BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF013D22

Length=658
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CBI20987.3|  unnamed protein product                                273   6e-83   Vitis vinifera
ref|XP_011081899.1|  PREDICTED: transcriptional corepressor LEUNIG      273   7e-82   Sesamum indicum [beniseed]
ref|XP_010648611.1|  PREDICTED: transcriptional corepressor LEUNI...    273   9e-82   Vitis vinifera
ref|XP_009624260.1|  PREDICTED: transcriptional corepressor LEUNI...    273   9e-82   
ref|XP_009787198.1|  PREDICTED: transcriptional corepressor LEUNI...    272   1e-81   Nicotiana sylvestris
ref|XP_009624258.1|  PREDICTED: transcriptional corepressor LEUNI...    272   1e-81   
ref|XP_002284900.1|  PREDICTED: transcriptional corepressor LEUNI...    272   1e-81   Vitis vinifera
ref|XP_009624257.1|  PREDICTED: transcriptional corepressor LEUNI...    272   1e-81   Nicotiana tomentosiformis
ref|XP_009787197.1|  PREDICTED: transcriptional corepressor LEUNI...    272   1e-81   Nicotiana sylvestris
ref|XP_009787196.1|  PREDICTED: transcriptional corepressor LEUNI...    272   1e-81   Nicotiana sylvestris
ref|XP_002284925.2|  PREDICTED: transcriptional corepressor LEUNI...    259   2e-81   Vitis vinifera
emb|CBI20989.3|  unnamed protein product                                258   3e-81   Vitis vinifera
ref|XP_011019744.1|  PREDICTED: transcriptional corepressor LEUNI...    268   2e-80   Populus euphratica
ref|XP_010322742.1|  PREDICTED: transcriptional corepressor LEUNI...    269   2e-80   Solanum lycopersicum
ref|XP_010322743.1|  PREDICTED: transcriptional corepressor LEUNI...    269   2e-80   Solanum lycopersicum
ref|XP_006353652.1|  PREDICTED: transcriptional corepressor LEUNI...    269   2e-80   Solanum tuberosum [potatoes]
ref|XP_006353653.1|  PREDICTED: transcriptional corepressor LEUNI...    268   3e-80   Solanum tuberosum [potatoes]
ref|XP_004241804.1|  PREDICTED: transcriptional corepressor LEUNI...    268   3e-80   Solanum lycopersicum
ref|XP_010322740.1|  PREDICTED: transcriptional corepressor LEUNI...    268   3e-80   Solanum lycopersicum
ref|XP_006353650.1|  PREDICTED: transcriptional corepressor LEUNI...    268   3e-80   Solanum tuberosum [potatoes]
ref|XP_011019743.1|  PREDICTED: transcriptional corepressor LEUNI...    268   3e-80   Populus euphratica
ref|XP_006353651.1|  PREDICTED: transcriptional corepressor LEUNI...    268   3e-80   Solanum tuberosum [potatoes]
ref|XP_011019742.1|  PREDICTED: transcriptional corepressor LEUNI...    268   3e-80   Populus euphratica
ref|XP_003544623.1|  PREDICTED: transcriptional corepressor LEUNI...    268   3e-80   Glycine max [soybeans]
ref|XP_010322741.1|  PREDICTED: transcriptional corepressor LEUNI...    268   4e-80   Solanum lycopersicum
ref|XP_003544622.1|  PREDICTED: transcriptional corepressor LEUNI...    268   4e-80   Glycine max [soybeans]
ref|XP_006596119.1|  PREDICTED: transcriptional corepressor LEUNI...    268   5e-80   Glycine max [soybeans]
ref|XP_002309593.2|  LEUNIG family protein                              268   6e-80   
ref|XP_008394022.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    267   7e-80   
ref|XP_004498639.1|  PREDICTED: transcriptional corepressor LEUNI...    267   7e-80   Cicer arietinum [garbanzo]
ref|XP_004498638.1|  PREDICTED: transcriptional corepressor LEUNI...    267   1e-79   Cicer arietinum [garbanzo]
gb|EYU21923.1|  hypothetical protein MIMGU_mgv1a000972mg                267   1e-79   Erythranthe guttata [common monkey flower]
ref|XP_009377499.1|  PREDICTED: transcriptional corepressor LEUNI...    266   3e-79   Pyrus x bretschneideri [bai li]
ref|XP_011459234.1|  PREDICTED: transcriptional corepressor LEUNI...    265   4e-79   Fragaria vesca subsp. vesca
ref|XP_003588695.1|  Transcriptional corepressor LEUNIG                 265   4e-79   Medicago truncatula
ref|XP_009377496.1|  PREDICTED: transcriptional corepressor LEUNI...    266   4e-79   Pyrus x bretschneideri [bai li]
ref|XP_004291496.1|  PREDICTED: transcriptional corepressor LEUNI...    265   4e-79   Fragaria vesca subsp. vesca
gb|KEH39820.1|  transcriptional corepressor leunig-like protein         265   5e-79   Medicago truncatula
ref|XP_010254246.1|  PREDICTED: transcriptional corepressor LEUNI...    265   9e-79   Nelumbo nucifera [Indian lotus]
ref|XP_008352162.1|  PREDICTED: transcriptional corepressor LEUNI...    253   1e-78   
ref|XP_010254245.1|  PREDICTED: transcriptional corepressor LEUNI...    265   1e-78   Nelumbo nucifera [Indian lotus]
ref|XP_010254244.1|  PREDICTED: transcriptional corepressor LEUNI...    265   1e-78   Nelumbo nucifera [Indian lotus]
ref|XP_010254242.1|  PREDICTED: transcriptional corepressor LEUNI...    265   1e-78   Nelumbo nucifera [Indian lotus]
ref|XP_010254243.1|  PREDICTED: transcriptional corepressor LEUNI...    264   1e-78   Nelumbo nucifera [Indian lotus]
ref|XP_009367963.1|  PREDICTED: transcriptional corepressor LEUNI...    253   2e-78   Pyrus x bretschneideri [bai li]
emb|CAF18245.1|  STYLOSA protein                                        264   2e-78   Antirrhinum majus [garden snapdragon]
ref|XP_008359610.1|  PREDICTED: transcriptional corepressor LEUNI...    263   3e-78   
ref|XP_009367962.1|  PREDICTED: transcriptional corepressor LEUNI...    253   3e-78   Pyrus x bretschneideri [bai li]
ref|XP_008359611.1|  PREDICTED: transcriptional corepressor LEUNI...    263   3e-78   
ref|XP_007225318.1|  hypothetical protein PRUPE_ppa001131mg             258   3e-78   
ref|XP_007161251.1|  hypothetical protein PHAVU_001G054700g             263   4e-78   Phaseolus vulgaris [French bean]
ref|XP_008359612.1|  PREDICTED: transcriptional corepressor LEUNI...    263   4e-78   
ref|XP_008219869.1|  PREDICTED: transcriptional corepressor LEUNI...    263   4e-78   Prunus mume [ume]
ref|XP_008359609.1|  PREDICTED: transcriptional corepressor LEUNI...    263   4e-78   
ref|XP_008359608.1|  PREDICTED: transcriptional corepressor LEUNI...    263   4e-78   
ref|XP_009372956.1|  PREDICTED: transcriptional corepressor LEUNI...    261   5e-78   
ref|XP_008219868.1|  PREDICTED: transcriptional corepressor LEUNI...    263   6e-78   Prunus mume [ume]
ref|XP_008219867.1|  PREDICTED: transcriptional corepressor LEUNI...    263   6e-78   Prunus mume [ume]
ref|XP_003550163.1|  PREDICTED: transcriptional corepressor LEUNI...    262   6e-78   
gb|KDO79602.1|  hypothetical protein CISIN_1g002471mg                   256   8e-78   Citrus sinensis [apfelsine]
ref|XP_003550164.1|  PREDICTED: transcriptional corepressor LEUNI...    262   8e-78   
ref|XP_009372954.1|  PREDICTED: transcriptional corepressor LEUNI...    261   9e-78   Pyrus x bretschneideri [bai li]
ref|XP_009372955.1|  PREDICTED: transcriptional corepressor LEUNI...    261   1e-77   Pyrus x bretschneideri [bai li]
ref|XP_009372950.1|  PREDICTED: transcriptional corepressor LEUNI...    261   1e-77   Pyrus x bretschneideri [bai li]
ref|XP_009372951.1|  PREDICTED: transcriptional corepressor LEUNI...    261   1e-77   Pyrus x bretschneideri [bai li]
ref|XP_007013777.1|  LisH dimerization motif,WD40/YVTN repeat-lik...    261   1e-77   
ref|XP_007013778.1|  LisH dimerization motif,WD40/YVTN repeat-lik...    261   2e-77   Theobroma cacao [chocolate]
ref|XP_010112086.1|  Transcriptional corepressor LEUNIG                 261   2e-77   Morus notabilis
ref|XP_007221603.1|  hypothetical protein PRUPE_ppa026892mg             249   4e-77   
ref|XP_002515595.1|  WD-repeat protein, putative                        257   4e-77   
ref|XP_010526195.1|  PREDICTED: transcriptional corepressor LEUNI...    258   1e-76   Tarenaya hassleriana [spider flower]
gb|KDO79600.1|  hypothetical protein CISIN_1g002471mg                   256   2e-76   Citrus sinensis [apfelsine]
ref|XP_007225320.1|  hypothetical protein PRUPE_ppa001131mg             258   2e-76   
ref|XP_007225321.1|  hypothetical protein PRUPE_ppa001131mg             258   2e-76   
ref|XP_007225322.1|  hypothetical protein PRUPE_ppa001131mg             258   2e-76   
ref|XP_010526194.1|  PREDICTED: transcriptional corepressor LEUNI...    257   4e-76   Tarenaya hassleriana [spider flower]
ref|XP_007013780.1|  LisH dimerization motif,WD40/YVTN repeat-lik...    257   6e-76   
ref|XP_011026513.1|  PREDICTED: transcriptional corepressor LEUNI...    256   9e-76   Populus euphratica
gb|KDO79597.1|  hypothetical protein CISIN_1g002471mg                   256   1e-75   Citrus sinensis [apfelsine]
ref|XP_011026514.1|  PREDICTED: transcriptional corepressor LEUNI...    256   1e-75   Populus euphratica
ref|XP_006476206.1|  PREDICTED: transcriptional corepressor LEUNI...    256   1e-75   Citrus sinensis [apfelsine]
ref|XP_006450544.1|  hypothetical protein CICLE_v10007390mg             256   1e-75   Citrus clementina [clementine]
gb|KDO79596.1|  hypothetical protein CISIN_1g002471mg                   256   1e-75   Citrus sinensis [apfelsine]
ref|XP_011026512.1|  PREDICTED: transcriptional corepressor LEUNI...    256   1e-75   Populus euphratica
ref|XP_006450543.1|  hypothetical protein CICLE_v10007390mg             256   1e-75   
gb|KDO79598.1|  hypothetical protein CISIN_1g002471mg                   256   1e-75   Citrus sinensis [apfelsine]
ref|XP_006371728.1|  LEUNIG family protein                              256   1e-75   
ref|XP_010526193.1|  PREDICTED: transcriptional corepressor LEUNI...    256   1e-75   
ref|XP_010526192.1|  PREDICTED: transcriptional corepressor LEUNI...    256   1e-75   
ref|XP_011026511.1|  PREDICTED: transcriptional corepressor LEUNI...    256   1e-75   Populus euphratica
ref|XP_003522634.1|  PREDICTED: transcriptional corepressor LEUNI...    256   1e-75   Glycine max [soybeans]
ref|XP_006578171.1|  PREDICTED: transcriptional corepressor LEUNI...    256   2e-75   Glycine max [soybeans]
ref|XP_009377500.1|  PREDICTED: transcriptional corepressor LEUNI...    254   2e-75   
ref|XP_004501292.1|  PREDICTED: transcriptional corepressor LEUNI...    255   2e-75   Cicer arietinum [garbanzo]
ref|XP_003522633.1|  PREDICTED: transcriptional corepressor LEUNI...    255   2e-75   Glycine max [soybeans]
ref|XP_010249918.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    255   2e-75   
ref|XP_004501291.1|  PREDICTED: transcriptional corepressor LEUNI...    255   2e-75   Cicer arietinum [garbanzo]
ref|XP_004501290.1|  PREDICTED: transcriptional corepressor LEUNI...    255   3e-75   Cicer arietinum [garbanzo]
ref|XP_009377497.1|  PREDICTED: transcriptional corepressor LEUNI...    255   3e-75   
ref|XP_009377494.1|  PREDICTED: transcriptional corepressor LEUNI...    255   3e-75   
ref|XP_009377498.1|  PREDICTED: transcriptional corepressor LEUNI...    254   4e-75   
ref|XP_010548472.1|  PREDICTED: transcriptional corepressor LEUNI...    254   6e-75   Tarenaya hassleriana [spider flower]
ref|XP_010548470.1|  PREDICTED: transcriptional corepressor LEUNI...    253   9e-75   Tarenaya hassleriana [spider flower]
ref|XP_010548471.1|  PREDICTED: transcriptional corepressor LEUNI...    253   9e-75   Tarenaya hassleriana [spider flower]
ref|XP_006581384.1|  PREDICTED: transcriptional corepressor LEUNI...    253   2e-74   Glycine max [soybeans]
ref|XP_003526430.1|  PREDICTED: transcriptional corepressor LEUNI...    252   2e-74   Glycine max [soybeans]
ref|XP_006581383.1|  PREDICTED: transcriptional corepressor LEUNI...    252   3e-74   Glycine max [soybeans]
gb|KDP32298.1|  hypothetical protein JCGZ_13223                         252   4e-74   Jatropha curcas
gb|KFK29865.1|  hypothetical protein AALP_AA7G189100                    251   7e-74   Arabis alpina [alpine rockcress]
ref|XP_010670737.1|  PREDICTED: transcriptional corepressor LEUNIG      251   8e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010914979.1|  PREDICTED: transcriptional corepressor LEUNI...    249   1e-73   
ref|XP_009138136.1|  PREDICTED: transcriptional corepressor LEUNI...    250   2e-73   Brassica rapa
gb|KJB83300.1|  hypothetical protein B456_013G240700                    250   2e-73   Gossypium raimondii
gb|KJB83302.1|  hypothetical protein B456_013G240700                    250   2e-73   Gossypium raimondii
