAG        ALYPNE+ SDFAF+PFGGG RKCVGDQFA+ E+ +ALA+LL++
Sbjct  523  PDFEGKWAGAYAVSGGAALYPNEVGSDFAFIPFGGGARKCVGDQFAMFEATVALAVLLRR  582

Query  398  FDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            F   L+G PE V + TGATIHT NGL  ++ +R
Sbjct  583  FSFALEGPPEKVGMATGATIHTANGLMVRVSRR  615



>gb|KIY95180.1| hypothetical protein MNEG_12781 [Monoraphidium neglectum]
Length=168

 Score =   159 bits (403),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 94/134 (70%), Gaps = 2/134 (1%)
 Frame = -3

Query  695  GYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQ-VRKESEIEG-WAGFDPSRSPGAL  522
            GY I  G D+FISV+NLHRSP+ W  P+ F PER++ V    +  G WAG+ P    GAL
Sbjct  16   GYPIGKGADLFISVWNLHRSPHLWKDPDTFRPERYEEVHTNPQYGGKWAGYQPEAGRGAL  75

Query  521  YPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGAT  342
            YPNE+ SDFAF+PFGGG RKC+GDQFAL E+ +A AMLL+++   L  TP+ + + TGAT
Sbjct  76   YPNEVASDFAFIPFGGGARKCIGDQFALFEATVAFAMLLRRYTFRLAATPQEIGMATGAT  135

Query  341  IHTKNGLWCKLKKR  300
            IHT NG+   + +R
Sbjct  136  IHTANGMMVSVSRR  149



>emb|CBJ27248.1| Cytochrome P450 [Ectocarpus siliculosus]
Length=774

 Score =   168 bits (426),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 104/146 (71%), Gaps = 6/146 (4%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDG-YAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKE  576
            IRR+L+  +LP    G  DG   +  GTD+FIS +NLHRS   WD+P E+ PERF     
Sbjct  539  IRRALKETELP---QGGADGPVKLVKGTDVFISTWNLHRSKELWDRPAEYMPERFLSEFR  595

Query  575  SE-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQK  399
            +E + GW GF P    G LYP+EI +DFAFLPFGGG RKCVGDQFA+ME+ ++LAM+L+K
Sbjct  596  NEGVVGWKGFTPKMGAG-LYPSEIDADFAFLPFGGGTRKCVGDQFAMMEATVSLAMMLKK  654

Query  398  FDIDLKGTPESVKLVTGATIHTKNGL  321
             D  L GTPE V +VTGATIHTKNGL
Sbjct  655  LDFTLVGTPEDVGMVTGATIHTKNGL  680



>ref|XP_002292287.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED90262.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=736

 Score =   167 bits (423),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 109/153 (71%), Gaps = 2/153 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KE  576
            IRR+   D LP G +G   G  +  GTDIFIS +NLHR+P +W+ P +++P R++ R K 
Sbjct  530  IRRARSEDNLPAGGSGLSGGVKVLRGTDIFISTWNLHRAPEYWENPEKYDPTRWERRFKN  589

Query  575  SEIEGWAGFDPSR-SPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQK  399
              ++GW G+DP + S  +LYPNEI +D+AFLPFG G RKC+GDQFA++E+++ LAM++ K
Sbjct  590  PGVKGWNGYDPEKQSESSLYPNEITADYAFLPFGAGKRKCIGDQFAMLEASVTLAMIINK  649

Query  398  FDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            FD  L G+P+ V + TGATIHT NGL   + +R
Sbjct  650  FDFTLVGSPKDVGMKTGATIHTMNGLNLVVSRR  682



>gb|EWM30289.1| cytochrome p450 [Nannochloropsis gaditana]
Length=623

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 104/154 (68%), Gaps = 7/154 (5%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQ---VR  582
            IRR+L    LP G  G +    I  G DIFIS+YNLHR P  W  PN F+PER+    + 
Sbjct  454  IRRALEDHSLPKGTAGFE--ARIIRGCDIFISIYNLHRDPDLWPNPNSFDPERYLRPFIN  511

Query  581  KESEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQ  402
            KE   E WAGFDP++  G LYPNEI SDFA LPFGGG RKCVGDQFA +E+ + LAMLL+
Sbjct  512  KEKYPE-WAGFDPAQVTG-LYPNEIASDFAMLPFGGGARKCVGDQFATLEATVTLAMLLR  569

Query  401  KFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            +FD D  G PE V + TGATIHT+NGL    ++R
Sbjct  570  RFDFDFVGKPEDVGMFTGATIHTRNGLRMTPRRR  603



>ref|XP_005650550.1| cytochrome P450 [Coccomyxa subellipsoidea C-169]
 gb|EIE26006.1| cytochrome P450 [Coccomyxa subellipsoidea C-169]
Length=533

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 101/160 (63%), Gaps = 9/160 (6%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFIS-------VYNLHRSPYFWDKPNEFEPER  594
            IRR+L  D LP    GD  GY I  G DIFIS         +LHRSP+ W  P+ F PER
Sbjct  356  IRRALSDDVLPAPLGGDSSGYPIGKGADIFISSSSGTIMFQSLHRSPHLWKDPDTFRPER  415

Query  593  F-QVRKESEIEG-WAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIA  420
            F +        G WAG+ P     + YPNE+ SDFAF+PFGGG RKCVGDQFAL+E+ +A
Sbjct  416  FSETNSNPAFNGAWAGYRPEAQGSSFYPNEVASDFAFIPFGGGARKCVGDQFALLEATVA  475

Query  419  LAMLLQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            L MLL++F  D    PESV + TGATIHT NGL  ++++R
Sbjct  476  LTMLLRRFTFDFVEGPESVGMATGATIHTANGLQVRVQRR  515



>gb|EJK63850.1| hypothetical protein THAOC_15469 [Thalassiosira oceanica]
Length=714

 Score =   164 bits (416),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 107/150 (71%), Gaps = 2/150 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KE  576
            IRR+   D LP G +G K G  +  GTDIFIS +NLHR+P +WD+P +++P R++     
Sbjct  527  IRRAREEDTLPAGGSGLKGGIKVLRGTDIFISTWNLHRAPEYWDEPEKYDPTRWERPFSN  586

Query  575  SEIEGWAGFDPSR-SPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQK  399
             +I+ W G++P + S   LYPNEI +DFAFLPFG G RKC+GDQFA++E+++ LAML+ K
Sbjct  587  PDIKDWLGYNPEKISSQFLYPNEIAADFAFLPFGAGKRKCIGDQFAMLEASVTLAMLMNK  646

Query  398  FDIDLKGTPESVKLVTGATIHTKNGLWCKL  309
            FD+ L G PE V + TGATIHT NGL  K+
Sbjct  647  FDLTLVGKPEDVGMKTGATIHTMNGLNMKV  676



>emb|CDY09055.1| BnaC08g10090D [Brassica napus]
Length=214

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 90/115 (78%), Gaps = 12/115 (10%)
 Frame = -3

Query  608  FEPERF-QVRKESEIEGWAGFDPSRSPGALYPNEI-----------ISDFAFLPFGGGPR  465
            FEPERF + +K + IEGWAGFDPSRSPGALYPNE+            S     PFGGGPR
Sbjct  98   FEPERFLRTKKSNTIEGWAGFDPSRSPGALYPNEVKMKTCKYNISYHSRLCIFPFGGGPR  157

Query  464  KCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             C+GDQFALMES +ALA+LLQKFD++++ +PESV+LV+GATI+ KNG+WCKLK+R
Sbjct  158  NCIGDQFALMESTVALAILLQKFDVEVRESPESVELVSGATINAKNGMWCKLKRR  212



>ref|XP_005845008.1| hypothetical protein CHLNCDRAFT_138471 [Chlorella variabilis]
 gb|EFN52906.1| hypothetical protein CHLNCDRAFT_138471 [Chlorella variabilis]
Length=614

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 104/158 (66%), Gaps = 7/158 (4%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            +R +L  D LP G  GD +GY I  G D+FIS++NLHRSP+ W  P+ F PERF  +   
Sbjct  445  VRVALGEDVLPAGLGGDPNGYPIGKGADLFISLWNLHRSPHLWKDPDTFRPERFTGQLGE  504

Query  572  EIEG------WAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAM  411
                      WAG+ P     +LYPNE+ SDFAFLPFGGG RKC+GDQFA+ E+A+ L M
Sbjct  505  RFVNAAFGGKWAGYTPGGEGSSLYPNEVSSDFAFLPFGGGARKCIGDQFAVTEAALILVM  564

Query  410  LLQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  297
            LL++F   L+  P+ V + TGATIHT NGL C +++R+
Sbjct  565  LLRRFRFRLQ-DPQGVGMATGATIHTANGLKCTVERRV  601



>gb|AAL73435.1|AF459441_1 cytochrome P450 [Skeletonema costatum]
Length=659

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 105/146 (72%), Gaps = 2/146 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KE  576
            IRR+ + D LP G  G   G  +  GTDIFIS +NLHR+P +W+  ++++P R++   K 
Sbjct  461  IRRARQEDTLPPGGTGLSGGVKVLRGTDIFISTWNLHRAPEYWENADKYDPTRWERPFKN  520

Query  575  SEIEGWAGFDPSR-SPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQK  399
              ++GW G+DP + S  +LYPNEI SD+AFLPFG G RKC+GDQFA++E+++ L+M++ K
Sbjct  521  PGVKGWNGYDPEKQSSQSLYPNEITSDYAFLPFGAGKRKCIGDQFAMLEASVTLSMIMNK  580

Query  398  FDIDLKGTPESVKLVTGATIHTKNGL  321
            FD  L GTPE V + TGATIHT NGL
Sbjct  581  FDFTLVGTPEDVGMKTGATIHTMNGL  606



>ref|XP_001421212.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99505.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=560

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 107/152 (70%), Gaps = 4/152 (3%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+++   LP G NG +    + AGTD FI+V+NLHRSP  W+ P +F+P RF  R E+
Sbjct  412  IRRAIKDVTLPRGGNGKE--ITLKAGTDCFIAVWNLHRSPDLWEDPEKFDPSRFSRRFEN  469

Query  572  -EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGW G +P    G LYPNE  +DF+++PFGGG R+C GDQFA++E+  AL++LL+KF
Sbjct  470  PAIEGWGGLNPELMTG-LYPNEQCTDFSYVPFGGGQRRCAGDQFAMLEAVTALSVLLKKF  528

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
              +L   P  V+++TGATIHTK GL  KLK+R
Sbjct  529  KFELACEPGEVEMITGATIHTKKGLPMKLKRR  560



>emb|CEG01697.1| Cytochrome P450, conserved site [Ostreococcus tauri]
Length=568

 Score =   158 bits (399),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 107/152 (70%), Gaps = 4/152 (3%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+++   LP G NG +    + AGTD FI+V+NLHRSP  W+ P +F+P RF  R  +
Sbjct  419  IRRAIKDVTLPRGGNGKE--ITLKAGTDCFIAVWNLHRSPDLWENPEKFDPSRFSRRFTN  476

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            E IEGW G +P    G LYPNE  +DF+++PFGGG R+C GDQFA++E+  +L++LL+KF
Sbjct  477  EAIEGWGGLNPDLMTG-LYPNEQSTDFSYVPFGGGQRRCAGDQFAMLEAVTSLSVLLKKF  535

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
              +L   P  V+++TGATIHTK GL  K+K+R
Sbjct  536  KFELDCPPNDVEMITGATIHTKKGLPMKIKRR  567



>ref|XP_005827896.1| cytochrome P450 [Guillardia theta CCMP2712]
 gb|EKX40916.1| cytochrome P450 [Guillardia theta CCMP2712]
Length=491

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 110/164 (67%), Gaps = 15/164 (9%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKD----------GYAIPAGTDIFISVYNLHRSPYFWDKPNEFE  603
            +RR+L+  +LP  ++G  +          G +I  G +IFISV+NLHR+P  WD P+ F+
Sbjct  328  LRRALKETKLPVAHSGSHEDQASSDMQPSGVSISPGANIFISVWNLHRNPKLWDNPDSFD  387

Query  602  PERFQVRKESEIEG---WAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALME  432
            P R+ +R +    G   WAG+ P +  G LYPNE  +++ ++PFGGG RKCVGDQFA+ E
Sbjct  388  PSRW-LRPQPATNGHSSWAGYTPRKDMG-LYPNENDANYGYIPFGGGQRKCVGDQFAMQE  445

Query  431  SAIALAMLLQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            + + L+ L Q+FDI+L G+PE V + TGATIH+KNGL  +LKKR
Sbjct  446  AVVILSKLFQRFDIELAGSPEEVGMSTGATIHSKNGLMIRLKKR  489



>gb|AHA51695.1| P450-type beta-carotene hydroxylase CYP97B29 [Porphyra umbilicalis]
Length=658

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 106/155 (68%), Gaps = 8/155 (5%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPER-FQVRKE  576
            IRR L  D LPGG  G      +  GTD+FI VY++HRSP  W++P+ F P+R  +    
Sbjct  492  IRRLLADDTLPGGEIGKPTN--LKRGTDVFICVYSMHRSPALWEEPDVFNPDRWLKPFSN  549

Query  575  SEIEGWAGF---DPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLL  405
              +EGW+G+   DP+R+  +LYPNE+ +DFAFLPFGGG RKCVGDQFA++ES +A A L+
Sbjct  550  PGVEGWSGYNPPDPNRA--SLYPNEVNADFAFLPFGGGSRKCVGDQFAMLESTVAFATLV  607

Query  404  QKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            ++FD  L   P  V + TGATIHTK G+  +++KR
Sbjct  608  RRFDFSLGCAPSEVGVDTGATIHTKGGMPIRVRKR  642



>ref|XP_003074608.1| cytochrome P450 (ISS) [Ostreococcus tauri]
 emb|CAL50459.1| Cytochrome P450, conserved site [Ostreococcus tauri]
Length=576

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 105/152 (69%), Gaps = 4/152 (3%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KE  576
            IRR L    LP G  GD +   I  G DIFISV+NLHRSP  W+ P EF+P RF+     
Sbjct  417  IRRCLEDVTLPKG-AGDAEVTLI-KGMDIFISVWNLHRSPECWENPEEFDPFRFKRPFAN  474

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              ++ WAG++P    G LYPNE+ SDFAF+PFG G RKC+GDQFA++E+ IA+AM+L+++
Sbjct  475  PGVKDWAGYNPELFTG-LYPNEVASDFAFIPFGAGARKCIGDQFAMLEATIAMAMVLRRY  533

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D +L   P+ + +  GATIHT+ GL C++++R
Sbjct  534  DFELTTDPKDIGMTMGATIHTEKGLPCRVRRR  565



>ref|XP_003061074.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54724.1| predicted protein [Micromonas pusilla CCMP1545]
Length=557

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 103/152 (68%), Gaps = 4/152 (3%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KE  576
            IRR+LR   LP G  G      +  GTD F++V+NLHRSP  W+ P +F+P RF+   + 
Sbjct  408  IRRALRDVTLPRGGMGK--AITLKKGTDCFVAVWNLHRSPDLWENPEKFDPSRFKRPFQN  465

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              +EGW G  P  + G LYPNE  +DFA++PFGGG R+C GD FA+ME+ +AL++L+++F
Sbjct  466  PAVEGWRGLQPELATG-LYPNETSTDFAYVPFGGGQRRCAGDMFAMMEATVALSVLMKRF  524

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D++L    E V+++TGATIHTK G+  KL  R
Sbjct  525  DVELACEKEDVEMITGATIHTKAGMPVKLTPR  556



>ref|XP_007509002.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20088.1| predicted protein [Bathycoccus prasinos]
Length=584

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 102/152 (67%), Gaps = 4/152 (3%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KE  576
            IRR L    LP G  GD+D   I  G D+FISV+NLHRSP  W+ P+E++PERF+   K 
Sbjct  434  IRRCLEDVPLPRG-AGDRDITLI-KGMDVFISVWNLHRSPECWENPDEYDPERFKKPFKN  491