gb|KJB83312.1|  hypothetical protein B456_013G240700                    250   2e-73   Gossypium raimondii
emb|CDX72364.1|  BnaC07g43860D                                          246   2e-73   
gb|KJB83314.1|  hypothetical protein B456_013G240700                    250   2e-73   Gossypium raimondii
gb|KJB83304.1|  hypothetical protein B456_013G240700                    250   3e-73   Gossypium raimondii
emb|CDY13494.1|  BnaA03g52120D                                          249   3e-73   Brassica napus [oilseed rape]
gb|KDP23675.1|  hypothetical protein JCGZ_23508                         236   3e-73   Jatropha curcas
ref|XP_010049009.1|  PREDICTED: transcriptional corepressor LEUNI...    235   1e-72   
emb|CDY23331.1|  BnaA08g12150D                                          248   1e-72   Brassica napus [oilseed rape]
ref|XP_010049010.1|  PREDICTED: transcriptional corepressor LEUNI...    234   1e-72   Eucalyptus grandis [rose gum]
emb|CDY51674.1|  BnaC03g67130D                                          248   1e-72   Brassica napus [oilseed rape]
ref|XP_006412457.1|  hypothetical protein EUTSA_v10024343mg             247   2e-72   Eutrema salsugineum [saltwater cress]
ref|XP_009108869.1|  PREDICTED: transcriptional corepressor LEUNIG      247   2e-72   Brassica rapa
gb|KFK29867.1|  hypothetical protein AALP_AA7G189300                    236   2e-72   Arabis alpina [alpine rockcress]
ref|XP_007137062.1|  hypothetical protein PHAVU_009G096600g             247   3e-72   Phaseolus vulgaris [French bean]
ref|XP_002514368.1|  WD-repeat protein, putative                        240   3e-72   
ref|XP_007137063.1|  hypothetical protein PHAVU_009G096600g             247   3e-72   Phaseolus vulgaris [French bean]
ref|XP_010049007.1|  PREDICTED: transcriptional corepressor LEUNI...    234   3e-72   
gb|KFK29866.1|  hypothetical protein AALP_AA7G189300                    236   4e-72   Arabis alpina [alpine rockcress]
ref|XP_010915804.1|  PREDICTED: transcriptional corepressor LEUNI...    246   6e-72   
ref|XP_010915881.1|  PREDICTED: transcriptional corepressor LEUNI...    245   7e-72   Elaeis guineensis
gb|KJB83303.1|  hypothetical protein B456_013G240700                    246   8e-72   Gossypium raimondii
ref|XP_010915729.1|  PREDICTED: transcriptional corepressor LEUNI...    245   8e-72   Elaeis guineensis
gb|KJB83301.1|  hypothetical protein B456_013G240700                    246   8e-72   Gossypium raimondii
ref|XP_010915657.1|  PREDICTED: transcriptional corepressor LEUNI...    245   9e-72   Elaeis guineensis
gb|AAG32022.1|AF277458_1  LEUNIG                                        245   1e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869264.1|  hypothetical protein ARALYDRAFT_491464             245   1e-71   
gb|KJB83305.1|  hypothetical protein B456_013G240700                    245   1e-71   Gossypium raimondii
ref|XP_010432701.1|  PREDICTED: transcriptional corepressor LEUNI...    245   1e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010447372.1|  PREDICTED: transcriptional corepressor LEUNIG      245   1e-71   Camelina sativa [gold-of-pleasure]
ref|NP_567896.1|  transcriptional corepressor LEUNIG                    245   1e-71   Arabidopsis thaliana [mouse-ear cress]
emb|CAB43692.1|  putative protein                                       245   2e-71   Arabidopsis thaliana [mouse-ear cress]
gb|KEH35932.1|  transcriptional corepressor leunig-like protein         244   2e-71   Medicago truncatula
ref|NP_001190891.1|  transcriptional corepressor LEUNIG                 245   2e-71   Arabidopsis thaliana [mouse-ear cress]
gb|AES73711.2|  transcriptional corepressor leunig-like protein         244   2e-71   Medicago truncatula
ref|XP_003603460.1|  NAD(P)H-quinone oxidoreductase subunit             244   4e-71   
ref|XP_008811606.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    243   6e-71   
emb|CDX68860.1|  BnaC01g05930D                                          243   8e-71   
ref|XP_009125860.1|  PREDICTED: transcriptional corepressor LEUNI...    242   1e-70   Brassica rapa
ref|XP_009125852.1|  PREDICTED: transcriptional corepressor LEUNI...    242   1e-70   Brassica rapa
ref|XP_009125844.1|  PREDICTED: transcriptional corepressor LEUNI...    242   1e-70   Brassica rapa
gb|KCW81465.1|  hypothetical protein EUGRSUZ_C028381                    241   2e-70   Eucalyptus grandis [rose gum]
ref|XP_010049005.1|  PREDICTED: transcriptional corepressor LEUNIG      241   2e-70   
emb|CDX75254.1|  BnaA01g04480D                                          242   4e-70   
ref|XP_009407640.1|  PREDICTED: transcriptional corepressor LEUNI...    239   4e-70   
ref|XP_002969651.1|  hypothetical protein SELMODRAFT_410492             239   6e-70   Selaginella moellendorffii
ref|XP_002970913.1|  hypothetical protein SELMODRAFT_94317              239   8e-70   
gb|KCW81467.1|  hypothetical protein EUGRSUZ_C028381                    239   1e-69   Eucalyptus grandis [rose gum]
gb|KJB64525.1|  hypothetical protein B456_010G053000                    239   2e-69   Gossypium raimondii
gb|KJB64523.1|  hypothetical protein B456_010G053000                    239   2e-69   Gossypium raimondii
gb|KJB64522.1|  hypothetical protein B456_010G053000                    239   2e-69   Gossypium raimondii
ref|XP_009407638.1|  PREDICTED: transcriptional corepressor LEUNI...    238   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407639.1|  PREDICTED: transcriptional corepressor LEUNI...    238   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008445143.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    238   3e-69   
ref|XP_010925121.1|  PREDICTED: transcriptional corepressor LEUNI...    238   3e-69   Elaeis guineensis
ref|XP_010925120.1|  PREDICTED: transcriptional corepressor LEUNI...    238   3e-69   Elaeis guineensis
gb|KCW81469.1|  hypothetical protein EUGRSUZ_C028381                    236   1e-68   Eucalyptus grandis [rose gum]
gb|KCW81471.1|  hypothetical protein EUGRSUZ_C028381                    236   1e-68   Eucalyptus grandis [rose gum]
gb|KGN62903.1|  hypothetical protein Csa_2G379340                       234   6e-68   Cucumis sativus [cucumbers]
gb|KHN08101.1|  Transcriptional corepressor LEUNIG                      234   8e-68   Glycine soja [wild soybean]
ref|XP_004138746.1|  PREDICTED: transcriptional corepressor LEUNI...    234   8e-68   Cucumis sativus [cucumbers]
ref|XP_004168288.1|  PREDICTED: transcriptional corepressor LEUNI...    234   9e-68   
ref|XP_004138745.1|  PREDICTED: transcriptional corepressor LEUNI...    234   9e-68   Cucumis sativus [cucumbers]
ref|XP_002531278.1|  WD-repeat protein, putative                        222   1e-67   
gb|KDP32334.1|  hypothetical protein JCGZ_13259                         232   4e-67   Jatropha curcas
ref|XP_008394021.1|  PREDICTED: transcriptional corepressor LEUNI...    221   6e-67   
gb|EPS73524.1|  hypothetical protein M569_01232                         221   8e-67   Genlisea aurea
gb|KHN16498.1|  Transcriptional corepressor LEUNIG                      231   9e-67   Glycine soja [wild soybean]
ref|XP_008390143.1|  PREDICTED: transcriptional corepressor LEUNI...    219   3e-65   
ref|XP_002962710.1|  hypothetical protein SELMODRAFT_79275              226   7e-65   
ref|XP_002980381.1|  hypothetical protein SELMODRAFT_112245             226   9e-65   
ref|XP_009405109.1|  PREDICTED: transcriptional corepressor LEUNI...    225   1e-64   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO80405.1|  hypothetical protein CISIN_1g003177mg                   221   1e-64   Citrus sinensis [apfelsine]
ref|XP_009405103.1|  PREDICTED: transcriptional corepressor LEUNI...    225   1e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009405115.1|  PREDICTED: transcriptional corepressor LEUNI...    225   1e-64   
ref|XP_010533194.1|  PREDICTED: transcriptional corepressor LEUNI...    224   2e-64   
gb|KJB83315.1|  hypothetical protein B456_013G240700                    224   3e-64   Gossypium raimondii
gb|KDO80403.1|  hypothetical protein CISIN_1g003177mg                   221   2e-63   Citrus sinensis [apfelsine]
gb|KDO80404.1|  hypothetical protein CISIN_1g003177mg                   221   2e-63   Citrus sinensis [apfelsine]
ref|XP_006838727.1|  hypothetical protein AMTR_s00002p00252820          222   2e-63   Amborella trichopoda
ref|XP_006451037.1|  hypothetical protein CICLE_v10007449mg             221   3e-63   Citrus clementina [clementine]
gb|KDO80395.1|  hypothetical protein CISIN_1g003177mg                   221   4e-63   Citrus sinensis [apfelsine]
ref|XP_006475763.1|  PREDICTED: transcriptional corepressor LEUNI...    221   4e-63   Citrus sinensis [apfelsine]
ref|XP_006475762.1|  PREDICTED: transcriptional corepressor LEUNI...    221   5e-63   Citrus sinensis [apfelsine]
gb|KDO80396.1|  hypothetical protein CISIN_1g003177mg                   221   5e-63   Citrus sinensis [apfelsine]
ref|XP_008386062.1|  PREDICTED: transcriptional corepressor LEUNI...    220   7e-63   
ref|XP_009371420.1|  PREDICTED: transcriptional corepressor LEUNI...    220   9e-63   
gb|ACZ98534.1|  LisH-SSDP-WD40                                          220   9e-63   Malus domestica [apple tree]
ref|XP_008386048.1|  PREDICTED: transcriptional corepressor LEUNI...    219   1e-62   
ref|XP_008386053.1|  PREDICTED: transcriptional corepressor LEUNI...    219   1e-62   
ref|XP_009371419.1|  PREDICTED: transcriptional corepressor LEUNI...    219   1e-62   Pyrus x bretschneideri [bai li]
gb|KHG05392.1|  Transcriptional corepressor LEUNIG -like protein        218   2e-62   Gossypium arboreum [tree cotton]
ref|XP_007013296.1|  LisH dimerization motif,WD40/YVTN repeat-lik...    219   2e-62   
ref|XP_010656383.1|  PREDICTED: transcriptional corepressor LEUNI...    219   2e-62   Vitis vinifera
ref|XP_010656382.1|  PREDICTED: transcriptional corepressor LEUNI...    219   2e-62   Vitis vinifera
gb|KHN15508.1|  Transcriptional corepressor LEUNIG                      218   3e-62   Glycine soja [wild soybean]
ref|XP_008337351.1|  PREDICTED: transcriptional corepressor LEUNI...    217   7e-62   
ref|XP_008337350.1|  PREDICTED: transcriptional corepressor LEUNI...    217   7e-62   
ref|XP_008337347.1|  PREDICTED: transcriptional corepressor LEUNI...    217   7e-62   
ref|XP_008337349.1|  PREDICTED: transcriptional corepressor LEUNI...    217   8e-62   
ref|XP_009374058.1|  PREDICTED: transcriptional corepressor LEUNI...    216   2e-61   
ref|XP_009403018.1|  PREDICTED: transcriptional corepressor LEUNI...    215   4e-61   
ref|XP_009403020.1|  PREDICTED: transcriptional corepressor LEUNI...    215   4e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009387170.1|  PREDICTED: transcriptional corepressor LEUNI...    214   8e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007204646.1|  hypothetical protein PRUPE_ppa001612mg             213   1e-60   
ref|XP_008242693.1|  PREDICTED: transcriptional corepressor LEUNI...    214   2e-60   Prunus mume [ume]
ref|XP_008242692.1|  PREDICTED: transcriptional corepressor LEUNI...    214   2e-60   Prunus mume [ume]
ref|XP_010541891.1|  PREDICTED: transcriptional corepressor LEUNI...    211   3e-60   Tarenaya hassleriana [spider flower]
ref|XP_010541888.1|  PREDICTED: transcriptional corepressor LEUNI...    212   4e-60   Tarenaya hassleriana [spider flower]
ref|XP_010245980.1|  PREDICTED: transcriptional corepressor LEUNI...    212   4e-60   Nelumbo nucifera [Indian lotus]
ref|XP_010245978.1|  PREDICTED: transcriptional corepressor LEUNI...    212   4e-60   Nelumbo nucifera [Indian lotus]
ref|XP_010245981.1|  PREDICTED: transcriptional corepressor LEUNI...    211   4e-60   Nelumbo nucifera [Indian lotus]
ref|XP_010245979.1|  PREDICTED: transcriptional corepressor LEUNI...    212   5e-60   Nelumbo nucifera [Indian lotus]
ref|XP_010541890.1|  PREDICTED: transcriptional corepressor LEUNI...    211   5e-60   Tarenaya hassleriana [spider flower]
ref|XP_006857440.1|  hypothetical protein AMTR_s00067p00167320          212   6e-60   
ref|XP_010541889.1|  PREDICTED: transcriptional corepressor LEUNI...    211   7e-60   Tarenaya hassleriana [spider flower]
ref|XP_009372971.1|  PREDICTED: transcriptional corepressor LEUNI...    198   8e-60   
gb|KHG11579.1|  Transcriptional corepressor LEUNIG -like protein        211   9e-60   Gossypium arboreum [tree cotton]
gb|KJB64845.1|  hypothetical protein B456_010G067800                    209   4e-59   Gossypium raimondii
gb|KJB64850.1|  hypothetical protein B456_010G067800                    209   4e-59   Gossypium raimondii
gb|KJB64846.1|  hypothetical protein B456_010G067800                    209   5e-59   Gossypium raimondii
gb|KJB64849.1|  hypothetical protein B456_010G067800                    209   7e-59   Gossypium raimondii
ref|NP_001042184.1|  Os01g0177100                                       209   9e-59   
dbj|BAD67819.1|  putative transcriptional corepressor LEUNIG            209   9e-59   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001137120.1|  uncharacterized protein LOC100217300               192   3e-58   
ref|XP_010264093.1|  PREDICTED: transcriptional corepressor LEUNI...    206   4e-58   Nelumbo nucifera [Indian lotus]
ref|XP_008796439.1|  PREDICTED: transcriptional corepressor LEUNI...    205   4e-58   
gb|KGN65390.1|  hypothetical protein Csa_1G403660                       205   6e-58   Cucumis sativus [cucumbers]
ref|XP_008785183.1|  PREDICTED: transcriptional corepressor LEUNI...    206   6e-58   
ref|XP_008785188.1|  PREDICTED: transcriptional corepressor LEUNI...    206   6e-58   
ref|XP_008785186.1|  PREDICTED: transcriptional corepressor LEUNI...    206   6e-58   
ref|XP_004149861.1|  PREDICTED: transcriptional corepressor LEUNI...    205   8e-58   
ref|XP_002518113.1|  WD-repeat protein, putative                        205   1e-57   
gb|ACN37000.1|  unknown                                                 196   4e-57   Zea mays [maize]
gb|KHG28610.1|  Transcriptional corepressor LEUNIG -like protein        204   5e-57   Gossypium arboreum [tree cotton]
ref|XP_003570372.1|  PREDICTED: transcriptional corepressor LEUNIG      203   5e-57   Brachypodium distachyon [annual false brome]
ref|XP_006420880.1|  hypothetical protein CICLE_v10004358mg             199   1e-56   
ref|XP_004517072.1|  PREDICTED: transcriptional corepressor LEUNI...    202   2e-56   
ref|XP_004517071.1|  PREDICTED: transcriptional corepressor LEUNI...    202   2e-56   
gb|EMS54829.1|  Transcriptional corepressor LEUNIG                      203   2e-56   Triticum urartu
ref|XP_004517073.1|  PREDICTED: transcriptional corepressor LEUNI...    202   2e-56   Cicer arietinum [garbanzo]
ref|XP_004517069.1|  PREDICTED: transcriptional corepressor LEUNI...    202   2e-56   
ref|XP_004517067.1|  PREDICTED: transcriptional corepressor LEUNI...    202   2e-56   Cicer arietinum [garbanzo]
ref|XP_004517070.1|  PREDICTED: transcriptional corepressor LEUNI...    201   2e-56   Cicer arietinum [garbanzo]
ref|XP_008802409.1|  PREDICTED: transcriptional corepressor LEUNI...    201   2e-56   Phoenix dactylifera
ref|XP_008802406.1|  PREDICTED: transcriptional corepressor LEUNI...    201   2e-56   Phoenix dactylifera
gb|EEC74226.1|  hypothetical protein OsI_09411                          201   3e-56   Oryza sativa Indica Group [Indian rice]
ref|XP_004954333.1|  PREDICTED: transcriptional corepressor LEUNI...    201   3e-56   
ref|XP_006652501.1|  PREDICTED: transcriptional corepressor LEUNI...    201   3e-56   Oryza brachyantha
ref|XP_006420876.1|  hypothetical protein CICLE_v10004358mg             201   4e-56   
ref|XP_006420877.1|  hypothetical protein CICLE_v10004358mg             201   5e-56   
ref|XP_008463346.1|  PREDICTED: transcriptional corepressor LEUNI...    200   5e-56   
ref|XP_008789440.1|  PREDICTED: transcriptional corepressor LEUNIG      200   6e-56   Phoenix dactylifera
gb|AFW73990.1|  hypothetical protein ZEAMMB73_066038                    197   8e-56   
emb|CAE03368.2|  OSJNBb0065L13.11                                       200   8e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002454764.1|  hypothetical protein SORBIDRAFT_04g036910          200   9e-56   Sorghum bicolor [broomcorn]
ref|XP_010522421.1|  PREDICTED: transcriptional corepressor LEUNI...    200   9e-56   Tarenaya hassleriana [spider flower]
ref|XP_006493701.1|  PREDICTED: transcriptional corepressor LEUNI...    200   9e-56   Citrus sinensis [apfelsine]
gb|KDP39380.1|  hypothetical protein JCGZ_01137                         200   9e-56   Jatropha curcas
ref|XP_010522422.1|  PREDICTED: transcriptional corepressor LEUNI...    199   9e-56   Tarenaya hassleriana [spider flower]
ref|XP_006493704.1|  PREDICTED: transcriptional corepressor LEUNI...    199   1e-55   
ref|NP_001048487.1|  Os02g0813800                                       199   1e-55   
ref|XP_010934265.1|  PREDICTED: transcriptional corepressor LEUNI...    199   1e-55   Elaeis guineensis
ref|XP_010934267.1|  PREDICTED: transcriptional corepressor LEUNI...    199   1e-55   Elaeis guineensis
gb|EEC77619.1|  hypothetical protein OsI_16603                          199   2e-55   Oryza sativa Indica Group [Indian rice]
ref|XP_010936002.1|  PREDICTED: transcriptional corepressor LEUNI...    198   3e-55   
ref|XP_010936003.1|  PREDICTED: transcriptional corepressor LEUNI...    198   3e-55   
gb|AFW83210.1|  hypothetical protein ZEAMMB73_733859                    193   3e-55   
ref|XP_010936000.1|  PREDICTED: transcriptional corepressor LEUNI...    198   3e-55   
ref|XP_006385922.1|  hypothetical protein POPTR_0003s17700g             198   4e-55   
ref|XP_011020662.1|  PREDICTED: transcriptional corepressor LEUNI...    197   5e-55   
ref|XP_008643802.1|  PREDICTED: LOC100285175 isoform X1                 197   5e-55   
ref|XP_006643822.1|  PREDICTED: transcriptional corepressor LEUNI...    198   6e-55   
dbj|BAK08332.1|  predicted protein                                      198   6e-55   
gb|KDP46173.1|  hypothetical protein JCGZ_06684                         194   7e-55   
ref|XP_009385699.1|  PREDICTED: transcriptional corepressor LEUNI...    197   7e-55   
gb|AFW83211.1|  hypothetical protein ZEAMMB73_733859                    194   1e-54   
gb|EPS68633.1|  hypothetical protein M569_06134                         196   1e-54   
ref|XP_002299273.1|  hypothetical protein POPTR_0001s14560g             196   2e-54   
ref|NP_001151541.1|  LOC100285175                                       196   2e-54   
ref|XP_006368907.1|  hypothetical protein POPTR_0001s14560g             196   2e-54   
ref|XP_003590232.1|  Transcriptional corepressor LEUNIG                 195   3e-54   
ref|XP_003607636.1|  Transcriptional corepressor LEUNIG                 195   3e-54   
ref|XP_003607635.1|  Transcriptional corepressor LEUNIG                 195   3e-54   
ref|XP_009382685.1|  PREDICTED: transcriptional corepressor LEUNI...    195   3e-54   
ref|XP_009382681.1|  PREDICTED: transcriptional corepressor LEUNI...    195   4e-54   
gb|KJB72103.1|  hypothetical protein B456_011G159400                    195   4e-54   
gb|KHG01358.1|  Transcriptional corepressor LEUNIG -like protein        195   4e-54   
ref|XP_008224605.1|  PREDICTED: transcriptional corepressor LEUNIG      195   4e-54   
gb|ACN34826.1|  unknown                                                 194   4e-54   
gb|KJB72102.1|  hypothetical protein B456_011G159400                    195   5e-54   
ref|XP_008438369.1|  PREDICTED: transcriptional corepressor LEUNI...    194   6e-54   
ref|XP_004134000.1|  PREDICTED: transcriptional corepressor LEUNI...    194   6e-54   
ref|XP_008438370.1|  PREDICTED: transcriptional corepressor LEUNI...    194   6e-54   
emb|CDY12182.1|  BnaC04g12120D                                          181   7e-54   
ref|XP_010232007.1|  PREDICTED: transcriptional corepressor LEUNI...    195   9e-54   
ref|XP_007221910.1|  hypothetical protein PRUPE_ppa001706mg             194   9e-54   
ref|XP_008654518.1|  PREDICTED: uncharacterized protein LOC100217...    194   1e-53   
ref|XP_004161049.1|  PREDICTED: transcriptional corepressor LEUNI...    193   1e-53   
ref|XP_004287384.1|  PREDICTED: transcriptional corepressor LEUNI...    194   2e-53   
ref|XP_011458499.1|  PREDICTED: transcriptional corepressor LEUNI...    194   2e-53   
ref|XP_009400486.1|  PREDICTED: transcriptional corepressor LEUNI...    192   6e-53   
ref|XP_004969116.1|  PREDICTED: transcriptional corepressor LEUNI...    192   6e-53   
ref|XP_004242402.1|  PREDICTED: transcriptional corepressor LEUNI...    191   7e-53   
ref|XP_004969118.1|  PREDICTED: transcriptional corepressor LEUNI...    191   7e-53   
ref|XP_006352696.1|  PREDICTED: transcriptional corepressor LEUNI...    191   9e-53   
ref|XP_006588999.1|  PREDICTED: transcriptional corepressor LEUNI...    191   1e-52   
ref|XP_006588998.1|  PREDICTED: transcriptional corepressor LEUNI...    191   1e-52   
ref|XP_006588997.1|  PREDICTED: transcriptional corepressor LEUNI...    191   1e-52   
ref|XP_006588996.1|  PREDICTED: transcriptional corepressor LEUNI...    191   1e-52   
ref|XP_004969117.1|  PREDICTED: transcriptional corepressor LEUNI...    191   1e-52   
ref|XP_010688121.1|  PREDICTED: transcriptional corepressor LEUNI...    191   2e-52   
ref|XP_010688120.1|  PREDICTED: transcriptional corepressor LEUNI...    191   2e-52   
ref|XP_002458130.1|  hypothetical protein SORBIDRAFT_03g027390          190   2e-52   
ref|XP_010940734.1|  PREDICTED: transcriptional corepressor LEUNI...    189   4e-52   
ref|XP_010940733.1|  PREDICTED: transcriptional corepressor LEUNI...    189   4e-52   
ref|XP_010230532.1|  PREDICTED: transcriptional corepressor LEUNI...    190   4e-52   
ref|XP_010940732.1|  PREDICTED: transcriptional corepressor LEUNI...    189   5e-52   
ref|XP_010940735.1|  PREDICTED: transcriptional corepressor LEUNI...    189   5e-52   
ref|XP_010940736.1|  PREDICTED: transcriptional corepressor LEUNI...    189   6e-52   
ref|XP_009374609.1|  PREDICTED: transcriptional corepressor LEUNI...    189   6e-52   
ref|XP_009374610.1|  PREDICTED: transcriptional corepressor LEUNI...    189   6e-52   
dbj|BAK05188.1|  predicted protein                                      189   8e-52   
ref|XP_009143945.1|  PREDICTED: transcriptional corepressor LEUNI...    188   9e-52   
ref|XP_009143947.1|  PREDICTED: transcriptional corepressor LEUNI...    188   9e-52   
ref|XP_006602530.1|  PREDICTED: transcriptional corepressor LEUNI...    188   1e-51   
ref|XP_010098951.1|  Transcriptional corepressor LEUNIG                 189   1e-51   
dbj|BAE98454.1|  hypothetical protein                                   178   1e-51   
ref|XP_004296628.1|  PREDICTED: transcriptional corepressor LEUNIG      188   1e-51   
ref|XP_006602529.1|  PREDICTED: transcriptional corepressor LEUNI...    188   1e-51   
gb|KHN09543.1|  Transcriptional corepressor LEUNIG                      187   1e-51   
ref|XP_003552134.1|  PREDICTED: transcriptional corepressor LEUNI...    188   1e-51   
gb|KHG13588.1|  Transcriptional corepressor LEUNIG -like protein        187   2e-51   
ref|XP_007145511.1|  hypothetical protein PHAVU_007G244700g             187   2e-51   
ref|XP_002458129.1|  hypothetical protein SORBIDRAFT_03g027380          188   2e-51   
ref|XP_011046456.1|  PREDICTED: transcriptional corepressor LEUNI...    175   2e-51   
ref|XP_010069048.1|  PREDICTED: transcriptional corepressor LEUNIG      187   2e-51   
ref|XP_009132864.1|  PREDICTED: transcriptional corepressor LEUNI...    187   2e-51   
ref|XP_009132865.1|  PREDICTED: transcriptional corepressor LEUNI...    187   2e-51   
gb|EMS61864.1|  Transcriptional corepressor LEUNIG                      187   2e-51   
emb|CDP04843.1|  unnamed protein product                                179   3e-51   
gb|KJB30141.1|  hypothetical protein B456_005G131200                    187   3e-51   
gb|KJB30138.1|  hypothetical protein B456_005G131200                    187   3e-51   
gb|KJB30139.1|  hypothetical protein B456_005G131200                    187   3e-51   
gb|KJB30144.1|  hypothetical protein B456_005G131200                    187   3e-51   
gb|AEB38252.1|  LEUNIG                                                  175   3e-51   
tpg|DAA58907.1|  TPA: hypothetical protein ZEAMMB73_625314              182   3e-51   