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              ++ WAG++P    G LYPNEI SD+AF+PFG G RKC+GDQFA +E+ I+L M L+KF
Sbjct  492  PGVKDWAGYNPDLLTG-LYPNEIASDYAFIPFGAGARKCIGDQFATLEATISLVMTLRKF  550

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
              +L+  P  + +  GATIHT  GL C LK R
Sbjct  551  TFNLQKDPNEIGMEMGATIHTAGGLPCTLKLR  582



>ref|XP_005830096.1| cytochrome P450 [Guillardia theta CCMP2712]
 gb|EKX43116.1| cytochrome P450 [Guillardia theta CCMP2712]
Length=498

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 102/156 (65%), Gaps = 5/156 (3%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFW-DKPNEFEPER-FQVRK  579
            IRR+L  D LP  + G++    +  GTDIF+ V+NLHRSP  W D  + F P+R    R 
Sbjct  343  IRRALDDDVLPLAW-GNEKQVKVFRGTDIFMLVWNLHRSPVLWGDDADAFRPDRWLSSRS  401

Query  578  ESEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQK  399
              ++ GW G+ P+     LYPNE+ SDFAF PFG GPRKC+GDQFA +ES + L+ +LQ+
Sbjct  402  NPDVPGWEGYKPNMK--NLYPNEVSSDFAFCPFGAGPRKCIGDQFAFLESVVILSRVLQE  459

Query  398  FDIDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
            FDI L  +PE V + TGATIHT+ GL   L+ R +V
Sbjct  460  FDIQLATSPEEVGMTTGATIHTEKGLKVSLRARKNV  495



>ref|XP_005715216.1| cytochrome P450 family 97G-CYP97G1 [Chondrus crispus]
 emb|CDF35397.1| cytochrome P450 family 97G-CYP97G1 [Chondrus crispus]
Length=591

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 102/148 (69%), Gaps = 6/148 (4%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR L    LP G  G  +   +P G+DIFI+VY+LHRSP  WD P  ++P+R+   K +
Sbjct  415  IRRLLEDTTLPKG--GSPEVTNLPRGSDIFINVYSLHRSPALWDDPEIYDPDRWLKPKSN  472

Query  572  E-IEGWAGFDPS---RSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLL  405
              +EGWAG+ P+        LYPNE+ +DFAFLPFGGG RKCVGD FA++ES +ALAM++
Sbjct  473  PGVEGWAGYKPASGLEEGTPLYPNEVNADFAFLPFGGGSRKCVGDHFAVLESVVALAMVI  532

Query  404  QKFDIDLKGTPESVKLVTGATIHTKNGL  321
            ++FD  +    + V++ TGATIHTKNGL
Sbjct  533  RQFDFVMVDPSKDVEMTTGATIHTKNGL  560



>ref|XP_002178724.1| lutein deficient 1-like protein [Phaeodactylum tricornutum CCAP 
1055/1]
 gb|EEC49422.1| lutein deficient 1-like protein [Phaeodactylum tricornutum CCAP 
1055/1]
Length=769

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 102/151 (68%), Gaps = 2/151 (1%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERF-QVRKE  576
            IRR+   D LP G +  K G  +  GTD+FIS +NLHRSP  W+ P  F+P R+ +    
Sbjct  556  IRRARTEDNLPAGSSDLKSGVKVLRGTDMFISTWNLHRSPDLWENPEVFDPTRWDRPFNN  615

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
            + I GW+G++P +  G LYP+E  +DFAFLPFGGG RKCVGDQFA+ME+ + +A++++K+
Sbjct  616  AGIPGWSGYNPDKVSG-LYPSENAADFAFLPFGGGQRKCVGDQFAMMEATVTMALMIKKY  674

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKK  303
            D D     E V + TGATIHT NGL  + ++
Sbjct  675  DFDFAIPAEDVGMKTGATIHTMNGLMMRARQ  705



>ref|XP_002506798.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68056.1| predicted protein [Micromonas sp. RCC299]
Length=573

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 103/152 (68%), Gaps = 4/152 (3%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KE  576
            IRR+L    LP G  G +    +  GTD F++V+NLHRSP  WD+P+ F+P RF+   K 
Sbjct  422  IRRALEDVTLPAGGMGRE--ITLKKGTDCFVAVWNLHRSPDLWDRPDVFDPARFKREFKN  479

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
             +IEGW G  P    G LYPNE  +DFA++PFGGG R+C GD FA+ME+ +AL++LL++F
Sbjct  480  PKIEGWNGLSPELVTG-LYPNEQSTDFAYVPFGGGQRRCAGDMFAMMEATVALSVLLKRF  538

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            + +L      V+++TGATIHTK G+  KL+ R
Sbjct  539  EFELGCDESEVEMITGATIHTKAGMPVKLRSR  570



>ref|XP_001415984.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94276.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=563

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 105/152 (69%), Gaps = 4/152 (3%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KE  576
            IRR L    LP G  GD +   I  G DIFISV+NLHRSP  W+ P+EF+P RF+   K 
Sbjct  411  IRRCLEDVTLPKG-AGDVEVTLI-KGMDIFISVWNLHRSPECWENPDEFDPFRFKRPFKN  468

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              ++ WAG++P    G LYPNE+ SDFAF+PFG G RKC+GDQFA++E+ IA+AM L+++
Sbjct  469  PGVKDWAGYNPDLLTG-LYPNEVASDFAFIPFGAGARKCIGDQFAMLEATIAMAMTLRRY  527

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D +L+  P+ + +  GATIHT  GL  K+K+R
Sbjct  528  DFELQKDPKDIGMEMGATIHTAGGLPMKIKRR  559



>ref|XP_002185035.1| lut1-1 [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC43482.1| lut1-1 [Phaeodactylum tricornutum CCAP 1055/1]
Length=538

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 103/167 (62%), Gaps = 19/167 (11%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERF-QVRKE  576
            IRR   PD+LP G   +     +  G DIF++VYN+HR   FW  P+ F+P RF +    
Sbjct  371  IRRCRTPDELPQGAGREA---KVIRGMDIFMAVYNIHRDERFWPSPDTFDPLRFTRSHSN  427

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
             ++ GWAGFDP +  G LYPNE+ SDFAFLPFGGG RKCVGD+FA++E+ + LAM+L++F
Sbjct  428  PDVPGWAGFDPKKWEGKLYPNEVASDFAFLPFGGGARKCVGDEFAILEATVTLAMVLRRF  487

Query  395  DIDL---------------KGTPESVKLVTGATIHTKNGLWCKLKKR  300
            +                  +G    V + TGATIHT+NGL   ++KR
Sbjct  488  EFSFDESKFEGKDDILSSAQGLNHPVGMRTGATIHTRNGLHLVVEKR  534



>ref|XP_002185034.1| lutein deficient 1-like protein [Phaeodactylum tricornutum CCAP 
1055/1]
 gb|EEC43481.1| lutein deficient 1-like protein [Phaeodactylum tricornutum CCAP 
1055/1]
Length=644

 Score =   149 bits (377),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 103/167 (62%), Gaps = 19/167 (11%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERF-QVRKE  576
            IRR   PD+LP G   +     +  G DIF++VYN+HR   FW  P+ F+P RF +    
Sbjct  477  IRRCRTPDELPQGAGREA---KVIRGMDIFMAVYNIHRDERFWPSPDTFDPLRFTRSHSN  533

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
             ++ GWAGFDP +  G LYPNE+ SDFAFLPFGGG RKCVGD+FA++E+ + LAM+L++F
Sbjct  534  PDVPGWAGFDPKKWEGKLYPNEVASDFAFLPFGGGARKCVGDEFAILEATVTLAMVLRRF  593

Query  395  DIDL---------------KGTPESVKLVTGATIHTKNGLWCKLKKR  300
            +                  +G    V + TGATIHT+NGL   ++KR
Sbjct  594  EFSFDESKFEGKDDILSSAQGLNHPVGMRTGATIHTRNGLHLVVEKR  640



>ref|XP_007514506.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14746.1| predicted protein [Bathycoccus prasinos]
Length=591

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 103/152 (68%), Gaps = 4/152 (3%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR-KE  576
            IRR++    LP G  G      +  GTD FI+V+NLHRSP  W+ P+ F+P R+  +   
Sbjct  440  IRRAIETVDLPKGGMGK--SIQLKKGTDCFIAVWNLHRSPDHWENPDLFDPSRWDRKFTN  497

Query  575  SEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
             +IEGW G+DP    G LYPNE+ +D+A++PFGGG R+C GD FA+ME+ +AL++LL+KF
Sbjct  498  PKIEGWNGYDPELVTG-LYPNEVATDYAYVPFGGGQRRCAGDVFAMMEATVALSVLLKKF  556

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
              +L    + V+++TGATIHTK GL  + K+R
Sbjct  557  SFELACDEKDVQMITGATIHTKKGLPVRAKRR  588



>ref|XP_009032928.1| hypothetical protein AURANDRAFT_19592 [Aureococcus anophagefferens]
 gb|EGB11800.1| hypothetical protein AURANDRAFT_19592 [Aureococcus anophagefferens]
Length=527

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 107/172 (62%), Gaps = 21/172 (12%)
 Frame = -3

Query  752  IRRSLRPD-----QLPGGYNGDKDGY-------AIPAGTDIFISVYNLHRSPYFWDKPNE  609
            IRR++  D     QLP     D  G         +P   D+FI++Y+LHR+P +W  P+ 
Sbjct  354  IRRAVDDDAVPTVQLPDTDELDASGLRARAVDVKVPRACDMFIAIYSLHRNPRYWKNPDS  413

Query  608  FEPERFQVRKESEIE-GWAGFDPSR-----SPGALYPNEIISDFAFLPFGGGPRKCVGDQ  447
            F+P+R+  +  +  E  WAG+DP++       G+LYP E  +DFA+LPFGGG RKCVGDQ
Sbjct  414  FDPKRWLEKYANPDEPTWAGYDPAKWKAGDGMGSLYPTETSADFAYLPFGGGARKCVGDQ  473

Query  446  FALMESAIALAMLLQKFDIDLKG---TPESVKLVTGATIHTKNGLWCKLKKR  300
            FA+ME+ +ALA  LQ+FD D  G   TP+ V   TGATIHT+NGLW  + +R
Sbjct  474  FAMMEATVALAGFLQRFDFDFAGPTDTPDKVGTNTGATIHTRNGLWMTVTER  525



>ref|XP_009034650.1| hypothetical protein AURANDRAFT_21944, partial [Aureococcus anophagefferens]
 gb|EGB11100.1| hypothetical protein AURANDRAFT_21944, partial [Aureococcus anophagefferens]
Length=279

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 107/170 (63%), Gaps = 20/170 (12%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKE-  576
            IRR+L  D+LP  Y  D+D   I  GTD+F+S ++LH++P  WD+P  F+P R++ +KE 
Sbjct  107  IRRALDSDELPQPY-ADEDRVKIARGTDVFMSTWSLHKNPALWDEPESFDPTRWERKKEP  165

Query  575  --SEIEGWAGFDPSRSPG-ALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLL  405
                  GW G+DP++ P  ALYP E  +D+AFLPFG G R+CVGDQFA++E+ + L  L+
Sbjct  166  GPDAPAGWRGYDPAKIPAQALYPTEQSADYAFLPFGAGNRRCVGDQFAILEATVMLTTLI  225

Query  404  QKFDID--------------LKGTPES-VKLVTGATIHTKNGLWCKLKKR  300
            ++FD +              L G P + V + TGATIHT++GLW   K R
Sbjct  226  REFDFEFALDDPSTLAPKTGLGGLPVADVGMRTGATIHTEHGLWMTAKPR  275



>emb|CDY61653.1| BnaCnng38160D [Brassica napus]
Length=260

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 88/124 (71%), Gaps = 16/124 (13%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IR +L+P+ L GGY G+++G+ +P  TDIFISV               FEP+RF   KES
Sbjct  152  IRHTLKPETLNGGYKGEEEGHKVPKRTDIFISV---------------FEPDRFLRTKES  196

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              IEGWAGFDPSRSPGALYPNEII+DF  LPFGGGPRKC+G+QFALMES +ALA +  + 
Sbjct  197  NGIEGWAGFDPSRSPGALYPNEIIADFQSLPFGGGPRKCIGEQFALMESTVALANVWNRL  256

Query  395  DIDL  384
             + +
Sbjct  257  SLRI  260



>gb|ACF83994.1| unknown [Zea mays]
Length=76

 Score =   135 bits (340),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = -3

Query  524  LYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGA  345
            +YPNEII+DFAFLPFGGGPRKCVGDQFAL+ES +ALA+LL+KFD++L+G+P+ V++VTGA
Sbjct  1    MYPNEIIADFAFLPFGGGPRKCVGDQFALLESTVALALLLRKFDVELRGSPDEVEMVTGA  60

Query  344  TIHTKNGLWCKLKKR  300
            TIHTKNGLWC+L++R
Sbjct  61   TIHTKNGLWCRLRRR  75



>ref|XP_007145289.1| hypothetical protein PHAVU_007G2265000g, partial [Phaseolus vulgaris]
 gb|ESW17283.1| hypothetical protein PHAVU_007G2265000g, partial [Phaseolus vulgaris]
Length=129

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 94/152 (62%), Gaps = 26/152 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+  PD+LPG Y        + AG DI ISVYN+HRS   WD+  EF PERF      
Sbjct  3    IRRAQVPDELPGSYK-------VNAGQDIMISVYNIHRSSEVWDRAEEFMPERF------  49

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            +++G              PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ +Q  +
Sbjct  50   DLDGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALMEAIVALAIFIQHMN  97

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  297
             +L    +++ + TGATIHT NGL+ KL +RL
Sbjct  98   FELV-PDQNISMTTGATIHTTNGLYMKLSQRL  128



>gb|AGK38422.1| CYP97B2 [Parachlorella kessleri]
Length=576

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 91/130 (70%), Gaps = 2/130 (2%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L  D LP G NGD +GY I  G D+FIS +NLHRSP+ W  P+ F PERF  R E+
Sbjct  438  IRRALGDDVLPAGLNGDPNGYPIGKGADLFISSWNLHRSPHLWKDPDTFRPERFAERFEN  497

Query  572  -EIEG-WAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQK  399
               EG WAG+DP     +LYPNE+ SDFA LPFGGG RKCVGDQFA+ME+ +AL MLL++
Sbjct  498  PAFEGRWAGYDPELQGNSLYPNEVASDFALLPFGGGIRKCVGDQFAIMEATVALTMLLRR  557

Query  398  FDIDLKGTPE  369
              +   G P+
Sbjct  558  RRLRADGRPQ  567



>ref|XP_002293604.1| cytochrome P450 [Thalassiosira pseudonana CCMP1335]
 gb|EED89340.1| cytochrome P450 [Thalassiosira pseudonana CCMP1335]
Length=546

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 108/169 (64%), Gaps = 21/169 (12%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRK-E  576
            IRR    ++LP G  G ++   I  G DIF+S+YNLH    FW +PNEF+PER++ +   
Sbjct  379  IRRCRTENKLPKG--GGREATVI-RGMDIFLSLYNLHHDERFWPEPNEFKPERWESKYIN  435

Query  575  SEIEGWAGFDPSRSPGA-LYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQK  399
             E+  WAG+DP++     LYPNE+ SDFA+LPFGGG RKCVGD+FA +E+ + LAMLL++
Sbjct  436  PEVPEWAGYDPAKWINTNLYPNEVASDFAYLPFGGGARKCVGDEFATLEATVTLAMLLRR  495

Query  398  FD------------IDLKGTPE----SVKLVTGATIHTKNGLWCKLKKR  300
            F+            ID+   PE    +V + TGATIHT+ GL   ++KR
Sbjct  496  FEFEFDSAKLAASKIDIMDHPEDLEHAVGMRTGATIHTRKGLHMVIRKR  544