gb|AEB38247.1|  LEUNIG                                                  175   3e-51   
emb|CDM81840.1|  unnamed protein product                                187   3e-51   
ref|XP_011080189.1|  PREDICTED: transcriptional corepressor LEUNI...    187   4e-51   
emb|CDP03866.1|  unnamed protein product                                186   5e-51   
gb|KJB64847.1|  hypothetical protein B456_010G067800                    187   6e-51   
gb|AEB38227.1|  LEUNIG                                                  173   9e-51   
gb|AEB38235.1|  LEUNIG                                                  173   1e-50   
ref|XP_008380581.1|  PREDICTED: transcriptional corepressor LEUNI...    185   1e-50   
emb|CDX79469.1|  BnaC03g18050D                                          188   1e-50   
gb|AHZ31529.1|  WD-40 repeat family protein                             172   1e-50   
gb|AHZ31532.1|  WD-40 repeat family protein                             172   1e-50   
gb|AEB38264.1|  LEUNIG                                                  173   1e-50   
ref|XP_008380582.1|  PREDICTED: transcriptional corepressor LEUNI...    185   1e-50   
ref|XP_006644351.1|  PREDICTED: transcriptional corepressor LEUNI...    186   1e-50   
gb|ABQ42123.1|  WD-40 repeat family protein (LEUNIG)                    172   1e-50   
ref|XP_008380580.1|  PREDICTED: transcriptional corepressor LEUNI...    185   1e-50   
gb|ABQ42122.1|  WD-40 repeat family protein (LEUNIG)                    171   1e-50   
gb|EYU46334.1|  hypothetical protein MIMGU_mgv1a001624mg                185   1e-50   
emb|CDX84727.1|  BnaA03g15030D                                          187   2e-50   
ref|XP_010049943.1|  PREDICTED: transcriptional corepressor LEUNI...    183   2e-50   
gb|ACS68698.1|  transcriptional corepressor LEUNIG                      171   2e-50   
gb|ABQ42121.1|  WD-40 repeat family protein (LEUNIG)                    171   2e-50   
ref|XP_006295571.1|  hypothetical protein CARUB_v10024675mg             184   2e-50   
ref|XP_009763485.1|  PREDICTED: transcriptional corepressor LEUNI...    180   2e-50   
gb|AHZ31527.1|  WD-40 repeat family protein                             171   3e-50   
ref|XP_002879407.1|  WD-40 repeat family protein                        184   3e-50   
gb|EMT14678.1|  Transcriptional corepressor LEUNIG                      186   4e-50   
emb|CDY19159.1|  BnaA04g18990D                                          180   4e-50   
ref|XP_007034391.1|  LEUNIG_homolog isoform 1                           184   4e-50   
ref|XP_011083129.1|  PREDICTED: transcriptional corepressor LEUNI...    184   4e-50   
ref|XP_008673195.1|  PREDICTED: hypothetical protein isoform X8         183   4e-50   
ref|XP_010049942.1|  PREDICTED: transcriptional corepressor LEUNI...    182   5e-50   
ref|XP_009372953.1|  PREDICTED: transcriptional corepressor LEUNI...    184   5e-50   
ref|XP_004971986.1|  PREDICTED: transcriptional corepressor LEUNI...    177   6e-50   
tpg|DAA58910.1|  TPA: hypothetical protein ZEAMMB73_487398              184   6e-50   
ref|XP_008673193.1|  PREDICTED: hypothetical protein isoform X6         184   6e-50   
ref|XP_008673192.1|  PREDICTED: hypothetical protein isoform X5         184   6e-50   
gb|AEB38257.1|  LEUNIG                                                  171   6e-50   
ref|XP_006586253.1|  PREDICTED: transcriptional corepressor LEUNI...    183   7e-50   
ref|XP_008673194.1|  PREDICTED: hypothetical protein isoform X7         184   7e-50   
ref|XP_010049941.1|  PREDICTED: transcriptional corepressor LEUNI...    182   7e-50   
gb|KCW82772.1|  hypothetical protein EUGRSUZ_C04148                     182   7e-50   
ref|XP_008673196.1|  PREDICTED: hypothetical protein isoform X9         184   7e-50   
ref|NP_001169538.1|  hypothetical protein                               183   8e-50   
ref|XP_008673191.1|  PREDICTED: hypothetical protein isoform X4         184   8e-50   
gb|AFK33901.1|  unknown                                                 169   8e-50   
ref|XP_008673190.1|  PREDICTED: hypothetical protein isoform X3         183   8e-50   
ref|XP_008673189.1|  PREDICTED: hypothetical protein isoform X2         183   8e-50   
ref|XP_008673188.1|  PREDICTED: hypothetical protein isoform X1         183   9e-50   
ref|XP_006829639.1|  hypothetical protein AMTR_s00122p00094620          183   9e-50   
ref|XP_002301780.1|  WD-40 repeat family protein                        182   2e-49   
dbj|BAD52824.1|  LEUNIG-like                                            179   3e-49   
ref|XP_009611891.1|  PREDICTED: transcriptional corepressor LEUNI...    181   3e-49   
gb|KHN15134.1|  Transcriptional corepressor LEUNIG                      181   4e-49   
ref|NP_565749.1|  WD40 repeat protein MUCILAGE-MODIFIED 1               181   5e-49   
ref|NP_001031466.2|  WD40 repeat protein MUCILAGE-MODIFIED 1            181   5e-49   
ref|XP_006479292.1|  PREDICTED: transcriptional corepressor LEUNI...    181   5e-49   
ref|XP_006479288.1|  PREDICTED: transcriptional corepressor LEUNI...    181   5e-49   
ref|XP_006443612.1|  hypothetical protein CICLE_v10023309mg             181   5e-49   
gb|KDO65918.1|  hypothetical protein CISIN_1g047260mg                   181   5e-49   
ref|XP_006479291.1|  PREDICTED: transcriptional corepressor LEUNI...    181   6e-49   
ref|XP_006600770.1|  PREDICTED: transcriptional corepressor LEUNI...    181   6e-49   
ref|XP_006479287.1|  PREDICTED: transcriptional corepressor LEUNI...    181   6e-49   
emb|CDP04841.1|  unnamed protein product                                176   6e-49   
ref|XP_006479286.1|  PREDICTED: transcriptional corepressor LEUNI...    181   6e-49   
ref|XP_006600771.1|  PREDICTED: transcriptional corepressor LEUNI...    181   6e-49   
gb|AHZ31531.1|  WD-40 repeat family protein                             167   6e-49   
ref|NP_001189659.1|  WD40 repeat protein MUCILAGE-MODIFIED 1            181   7e-49   
ref|XP_006600769.1|  PREDICTED: transcriptional corepressor LEUNI...    181   7e-49   
gb|KHN45807.1|  Transcriptional corepressor LEUNIG                      174   1e-48   
emb|CAF18246.1|  STY-L protein                                          180   1e-48   
ref|XP_004173399.1|  PREDICTED: transcriptional corepressor LEUNI...    166   1e-48   
ref|XP_003569328.1|  PREDICTED: transcriptional corepressor LEUNI...    180   2e-48   
ref|XP_010232006.1|  PREDICTED: transcriptional corepressor LEUNI...    180   2e-48   
gb|KJB42456.1|  hypothetical protein B456_007G154000                    179   2e-48   
ref|XP_010232005.1|  PREDICTED: transcriptional corepressor LEUNI...    180   2e-48   
gb|KJB42455.1|  hypothetical protein B456_007G154000                    179   2e-48   
ref|NP_001043531.2|  Os01g0607400                                       180   2e-48   
gb|KDP26395.1|  hypothetical protein JCGZ_17553                         179   2e-48   
dbj|BAM17634.1|  HWC1                                                   179   2e-48   
gb|EEE54961.1|  hypothetical protein OsJ_02550                          179   3e-48   
gb|KHN07186.1|  Transcriptional corepressor LEUNIG                      179   3e-48   
ref|XP_004968403.1|  PREDICTED: transcriptional corepressor LEUNI...    179   3e-48   
ref|XP_007225319.1|  hypothetical protein PRUPE_ppa001131mg             179   3e-48   
ref|XP_006356768.1|  PREDICTED: transcriptional corepressor LEUNI...    178   3e-48   
gb|KHG03492.1|  Transcriptional corepressor LEUNIG -like protein        178   4e-48   
ref|XP_009760188.1|  PREDICTED: transcriptional corepressor LEUNIG      178   5e-48   
gb|EYU17986.1|  hypothetical protein MIMGU_mgv1a001888mg                177   5e-48   
ref|XP_009620776.1|  PREDICTED: transcriptional corepressor LEUNI...    177   6e-48   
ref|XP_007154933.1|  hypothetical protein PHAVU_003G159500g             178   6e-48   
ref|XP_007154935.1|  hypothetical protein PHAVU_003G159500g             178   6e-48   
ref|XP_007154930.1|  hypothetical protein PHAVU_003G159500g             178   6e-48   
ref|XP_004492306.1|  PREDICTED: transcriptional corepressor LEUNI...    177   6e-48   
gb|EEC71055.1|  hypothetical protein OsI_02792                          178   7e-48   
ref|XP_004492304.1|  PREDICTED: transcriptional corepressor LEUNI...    177   7e-48   
ref|XP_004247088.1|  PREDICTED: transcriptional corepressor LEUNI...    177   8e-48   
ref|XP_007154936.1|  hypothetical protein PHAVU_003G159500g             177   8e-48   
ref|XP_011024693.1|  PREDICTED: transcriptional corepressor LEUNI...    177   8e-48   
emb|CAN78118.1|  hypothetical protein VITISV_041543                     172   9e-48   
ref|XP_004492305.1|  PREDICTED: transcriptional corepressor LEUNI...    177   9e-48   
ref|XP_004290216.1|  PREDICTED: transcriptional corepressor LEUNI...    177   1e-47   
ref|XP_006855981.1|  hypothetical protein AMTR_s00037p00237830          175   1e-47   
ref|XP_011024692.1|  PREDICTED: transcriptional corepressor LEUNI...    177   1e-47   
ref|XP_011024691.1|  PREDICTED: transcriptional corepressor LEUNI...    177   1e-47   
ref|XP_010109725.1|  Transcriptional corepressor LEUNIG                 177   1e-47   
ref|XP_011024689.1|  PREDICTED: transcriptional corepressor LEUNI...    177   1e-47   
ref|XP_006575161.1|  PREDICTED: transcriptional corepressor LEUNI...    176   2e-47   
ref|XP_008235491.1|  PREDICTED: transcriptional corepressor LEUNI...    176   2e-47   
ref|XP_003518997.1|  PREDICTED: transcriptional corepressor LEUNI...    176   2e-47   
ref|XP_006575160.1|  PREDICTED: transcriptional corepressor LEUNI...    176   2e-47   
ref|XP_006575159.1|  PREDICTED: transcriptional corepressor LEUNI...    176   2e-47   
ref|XP_006575158.1|  PREDICTED: transcriptional corepressor LEUNI...    176   2e-47   
gb|EMS47185.1|  Transcriptional corepressor LEUNIG                      178   2e-47   
gb|EMT20506.1|  hypothetical protein F775_26146                         178   2e-47   
gb|KJB10968.1|  hypothetical protein B456_001G234100                    176   2e-47   
ref|XP_008235489.1|  PREDICTED: transcriptional corepressor LEUNI...    176   3e-47   
ref|XP_007025589.1|  LisH dimerization motif,WD40/YVTN repeat-lik...    174   3e-47   
gb|KJB42457.1|  hypothetical protein B456_007G154000                    176   3e-47   
gb|KJB42458.1|  hypothetical protein B456_007G154000                    176   3e-47   
gb|KHG14548.1|  Transcriptional corepressor LEUNIG -like protein        176   3e-47   
gb|KJB10966.1|  hypothetical protein B456_001G234100                    176   3e-47   
gb|KJB10964.1|  hypothetical protein B456_001G234100                    175   3e-47   
gb|KJB10969.1|  hypothetical protein B456_001G234100                    176   3e-47   
ref|XP_002266172.1|  PREDICTED: transcriptional corepressor LEUNI...    176   3e-47   
ref|XP_010652506.1|  PREDICTED: transcriptional corepressor LEUNI...    176   3e-47   
gb|KJB10965.1|  hypothetical protein B456_001G234100                    176   3e-47   
gb|KJB10963.1|  hypothetical protein B456_001G234100                    176   3e-47   
gb|KJB83313.1|  hypothetical protein B456_013G240700                    177   3e-47   
gb|KJB10967.1|  hypothetical protein B456_001G234100                    175   4e-47   
emb|CAN73936.1|  hypothetical protein VITISV_026282                     175   4e-47   
ref|XP_010107758.1|  Transcriptional corepressor LEUNIG                 176   4e-47   
ref|XP_007025588.1|  LisH dimerization motif,WD40/YVTN repeat-lik...    174   6e-47   
ref|XP_006579741.1|  PREDICTED: transcriptional corepressor LEUNI...    175   7e-47   
ref|XP_003525653.1|  PREDICTED: transcriptional corepressor LEUNI...    175   7e-47   
ref|XP_009389935.1|  PREDICTED: transcriptional corepressor LEUNI...    174   8e-47   
gb|KHN27387.1|  Transcriptional corepressor LEUNIG                      175   8e-47   
gb|KDP20984.1|  hypothetical protein JCGZ_21455                         166   9e-47   
gb|KDP46176.1|  hypothetical protein JCGZ_06687                         170   1e-46   
ref|XP_010469555.1|  PREDICTED: transcriptional corepressor LEUNI...    174   1e-46   
ref|XP_011460664.1|  PREDICTED: transcriptional corepressor LEUNI...    173   1e-46   



>emb|CBI20987.3| unnamed protein product [Vitis vinifera]
Length=734

 Score =   273 bits (697),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE LASVSEDSVRVWTLGS
Sbjct  592  GRYLAAAAENVVSILDVETQACRHSLQGHTKPIHSVCWDPSGEFLASVSEDSVRVWTLGS  651

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GNEG CVHELS NGNKFHSCVFHP+YSSLLVIGCYQSLELWNM+ENKTMTL AH+GLI +
Sbjct  652  GNEGECVHELSCNGNKFHSCVFHPTYSSLLVIGCYQSLELWNMSENKTMTLSAHDGLIAA  711

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV+GLVASASHDKI+KLWK
Sbjct  712  LAVSTVSGLVASASHDKIVKLWK  734



>ref|XP_011081899.1| PREDICTED: transcriptional corepressor LEUNIG [Sesamum indicum]
 ref|XP_011081901.1| PREDICTED: transcriptional corepressor LEUNIG [Sesamum indicum]
 ref|XP_011081902.1| PREDICTED: transcriptional corepressor LEUNIG [Sesamum indicum]
 ref|XP_011081903.1| PREDICTED: transcriptional corepressor LEUNIG [Sesamum indicum]
 ref|XP_011081904.1| PREDICTED: transcriptional corepressor LEUNIG [Sesamum indicum]
Length=912

 Score =   273 bits (698),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILD ETQTCR +LKGHTKPIHSVCWDPSGE LASVSEDSVRVWTL S
Sbjct  770  GRYLAAAAENVVSILDAETQTCRHSLKGHTKPIHSVCWDPSGELLASVSEDSVRVWTLRS  829

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG+C+HELS NGNKFHSCVFHP+YSSLLVIGCYQSLELWNMTENKTMTL AHEGLI S
Sbjct  830  GSEGDCLHELSCNGNKFHSCVFHPTYSSLLVIGCYQSLELWNMTENKTMTLSAHEGLIAS  889

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTVAGLVASASHDKI+KLWK
Sbjct  890  LAVSTVAGLVASASHDKIVKLWK  912



>ref|XP_010648611.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Vitis 
vinifera]
Length=901

 Score =   273 bits (697),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE LASVSEDSVRVWTLGS
Sbjct  759  GRYLAAAAENVVSILDVETQACRHSLQGHTKPIHSVCWDPSGEFLASVSEDSVRVWTLGS  818

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GNEG CVHELS NGNKFHSCVFHP+YSSLLVIGCYQSLELWNM+ENKTMTL AH+GLI +
Sbjct  819  GNEGECVHELSCNGNKFHSCVFHPTYSSLLVIGCYQSLELWNMSENKTMTLSAHDGLIAA  878

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV+GLVASASHDKI+KLWK
Sbjct  879  LAVSTVSGLVASASHDKIVKLWK  901



>ref|XP_009624260.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Nicotiana 
tomentosiformis]
Length=896

 Score =   273 bits (697),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE LASVSEDSVRVWTL S
Sbjct  754  GRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGELLASVSEDSVRVWTLRS  813

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM ENKTMTL AHEGLI S
Sbjct  814  GSEGDCLHELSSNGNKFHSCVFHPTYSSLLVIGCYQSLELWNMNENKTMTLTAHEGLIAS  873