>ref|XP_004516959.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=537

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 95/152 (63%), Gaps = 26/152 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L PD+LPG Y        + AG DI ISVYN+HRS   WD+  EF PERF      
Sbjct  411  IRRALVPDELPGAYK-------VNAGQDIMISVYNIHRSSEVWDRAEEFLPERF------  457

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            E++G              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  +
Sbjct  458  ELDGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEATVALAVFLQNMN  505

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  297
             +L    +++ + TGATIHT NGL+ KL +RL
Sbjct  506  FELVPN-QNISMTTGATIHTTNGLYMKLNRRL  536



>ref|XP_005648231.1| CYP97C3 [Coccomyxa subellipsoidea C-169]
 gb|EIE23687.1| CYP97C3 [Coccomyxa subellipsoidea C-169]
Length=540

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 96/151 (64%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            +RR+   D LPGGY+       +P G D+ ISVYN+HRSP  WD PN+F PERF      
Sbjct  390  LRRAQVADTLPGGYS-------VPVGQDVMISVYNIHRSPAVWDDPNDFRPERF------  436

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                     P   P    P+E  +D+ F+PF GGPRKCVGDQFALME+ +ALA+LL++FD
Sbjct  437  ---------PLDEP---VPSEQTTDYRFIPFSGGPRKCVGDQFALMEAVVALAVLLKRFD  484

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    + + + TGATIHT+NGL+  +++R
Sbjct  485  FELV-PDQDIGMTTGATIHTQNGLFMTVRER  514



>dbj|BAD94136.1| Cytochrom P450 -like protein [Arabidopsis thaliana]
Length=301

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 94/152 (62%), Gaps = 28/152 (18%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+  PD LPG Y        +  G DI ISVYN+HRS   W+K  EF PERF +    
Sbjct  177  IRRAQVPDILPGNYK-------VNTGQDIMISVYNIHRSSEVWEKAEEFLPERFDI----  225

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                          GA+ PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +
Sbjct  226  -------------DGAI-PNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLN  271

Query  392  IDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  300
            ++L   P +++ + TGATIHT NGL+ K+ +R
Sbjct  272  VEL--VPDQTISMTTGATIHTTNGLYMKVSQR  301



>ref|XP_003542540.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
[Glycine max]
Length=534

 Score =   140 bits (353),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 95/152 (63%), Gaps = 26/152 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+  PD+LPGGY  D       AG DI ISVYN+HRS   WD+  EF PERF      
Sbjct  408  IRRAQVPDELPGGYKLD-------AGQDIMISVYNIHRSSEVWDRAEEFVPERF------  454

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            +++G              PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ  +
Sbjct  455  DLDGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALMEAIVALAIFLQHMN  502

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  297
             +L    +++ + TGATIHT NGL+ KL +RL
Sbjct  503  FELVPD-QNISMTTGATIHTTNGLYMKLSRRL  533



>gb|AGN27239.1| CYP97A1 [Parachlorella kessleri]
Length=647

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 92/154 (60%), Gaps = 25/154 (16%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL PD L G        + I  G DIFI+ +NLHRSP  WD+P+EF+P+RF      
Sbjct  454  IRRSLEPDTLAG--------FEIQEGQDIFIATWNLHRSPQLWDRPDEFDPDRF-----G  500

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
             +EG A            PNE+  DF +LPFGGG RKC+GDQFA+ ES  ALAML+++FD
Sbjct  501  PLEGPA------------PNEVTEDFKYLPFGGGKRKCIGDQFAIFESVTALAMLVRRFD  548

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
                     V + TGATIHT NGLW   K R D+
Sbjct  549  FAFAPDAPPVSMTTGATIHTTNGLWLCPKPRADL  582



>gb|KFK34549.1| hypothetical protein AALP_AA5G160700 [Arabis alpina]
Length=542

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 94/151 (62%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+  PD LPG Y        +  G DI ISVYN+HRS   W+K  EF PERF      
Sbjct  418  IRRAQVPDILPGNYK-------VNTGQDIMISVYNIHRSSVVWEKAEEFLPERF------  464

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            E+EG              PNEI +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +
Sbjct  465  ELEG------------AIPNEINTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLN  512

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            ++L    +++ + TGATIHT NGL+ K+ +R
Sbjct  513  VELVPD-QTISMTTGATIHTTNGLYMKVSQR  542



>ref|XP_002876190.1| hypothetical protein ARALYDRAFT_485688 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52449.1| hypothetical protein ARALYDRAFT_485688 [Arabidopsis lyrata subsp. 
lyrata]
Length=532

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 94/151 (62%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+  PD LPG YN       +  G DI ISVYN+HRS   W+K  EF PERF +    
Sbjct  408  IRRAQVPDILPGNYN-------VNTGQDIMISVYNIHRSSEVWEKAEEFLPERFDIE---  457

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                          GA+ PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +
Sbjct  458  --------------GAI-PNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLN  502

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            ++L    +++ + TGATIHT NGL+ K+ +R
Sbjct  503  VELVPD-QTISMTTGATIHTTNGLYMKVSQR  532



>ref|XP_011397501.1| Cytochrome P450 97B2, chloroplastic [Auxenochlorella protothecoides]
 gb|AHA86562.1| cytochrome P450 like protein [Auxenochlorella protothecoides]
 gb|KFM24613.1| Cytochrome P450 97B2, chloroplastic [Auxenochlorella protothecoides]
Length=567

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 93/151 (62%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L  D L         G+ +P G+DIFISV+NLHRSP  WD+P  F+P+RF +   +
Sbjct  418  IRRALGEDTL--------QGFRLPKGSDIFISVWNLHRSPAHWDRPEAFDPDRFDLAGPT  469

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                              PNEI + FA+LPFGGG RKC+GDQFALMES +ALA+L ++FD
Sbjct  470  ------------------PNEITTGFAYLPFGGGRRKCIGDQFALMESVVALAVLARRFD  511

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            + +      V + TGATIHT NGLW  ++ R
Sbjct  512  VAVPPDAPEVGMTTGATIHTANGLWLNVRPR  542



>ref|XP_003537025.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Glycine 
max]
Length=537

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 95/152 (63%), Gaps = 26/152 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+  PD+LPGGY        + AG DI ISVYN+HRS   WD+  EF PERF      
Sbjct  411  IRRAQVPDELPGGYK-------LNAGQDIMISVYNIHRSSEVWDRAEEFAPERF------  457

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            +++G              PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ  +
Sbjct  458  DLDGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALMEAIVALAIFLQHMN  505

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  297
             +L    ++V + TGATIHT NGL+ KL +RL
Sbjct  506  FELVPD-QNVSMTTGATIHTTNGLYMKLSRRL  536



>gb|KHN36453.1| Carotene epsilon-monooxygenase, chloroplastic [Glycine soja]
Length=674

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 95/152 (63%), Gaps = 26/152 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+  PD+LPGGY        + AG DI ISVYN+HRS   WD+  EF PERF      
Sbjct  548  IRRAQVPDELPGGYK-------LNAGQDIMISVYNIHRSSEVWDRAEEFAPERF------  594

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            +++G              PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ  +
Sbjct  595  DLDGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALMEAIVALAIFLQHMN  642

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  297
             +L    ++V + TGATIHT NGL+ KL +RL
Sbjct  643  FELVPD-QNVSMTTGATIHTTNGLYMKLSRRL  673



>ref|XP_005826161.1| cytochrome P450 [Guillardia theta CCMP2712]
 gb|EKX39181.1| cytochrome P450 [Guillardia theta CCMP2712]
Length=637

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 103/175 (59%), Gaps = 26/175 (15%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDK----DGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQ-  588
            IRR+L  D LP   N D     +   I  G+D F+SV+NLHRSP  WDKP+EF+P+R++ 
Sbjct  463  IRRALDADVLPKASNLDGSVQGNAVKIIKGSDFFLSVWNLHRSPLLWDKPDEFDPDRWRR  522

Query  587  ------------VRKESEIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQF  444
                         R+   +  W G+ P      LYPNE+ +D+AFLPFG GPRKC+GDQF
Sbjct  523  PTPPELVEKYNAQRRAEGLPEWQGYVPDLK--TLYPNEVHADYAFLPFGAGPRKCLGDQF  580

Query  443  ALMESAIALAMLLQKFDIDLKGTPE-------SVKLVTGATIHTKNGLWCKLKKR  300
            ALMES + L  + Q++  +L G  +        V ++ GATIHT NGL  ++K+R
Sbjct  581  ALMESVVMLTKIFQRYSFELVGNHDPKVPNESDVGMMFGATIHTANGLNVRVKRR  635



>ref|XP_001700492.1| cytochrome P450, carotenoid hydroxylase [Chlamydomonas reinhardtii]
 gb|ABQ59244.1| CYP97A5 [Chlamydomonas reinhardtii]
 gb|EDO98047.1| cytochrome P450, carotenoid hydroxylase [Chlamydomonas reinhardtii]
Length=652

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 99/151 (66%), Gaps = 25/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L+ D          D + +PAG+D+FISV+NLHRSP  WD+P++F+PERF      
Sbjct  454  IRRALQDDHF--------DQFTVPAGSDLFISVWNLHRSPKLWDEPDKFKPERF------  499

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                     P  SP    PNE+  +FA+LPFGGG RKC+GDQFAL E+ +ALAML+++++
Sbjct  500  --------GPLDSP---IPNEVTENFAYLPFGGGRRKCIGDQFALFEAVVALAMLMRRYE  548

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L  +  +V + TGATIHT NGL   +++R
Sbjct  549  FNLDESKGTVGMTTGATIHTTNGLNMFVRRR  579



>gb|AGI61105.1| carotenoid hydroxylase [Parachlorella kessleri]
Length=647

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 91/154 (59%), Gaps = 25/154 (16%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL PD L G        + I  G DIFI+ +NLHRSP  WD+P+EF+P+RF      
Sbjct  454  IRRSLEPDTLAG--------FEIQEGQDIFIATWNLHRSPQLWDRPDEFDPDRF-----G  500

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
             +EG A            PNE+  DF  LPFGGG RKC+GDQFA+ ES  ALAML+++FD
Sbjct  501  PLEGPA------------PNEVTEDFKCLPFGGGKRKCIGDQFAIFESVTALAMLVRRFD  548

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
                     V + TGATIHT NGLW   K R D+
Sbjct  549  FAFAPDAPPVSMTTGATIHTTNGLWLCPKPRADL  582



>ref|XP_006391881.1| hypothetical protein EUTSA_v10023482mg [Eutrema salsugineum]
 gb|ESQ29167.1| hypothetical protein EUTSA_v10023482mg [Eutrema salsugineum]
Length=315

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 93/150 (62%), Gaps = 28/150 (19%)
 Frame = -3

Query  746  RSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEI  567
            R+  PD LPG Y        + +G DI ISVYN+HRS   W+K  EF PERF      E+
Sbjct  193  RAQVPDILPGNYK-------VNSGQDIMISVYNVHRSSAVWEKAEEFLPERF------EL  239

Query  566  EGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDID  387
            EG              PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +++
Sbjct  240  EGA------------IPNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLNVE  287

Query  386  LKGTP-ESVKLVTGATIHTKNGLWCKLKKR  300
            L   P +++ + TGATIHT NGL+ K+ +R
Sbjct  288  L--VPDQTISMTTGATIHTTNGLYMKVSRR  315



>ref|XP_002958826.1| hypothetical protein VOLCADRAFT_100143 [Volvox carteri f. nagariensis]
 gb|EFJ40130.1| hypothetical protein VOLCADRAFT_100143 [Volvox carteri f. nagariensis]
Length=671

 Score =   139 bits (351),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 96/151 (64%), Gaps = 25/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L+ D+         D Y +PAG+D+FISV+NLHRSP  WD+P++F+PERF      
Sbjct  454  IRRALQEDKF--------DQYVVPAGSDLFISVWNLHRSPELWDEPDKFKPERF------  499

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                     P   P    PNE+  +F +LPFGGG RKC+GDQFAL E+ +ALAML++++D
Sbjct  500  --------GPLDGP---IPNEVTENFGYLPFGGGRRKCIGDQFALFEALVALAMLVRRYD  548

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
              L  +   V + TGATIHT  GL+  +KKR
Sbjct  549  FVLDTSKPPVGMTTGATIHTTGGLYMHVKKR  579



>ref|XP_003574294.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Brachypodium 
distachyon]
Length=550

 Score =   138 bits (347),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 93/151 (62%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR++  D LPG Y        + AG DI ISVYN+HRSP  WD+ +EF PERF      
Sbjct  412  IRRAIVDDVLPGNYK-------VKAGQDIMISVYNIHRSPEVWDRADEFVPERF------  458

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA++LQK D
Sbjct  459  DLEGPV------------PNESNTDFRFVPFSGGPRKCVGDQFALLEAIVALAVVLQKID  506

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            I L    E + + TGATIHT NGL+  +  R
Sbjct  507  IQLVADQE-INMTTGATIHTTNGLYMNVSLR  536



>ref|XP_001422903.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABP01262.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=461

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 96/154 (62%), Gaps = 29/154 (19%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L P  L GGYN D       AGTD FISV+NLHR+P  WD+P+ F+PERF      
Sbjct  334  IRRALEPVTL-GGYNID-------AGTDFFISVWNLHRNPRIWDEPDAFKPERF------  379

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                     P  +P    PNE   ++A+LPFGGG RKCVGDQFA+ ES ++LAML+++FD
Sbjct  380  ---------PIDAP---MPNEYTEEYAYLPFGGGQRKCVGDQFAIFESIVSLAMLMRRFD  427

Query  392  IDLKGTPE---SVKLVTGATIHTKNGLWCKLKKR  300
             +L  +        + TGATIHT NGL  KLK+R
Sbjct  428  FELDESKHPDGECGMTTGATIHTTNGLHVKLKRR  461



>ref|XP_010504071.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
[Camelina sativa]
Length=545

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 93/151 (62%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+  PD LPG Y        +  G DI ISVYN+HRS   W+K  EF PERF      
Sbjct  421  IRRAQVPDILPGNYK-------VNTGQDIMISVYNIHRSSEVWEKAEEFLPERF------  467

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            E+EG              PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +
Sbjct  468  ELEG------------AIPNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLN  515

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            ++L    +++ + TGATIHT NGL+ K+ +R
Sbjct  516  VELVPD-QTISMTTGATIHTTNGLYMKVSRR  545



>ref|XP_001420992.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO99285.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=495

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 96/154 (62%), Gaps = 29/154 (19%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L P  L GGYN       I AGTD FISV+NLHR+P  WD+P+ F+PERF      
Sbjct  333  IRRALEPVTL-GGYN-------IDAGTDFFISVWNLHRNPRIWDEPDAFKPERF------  378

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                     P  +P    PNE   ++A+LPFGGG RKCVGDQFA+ ES ++LAML+++FD
Sbjct  379  ---------PIDAP---MPNEYTEEYAYLPFGGGQRKCVGDQFAIFESIVSLAMLMRRFD  426

Query  392  IDLKGTPE---SVKLVTGATIHTKNGLWCKLKKR  300
             +L  +        + TGATIHT NGL  KLK+R
Sbjct  427  FELDESKHPDGECGMTTGATIHTTNGLHVKLKRR  460



>ref|XP_010426945.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Camelina 
sativa]
Length=544

 Score =   137 bits (346),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 93/151 (62%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+  PD LPG Y        +  G DI ISVYN+HRS   W+K  EF PERF      
Sbjct  420  IRRAQVPDILPGNYK-------VNTGQDIMISVYNIHRSSEVWEKAEEFLPERF------  466

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            E+EG              PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +
Sbjct  467  ELEG------------AIPNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLN  514