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTVAGLVASASHDK +KLWK
Sbjct  874  LAVSTVAGLVASASHDKFVKLWK  896



>ref|XP_009787198.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Nicotiana 
sylvestris]
Length=892

 Score =   272 bits (696),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE LASVSEDSVRVWTL S
Sbjct  750  GRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGELLASVSEDSVRVWTLRS  809

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM ENKTMTL AHEGLI S
Sbjct  810  GSEGDCLHELSSNGNKFHSCVFHPTYSSLLVIGCYQSLELWNMNENKTMTLTAHEGLIAS  869

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTVAGLVASASHDK +KLWK
Sbjct  870  LAVSTVAGLVASASHDKFVKLWK  892



>ref|XP_009624258.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Nicotiana 
tomentosiformis]
Length=899

 Score =   272 bits (696),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE LASVSEDSVRVWTL S
Sbjct  757  GRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGELLASVSEDSVRVWTLRS  816

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM ENKTMTL AHEGLI S
Sbjct  817  GSEGDCLHELSSNGNKFHSCVFHPTYSSLLVIGCYQSLELWNMNENKTMTLTAHEGLIAS  876

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTVAGLVASASHDK +KLWK
Sbjct  877  LAVSTVAGLVASASHDKFVKLWK  899



>ref|XP_002284900.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Vitis 
vinifera]
 ref|XP_010648609.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Vitis 
vinifera]
 ref|XP_010648610.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Vitis 
vinifera]
Length=910

 Score =   272 bits (696),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE LASVSEDSVRVWTLGS
Sbjct  768  GRYLAAAAENVVSILDVETQACRHSLQGHTKPIHSVCWDPSGEFLASVSEDSVRVWTLGS  827

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GNEG CVHELS NGNKFHSCVFHP+YSSLLVIGCYQSLELWNM+ENKTMTL AH+GLI +
Sbjct  828  GNEGECVHELSCNGNKFHSCVFHPTYSSLLVIGCYQSLELWNMSENKTMTLSAHDGLIAA  887

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV+GLVASASHDKI+KLWK
Sbjct  888  LAVSTVSGLVASASHDKIVKLWK  910



>ref|XP_009624257.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Nicotiana 
tomentosiformis]
Length=904

 Score =   272 bits (696),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE LASVSEDSVRVWTL S
Sbjct  762  GRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGELLASVSEDSVRVWTLRS  821

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM ENKTMTL AHEGLI S
Sbjct  822  GSEGDCLHELSSNGNKFHSCVFHPTYSSLLVIGCYQSLELWNMNENKTMTLTAHEGLIAS  881

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTVAGLVASASHDK +KLWK
Sbjct  882  LAVSTVAGLVASASHDKFVKLWK  904



>ref|XP_009787197.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Nicotiana 
sylvestris]
Length=895

 Score =   272 bits (695),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE LASVSEDSVRVWTL S
Sbjct  753  GRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGELLASVSEDSVRVWTLRS  812

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM ENKTMTL AHEGLI S
Sbjct  813  GSEGDCLHELSSNGNKFHSCVFHPTYSSLLVIGCYQSLELWNMNENKTMTLTAHEGLIAS  872

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTVAGLVASASHDK +KLWK
Sbjct  873  LAVSTVAGLVASASHDKFVKLWK  895



>ref|XP_009787196.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Nicotiana 
sylvestris]
Length=900

 Score =   272 bits (695),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE LASVSEDSVRVWTL S
Sbjct  758  GRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGELLASVSEDSVRVWTLRS  817

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM ENKTMTL AHEGLI S
Sbjct  818  GSEGDCLHELSSNGNKFHSCVFHPTYSSLLVIGCYQSLELWNMNENKTMTLTAHEGLIAS  877

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTVAGLVASASHDK +KLWK
Sbjct  878  LAVSTVAGLVASASHDKFVKLWK  900



>ref|XP_002284925.2| PREDICTED: transcriptional corepressor LEUNIG-like [Vitis vinifera]
Length=363

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +L+GHT+PIHSVCWDPSGE LASVS DS+RVWTLGS
Sbjct  221  GRYLAAAAENVVSILDVETQACRHSLQGHTEPIHSVCWDPSGEFLASVSVDSIRVWTLGS  280

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GNEG CVHELS N  KFHSCVFHP+YSSLLVIGCYQSLELWNM+ENKTMTL AH+GLI +
Sbjct  281  GNEGECVHELSCNDKKFHSCVFHPTYSSLLVIGCYQSLELWNMSENKTMTLSAHDGLIAA  340

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV+GLVASASHDKI+KLWK
Sbjct  341  LAVSTVSGLVASASHDKIVKLWK  363



>emb|CBI20989.3| unnamed protein product [Vitis vinifera]
Length=356

 Score =   258 bits (659),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +L+GHT+PIHSVCWDPSGE LASVS DS+RVWTLGS
Sbjct  214  GRYLAAAAENVVSILDVETQACRHSLQGHTEPIHSVCWDPSGEFLASVSVDSIRVWTLGS  273

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GNEG CVHELS N  KFHSCVFHP+YSSLLVIGCYQSLELWNM+ENKTMTL AH+GLI +
Sbjct  274  GNEGECVHELSCNDKKFHSCVFHPTYSSLLVIGCYQSLELWNMSENKTMTLSAHDGLIAA  333

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV+GLVASASHDKI+KLWK
Sbjct  334  LAVSTVSGLVASASHDKIVKLWK  356



>ref|XP_011019744.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Populus 
euphratica]
Length=849

 Score =   268 bits (685),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAA AENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE+LAS SEDSVRVWTLGS
Sbjct  707  GRYLAAVAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGEYLASASEDSVRVWTLGS  766

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP++ SLLVIGCYQSLELWNM ENKTMTLPAHEGLI +
Sbjct  767  GSEGECVHELSCNGNKFHSCVFHPTFPSLLVIGCYQSLELWNMDENKTMTLPAHEGLIAA  826

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK++KLWK
Sbjct  827  LAVSTATGLVASASHDKLVKLWK  849



>ref|XP_010322742.1| PREDICTED: transcriptional corepressor LEUNIG isoform X4 [Solanum 
lycopersicum]
Length=896

 Score =   269 bits (687),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE LASVSEDSVRVWTL S
Sbjct  754  GRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGELLASVSEDSVRVWTLRS  813

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM ENKTMTL  HEGLI S
Sbjct  814  GSEGDCLHELSSNGNKFHSCVFHPAYSSLLVIGCYQSLELWNMNENKTMTLTGHEGLIAS  873

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS VAGLVASASHDK +KLWK
Sbjct  874  LAVSGVAGLVASASHDKFVKLWK  896



>ref|XP_010322743.1| PREDICTED: transcriptional corepressor LEUNIG isoform X5 [Solanum 
lycopersicum]
Length=894

 Score =   269 bits (687),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE LASVSEDSVRVWTL S
Sbjct  752  GRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGELLASVSEDSVRVWTLRS  811

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM ENKTMTL  HEGLI S
Sbjct  812  GSEGDCLHELSSNGNKFHSCVFHPAYSSLLVIGCYQSLELWNMNENKTMTLTGHEGLIAS  871

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS VAGLVASASHDK +KLWK
Sbjct  872  LAVSGVAGLVASASHDKFVKLWK  894



>ref|XP_006353652.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Solanum tuberosum]
Length=900

 Score =   269 bits (687),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE LASVSEDSVRVWTL S
Sbjct  758  GRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGELLASVSEDSVRVWTLRS  817

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM ENKTMTL  HEGLI S
Sbjct  818  GSEGDCLHELSSNGNKFHSCVFHPAYSSLLVIGCYQSLELWNMNENKTMTLTGHEGLIAS  877

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS VAGLVASASHDK +KLWK
Sbjct  878  LAVSGVAGLVASASHDKFVKLWK  900



>ref|XP_006353653.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Solanum tuberosum]
Length=898

 Score =   268 bits (686),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE LASVSEDSVRVWTL S
Sbjct  756  GRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGELLASVSEDSVRVWTLRS  815

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM ENKTMTL  HEGLI S
Sbjct  816  GSEGDCLHELSSNGNKFHSCVFHPAYSSLLVIGCYQSLELWNMNENKTMTLTGHEGLIAS  875

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS VAGLVASASHDK +KLWK
Sbjct  876  LAVSGVAGLVASASHDKFVKLWK  898



>ref|XP_004241804.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Solanum 
lycopersicum]
Length=902

 Score =   268 bits (686),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE LASVSEDSVRVWTL S
Sbjct  760  GRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGELLASVSEDSVRVWTLRS  819

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM ENKTMTL  HEGLI S
Sbjct  820  GSEGDCLHELSSNGNKFHSCVFHPAYSSLLVIGCYQSLELWNMNENKTMTLTGHEGLIAS  879

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS VAGLVASASHDK +KLWK
Sbjct  880  LAVSGVAGLVASASHDKFVKLWK  902



>ref|XP_010322740.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Solanum 
lycopersicum]
Length=904

 Score =   268 bits (686),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE LASVSEDSVRVWTL S
Sbjct  762  GRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGELLASVSEDSVRVWTLRS  821

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM ENKTMTL  HEGLI S
Sbjct  822  GSEGDCLHELSSNGNKFHSCVFHPAYSSLLVIGCYQSLELWNMNENKTMTLTGHEGLIAS  881

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS VAGLVASASHDK +KLWK
Sbjct  882  LAVSGVAGLVASASHDKFVKLWK  904



>ref|XP_006353650.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Solanum tuberosum]
Length=908

 Score =   268 bits (686),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE LASVSEDSVRVWTL S
Sbjct  766  GRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGELLASVSEDSVRVWTLRS  825

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM ENKTMTL  HEGLI S
Sbjct  826  GSEGDCLHELSSNGNKFHSCVFHPAYSSLLVIGCYQSLELWNMNENKTMTLTGHEGLIAS  885

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS VAGLVASASHDK +KLWK
Sbjct  886  LAVSGVAGLVASASHDKFVKLWK  908



>ref|XP_011019743.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Populus 
euphratica]
Length=857

 Score =   268 bits (684),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAA AENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE+LAS SEDSVRVWTLGS
Sbjct  715  GRYLAAVAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGEYLASASEDSVRVWTLGS  774

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP++ SLLVIGCYQSLELWNM ENKTMTLPAHEGLI +
Sbjct  775  GSEGECVHELSCNGNKFHSCVFHPTFPSLLVIGCYQSLELWNMDENKTMTLPAHEGLIAA  834

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK++KLWK
Sbjct  835  LAVSTATGLVASASHDKLVKLWK  857



>ref|XP_006353651.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Solanum tuberosum]
Length=906

 Score =   268 bits (686),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE LASVSEDSVRVWTL S
Sbjct  764  GRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGELLASVSEDSVRVWTLRS  823

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM ENKTMTL  HEGLI S
Sbjct  824  GSEGDCLHELSSNGNKFHSCVFHPAYSSLLVIGCYQSLELWNMNENKTMTLTGHEGLIAS  883

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS VAGLVASASHDK +KLWK
Sbjct  884  LAVSGVAGLVASASHDKFVKLWK  906



>ref|XP_011019742.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Populus 
euphratica]
Length=858

 Score =   268 bits (684),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAA AENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE+LAS SEDSVRVWTLGS
Sbjct  716  GRYLAAVAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGEYLASASEDSVRVWTLGS  775

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP++ SLLVIGCYQSLELWNM ENKTMTLPAHEGLI +
Sbjct  776  GSEGECVHELSCNGNKFHSCVFHPTFPSLLVIGCYQSLELWNMDENKTMTLPAHEGLIAA  835

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK++KLWK
Sbjct  836  LAVSTATGLVASASHDKLVKLWK  858