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            ++L    +++ + TGATIHT NGL+ K+ +R
Sbjct  515  VELVPD-QTISMTTGATIHTTNGLYMKVSRR  544



>ref|XP_010515801.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
[Camelina sativa]
Length=545

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 93/151 (62%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+  PD LPG Y        +  G DI ISVYN+HRS   W+K  EF PERF      
Sbjct  421  IRRAQVPDILPGNYK-------VNTGQDIMISVYNIHRSSEVWEKAEEFLPERF------  467

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            E+EG              PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +
Sbjct  468  ELEG------------AIPNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLN  515

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            ++L    +++ + TGATIHT NGL+ K+ +R
Sbjct  516  VELVPD-QTISMTTGATIHTTNGLYMKVSRR  545



>ref|XP_009125249.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Brassica 
rapa]
Length=533

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 93/151 (62%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+  PD LPG Y        +  G DI ISVYN+HRS   W+K  EF PERF      
Sbjct  409  IRRAQVPDVLPGNYK-------VNTGQDIMISVYNVHRSSAVWEKAEEFLPERF------  455

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            E+EG              PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +
Sbjct  456  ELEG------------PIPNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLN  503

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            ++L    +++ + TGATIHT NGL+ K+ +R
Sbjct  504  VELVPD-QTISMTTGATIHTTNGLYMKVSQR  533



>gb|AAM13903.1| putative cytochrome P450 [Arabidopsis thaliana]
Length=552

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 93/151 (62%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+  PD LPG Y        +  G DI ISVYN+HRS   W+K  EF PERF +    
Sbjct  428  IRRAQVPDILPGNYK-------VNTGQDIMISVYNIHRSSEVWEKAEEFLPERFDI----  476

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                          GA+ PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +
Sbjct  477  -------------DGAI-PNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLN  522

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            ++L    +++ + TGATIHT NGL+ K+ +R
Sbjct  523  VELVPD-QTISMTTGATIHTTNGLYMKVSQR  552



>emb|CDY13314.1| BnaC06g14430D [Brassica napus]
Length=533

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 93/151 (62%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+  PD LPG Y        +  G DI ISVYN+HRS   W+K  EF PERF      
Sbjct  409  IRRAQVPDILPGNYK-------VNTGQDIMISVYNVHRSSAVWEKAEEFLPERF------  455

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            E+EG              PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +
Sbjct  456  ELEG------------PIPNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLN  503

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            ++L    +++ + TGATIHT NGL+ K+ +R
Sbjct  504  VELVPD-QTISMTTGATIHTTNGLYMKVSQR  533



>ref|NP_190881.2| carotene epsilon-monooxygenase [Arabidopsis thaliana]
 sp|Q6TBX7.1|LUT1_ARATH RecName: Full=Carotene epsilon-monooxygenase, chloroplastic; 
AltName: Full=Cytochrome P450 97C1; AltName: Full=Protein LUTEIN 
DEFICIENT 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAR83120.1| chloroplast carotenoid epsilon-ring hydroxylase [Arabidopsis 
thaliana]
 gb|AEE79040.1| carotene epsilon-monooxygenase [Arabidopsis thaliana]
Length=539

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 93/151 (62%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+  PD LPG Y        +  G DI ISVYN+HRS   W+K  EF PERF +    
Sbjct  415  IRRAQVPDILPGNYK-------VNTGQDIMISVYNIHRSSEVWEKAEEFLPERFDI----  463

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                          GA+ PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +
Sbjct  464  -------------DGAI-PNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLN  509

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            ++L    +++ + TGATIHT NGL+ K+ +R
Sbjct  510  VELVPD-QTISMTTGATIHTTNGLYMKVSQR  539



>ref|XP_003058421.1| cytochrome P450 superfamily protein [Micromonas pusilla CCMP1545]
 gb|EEH56876.1| cytochrome P450 superfamily protein [Micromonas pusilla CCMP1545]
Length=702

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 95/154 (62%), Gaps = 29/154 (19%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L P  L        DGY I AGTD FISV+NLHR+P  W+ P++F+P+RF + ++ 
Sbjct  456  IRRALEPVTL--------DGYKIDAGTDFFISVWNLHRNPRLWENPDKFDPDRFPIDQK-  506

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                              PNEI  +FA+LPFGGG RKCVGDQFAL ES I LAM+ ++FD
Sbjct  507  -----------------MPNEITENFAYLPFGGGQRKCVGDQFALFESIITLAMVCRRFD  549

Query  392  --IDLKGTPE-SVKLVTGATIHTKNGLWCKLKKR  300
              +D K  P+    + TGATIHT  GL  KLK+R
Sbjct  550  FELDAKFHPDGECGMTTGATIHTTGGLHVKLKRR  583



>emb|CDX67558.1| BnaA07g15980D [Brassica napus]
Length=546

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 93/151 (62%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+  PD LPG Y        +  G DI ISVYN+HRS   W+K  EF PERF      
Sbjct  422  IRRAQVPDILPGNYK-------VNTGQDIMISVYNVHRSSAVWEKAEEFLPERF------  468

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            E+EG              PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +
Sbjct  469  ELEG------------PIPNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLN  516

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            ++L    +++ + TGATIHT NGL+ K+ +R
Sbjct  517  VELVPD-QTISMTTGATIHTTNGLYMKVSQR  546



>gb|ACO53105.1| epsilon carotene hydroxylase [Actinidia chinensis]
Length=208

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 90/151 (60%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            +RR+  PD LPG Y        + AG DI ISVYN+H S   W++  EF PERF +    
Sbjct  72   LRRAQVPDVLPGNYK-------VNAGQDIMISVYNIHHSAQVWERAEEFVPERFDLD---  121

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                    DP        PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ  +
Sbjct  122  --------DP-------VPNETNTDFRFIPFSGGPRKCVGDQFALMEAIVALAIFLQHMN  166

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    +++ + TGATIHT NGL+ K+ +R
Sbjct  167  FELVPD-QNISMTTGATIHTTNGLYMKVSQR  196



>gb|AID51468.1| epsilon-ring carotene hydroxylase [Cucumis melo var. makuwa]
Length=148

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 91/151 (60%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+HRS   W++  EF PERF      
Sbjct  11   IRRAQVADTLPGNYK-------VNAGQDIMISVYNIHRSLQVWEQAEEFIPERF------  57

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  +
Sbjct  58   DLEGPV------------PNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQHLN  105

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    +++ + TGATIHT NGL+ KL +R
Sbjct  106  FELVPN-QTIGMTTGATIHTTNGLYMKLSQR  135



>ref|XP_006391882.1| hypothetical protein EUTSA_v10023482mg [Eutrema salsugineum]
 gb|ESQ29168.1| hypothetical protein EUTSA_v10023482mg [Eutrema salsugineum]
Length=422

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 93/150 (62%), Gaps = 28/150 (19%)
 Frame = -3

Query  746  RSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKESEI  567
            R+  PD LPG Y        + +G DI ISVYN+HRS   W+K  EF PERF      E+
Sbjct  300  RAQVPDILPGNYK-------VNSGQDIMISVYNVHRSSAVWEKAEEFLPERF------EL  346

Query  566  EGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDID  387
            EG              PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +++
Sbjct  347  EGA------------IPNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLNVE  394

Query  386  LKGTP-ESVKLVTGATIHTKNGLWCKLKKR  300
            L   P +++ + TGATIHT NGL+ K+ +R
Sbjct  395  L--VPDQTISMTTGATIHTTNGLYMKVSRR  422



>emb|CAB64216.1| Cytochrom P450-like protein [Arabidopsis thaliana]
Length=566

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 93/151 (62%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+  PD LPG Y        +  G DI ISVYN+HRS   W+K  EF PERF +    
Sbjct  442  IRRAQVPDILPGNYK-------VNTGQDIMISVYNIHRSSEVWEKAEEFLPERFDI----  490

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                          GA+ PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +
Sbjct  491  -------------DGAI-PNETNTDFKFIPFSGGPRKCVGDQFALMEAIVALAVFLQRLN  536

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            ++L    +++ + TGATIHT NGL+ K+ +R
Sbjct  537  VELVPD-QTISMTTGATIHTTNGLYMKVSQR  566



>ref|XP_009623194.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X2 [Nicotiana tomentosiformis]
Length=386

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 91/151 (60%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L  D LPG Y        + AG DI ISVYN+H S   W++  EF+PERF      
Sbjct  254  IRRALVADVLPGNYK-------VNAGQDIMISVYNVHHSSEVWERAEEFDPERFD-----  301

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                      S  P    PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ F 
Sbjct  302  ----------SEGP---VPNETNTDFRFIPFSGGPRKCVGDQFALLEATVALAIFLQNFS  348

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    +++ + TGATIHT NGL+ K+K+R
Sbjct  349  FELIP-DQNISMTTGATIHTTNGLYMKVKQR  378



>gb|EJK46027.1| hypothetical protein THAOC_35331 [Thalassiosira oceanica]
Length=472

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 99/172 (58%), Gaps = 24/172 (14%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVR---  582
            IRR    + LP G   +     +  G D+FIS+YNLHR   FW +P+EF PER++ +   
Sbjct  302  IRRCRTQNDLPKGCGKEA---TVIRGMDMFISLYNLHRDERFWPQPDEFIPERWETKYRY  358

Query  581  KESEIEGWAGFDPSR--SPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAML  408
               ++  W G+DP R  +   LYPNE+ SDFA+LPFGGG RKCVGD+FA +E+ + LAM+
Sbjct  359  VNPDVPEWGGYDPDRWMNTNFLYPNEVASDFAYLPFGGGARKCVGDEFATLEATVTLAMV  418

Query  407  LQKFDIDL----------------KGTPESVKLVTGATIHTKNGLWCKLKKR  300
            L++F  D                 K     V + TGATIHT+ GL   +KKR
Sbjct  419  LRRFSFDFDQAKLAETSMSVHEHPKNLEHPVGMKTGATIHTRKGLHMIVKKR  470



>gb|EMS57747.1| Cytochrome P450 97B2, chloroplastic [Triticum urartu]
Length=528

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 93/151 (62%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L  D LPG Y        +  G DI ISVYN+HRSP  WD+ +EF PERF      
Sbjct  367  IRRALVDDVLPGNYK-------VKTGQDIMISVYNIHRSPEVWDRADEFIPERF------  413

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG         P    PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+++QK D
Sbjct  414  DLEG---------P---IPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIVIQKVD  461

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            I L    + + + TGATIHT NGL+  +  R
Sbjct  462  IQLVAD-QKISMTTGATIHTTNGLYMNVSLR  491



>ref|XP_002506759.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68017.1| predicted protein [Micromonas sp. RCC299]
Length=538

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 99/152 (65%), Gaps = 4/152 (3%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR L    LP G  GD +   I  G D+FISV+NLHR P  W++P +F+P RF+   ++
Sbjct  390  IRRCLEDVPLPKG-AGDANVTLI-KGMDVFISVWNLHRHPDCWEEPLKFDPTRFKRPFQN  447

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKF  396
              ++ WAG++P    G LYPNE+ SDFAF+PFG G RKC+GDQFA++E+   LAM L+++
Sbjct  448  PGVKDWAGYNPDLISG-LYPNEVTSDFAFIPFGAGARKCIGDQFAMLEATSCLAMTLRRY  506

Query  395  DIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            D ++      V +  GATIHT  GL  K+ +R
Sbjct  507  DFEMTKDASEVGMEMGATIHTAGGLPMKVTRR  538



>emb|CEG00185.1| Cytochrome P450, conserved site [Ostreococcus tauri]
Length=534

 Score =   135 bits (340),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 94/154 (61%), Gaps = 29/154 (19%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L P  L GGYN       I AGTD FISV+NLHR+P  W +P+ F+PERF      
Sbjct  336  IRRALEPVTL-GGYN-------IDAGTDFFISVWNLHRNPRIWPEPDAFKPERF------  381

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                     P   P    PNE   D+A+LPFGGG RKCVGDQFA+ ES ++LAML+++FD
Sbjct  382  ---------PIEGP---MPNEYTEDYAYLPFGGGQRKCVGDQFAIFESIVSLAMLMRRFD  429

Query  392  IDLKGTPE---SVKLVTGATIHTKNGLWCKLKKR  300
             +L  +        + TGATIHT NGL  +LK+R
Sbjct  430  FELDESKHPDGECGMTTGATIHTTNGLHVRLKRR  463



>gb|AFP65826.1| carotene epsilon-ring hydroxylase, partial [Eriobotrya japonica]
Length=246

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 90/151 (60%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+HRS   W++  EF PERF      
Sbjct  106  IRRAQVADVLPGNYK-------VNAGPDIMISVYNIHRSSKVWERAEEFVPERF------  152

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ +Q  +
Sbjct  153  DLEGSV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEATVALAIFIQNLN  200

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    + + + TGATIHT NGL+ KL +R
Sbjct  201  FELV-LDQKISMTTGATIHTTNGLYMKLSQR  230



>emb|CDP15310.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 94/152 (62%), Gaps = 26/152 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            +RR+  PD LPGGY        +  G D+ ISVYN+H SP  W++  +F PERF      
Sbjct  349  LRRAQVPDVLPGGYK-------VNTGQDVMISVYNIHHSPQVWERAEDFVPERF------  395

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            E+EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA++LQ  +
Sbjct  396  ELEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAVILQHLN  443

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  297
             +L    +++ + TGATIHT NGL+ K+ +RL
Sbjct  444  FELI-PDQNISMTTGATIHTTNGLYMKVSQRL  474



>ref|XP_003082726.1| probable cytochrome P450 (ISS) [Ostreococcus tauri]
Length=643

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 94/154 (61%), Gaps = 29/154 (19%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L P  L GGYN       I AGTD FISV+NLHR+P  W +P+ F+PERF      
Sbjct  445  IRRALEPVTL-GGYN-------IDAGTDFFISVWNLHRNPRIWPEPDAFKPERF------  490

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                     P   P    PNE   D+A+LPFGGG RKCVGDQFA+ ES ++LAML+++FD
Sbjct  491  ---------PIEGP---MPNEYTEDYAYLPFGGGQRKCVGDQFAIFESIVSLAMLMRRFD  538

Query  392  IDLKGTPE---SVKLVTGATIHTKNGLWCKLKKR  300
             +L  +        + TGATIHT NGL  +LK+R
Sbjct  539  FELDESKHPDGECGMTTGATIHTTNGLHVRLKRR  572



>ref|XP_006403722.1| hypothetical protein EUTSA_v10010267mg [Eutrema salsugineum]
 gb|ESQ45175.1| hypothetical protein EUTSA_v10010267mg [Eutrema salsugineum]
Length=546

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 93/151 (62%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+  PD LPG Y        +  G DI ISVYN+HRS   W+K  EF PERF      
Sbjct  421  IRRAQVPDILPGNYK-------VNPGQDIMISVYNVHRSSAVWEKAEEFLPERF------  467

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            E+EG              PNE  +DF F+PF GGPRKCVGDQFA+ME+ +ALA+ LQ+ +
Sbjct  468  ELEG------------PIPNETNTDFKFIPFSGGPRKCVGDQFAMMEAIVALAVFLQRLN  515

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            ++L    +++ + TGATIHT NGL+ K+ +R
Sbjct  516  VELVPD-QTISMTTGATIHTTNGLYMKVSQR  545



>ref|XP_004983762.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
isoform X2 [Setaria italica]
Length=550

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 93/151 (62%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            +RR++  D LPG Y        + AG DI ISVYN+HRSP  WD+ +EF PERF      
Sbjct  414  LRRAIVDDVLPGNYK-------VKAGQDIMISVYNIHRSPEVWDRADEFIPERF------  460

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA++LQK D
Sbjct  461  DLEGPV------------PNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIVLQKMD  508

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            I L    + + + TGATIHT NGL+  +  R
Sbjct  509  IQLVPD-QKINMTTGATIHTTNGLYMNVSLR  538