>ref|XP_003544623.1| PREDICTED: transcriptional corepressor LEUNIG-like isoformX2 
[Glycine max]
Length=893

 Score =   268 bits (685),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +LKGHTK IHSVCWDPSGE LASVSEDSVRVWTLGS
Sbjct  751  GRYLAAAAENVVSILDVETQACRYSLKGHTKSIHSVCWDPSGEFLASVSEDSVRVWTLGS  810

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP+YSSLLV+GCYQSLELWNMTENKTMTL AHEGLI +
Sbjct  811  GSEGECVHELSCNGNKFHSCVFHPTYSSLLVVGCYQSLELWNMTENKTMTLSAHEGLIAA  870

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GLVASASHDK +KLWK
Sbjct  871  LAVSTVNGLVASASHDKFVKLWK  893



>ref|XP_010322741.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Solanum 
lycopersicum]
Length=899

 Score =   268 bits (685),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE LASVSEDSVRVWTL S
Sbjct  757  GRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGELLASVSEDSVRVWTLRS  816

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM ENKTMTL  HEGLI S
Sbjct  817  GSEGDCLHELSSNGNKFHSCVFHPAYSSLLVIGCYQSLELWNMNENKTMTLTGHEGLIAS  876

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS VAGLVASASHDK +KLWK
Sbjct  877  LAVSGVAGLVASASHDKFVKLWK  899



>ref|XP_003544622.1| PREDICTED: transcriptional corepressor LEUNIG-like isoformX1 
[Glycine max]
Length=902

 Score =   268 bits (685),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +LKGHTK IHSVCWDPSGE LASVSEDSVRVWTLGS
Sbjct  760  GRYLAAAAENVVSILDVETQACRYSLKGHTKSIHSVCWDPSGEFLASVSEDSVRVWTLGS  819

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP+YSSLLV+GCYQSLELWNMTENKTMTL AHEGLI +
Sbjct  820  GSEGECVHELSCNGNKFHSCVFHPTYSSLLVVGCYQSLELWNMTENKTMTLSAHEGLIAA  879

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GLVASASHDK +KLWK
Sbjct  880  LAVSTVNGLVASASHDKFVKLWK  902



>ref|XP_006596119.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Glycine max]
Length=897

 Score =   268 bits (684),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +LKGHTK IHSVCWDPSGE LASVSEDSVRVWTLGS
Sbjct  755  GRYLAAAAENVVSILDVETQACRYSLKGHTKSIHSVCWDPSGEFLASVSEDSVRVWTLGS  814

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP+YSSLLV+GCYQSLELWNMTENKTMTL AHEGLI +
Sbjct  815  GSEGECVHELSCNGNKFHSCVFHPTYSSLLVVGCYQSLELWNMTENKTMTLSAHEGLIAA  874

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GLVASASHDK +KLWK
Sbjct  875  LAVSTVNGLVASASHDKFVKLWK  897



>ref|XP_002309593.2| LEUNIG family protein [Populus trichocarpa]
 gb|EEE93116.2| LEUNIG family protein [Populus trichocarpa]
Length=900

 Score =   268 bits (684),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE LAS SEDSVRVWTLGS
Sbjct  758  GRYLAAAAENVVSILDVETQACRHSLQGHTKPIHSVCWDPSGEFLASASEDSVRVWTLGS  817

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP++ SLLVIGCYQSLELWNM ENKTMTLPAHEGLI +
Sbjct  818  GSEGECVHELSCNGNKFHSCVFHPTFPSLLVIGCYQSLELWNMNENKTMTLPAHEGLIAA  877

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK +KLWK
Sbjct  878  LAVSTATGLVASASHDKFVKLWK  900



>ref|XP_008394022.1| PREDICTED: LOW QUALITY PROTEIN: transcriptional corepressor LEUNIG 
[Malus domestica]
Length=897

 Score =   267 bits (683),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LAAAAENVVSILDVETQTCR +L+GHTKPIHSVCWDPSGE LASVSEDSVRVWT G+
Sbjct  755  GRFLAAAAENVVSILDVETQTCRHSLQGHTKPIHSVCWDPSGEFLASVSEDSVRVWTFGA  814

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTENKTMTL AHEGLI +
Sbjct  815  GGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTENKTMTLSAHEGLIAA  874

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            L+VSTV GLVASASHDK +KLWK
Sbjct  875  LSVSTVTGLVASASHDKFVKLWK  897



>ref|XP_004498639.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Cicer arietinum]
Length=900

 Score =   267 bits (683),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +LKGHTK IHSVCWDPSGE LASVSEDSVRVWTLGS
Sbjct  758  GRYLAAAAENVVSILDVETQACRYSLKGHTKSIHSVCWDPSGEFLASVSEDSVRVWTLGS  817

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP+YSSLLVIGCYQSLELWNMTENKTMTL AH+GLI +
Sbjct  818  GSEGECVHELSCNGNKFHSCVFHPTYSSLLVIGCYQSLELWNMTENKTMTLSAHDGLIAA  877

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GLVASASHDK +KLWK
Sbjct  878  LAVSTVNGLVASASHDKFVKLWK  900



>ref|XP_004498638.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Cicer arietinum]
Length=909

 Score =   267 bits (682),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +LKGHTK IHSVCWDPSGE LASVSEDSVRVWTLGS
Sbjct  767  GRYLAAAAENVVSILDVETQACRYSLKGHTKSIHSVCWDPSGEFLASVSEDSVRVWTLGS  826

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP+YSSLLVIGCYQSLELWNMTENKTMTL AH+GLI +
Sbjct  827  GSEGECVHELSCNGNKFHSCVFHPTYSSLLVIGCYQSLELWNMTENKTMTLSAHDGLIAA  886

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GLVASASHDK +KLWK
Sbjct  887  LAVSTVNGLVASASHDKFVKLWK  909



>gb|EYU21923.1| hypothetical protein MIMGU_mgv1a000972mg [Erythranthe guttata]
Length=926

 Score =   267 bits (682),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILD ETQ CR +LKGHTKPI S+CWDPSGE LASVSEDSVRVWT+ S
Sbjct  784  GRYLAAAAENVVSILDAETQACRHSLKGHTKPITSICWDPSGELLASVSEDSVRVWTMRS  843

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG+C+HELS NGNKFHSCVFHP+YSSLLVIGCYQSLELWNMTENKTMTL AHEGLI S
Sbjct  844  GSEGDCLHELSCNGNKFHSCVFHPTYSSLLVIGCYQSLELWNMTENKTMTLSAHEGLIAS  903

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTVAGLVASASHDKI+KLWK
Sbjct  904  LAVSTVAGLVASASHDKIVKLWK  926



>ref|XP_009377499.1| PREDICTED: transcriptional corepressor LEUNIG isoform X5 [Pyrus 
x bretschneideri]
Length=897

 Score =   266 bits (679),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE LASVSEDSVRVWTLG+
Sbjct  755  GRFLAAAAENVVSILDVETQNCRHSLQGHTKPIHSVCWDPSGEFLASVSEDSVRVWTLGA  814

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTENKTMTL AH+GLI +
Sbjct  815  GGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTENKTMTLSAHDGLIAA  874

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            L+VSTV GLVASASHDK +KLWK
Sbjct  875  LSVSTVTGLVASASHDKFVKLWK  897



>ref|XP_011459234.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Fragaria 
vesca subsp. vesca]
Length=892

 Score =   265 bits (678),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +L+GHTKPI SVCWDPSGE LASVSEDSVRVWT GS
Sbjct  750  GRYLAAAAENVVSILDVETQACRHSLQGHTKPIKSVCWDPSGEFLASVSEDSVRVWTFGS  809

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GNEG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTE KTMTL AHEGLI S
Sbjct  810  GNEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTEGKTMTLSAHEGLIAS  869

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GLVASASHDK +KLWK
Sbjct  870  LAVSTVTGLVASASHDKWVKLWK  892



>ref|XP_003588695.1| Transcriptional corepressor LEUNIG [Medicago truncatula]
 gb|AES58946.1| transcriptional corepressor leunig-like protein [Medicago truncatula]
Length=893

 Score =   265 bits (678),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LAAAAENVVSILDVETQ CR +LKGHTK IHSVCWDPSGE LASVSEDSVRVWTLGS
Sbjct  751  GRFLAAAAENVVSILDVETQACRYSLKGHTKSIHSVCWDPSGEFLASVSEDSVRVWTLGS  810

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP+YSSLLVIGCYQSLELWNMTENKTMTL AH+GLI +
Sbjct  811  GSEGECVHELSCNGNKFHSCVFHPTYSSLLVIGCYQSLELWNMTENKTMTLSAHDGLIAA  870

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GLVASASHD+ +KLWK
Sbjct  871  LAVSTVNGLVASASHDRFVKLWK  893



>ref|XP_009377496.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Pyrus 
x bretschneideri]
Length=906

 Score =   266 bits (679),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE LASVSEDSVRVWTLG+
Sbjct  764  GRFLAAAAENVVSILDVETQNCRHSLQGHTKPIHSVCWDPSGEFLASVSEDSVRVWTLGA  823

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTENKTMTL AH+GLI +
Sbjct  824  GGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTENKTMTLSAHDGLIAA  883

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            L+VSTV GLVASASHDK +KLWK
Sbjct  884  LSVSTVTGLVASASHDKFVKLWK  906



>ref|XP_004291496.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011459233.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Fragaria 
vesca subsp. vesca]
Length=901

 Score =   265 bits (678),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +L+GHTKPI SVCWDPSGE LASVSEDSVRVWT GS
Sbjct  759  GRYLAAAAENVVSILDVETQACRHSLQGHTKPIKSVCWDPSGEFLASVSEDSVRVWTFGS  818

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GNEG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTE KTMTL AHEGLI S
Sbjct  819  GNEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTEGKTMTLSAHEGLIAS  878

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GLVASASHDK +KLWK
Sbjct  879  LAVSTVTGLVASASHDKWVKLWK  901



>gb|KEH39820.1| transcriptional corepressor leunig-like protein [Medicago truncatula]
Length=902

 Score =   265 bits (677),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LAAAAENVVSILDVETQ CR +LKGHTK IHSVCWDPSGE LASVSEDSVRVWTLGS
Sbjct  760  GRFLAAAAENVVSILDVETQACRYSLKGHTKSIHSVCWDPSGEFLASVSEDSVRVWTLGS  819

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP+YSSLLVIGCYQSLELWNMTENKTMTL AH+GLI +
Sbjct  820  GSEGECVHELSCNGNKFHSCVFHPTYSSLLVIGCYQSLELWNMTENKTMTLSAHDGLIAA  879

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GLVASASHD+ +KLWK
Sbjct  880  LAVSTVNGLVASASHDRFVKLWK  902



>ref|XP_010254246.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X5 
[Nelumbo nucifera]
Length=902

 Score =   265 bits (676),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +L+GHTKP+HSVCWDPSGE  ASVSEDSVRVWT GS
Sbjct  760  GRYLAAAAENVVSILDVETQMCRHSLQGHTKPVHSVCWDPSGELFASVSEDSVRVWTFGS  819

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GNEG CVHELS NGNKFHSCVFHPSYSSLLVIGCYQSLELWNM+ENKTMTL AHEGLI +
Sbjct  820  GNEGECVHELSCNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMSENKTMTLSAHEGLIAA  879

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS   GLVASASHDK +KLWK
Sbjct  880  LAVSNATGLVASASHDKYVKLWK  902



>ref|XP_008352162.1| PREDICTED: transcriptional corepressor LEUNIG-like [Malus domestica]
Length=401