>ref|XP_004983761.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
isoform X1 [Setaria italica]
Length=553

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 93/151 (62%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            +RR++  D LPG Y        + AG DI ISVYN+HRSP  WD+ +EF PERF      
Sbjct  414  LRRAIVDDVLPGNYK-------VKAGQDIMISVYNIHRSPEVWDRADEFIPERF------  460

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA++LQK D
Sbjct  461  DLEGPV------------PNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIVLQKMD  508

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            I L    + + + TGATIHT NGL+  +  R
Sbjct  509  IQLVPD-QKINMTTGATIHTTNGLYMNVSLR  538



>dbj|BAJ87296.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92581.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=545

 Score =   135 bits (339),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 92/151 (61%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L  D LPG Y        +  G DI ISVYN+HRSP  WD+ +EF PERF      
Sbjct  407  IRRALVDDVLPGNYK-------VKTGQDIMISVYNIHRSPEVWDRADEFIPERF------  453

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+++QK D
Sbjct  454  DLEGP------------IPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIVIQKMD  501

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            + L    + + + TGATIHT NGL+  +  R
Sbjct  502  VQLVAD-QKISMTTGATIHTTNGLYMNVSLR  531



>ref|XP_005761340.1| hypothetical protein EMIHUDRAFT_471046 [Emiliania huxleyi CCMP1516]
 gb|EOD08911.1| hypothetical protein EMIHUDRAFT_471046 [Emiliania huxleyi CCMP1516]
Length=211

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 106/173 (61%), Gaps = 28/173 (16%)
 Frame = -3

Query  731  DQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES-EIEGWA  555
            DQ P G  G + G+A+    D+FIS YN+ RSP  W++P+ F+P+R+    ++  ++GWA
Sbjct  8    DQWPEGGTGVEGGFALARANDLFISTYNMGRSPQLWEEPDVFDPQRWDRPFDNPNVKGWA  67

Query  554  GFDPSRSPGA--LYPN--------EIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLL  405
            G+DP++  G   + P         EI SD A +PFG G RKCVGDQFAL+E+A+++ MLL
Sbjct  68   GYDPAKRTGTGKMKPEGGLWVANLEIASDHAMIPFGAGERKCVGDQFALLEAAVSVVMLL  127

Query  404  QKFDIDL----------KGTPE-------SVKLVTGATIHTKNGLWCKLKKRL  297
            ++F+ DL          K  P+       +V +V+ ATIHT  GL+C++K+R 
Sbjct  128  RRFEFDLEMPDGPVNPAKLDPDNPDKSIGTVGMVSAATIHTATGLFCRVKERF  180



>ref|XP_005849069.1| hypothetical protein CHLNCDRAFT_51247 [Chlorella variabilis]
 gb|EFN56967.1| hypothetical protein CHLNCDRAFT_51247 [Chlorella variabilis]
Length=577

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 95/151 (63%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            +RR++ PD+LPGG         +P G D+ ISVYN+HRSP  WD+P++F PERF      
Sbjct  429  LRRAMVPDELPGGLT-------VPQGQDVMISVYNIHRSPAVWDRPDDFLPERF------  475

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                     P   P    PNE  +D+ ++PF GGPRKCVGDQFALME+ +ALA+++++FD
Sbjct  476  ---------PLDGP---VPNEQNTDYKYIPFSGGPRKCVGDQFALMEAVVALAVMIREFD  523

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
               +   +   + TGATIHTKNGL+  + KR
Sbjct  524  FAPQPGHDP-GMTTGATIHTKNGLYMTVAKR  553



>ref|XP_003590442.1| Cytochrome P450 monooxygenase CYP97C10 [Medicago truncatula]
 gb|AES60693.1| cytochrome P450 family monooxygenase [Medicago truncatula]
Length=541

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 93/152 (61%), Gaps = 26/152 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRS  PD+LPG Y  D       AG DI ISVYN+H S   WD+  EF PERF      
Sbjct  415  IRRSQIPDELPGDYKID-------AGQDIMISVYNIHHSSKVWDRAEEFLPERF------  461

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            +++G              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  +
Sbjct  462  DLDGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEATVALAVFLQHMN  509

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  297
             +L    +++ + TGATIHT NGL+ KL +RL
Sbjct  510  FELVPD-QNIGMTTGATIHTTNGLYMKLSQRL  540



>gb|AIX87504.1| P450 carotenoid epsilon-ring hydroxylase [Lycium barbarum]
Length=547

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 93/151 (62%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L  D LPG Y        + AG DI ISVYN+H S   W++  EF+PERF      
Sbjct  413  IRRALVADVLPGNYK-------VNAGQDIMISVYNVHHSSEVWERAEEFDPERF------  459

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ F 
Sbjct  460  DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEATVALAIFLQNFS  507

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    +++ + TGATIHT NGL+ K+K+R
Sbjct  508  FELIPD-QNISMTTGATIHTTNGLYMKVKQR  537



>gb|AIX87528.1| P450 carotenoid epsilon-ring hydroxylase [Lycium ruthenicum]
Length=546

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 93/151 (62%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L  D LPG Y        + AG DI ISVYN+H S   W++  EF+PERF      
Sbjct  412  IRRALVADVLPGNYK-------VNAGQDIMISVYNVHHSSEVWERAEEFDPERF------  458

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ F 
Sbjct  459  DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEATVALAIFLQNFS  506

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    +++ + TGATIHT NGL+ K+K+R
Sbjct  507  FELIPD-QNISMTTGATIHTTNGLYMKVKQR  536



>ref|XP_006339098.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=388

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 91/151 (60%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+H S   WD+  EF+PERF      
Sbjct  254  IRRAQVADVLPGNYK-------VNAGQDIMISVYNIHHSSEVWDRAEEFDPERF------  300

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ I LA+ +Q F 
Sbjct  301  DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEATITLAIFVQNFS  348

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    +++ + TGATIHT NGL+ K+K+R
Sbjct  349  FELIP-DQTISMTTGATIHTTNGLYMKVKQR  378



>ref|NP_001065217.1| Os10g0546600 [Oryza sativa Japonica Group]
 gb|ABB47954.1| Cytochrome P450 family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27131.1| Os10g0546600 [Oryza sativa Japonica Group]
 dbj|BAG89623.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51348.1| hypothetical protein OsJ_32354 [Oryza sativa Japonica Group]
Length=561

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 94/151 (62%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR++  D LPG Y        I AG DI ISVYN+HRSP  WD+ ++F PERF      
Sbjct  423  IRRAIVDDVLPGNYK-------IKAGQDIMISVYNIHRSPEVWDRADDFIPERF------  469

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +++ F+PF GGPRKCVGDQFAL+E+ +ALA++LQK D
Sbjct  470  DLEGPV------------PNETNTEYRFIPFSGGPRKCVGDQFALLEAIVALAVVLQKMD  517

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            I+L    + + + TGATIHT NGL+  +  R
Sbjct  518  IELVPD-QKINMTTGATIHTTNGLYMNVSLR  547



>ref|XP_009623193.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X1 [Nicotiana tomentosiformis]
Length=544

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 91/151 (60%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L  D LPG Y        + AG DI ISVYN+H S   W++  EF+PERF      
Sbjct  412  IRRALVADVLPGNYK-------VNAGQDIMISVYNVHHSSEVWERAEEFDPERFD-----  459

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                      S  P    PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ F 
Sbjct  460  ----------SEGP---VPNETNTDFRFIPFSGGPRKCVGDQFALLEATVALAIFLQNFS  506

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    +++ + TGATIHT NGL+ K+K+R
Sbjct  507  FELIPD-QNISMTTGATIHTTNGLYMKVKQR  536



>ref|XP_010241652.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X2 [Nelumbo nucifera]
Length=555

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 90/151 (60%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+H S   W++  EF PERF      
Sbjct  420  IRRAQVADVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEEFVPERF------  466

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ FD
Sbjct  467  DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQHFD  514

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             DL    + + + TGATIHT NGL+ KL +R
Sbjct  515  FDLVPD-QKISMTTGATIHTTNGLYMKLSQR  544



>ref|XP_006662027.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
[Oryza brachyantha]
Length=565

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 94/151 (62%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            +RR++  D LPG Y        I AG DI ISVYN+HRSP  WD+ +EF PERF      
Sbjct  427  LRRAIVDDVLPGNYK-------IKAGQDIMISVYNIHRSPEVWDRADEFIPERF------  473

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +++ F+PF GGPRKCVGDQFAL+E+ +ALA++LQK D
Sbjct  474  DLEGPV------------PNETNTEYRFIPFSGGPRKCVGDQFALLEAIVALAIVLQKID  521

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            I+L    + + + TGATIHT NGL+  +  R
Sbjct  522  IELVPD-QKINMTTGATIHTTNGLYMNVGLR  551



>ref|XP_009757367.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Nicotiana 
sylvestris]
Length=544

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 92/151 (61%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L  D LPG Y        + AG DI ISVYN+H S   W++  EF+PERF      
Sbjct  412  IRRALEADVLPGNYK-------VNAGQDIMISVYNVHHSSEVWERAEEFDPERF------  458

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ   
Sbjct  459  DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEATVALAIFLQNLS  506

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    +++ + TGATIHT NGL+ K+K+R
Sbjct  507  FELIPD-QNISMTTGATIHTTNGLYMKVKQR  536



>ref|XP_008462512.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Cucumis 
melo]
Length=558

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 92/151 (61%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+HRSP  W++  EF PERF      
Sbjct  421  IRRAQVADTLPGNYK-------VNAGQDIMISVYNIHRSPQVWEQAEEFIPERF------  467

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  +
Sbjct  468  DLEGPV------------PNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQHLN  515

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    +++ + TGATIHT NGL+ KL +R
Sbjct  516  FELVPN-QTIGMTTGATIHTTNGLYMKLSQR  545



>ref|XP_010241651.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X1 [Nelumbo nucifera]
Length=580

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 90/151 (60%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+H S   W++  EF PERF      
Sbjct  420  IRRAQVADVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEEFVPERF------  466

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ FD
Sbjct  467  DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQHFD  514

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             DL    + + + TGATIHT NGL+ KL +R
Sbjct  515  FDLVPD-QKISMTTGATIHTTNGLYMKLSQR  544



>gb|ABQ59243.1| CYP97C3 [Chlamydomonas reinhardtii]
Length=576

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 91/151 (60%), Gaps = 25/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            +RR+L  D+LPGG+        +P G D+ ISVYN+H SP  WD P  F PERF      
Sbjct  432  LRRALVEDELPGGFK-------VPVGQDVMISVYNIHHSPAVWDDPEAFIPERF------  478

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                     P   P    PNE  +DF ++PF GGPRKCVGDQFALME+ +AL +LL+++D
Sbjct  479  --------GPLDGP---VPNEQNTDFRYIPFSGGPRKCVGDQFALMEAVVALTVLLRQYD  527

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
              +    + + + TGATIHT NGL+  +K+R
Sbjct  528  FQMVPN-QQIGMTTGATIHTTNGLYMYVKER  557



>ref|XP_002503315.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64573.1| predicted protein [Micromonas sp. RCC299]
Length=693

 Score =   133 bits (335),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 92/154 (60%), Gaps = 29/154 (19%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L P  L        DGY I  GTD FISV+NLHR+P  W +P++F PERF + ++ 
Sbjct  457  IRRALEPVTL--------DGYKIETGTDFFISVWNLHRNPRLWPEPDKFIPERFPLDQK-  507

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                              PNE+  +FA+LPFGGG RKCVGDQFAL ES I LAM+ ++FD
Sbjct  508  -----------------MPNEVTENFAYLPFGGGQRKCVGDQFALFESIITLAMVCRRFD  550

Query  392  IDLKGT--PE-SVKLVTGATIHTKNGLWCKLKKR  300
            IDL     P+    + TGATIHT  GL  KL +R
Sbjct  551  IDLDPAFHPDGECGMTTGATIHTTGGLHVKLTRR  584



>ref|XP_008807069.1| PREDICTED: LOW QUALITY PROTEIN: carotene epsilon-monooxygenase, 
chloroplastic [Phoenix dactylifera]
Length=552

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 92/152 (61%), Gaps = 28/152 (18%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+HRSP  WD+  EF PERF      
Sbjct  419  IRRAQVADILPGDYK-------VNAGQDIMISVYNIHRSPQVWDRAEEFLPERF------  465

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  D
Sbjct  466  DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQ--D  511

Query  392  IDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  300
            +D +  P +++ + TGATIHT NGL+  L  R
Sbjct  512  MDFRLVPDQNITMTTGATIHTVNGLYMTLSPR  543



>ref|NP_001234058.1| cytochrome P450-type monooxygenase 97C11 [Solanum lycopersicum]
 gb|ACJ25967.1| cytochrome P450-type monooxygenase 97C11 [Solanum lycopersicum]
 gb|ACJ25968.1| cytochrome P450-type monooxygenase 97C11 [Solanum lycopersicum]
Length=547

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 92/154 (60%), Gaps = 26/154 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        +  G DI ISVYN+H S   WD+  EF+PERF      
Sbjct  413  IRRAQVADVLPGNYK-------VNVGQDIMISVYNIHHSSEVWDRAEEFDPERF------  459

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ IALA+ +Q F 
Sbjct  460  DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEATIALAIFVQNFS  507

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
             +L    +++ + TGATIHT NGL+ K+K+R  V
Sbjct  508  FELIPD-QTISMTTGATIHTTNGLYMKVKQREKV  540



>ref|XP_006339097.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
isoform X1 [Solanum tuberosum]
Length=551

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 92/154 (60%), Gaps = 26/154 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+H S   WD+  EF+PERF      
Sbjct  417  IRRAQVADVLPGNYK-------VNAGQDIMISVYNIHHSSEVWDRAEEFDPERF------  463

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ I LA+ +Q F 
Sbjct  464  DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEATITLAIFVQNFS  511

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDV  291
             +L    +++ + TGATIHT NGL+ K+K+R  V
Sbjct  512  FELIPD-QTISMTTGATIHTTNGLYMKVKQREKV  544



>ref|XP_008658121.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Zea 
mays]
 gb|ADD14593.1| carotene epsilon-ring hydroxylase [Zea mays subsp. mays]
 gb|AFP28223.1| carotene epsilon-ring hydroxylase [synthetic construct]
Length=556

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 93/151 (62%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            +RR++  D LPG Y        + AG DI ISVYN+HRSP  WD+ +EF PERF      
Sbjct  418  LRRAIVDDVLPGNYK-------VKAGQDIMISVYNIHRSPEVWDRADEFIPERF------  464

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA++LQK D
Sbjct  465  DLEGPV------------PNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAVVLQKMD  512

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            + L    + + + TGATIHT +GL+  +  R
Sbjct  513  MQLV-PDQKINMTTGATIHTTSGLYMNVSLR  542



>gb|AAK20054.1|AC025783_14 putative cytochrome P450 monooxygenase [Oryza sativa Japonica 
Group]
Length=584

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 93/148 (63%), Gaps = 26/148 (18%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR++  D LPG Y        I AG DI ISVYN+HRSP  WD+ ++F PERF      
Sbjct  423  IRRAIVDDVLPGNYK-------IKAGQDIMISVYNIHRSPEVWDRADDFIPERF------  469

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +++ F+PF GGPRKCVGDQFAL+E+ +ALA++LQK D
Sbjct  470  DLEGPV------------PNETNTEYRFIPFSGGPRKCVGDQFALLEAIVALAVVLQKMD  517

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKL  309
            I+L    + + + TGATIHT NGL+  +
Sbjct  518  IELV-PDQKINMTTGATIHTTNGLYMNV  544



>ref|XP_006491796.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=498

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 94/152 (62%), Gaps = 28/152 (18%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+H S   W++  EF PERF      
Sbjct  363  IRRAQVDDVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEEFLPERF------  409

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG         P    PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+LLQ  +
Sbjct  410  DLEG---------P---MPNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAILLQNMN  457

Query  392  IDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  300
             +L   P +++ + TGATIHT NGL+ KL++R
Sbjct  458  FEL--VPDQNINMTTGATIHTTNGLYMKLRQR  487



>ref|XP_010098846.1| Carotene epsilon-monooxygenase [Morus notabilis]
 gb|EXB75934.1| Carotene epsilon-monooxygenase [Morus notabilis]
Length=634

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 92/152 (61%), Gaps = 28/152 (18%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D+LPG Y        + AG DI ISVYN+HRS   W++  EF PERF      
Sbjct  419  IRRAQVADKLPGNYK-------VNAGQDIMISVYNIHRSSKVWERAEEFVPERF------  465

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+ES +ALA+ LQ F 
Sbjct  466  DMEGPV------------PNESNTDFRFIPFSGGPRKCVGDQFALLESIVALAIFLQHFT  513

Query  392  IDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  300
             +L   P +++ + TGATIHT NGL+ KL  R
Sbjct  514  FEL--VPDQNIGMTTGATIHTTNGLYMKLSSR  543



>ref|XP_011094564.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Sesamum 
indicum]
 ref|XP_011094565.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Sesamum 
indicum]
Length=542

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 91/151 (60%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            +RR+   D LPG Y        + AG DI ISVYN+H S   W++ +EF PERF      
Sbjct  407  LRRAQVADVLPGNYK-------VNAGQDIMISVYNIHHSAQVWERADEFVPERF------  453

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  SD+ F+PF GGPRKCVGDQFAL+E+ +ALA+LLQ   
Sbjct  454  DLEGPV------------PNETNSDYRFIPFSGGPRKCVGDQFALLEAIVALAVLLQHLS  501

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             DL    +++ + TGATIHT NGL+ KL +R
Sbjct  502  FDLVPN-QNISMTTGATIHTTNGLYMKLTER  531



>gb|EEC67393.1| hypothetical protein OsI_34547 [Oryza sativa Indica Group]
Length=557

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 93/151 (62%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR++  D LPG Y        I AG DI ISVYN+HRS   WD+ ++F PERF      
Sbjct  419  IRRAIVDDVLPGNYK-------IKAGQDIMISVYNIHRSSEVWDRADDFIPERF------  465

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +++ F+PF GGPRKCVGDQFAL+E+ +ALA++LQK D
Sbjct  466  DLEGPV------------PNETNTEYRFIPFSGGPRKCVGDQFALLEAIVALAVVLQKMD  513

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            I+L    + + + TGATIHT NGL+  +  R
Sbjct  514  IELV-PDQKINMTTGATIHTTNGLYMNVSLR  543



>ref|XP_006428525.1| hypothetical protein CICLE_v10011420mg [Citrus clementina]
 ref|XP_006491795.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
isoform X1 [Citrus sinensis]
 gb|ESR41765.1| hypothetical protein CICLE_v10011420mg [Citrus clementina]
Length=545

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 94/152 (62%), Gaps = 28/152 (18%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+H S   W++  EF PERF      
Sbjct  410  IRRAQVDDVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEEFLPERF------  456

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG         P    PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+LLQ  +
Sbjct  457  DLEG---------P---MPNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAILLQNMN  504

Query  392  IDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  300
             +L   P +++ + TGATIHT NGL+ KL++R
Sbjct  505  FEL--VPDQNINMTTGATIHTTNGLYMKLRQR  534



>gb|KDO54336.1| hypothetical protein CISIN_1g008564mg [Citrus sinensis]
Length=498

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 94/152 (62%), Gaps = 28/152 (18%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+H S   W++  EF PERF      
Sbjct  363  IRRAQVDDVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEEFLPERF------  409

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG         P    PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+LLQ  +
Sbjct  410  DLEG---------P---MPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAILLQNMN  457

Query  392  IDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  300
             +L   P +++ + TGATIHT NGL+ KL++R
Sbjct  458  FEL--VPDQNINMTTGATIHTTNGLYMKLRQR  487



>ref|XP_005779653.1| hypothetical protein EMIHUDRAFT_463287 [Emiliania huxleyi CCMP1516]
 gb|EOD27224.1| hypothetical protein EMIHUDRAFT_463287 [Emiliania huxleyi CCMP1516]
Length=617

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 108/175 (62%), Gaps = 28/175 (16%)
 Frame = -3

Query  737  RPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES-EIEG  561
            + DQ P G  G + G+A+    D+FIS YN+ RSP  W++P+ F+P+R+    ++ +++G
Sbjct  412  KADQWPEGGTGVEGGFALARANDLFISTYNMGRSPQLWEEPDVFDPQRWDRPFDNPDVKG  471

Query  560  WAGFDPSRSPGA--LYPN--------EIISDFAFLPFGGGPRKCVGDQFALMESAIALAM  411
            WAG+DP++  G   + P         EI SD A +PFG G RKCVGDQFAL+E+A+++ M
Sbjct  472  WAGYDPAKRTGTGKMKPEGGLWVANLEIASDHAMIPFGAGERKCVGDQFALLEAAVSVVM  531

Query  410  LLQKFDIDL----------KGTPE-------SVKLVTGATIHTKNGLWCKLKKRL  297
            LL++F+ DL          K  P+       +V +V+ ATIHT  GL+C++K+R 
Sbjct  532  LLRRFEFDLEMPDGPVNPAKLDPDNPDKSIGTVGMVSAATIHTATGLFCRVKERF  586



>ref|XP_011396817.1| Cytochrome P450 97B3, chloroplastic [Auxenochlorella protothecoides]
 gb|AHA86563.1| cytochrome P450 like protein [Auxenochlorella protothecoides]
 gb|KFM23939.1| Cytochrome P450 97B3, chloroplastic [Auxenochlorella protothecoides]
Length=547

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 93/151 (62%), Gaps = 19/151 (13%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            +RR+L PD+LPG +   + GY +P G D+ ISVYN+H SP  WD+P  F P+RF      
Sbjct  414  LRRALVPDELPGTWLAGECGYKVPKGQDVMISVYNIHHSPAVWDEPEAFRPDRF------  467

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                     P  +P    P E  +D+ ++PF GGPRKCVGDQFA+ME+  ALA++L++F 
Sbjct  468  ---------PLDAPP---PTEQNTDYRYIPFSGGPRKCVGDQFAMMEAVSALAVVLRRFT  515

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
               K   E V + TGATIHT+NGL+  +  R
Sbjct  516  FYPKPGHE-VGMTTGATIHTQNGLYMGVGLR  545



>gb|KDO54333.1| hypothetical protein CISIN_1g008564mg [Citrus sinensis]
Length=544

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 93/151 (62%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+H S   W++  EF PERF      
Sbjct  409  IRRAQVDDVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEEFLPERF------  455

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG         P    PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+LLQ  +
Sbjct  456  DLEG---------P---MPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAILLQNMN  503

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    +++ + TGATIHT NGL+ KL++R
Sbjct  504  FELVPD-QNINMTTGATIHTTNGLYMKLRQR  533



>gb|KDO54334.1| hypothetical protein CISIN_1g008564mg [Citrus sinensis]
Length=561

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 94/152 (62%), Gaps = 28/152 (18%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+H S   W++  EF PERF      
Sbjct  426  IRRAQVDDVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEEFLPERF------  472

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG         P    PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+LLQ  +
Sbjct  473  DLEG---------P---MPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAILLQNMN  520

Query  392  IDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  300
             +L   P +++ + TGATIHT NGL+ KL++R
Sbjct  521  FEL--VPDQNINMTTGATIHTTNGLYMKLRQR  550



>gb|KDO54335.1| hypothetical protein CISIN_1g008564mg [Citrus sinensis]
Length=545

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 93/151 (62%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+H S   W++  EF PERF      
Sbjct  410  IRRAQVDDVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEEFLPERF------  456

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG         P    PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+LLQ  +
Sbjct  457  DLEG---------P---MPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAILLQNMN  504

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    +++ + TGATIHT NGL+ KL++R
Sbjct  505  FELVPD-QNINMTTGATIHTTNGLYMKLRQR  534



>gb|KDO54337.1| hypothetical protein CISIN_1g008564mg [Citrus sinensis]
Length=511

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 92/151 (61%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+H S   W++  EF PERF      
Sbjct  376  IRRAQVDDVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEEFLPERF------  422

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+LLQ  +
Sbjct  423  DLEGP------------MPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAILLQNMN  470

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    +++ + TGATIHT NGL+ KL++R
Sbjct  471  FELVPD-QNINMTTGATIHTTNGLYMKLRQR  500



>ref|XP_009382396.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=561

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 88/151 (58%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+HRSP  W+K  EF PERF      
Sbjct  423  IRRAQVDDVLPGDYK-------VNAGQDIMISVYNIHRSPQVWEKAEEFCPERFN-----  470

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
             +EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  +
Sbjct  471  -LEGP------------IPNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQHME  517

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    + + + TGATIHT NGL+  L  R
Sbjct  518  FELVAD-QKISMTTGATIHTTNGLYMTLSPR  547



>ref|XP_009382395.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=561

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 88/151 (58%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+HRSP  W+K  EF PERF      
Sbjct  423  IRRAQVDDVLPGDYK-------VNAGQDIMISVYNIHRSPQVWEKAEEFCPERFN-----  470

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
             +EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  +
Sbjct  471  -LEGP------------IPNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQHME  517

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    + + + TGATIHT NGL+  L  R
Sbjct  518  FELVAD-QKISMTTGATIHTTNGLYMTLSPR  547



>ref|XP_009382394.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=563

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 88/151 (58%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+HRSP  W+K  EF PERF      
Sbjct  423  IRRAQVDDVLPGDYK-------VNAGQDIMISVYNIHRSPQVWEKAEEFCPERFN-----  470

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
             +EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  +
Sbjct  471  -LEGP------------IPNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQHME  517

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    + + + TGATIHT NGL+  L  R
Sbjct  518  FELVAD-QKISMTTGATIHTTNGLYMTLSPR  547



>ref|XP_009375781.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009375782.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
[Pyrus x bretschneideri]
Length=545

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 89/151 (59%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+HRS   W++  EF PERF      
Sbjct  409  IRRAQVADVLPGNYK-------VNAGQDIMISVYNIHRSSKVWERAEEFVPERF------  455

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +AL + +Q  +
Sbjct  456  DLEGSV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEATVALTIFIQNLN  503

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    + + + TGATIHT NGL+ KL +R
Sbjct  504  FELVPD-QKISMTTGATIHTTNGLYMKLSQR  533



>ref|XP_002467549.1| hypothetical protein SORBIDRAFT_01g030050 [Sorghum bicolor]
 gb|EER94547.1| hypothetical protein SORBIDRAFT_01g030050 [Sorghum bicolor]
Length=538

 Score =   129 bits (324),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 90/144 (63%), Gaps = 26/144 (18%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            +RR++  D LPG Y        + AG DI ISVYN+HRSP  WD+ +EF PERF      
Sbjct  417  LRRAIVDDVLPGNYK-------VKAGQDIMISVYNIHRSPEVWDRADEFIPERF------  463

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +D+ F+PF GGPRKCVGDQFAL+E+ +ALA++LQK D
Sbjct  464  DLEGPV------------PNESNTDYRFIPFSGGPRKCVGDQFALLEAIVALAVVLQKID  511

Query  392  IDLKGTPESVKLVTGATIHTKNGL  321
            I L    + + + TGATIHT NG+
Sbjct  512  IQLVPD-QKINMTTGATIHTTNGI  534



>ref|XP_002955547.1| hypothetical protein VOLCADRAFT_83281 [Volvox carteri f. nagariensis]
 gb|EFJ43400.1| hypothetical protein VOLCADRAFT_83281 [Volvox carteri f. nagariensis]
Length=575

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 91/151 (60%), Gaps = 25/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            +RR+L  D+LPGGY        +P G D+ ISVYN+H S   WD P  F PERF      
Sbjct  433  LRRALVEDELPGGYK-------VPVGQDVMISVYNIHHSEAVWDNPEAFIPERF------  479

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                     P   P    P+E  +DF ++PF GGPRKCVGDQFALME+ +ALA+LL++FD
Sbjct  480  --------GPLDGP---VPSEQNTDFRYIPFSGGPRKCVGDQFALMEAVVALAVLLRQFD  528

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
              L    + + + TGATIHT +GL+  +K+R
Sbjct  529  FSLVPN-QKIGMTTGATIHTTDGLYMYVKER  558



>gb|KHG23674.1| Cytochrome P450, chloroplastic [Gossypium arboreum]
Length=510

 Score =   129 bits (323),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 92/152 (61%), Gaps = 26/152 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+H S   W++  EF PERF +  ES
Sbjct  376  IRRAQVDDVLPGDYK-------VKAGQDIMISVYNIHHSSQVWERAEEFVPERFDL--ES  426

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
             +                PNE  +D+ F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ+ +
Sbjct  427  SV----------------PNESNTDYRFIPFSGGPRKCVGDQFALLEAIVALAIFLQRLN  470

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  297
             +L    +++ + TGATIHT NGL+ KL +R+
Sbjct  471  FELVPD-QNISMTTGATIHTTNGLYMKLSQRM  501



>ref|XP_008392557.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Malus 
domestica]
Length=549

 Score =   129 bits (324),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 89/151 (59%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+HRS   W++  EF PERF      
Sbjct  409  IRRAQVADVLPGNYK-------VNAGQDIMISVYNIHRSSKVWERAEEFVPERF------  455

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +AL + +Q  +
Sbjct  456  DLEGSV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEATVALTIFIQNLN  503

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    + + + TGATIHT NGL+ KL +R
Sbjct  504  FELVPD-QKISMTTGATIHTTNGLYMKLSQR  533



>ref|XP_007027524.1| Cytochrome P450 superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY08026.1| Cytochrome P450 superfamily protein isoform 2 [Theobroma cacao]
Length=369

 Score =   127 bits (320),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 89/151 (59%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+H S   W++  EF PERF +    
Sbjct  232  IRRAQVDDILPGNYK-------VKAGQDIMISVYNIHHSSQVWERAEEFVPERFDLE---  281

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                        SP    PNE  +D+ F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ+ +
Sbjct  282  ------------SP---VPNETNTDYRFIPFSGGPRKCVGDQFALLEAIVALAIFLQRLN  326

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    + + + TGATIHT NG++ KL +R
Sbjct  327  FELVP-DQDISMTTGATIHTTNGMYMKLSER  356



>gb|KJB46498.1| hypothetical protein B456_007G372200 [Gossypium raimondii]
Length=548

 Score =   129 bits (324),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 92/152 (61%), Gaps = 26/152 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+H S   W++  EF PERF +  ES
Sbjct  414  IRRAQVDDVLPGDYK-------VKAGQDIMISVYNIHHSSQVWERAEEFVPERFDL--ES  464

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
             +                PNE  +D+ F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ+ +
Sbjct  465  SV----------------PNESNTDYRFIPFSGGPRKCVGDQFALLEAIVALAIFLQRLN  508

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  297
             +L    +++ + TGATIHT NGL+ KL +R+
Sbjct  509  FELVPD-QNISMTTGATIHTTNGLYMKLSQRM  539



>ref|XP_004156328.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
[Cucumis sativus]
Length=512

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 91/151 (60%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+HRS   W++  EF PERF      
Sbjct  375  IRRAQVADILPGDYK-------VNAGQDIMISVYNIHRSSQVWEQAEEFIPERF------  421

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  +
Sbjct  422  DLEGPV------------PNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQHMN  469

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    +++ + TGATIHT NGL+ KL +R
Sbjct  470  FELVPN-QTIGMTTGATIHTTNGLYMKLSQR  499



>ref|XP_002519427.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF42841.1| cytochrome P450, putative [Ricinus communis]
Length=552

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 89/151 (59%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            +RR+   D LPG Y        + AG DI ISVYN+H S   WD+  EF PERF      
Sbjct  416  LRRAQVADVLPGNYK-------VNAGQDIMISVYNIHHSSKVWDRAEEFVPERF------  462

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  +
Sbjct  463  DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQNMN  510

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    + + + TGATIHT NGL+ KL KR
Sbjct  511  FELVPD-QKISMTTGATIHTTNGLYMKLGKR  540



>ref|XP_004143287.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
[Cucumis sativus]
 gb|KGN48212.1| hypothetical protein Csa_6G448700 [Cucumis sativus]
Length=559

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 91/151 (60%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+HRS   W++  EF PERF      
Sbjct  422  IRRAQVADILPGDYK-------VNAGQDIMISVYNIHRSSQVWEQAEEFIPERF------  468

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  +
Sbjct  469  DLEGPV------------PNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQHMN  516

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    +++ + TGATIHT NGL+ KL +R
Sbjct  517  FELVPN-QTIGMTTGATIHTTNGLYMKLSQR  546



>ref|XP_010907646.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X4 [Elaeis guineensis]
Length=483

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 88/151 (58%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + A  DI ISVYN+HRSP  WD+  EF PERF      
Sbjct  350  IRRAQVADILPGDYK-------VNAAQDIMISVYNIHRSPQVWDRAEEFLPERF------  396

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  D
Sbjct  397  DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQHMD  444

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
              L    +++ + TGATIHT NGL+  L  R
Sbjct  445  FRLVPD-QNIAMTTGATIHTMNGLYMTLSPR  474



>ref|XP_010907645.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X3 [Elaeis guineensis]
Length=542

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 88/151 (58%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + A  DI ISVYN+HRSP  WD+  EF PERF      
Sbjct  409  IRRAQVADILPGDYK-------VNAAQDIMISVYNIHRSPQVWDRAEEFLPERF------  455

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  D
Sbjct  456  DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQHMD  503

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
              L    +++ + TGATIHT NGL+  L  R
Sbjct  504  FRLVPD-QNIAMTTGATIHTMNGLYMTLSPR  533



>ref|XP_010907643.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X1 [Elaeis guineensis]
Length=549

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 88/151 (58%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + A  DI ISVYN+HRSP  WD+  EF PERF      
Sbjct  416  IRRAQVADILPGDYK-------VNAAQDIMISVYNIHRSPQVWDRAEEFLPERF------  462

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  D
Sbjct  463  DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQHMD  510

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
              L    +++ + TGATIHT NGL+  L  R
Sbjct  511  FRLVPD-QNIAMTTGATIHTMNGLYMTLSPR  540



>ref|XP_004516958.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=545

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 87/142 (61%), Gaps = 26/142 (18%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+L PD+LPG Y        + AG DI ISVYN+HRS   WD+  EF PERF      
Sbjct  411  IRRALVPDELPGAYK-------VNAGQDIMISVYNIHRSSEVWDRAEEFLPERF------  457

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            E++G              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  +
Sbjct  458  ELDGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEATVALAVFLQNMN  505

Query  392  IDLKGTPESVKLVTGATIHTKN  327
             +L    +++ + TGATIHT N
Sbjct  506  FELVPN-QNISMTTGATIHTTN  526



>ref|XP_010546517.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=543

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 90/151 (60%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+  PD LPG Y        +  G DI ISVYN+HRS   W+  NEF PERF ++   
Sbjct  417  IRRAQFPDVLPGNYK-------VNTGQDIMISVYNIHRSSEVWESANEFVPERFDLQ---  466

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                          G + PNE  +DF F+PF GGPRKCVGDQFALME+ +ALA+ LQ+ +
Sbjct  467  --------------GPI-PNESNTDFKFIPFSGGPRKCVGDQFALMEAIVALAIFLQRLN  511

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    +++ + TGATIHT NGL+  +  R
Sbjct  512  FELVPD-QNIGMTTGATIHTTNGLYMTVSPR  541



>gb|EYU41579.1| hypothetical protein MIMGU_mgv1a004062mg [Erythranthe guttata]
Length=546

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 90/151 (60%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            +RR+   D LPG Y        +  G D+ ISVYN+H S   WD+ +EF PERF      
Sbjct  411  LRRAQVADVLPGDYK-------VNPGQDVMISVYNVHHSAQVWDRADEFVPERF------  457

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ  +
Sbjct  458  DLEGAV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAVFLQHLN  505

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             DL    +++ + TGATIHT NGL+ KL +R
Sbjct  506  FDLV-PDQNIGMTTGATIHTANGLYMKLSQR  535



>ref|XP_011468004.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X2 [Fragaria vesca subsp. vesca]
Length=445

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 90/151 (60%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        +  G DI ISVYN+HRS   W++  EF PERF      
Sbjct  310  IRRAQVADVLPGNYR-------VNPGQDIMISVYNIHRSSEVWERAEEFSPERF------  356

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ +Q  +
Sbjct  357  DMEG------------PIPNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFIQHLN  404

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    +++ + TGATIHT NGL+ KL +R
Sbjct  405  FELVPD-QNISMTTGATIHTTNGLYMKLSQR  434



>ref|XP_008241353.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Prunus 
mume]
Length=556

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 90/151 (60%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+H S   W++  EF PERF +  ES
Sbjct  418  IRRAQVADVLPGNYK-------VNAGQDIMISVYNIHHSSEVWERAEEFLPERFDL--ES  468

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
             +                PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ +Q  +
Sbjct  469  SV----------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFIQHLN  512

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    +++ + TGATIHT NGL+ KL +R
Sbjct  513  FELVPD-QNISMTTGATIHTTNGLFMKLSQR  542



>gb|AFQ31612.1| CYP97C [Haematococcus pluvialis]
Length=571

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 94/163 (58%), Gaps = 28/163 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            +RR+   D LPGGY   K       G D+ ISVYN+HRS   WD P  F PERF      
Sbjct  434  LRRAFAADTLPGGYKVVK-------GQDVMISVYNIHRSKAVWDSPEAFLPERF------  480

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                     P   P    P+E  +DF ++PF GGPRKCVGDQFALME+ ++LA+LL++FD
Sbjct  481  --------GPLDGP---VPSEQNTDFRYIPFSGGPRKCVGDQFALMEAVVSLAVLLREFD  529

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRLDVC*I*KSIVL  264
            + L    +++ + TGATIHT NGL+   + R+      KS+ L
Sbjct  530  LSLVPN-QTIGMTTGATIHTTNGLYMYARARIAAA---KSVAL  568



>ref|XP_011018827.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X2 [Populus euphratica]
Length=544

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 90/151 (60%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+H S   W++  EF PERF      
Sbjct  407  IRRAQVADVLPGNYK-------VNAGQDIMISVYNIHHSSKVWERAEEFVPERF------  453

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                  G D         PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQK +
Sbjct  454  ------GLD------GPVPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQKIN  501

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    +++++ TGATIHT +GL+ KL +R
Sbjct  502  FELVPD-QNIRMTTGATIHTTDGLYMKLSQR  531



>ref|XP_003062894.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52833.1| predicted protein [Micromonas pusilla CCMP1545]
Length=529

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 98/164 (60%), Gaps = 16/164 (10%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR L    LP G  GD D   I  G D+FISV+NLHR P  W++P +F+P RF+    +
Sbjct  368  IRRCLEDVPLPKG-AGDADVTLI-KGMDVFISVWNLHRHPDCWEEPLKFDPFRFKKPYSN  425

Query  572  E-IEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQ------------FALME  432
              ++ WAG++P    G +YPNE+ SDFAF+PFG G RKC+GDQ            FA++E
Sbjct  426  PGVKDWAGYNPDLISG-MYPNEVTSDFAFVPFGAGARKCIGDQARSCLHWSPYDRFAMLE  484

Query  431  SAIALAMLLQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
            +   LAM LQ++D +L      V +  GATIHT  GL  ++ +R
Sbjct  485  ATSCLAMTLQRYDFELDKDAAEVGMEMGATIHTAGGLPMRVTRR  528



>ref|XP_004306170.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X1 [Fragaria vesca subsp. vesca]
Length=544

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 90/151 (60%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        +  G DI ISVYN+HRS   W++  EF PERF      
Sbjct  409  IRRAQVADVLPGNYR-------VNPGQDIMISVYNIHRSSEVWERAEEFSPERF------  455

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ +Q  +
Sbjct  456  DMEGP------------IPNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFIQHLN  503

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    +++ + TGATIHT NGL+ KL +R
Sbjct  504  FELVPD-QNISMTTGATIHTTNGLYMKLSQR  533



>ref|XP_011018826.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X1 [Populus euphratica]
Length=548

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 90/151 (60%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+H S   W++  EF PERF      
Sbjct  407  IRRAQVADVLPGNYK-------VNAGQDIMISVYNIHHSSKVWERAEEFVPERF------  453

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                  G D         PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQK +
Sbjct  454  ------GLD------GPVPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQKIN  501

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    +++++ TGATIHT +GL+ KL +R
Sbjct  502  FELV-PDQNIRMTTGATIHTTDGLYMKLSQR  531



>ref|XP_006381359.1| hypothetical protein POPTR_0006s12150g [Populus trichocarpa]
 gb|ERP59156.1| hypothetical protein POPTR_0006s12150g [Populus trichocarpa]
Length=545

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 90/151 (60%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+H S   W++  EF PERF      
Sbjct  419  IRRAQVADVLPGNYK-------VNAGQDIMISVYNIHHSSKVWERAEEFVPERF------  465

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                  G D         PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ LQK +
Sbjct  466  ------GLDGP------VPNESNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFLQKIN  513

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    +++++ TGATIHT +GL+ KL +R
Sbjct  514  FELVPD-QNIRMTTGATIHTTDGLYMKLSQR  543



>gb|AGT63110.1| plastid carotenoid epsilon-ring hydroxylase [Haematococcus pluvialis]
Length=571

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 90/152 (59%), Gaps = 25/152 (16%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            +RR+   D LPGGY   K       G D+ ISVYN+HRS   WD P  F PERF      
Sbjct  434  LRRAFAADTLPGGYKVVK-------GQDVMISVYNIHRSKAVWDSPEAFLPERF------  480

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                     P   P    P+E  +DF ++PF GGPRKCVGDQFALME+ ++LA+LL++FD
Sbjct  481  --------GPLDGP---VPSEQNTDFRYIPFSGGPRKCVGDQFALMEAVVSLAVLLREFD  529

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  297
            + L    +++ + TGATIHT NGL+   + R+
Sbjct  530  LSLVPN-QTIGMTTGATIHTTNGLYMYARARI  560



>ref|XP_007027523.1| Cytochrome P450 superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY08025.1| Cytochrome P450 superfamily protein isoform 1 [Theobroma cacao]
Length=550

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 89/151 (59%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+H S   W++  EF PERF +    
Sbjct  413  IRRAQVDDILPGNYK-------VKAGQDIMISVYNIHHSSQVWERAEEFVPERFDLE---  462

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                        SP    PNE  +D+ F+PF GGPRKCVGDQFAL+E+ +ALA+ LQ+ +
Sbjct  463  ------------SP---VPNETNTDYRFIPFSGGPRKCVGDQFALLEAIVALAIFLQRLN  507

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    + + + TGATIHT NG++ KL +R
Sbjct  508  FELVPD-QDISMTTGATIHTTNGMYMKLSER  537



>emb|CBI30186.3| unnamed protein product [Vitis vinifera]
 gb|AIO11761.1| cytochrome p450 [Croton stellatopilosus]
 emb|CDM63951.1| cytochrom p450 reductase [Croton stellatopilosus]
Length=471

 Score =   125 bits (315),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 91/152 (60%), Gaps = 28/152 (18%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+H S   W++  +F PERF      
Sbjct  335  IRRAKVADVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEDFLPERF------  381

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ +Q  +
Sbjct  382  DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFVQHMN  429

Query  392  IDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  300
             +L   P +++ + TGATIHT NGL+ KL +R
Sbjct  430  FEL--VPDQNISMTTGATIHTTNGLYMKLTQR  459



>gb|KCW89308.1| hypothetical protein EUGRSUZ_A01599 [Eucalyptus grandis]
Length=529

 Score =   126 bits (316),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 89/151 (59%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR++  D LPG Y  D        G DI ISVYN+H SP  W++  EF PERF      
Sbjct  393  IRRAMVSDVLPGNYKVDP-------GQDIMISVYNIHHSPQVWERAEEFVPERFY-----  440

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                        + G L PNE  +DF F+PF GGPRKCVGDQFA++ES +ALA+ L++ +
Sbjct  441  ------------TEGPL-PNETNTDFRFIPFSGGPRKCVGDQFAMLESIVALAVFLERMN  487

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
              L    + + + TGATIHT NGL+ ++ +R
Sbjct  488  FVLVPD-QKISMTTGATIHTTNGLYMRVSRR  517



>ref|XP_007204192.1| hypothetical protein PRUPE_ppa003701mg [Prunus persica]
 gb|EMJ05391.1| hypothetical protein PRUPE_ppa003701mg [Prunus persica]
Length=555

 Score =   126 bits (317),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 90/152 (59%), Gaps = 28/152 (18%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+H S   W++  EF PERF      
Sbjct  417  IRRAQVADVLPGNYK-------VNAGQDIMISVYNIHHSSEVWERAEEFLPERF------  463

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +AL + +Q  +
Sbjct  464  DLEGSV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALVIFIQHLN  511

Query  392  IDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  300
             +L   P +++ + TGATIHT NGL+ KL +R
Sbjct  512  FEL--VPDQNISMTTGATIHTTNGLFMKLSQR  541



>gb|ACU20919.1| unknown [Glycine max]
Length=105

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 78/123 (63%), Gaps = 19/123 (15%)
 Frame = -3

Query  665  FISVYNLHRSPYFWDKPNEFEPERFQVRKESEIEGWAGFDPSRSPGALYPNEIISDFAFL  486
             ISVYN+HRS   WD+  EF PERF      +++G              PNE  +DF F+
Sbjct  1    MISVYNIHRSSEVWDRAEEFAPERF------DLDGPV------------PNETNTDFRFI  42

Query  485  PFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGATIHTKNGLWCKLK  306
            PF GGPRKCVGDQFALME+ +ALA+ LQ  + +L    ++V + TGATIHT NGL+ KL 
Sbjct  43   PFSGGPRKCVGDQFALMEAIVALAIFLQHMNFELV-PDQNVSMTTGATIHTTNGLYMKLS  101

Query  305  KRL  297
            +RL
Sbjct  102  RRL  104



>ref|XP_010050328.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Eucalyptus 
grandis]
Length=559

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 88/151 (58%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR++  D LPG Y  D        G DI ISVYN+H SP  W++  EF PERF      
Sbjct  423  IRRAMVSDVLPGNYKVDP-------GQDIMISVYNIHHSPQVWERAEEFVPERFYTE---  472

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                          G L PNE  +DF F+PF GGPRKCVGDQFA++ES +ALA+ L++ +
Sbjct  473  --------------GPL-PNETNTDFRFIPFSGGPRKCVGDQFAMLESIVALAVFLERMN  517

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
              L    + + + TGATIHT NGL+ ++ +R
Sbjct  518  FVLVPD-QKISMTTGATIHTTNGLYMRVSRR  547



>ref|XP_002991812.1| hypothetical protein SELMODRAFT_186370 [Selaginella moellendorffii]
 gb|EFJ07074.1| hypothetical protein SELMODRAFT_186370 [Selaginella moellendorffii]
Length=525

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 90/152 (59%), Gaps = 28/152 (18%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPGGY  ++       G ++ ISVYN+H SP  W++  +F PERF      
Sbjct  401  IRRAQEQDTLPGGYKLER-------GQNVMISVYNIHHSPALWERAEDFVPERF------  447

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                         P    PNE  +DF ++PF GG RKCVGDQFA++E+ + LAMLLQ+F+
Sbjct  448  ------------DPDGPIPNESNTDFRYIPFSGGARKCVGDQFAMLEALVTLAMLLQRFE  495

Query  392  IDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  300
            ++L   P + + + TGATIHT  GL+  +K+R
Sbjct  496  LEL--VPGQDIGMTTGATIHTTKGLFMTVKRR  525



>ref|XP_002992972.1| hypothetical protein SELMODRAFT_187123 [Selaginella moellendorffii]
 gb|EFJ05918.1| hypothetical protein SELMODRAFT_187123 [Selaginella moellendorffii]
Length=525

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 90/152 (59%), Gaps = 28/152 (18%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPGGY  ++       G ++ ISVYN+H SP  W++  +F PERF      
Sbjct  401  IRRAQEQDTLPGGYKLER-------GQNVMISVYNIHHSPALWERAEDFVPERF------  447

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                         P    PNE  +DF ++PF GG RKCVGDQFA++E+ + LAMLLQ+F+
Sbjct  448  ------------DPDGPIPNESNTDFRYIPFSGGARKCVGDQFAMLEALVTLAMLLQRFE  495

Query  392  IDLKGTP-ESVKLVTGATIHTKNGLWCKLKKR  300
            ++L   P + + + TGATIHT  GL+  +K+R
Sbjct  496  LEL--VPGQDIGMTTGATIHTTKGLFMTVKRR  525



>emb|CAN65775.1| hypothetical protein VITISV_030413 [Vitis vinifera]
Length=521

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 90/151 (60%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+H S   W++  +F PERF      
Sbjct  385  IRRAKVADVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEDFLPERF------  431

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ +Q  +
Sbjct  432  DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFVQHMN  479

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    +++ + TGATIHT NGL+ KL +R
Sbjct  480  FELV-PDQNISMTTGATIHTTNGLYMKLTQR  509



>ref|XP_002265015.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Vitis 
vinifera]
Length=546

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 90/151 (60%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D LPG Y        + AG DI ISVYN+H S   W++  +F PERF      
Sbjct  410  IRRAKVADVLPGNYK-------VNAGQDIMISVYNIHHSSQVWERAEDFLPERF------  456

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ +ALA+ +Q  +
Sbjct  457  DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALAIFVQHMN  504

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    +++ + TGATIHT NGL+ KL +R
Sbjct  505  FELVPD-QNISMTTGATIHTTNGLYMKLTQR  534



>gb|EPS64627.1| hypothetical protein M569_10150 [Genlisea aurea]
Length=624

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 87/152 (57%), Gaps = 28/152 (18%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            +RR+   D LPG Y        +  G DI ISVYN+HRS   WD+  EF P+RF V    
Sbjct  398  LRRARVADTLPGNYK-------VEPGQDIMISVYNIHRSSQVWDRAEEFVPDRFDV----  446

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                              PNE  +DF F+PF GGPRKCVGDQFAL+E+ + LA++LQ+ D
Sbjct  447  --------------AGPVPNETNTDFKFIPFSGGPRKCVGDQFALLEATVGLAVVLQRLD  492

Query  392  IDLKGTPES-VKLVTGATIHTKNGLWCKLKKR  300
             +L   P+  + + TGATIHT NGL+ K+  R
Sbjct  493  FEL--VPDQIIGMTTGATIHTTNGLFMKVSPR  522



>ref|XP_002971637.1| hypothetical protein SELMODRAFT_231778 [Selaginella moellendorffii]
 gb|EFJ27386.1| hypothetical protein SELMODRAFT_231778 [Selaginella moellendorffii]
Length=399

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 86/152 (57%), Gaps = 26/152 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL+ D L G        Y +  G DIFIS++NLHRSP  W+  +EF PER+      
Sbjct  261  IRRSLQDDVLAG--------YPLKRGEDIFISLWNLHRSPSLWEHSHEFRPERW------  306

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                     P   P    PNE+  +F +LPFGGGPRKCVGD FA  E+  A+AML+++FD
Sbjct  307  ---------PLDGPD---PNEVTENFKYLPFGGGPRKCVGDMFATFETVTAVAMLVRRFD  354

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  297
              L      V + TGATIHT  GL   + KR+
Sbjct  355  FKLAQGAPPVGMTTGATIHTTAGLHVAVTKRI  386



>gb|ADK60778.1| putative mitochondrial cytochrome P450 monooxygenase [Arachis 
diogoi]
Length=197

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 86/152 (57%), Gaps = 26/152 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL  D L          Y I  G DIFISV+NLHRSP  WD  ++F+PER+      
Sbjct  37   IRRSLENDML--------GEYTIKRGEDIFISVWNLHRSPNLWDDADKFQPERW------  82

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                     P   P    PNE   +F +LPFGGGPRKCVGD FA  E+ +ALAML+++F+
Sbjct  83   ---------PVDGPN---PNETNQNFKYLPFGGGPRKCVGDLFASYETIVALAMLVRRFN  130

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  297
              +      V++ TGATIHT  GL   + +R+
Sbjct  131  FQVAVGAPPVEMTTGATIHTTQGLKMTVTRRI  162



>ref|XP_010683980.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010683981.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010683982.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=543

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 88/151 (58%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            +RR+   D LPG Y        +  G DI ISVYN+H S   W++  EF PERF +    
Sbjct  411  LRRAQIADTLPGDYK-------VNPGQDIMISVYNIHHSSQVWERAEEFIPERFDLE---  460

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                        SP    PNE  +D+ ++PF GGPRKCVGDQFAL+E+ +ALA+LLQ  D
Sbjct  461  ------------SP---VPNESNTDYRYIPFSGGPRKCVGDQFALLEAIVALAILLQNMD  505

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    + + + TGATIHT NGL+ KL +R
Sbjct  506  FELVPD-QDITMTTGATIHTTNGLYMKLSER  535



>gb|AJB84623.1| carotene epsilon-monooxygenase [Camellia sinensis]
Length=557

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 90/151 (60%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            +RR+   D LPG Y        +  G DI ISVYN+H SP  WD+   F PERF      
Sbjct  419  LRRAQVADVLPGNYK-------VNPGQDIMISVYNIHHSPQVWDRAEVFVPERF------  465

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            +++G              PNE  +DF F+PF GGPRKC+GDQFAL+E+ +ALA+ +Q  D
Sbjct  466  DLDG------------PMPNETNTDFRFIPFSGGPRKCIGDQFALLEAIVALAIFVQHMD  513

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    +++ + TGATIHT+NGL+ K+ +R
Sbjct  514  FELVPD-QNISMTTGATIHTENGLYMKVSQR  543



>ref|XP_002965693.1| hypothetical protein SELMODRAFT_407294 [Selaginella moellendorffii]
 gb|EFJ33113.1| hypothetical protein SELMODRAFT_407294 [Selaginella moellendorffii]
Length=553

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 86/152 (57%), Gaps = 26/152 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL+ D L G        Y +  G DIFIS++NLHRSP  W+  +EF PER+      
Sbjct  415  IRRSLQDDVLAG--------YPLKRGEDIFISLWNLHRSPSLWEHSHEFRPERW------  460

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                     P   P    PNE+  +F +LPFGGGPRKCVGD FA  E+  A+AML+++FD
Sbjct  461  ---------PLDGPD---PNEVTENFKYLPFGGGPRKCVGDMFATFETVTAVAMLVRRFD  508

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  297
              L      V + TGATIHT  GL   + KR+
Sbjct  509  FKLAQGAPPVGMTTGATIHTTAGLHVAVTKRI  540



>ref|XP_006833028.1| hypothetical protein AMTR_s00094p00105890 [Amborella trichopoda]
 gb|ERM98306.1| hypothetical protein AMTR_s00094p00105890 [Amborella trichopoda]
Length=80

 Score =   115 bits (289),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -3

Query  512  EIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFDIDLKGTPESVKLVTGATIHT  333
            +IISDFAFLPFGGGPRKC+GDQFALMES IALA+LL +FD +L+  PE ++ VT ATIHT
Sbjct  3    QIISDFAFLPFGGGPRKCLGDQFALMESTIALALLLHRFDAELRYPPEYMEAVTEATIHT  62

Query  332  KNGLWCKLKKR  300
            K+GLWCKL+KR
Sbjct  63   KDGLWCKLRKR  73



>gb|ABB52076.1| putative epsilon-ring carotene hydroxylase [Daucus carota subsp. 
sativus]
Length=548

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 89/152 (59%), Gaps = 28/152 (18%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRR+   D+LPG Y        +  G DI ISVYN+H S   WD+  EF PERF      
Sbjct  412  IRRAEVADELPGSYK-------VNPGQDIMISVYNIHHSSKVWDRAEEFIPERF------  458

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            +++G              PNE  +D+ F+PF GGPRKCVGDQFAL+E+ ++LA+ LQ   
Sbjct  459  DLDGPV------------PNESNTDYRFIPFSGGPRKCVGDQFALLEAIVSLAIFLQHLS  506

Query  392  IDLKGTPESV-KLVTGATIHTKNGLWCKLKKR  300
             +L   P+ V  + TGATIHT NGL+ K+ KR
Sbjct  507  FEL--IPDQVINMTTGATIHTTNGLYMKVSKR  536



>gb|KDP29211.1| hypothetical protein JCGZ_16600 [Jatropha curcas]
Length=573

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 88/151 (58%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            +RR+   D LPG Y        +  G DI ISVYN+H S   W++  EF PERF      
Sbjct  413  LRRAQVADVLPGNYK-------VNPGQDIMISVYNIHHSSKVWERAEEFVPERF------  459

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
            ++EG              PNE  +DF F+PF GGPRKCVGDQFAL+E+ ++LA+ LQ  +
Sbjct  460  DLEGPV------------PNETNTDFRFIPFSGGPRKCVGDQFALLEAIVSLAIFLQNMN  507

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    + + + TGATIHT NGL+ KL +R
Sbjct  508  FELVPD-QKINMTTGATIHTTNGLYMKLSQR  537



>gb|ABD97103.1| cytochrome P450 monooxygenase CYP97C10 [Glycine max]
Length=425

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 86/152 (57%), Gaps = 26/152 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL  D L          Y I  G DIFISV+NLHRSP  WD  ++F+PER       
Sbjct  260  IRRSLEDDVL--------GEYPIKRGEDIFISVWNLHRSPKLWDDADKFKPER-------  304

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                WA   PS       PNE   +F +LPFGGGPRKCVGD FA  E+ +ALAML+++F+
Sbjct  305  ----WALDGPS-------PNETNQNFKYLPFGGGPRKCVGDLFASYETVVALAMLMRRFN  353

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  297
              +      V++ TGATIHT  GL   +  R+
Sbjct  354  FQIAVGAPPVEMTTGATIHTTQGLKMTVTHRI  385



>ref|XP_010674674.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=628

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 86/151 (57%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRS+  D L          Y I  G DIFIS++NLHRSP  W+  ++F PER+      
Sbjct  465  IRRSIEEDTL--------GPYPIRKGEDIFISIWNLHRSPSLWEDADKFNPERW------  510

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                     P   P    PNE    F +LPFGGG RKC+GD FA  E+ +ALAML+Q+FD
Sbjct  511  ---------PLDGPA---PNETNQSFRYLPFGGGQRKCIGDMFASYENVVALAMLVQRFD  558

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L      VK+ TGATIHT NGL  K+++R
Sbjct  559  FELDPEAPPVKMTTGATIHTTNGLMMKVRQR  589



>gb|AJD25228.1| cytochrome P450 CYP97C28 [Salvia miltiorrhiza]
Length=542

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 90/151 (60%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            +RR+   D LPG Y        +  G DI ISVYN+HRS   W++ ++F PERF +    
Sbjct  407  LRRAQVDDLLPGNYK-------VSPGQDIMISVYNIHRSAEVWERADDFVPERFDLD---  456

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                        SP    PNE  +D+ ++PF GGPRKCVGDQFAL+E+ +ALA+LLQ   
Sbjct  457  ------------SP---VPNEANTDYRYIPFSGGPRKCVGDQFALLEAIVALAVLLQHAS  501

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
             +L    +++ + TGATIHT NGL+ KL +R
Sbjct  502  FELIPD-QTIGMTTGATIHTTNGLYMKLSQR  531



>gb|AJD25226.1| cytochrome P450 CYP97A41 [Salvia miltiorrhiza]
Length=612

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 88/151 (58%), Gaps = 26/151 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL  D L          Y I  G DIFISV+NLHRSP+ W++ ++F PER+      
Sbjct  452  IRRSLGDDIL--------GKYPIKKGEDIFISVWNLHRSPHHWEEADKFNPERW------  497

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                     P   P    PNE   +F++LPFGGGPRKC+GD FA  E+ +A+AML+++FD
Sbjct  498  ---------PLDGPN---PNETNQNFSYLPFGGGPRKCIGDMFATFETVVAVAMLVRRFD  545

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKR  300
              L  +   VK+ TGATIHT  GL   + +R
Sbjct  546  FQLAISAPPVKMTTGATIHTTEGLKMTVTRR  576



>ref|XP_008218412.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic-like [Prunus 
mume]
Length=610

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 91/153 (59%), Gaps = 28/153 (18%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL  D+L     GD   Y+I    DIFI ++NLHRSP  WD  ++F+PER+      
Sbjct  452  IRRSLEDDRL-----GD---YSITRNEDIFICIWNLHRSPKQWDDADKFKPERW------  497

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                     P   P    PNE   +F +LPFGGGPRKCVGD FA  E+ +ALAML+Q+F+
Sbjct  498  ---------PLDGPN---PNETNQNFRYLPFGGGPRKCVGDMFATYETVVALAMLVQRFN  545

Query  392  IDLK-GTPESVKLVTGATIHTKNGLWCKLKKRL  297
              +  G PE VK+ TGATIHT  GL   + +R+
Sbjct  546  FQIALGAPE-VKMTTGATIHTTEGLKMTVTRRI  577



>ref|XP_002512609.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF50061.1| cytochrome P450, putative [Ricinus communis]
Length=632

 Score =   122 bits (306),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 85/152 (56%), Gaps = 26/152 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL+ D L          Y I  G DIFISV+NLHRSP+ WD   +F PER+      
Sbjct  468  IRRSLQDDML--------GKYPIKRGEDIFISVWNLHRSPHLWDDAEKFNPERW------  513

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                     P   P    PNE   +F +LPFGGGPRKCVGD FA  E+ +A AML+++F+
Sbjct  514  ---------PLDGPN---PNETNQNFCYLPFGGGPRKCVGDMFASFETVVATAMLVRRFN  561

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  297
              L      VK+ TGATIHT  GL   + +R+
Sbjct  562  FQLALGAPPVKMTTGATIHTTEGLTMTVTRRI  593



>ref|XP_003534527.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic-like [Glycine 
max]
Length=633

 Score =   121 bits (304),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 88/152 (58%), Gaps = 26/152 (17%)
 Frame = -3

Query  752  IRRSLRPDQLPGGYNGDKDGYAIPAGTDIFISVYNLHRSPYFWDKPNEFEPERFQVRKES  573
            IRRSL  D L     G+   Y I  G DIFISV+NLHRSP  WD  ++F+PER       
Sbjct  470  IRRSLEDDVL-----GE---YPIKRGEDIFISVWNLHRSPKLWDDADKFKPER-------  514

Query  572  EIEGWAGFDPSRSPGALYPNEIISDFAFLPFGGGPRKCVGDQFALMESAIALAMLLQKFD  393
                WA   PS       PNE   +F +LPFGGGPRKCVGD FA  E+ +ALAML+++F+
Sbjct  515  ----WALDGPS-------PNETNQNFKYLPFGGGPRKCVGDLFASYETVVALAMLMRRFN  563

Query  392  IDLKGTPESVKLVTGATIHTKNGLWCKLKKRL  297
              +      V++ TGATIHT  GL   +  R+
Sbjct  564  FQIAVGAPPVEMTTGATIHTTQGLKMTVTHRI  595



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401010927050