 Score =   253 bits (646),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G +LAAAAENVVSILDVETQTC  +L+GHTKPIHSVCWDPSGE LASVSEDSVRVWTLG+
Sbjct  259  GXFLAAAAENVVSILDVETQTCXXSLQGHTKPIHSVCWDPSGEFLASVSEDSVRVWTLGA  318

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHEL  NGNKFHSCVFHP+Y+SLLVIGCYQ+LELWNMTENKTMTL AHEGLI S
Sbjct  319  GGEGECVHELICNGNKFHSCVFHPTYTSLLVIGCYQTLELWNMTENKTMTLXAHEGLIDS  378

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GL+ SASHD  +K+WK
Sbjct  379  LAVSTVTGLIXSASHDXFVKIWK  401



>ref|XP_010254245.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Nelumbo nucifera]
Length=911

 Score =   265 bits (676),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +L+GHTKP+HSVCWDPSGE  ASVSEDSVRVWT GS
Sbjct  769  GRYLAAAAENVVSILDVETQMCRHSLQGHTKPVHSVCWDPSGELFASVSEDSVRVWTFGS  828

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GNEG CVHELS NGNKFHSCVFHPSYSSLLVIGCYQSLELWNM+ENKTMTL AHEGLI +
Sbjct  829  GNEGECVHELSCNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMSENKTMTLSAHEGLIAA  888

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS   GLVASASHDK +KLWK
Sbjct  889  LAVSNATGLVASASHDKYVKLWK  911



>ref|XP_010254244.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Nelumbo nucifera]
Length=918

 Score =   265 bits (676),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +L+GHTKP+HSVCWDPSGE  ASVSEDSVRVWT GS
Sbjct  776  GRYLAAAAENVVSILDVETQMCRHSLQGHTKPVHSVCWDPSGELFASVSEDSVRVWTFGS  835

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GNEG CVHELS NGNKFHSCVFHPSYSSLLVIGCYQSLELWNM+ENKTMTL AHEGLI +
Sbjct  836  GNEGECVHELSCNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMSENKTMTLSAHEGLIAA  895

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS   GLVASASHDK +KLWK
Sbjct  896  LAVSNATGLVASASHDKYVKLWK  918



>ref|XP_010254242.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Nelumbo nucifera]
Length=927

 Score =   265 bits (676),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +L+GHTKP+HSVCWDPSGE  ASVSEDSVRVWT GS
Sbjct  785  GRYLAAAAENVVSILDVETQMCRHSLQGHTKPVHSVCWDPSGELFASVSEDSVRVWTFGS  844

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GNEG CVHELS NGNKFHSCVFHPSYSSLLVIGCYQSLELWNM+ENKTMTL AHEGLI +
Sbjct  845  GNEGECVHELSCNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMSENKTMTLSAHEGLIAA  904

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS   GLVASASHDK +KLWK
Sbjct  905  LAVSNATGLVASASHDKYVKLWK  927



>ref|XP_010254243.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Nelumbo nucifera]
Length=922

 Score =   264 bits (675),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +L+GHTKP+HSVCWDPSGE  ASVSEDSVRVWT GS
Sbjct  780  GRYLAAAAENVVSILDVETQMCRHSLQGHTKPVHSVCWDPSGELFASVSEDSVRVWTFGS  839

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GNEG CVHELS NGNKFHSCVFHPSYSSLLVIGCYQSLELWNM+ENKTMTL AHEGLI +
Sbjct  840  GNEGECVHELSCNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMSENKTMTLSAHEGLIAA  899

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS   GLVASASHDK +KLWK
Sbjct  900  LAVSNATGLVASASHDKYVKLWK  922



>ref|XP_009367963.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Pyrus x bretschneideri]
Length=419

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LAAAAENVVSILDVET TCR +L+GHTKPIHSVCWDPSGE LASVSEDSVRVW LG+
Sbjct  277  GRFLAAAAENVVSILDVETLTCRHSLQGHTKPIHSVCWDPSGEFLASVSEDSVRVWALGA  336

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G +G CVHELS N NKFHSC FHP+ +SLLV+GCYQ+LELWN+TENKTMTLPAHEGLI S
Sbjct  337  GGKGECVHELSCNRNKFHSCAFHPADTSLLVVGCYQTLELWNITENKTMTLPAHEGLIAS  396

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GL+ASASHDK +K+WK
Sbjct  397  LAVSTVTGLIASASHDKFVKIWK  419



>emb|CAF18245.1| STYLOSA protein [Antirrhinum majus]
Length=915

 Score =   264 bits (674),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILD ET  CR +LKGHTKPIHSVCWDPSGE LASVSEDSVRVWTL S
Sbjct  773  GRYLAAAAENVVSILDSETLACRHSLKGHTKPIHSVCWDPSGELLASVSEDSVRVWTLRS  832

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG+C+HELS NGNKFHSCVFHP+YSSLLVIGCYQSLELWNM+ENKTMTL AHEGLI S
Sbjct  833  GSEGDCLHELSCNGNKFHSCVFHPTYSSLLVIGCYQSLELWNMSENKTMTLSAHEGLIAS  892

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST AGLVASASHDKI+KLWK
Sbjct  893  LAVSTGAGLVASASHDKIVKLWK  915



>ref|XP_008359610.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Malus domestica]
Length=902

 Score =   263 bits (672),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAAENVVSILDVETQTCR +L+GHTKPIHSVCWDPSGE LASVSEDSVRVWTLG+
Sbjct  760  GRLLAAAAENVVSILDVETQTCRHSLQGHTKPIHSVCWDPSGEFLASVSEDSVRVWTLGA  819

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTENKTMTL AH+GLI +
Sbjct  820  GGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTENKTMTLSAHDGLIAA  879

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            L+VST  GLVASASHDK +KLWK
Sbjct  880  LSVSTGTGLVASASHDKFVKLWK  902



>ref|XP_009367962.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Pyrus x bretschneideri]
Length=428

 Score =   253 bits (645),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LAAAAENVVSILDVET TCR +L+GHTKPIHSVCWDPSGE LASVSEDSVRVW LG+
Sbjct  286  GRFLAAAAENVVSILDVETLTCRHSLQGHTKPIHSVCWDPSGEFLASVSEDSVRVWALGA  345

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G +G CVHELS N NKFHSC FHP+ +SLLV+GCYQ+LELWN+TENKTMTLPAHEGLI S
Sbjct  346  GGKGECVHELSCNRNKFHSCAFHPADTSLLVVGCYQTLELWNITENKTMTLPAHEGLIAS  405

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GL+ASASHDK +K+WK
Sbjct  406  LAVSTVTGLIASASHDKFVKIWK  428



>ref|XP_008359611.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Malus domestica]
Length=901

 Score =   263 bits (672),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAAENVVSILDVETQTCR +L+GHTKPIHSVCWDPSGE LASVSEDSVRVWTLG+
Sbjct  759  GRLLAAAAENVVSILDVETQTCRHSLQGHTKPIHSVCWDPSGEFLASVSEDSVRVWTLGA  818

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTENKTMTL AH+GLI +
Sbjct  819  GGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTENKTMTLSAHDGLIAA  878

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            L+VST  GLVASASHDK +KLWK
Sbjct  879  LSVSTGTGLVASASHDKFVKLWK  901



>ref|XP_007225318.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
 gb|EMJ26517.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
Length=636

 Score =   258 bits (659),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LAAAA+NVVSILDVETQ CR +L+GH+KP+HSVCWDPSGE LASVSEDSVRVWTL S
Sbjct  494  GRFLAAAADNVVSILDVETQACRHSLQGHSKPVHSVCWDPSGEFLASVSEDSVRVWTLRS  553

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS NG+KFHSCVFHP+Y+SLLVIGCYQSLELWNMTENKTMTL AH+GLI +
Sbjct  554  GGEGECVHELSCNGSKFHSCVFHPTYTSLLVIGCYQSLELWNMTENKTMTLSAHDGLIAA  613

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA+STV GLVASASHDK +KLWK
Sbjct  614  LAMSTVTGLVASASHDKFVKLWK  636



>ref|XP_007161251.1| hypothetical protein PHAVU_001G054700g [Phaseolus vulgaris]
 gb|ESW33245.1| hypothetical protein PHAVU_001G054700g [Phaseolus vulgaris]
Length=895

 Score =   263 bits (671),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LAAAAENVVSI DVETQ CR +LKGHTK IHSVCWDPSGE LASVSEDSVRVWTLGS
Sbjct  753  GRFLAAAAENVVSIFDVETQACRYSLKGHTKSIHSVCWDPSGEFLASVSEDSVRVWTLGS  812

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP++SSLLV+GCY+SLELWNMTENKTMTL AHEGLI +
Sbjct  813  GSEGECVHELSCNGNKFHSCVFHPTFSSLLVVGCYESLELWNMTENKTMTLSAHEGLIAA  872

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GLVASASHDK +KLWK
Sbjct  873  LAVSTVNGLVASASHDKFVKLWK  895



>ref|XP_008359612.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X5 
[Malus domestica]
Length=895

 Score =   263 bits (671),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAAENVVSILDVETQTCR +L+GHTKPIHSVCWDPSGE LASVSEDSVRVWTLG+
Sbjct  753  GRLLAAAAENVVSILDVETQTCRHSLQGHTKPIHSVCWDPSGEFLASVSEDSVRVWTLGA  812

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTENKTMTL AH+GLI +
Sbjct  813  GGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTENKTMTLSAHDGLIAA  872

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            L+VST  GLVASASHDK +KLWK
Sbjct  873  LSVSTGTGLVASASHDKFVKLWK  895



>ref|XP_008219869.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Prunus 
mume]
Length=914

 Score =   263 bits (672),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LAAAA+NVVSILDVETQ CR +L+GHTKP+HSVCWDPSGE LASVSEDSVRVWTLGS
Sbjct  772  GRFLAAAADNVVSILDVETQACRHSLQGHTKPVHSVCWDPSGEFLASVSEDSVRVWTLGS  831

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS NG+KFHSCVFHP+Y+SLLVIGCYQSLELWNMTENKTMTL AH+GLI +
Sbjct  832  GGEGECVHELSCNGSKFHSCVFHPTYTSLLVIGCYQSLELWNMTENKTMTLSAHDGLIAA  891

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA+STV GLVASASHDK +KLWK
Sbjct  892  LAMSTVTGLVASASHDKFVKLWK  914



>ref|XP_008359609.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Malus domestica]
Length=910

 Score =   263 bits (671),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAAENVVSILDVETQTCR +L+GHTKPIHSVCWDPSGE LASVSEDSVRVWTLG+
Sbjct  768  GRLLAAAAENVVSILDVETQTCRHSLQGHTKPIHSVCWDPSGEFLASVSEDSVRVWTLGA  827

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTENKTMTL AH+GLI +
Sbjct  828  GGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTENKTMTLSAHDGLIAA  887

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            L+VST  GLVASASHDK +KLWK
Sbjct  888  LSVSTGTGLVASASHDKFVKLWK  910



>ref|XP_008359608.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Malus domestica]
Length=911

 Score =   263 bits (671),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAAENVVSILDVETQTCR +L+GHTKPIHSVCWDPSGE LASVSEDSVRVWTLG+
Sbjct  769  GRLLAAAAENVVSILDVETQTCRHSLQGHTKPIHSVCWDPSGEFLASVSEDSVRVWTLGA  828

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTENKTMTL AH+GLI +
Sbjct  829  GGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTENKTMTLSAHDGLIAA  888

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            L+VST  GLVASASHDK +KLWK
Sbjct  889  LSVSTGTGLVASASHDKFVKLWK  911



>ref|XP_009372956.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X6 
[Pyrus x bretschneideri]
Length=814

 Score =   261 bits (667),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE LASVSEDSVRVWTLG+
Sbjct  672  GRLLAAAAENVVSILDVETQACRHSLQGHTKPIHSVCWDPSGEFLASVSEDSVRVWTLGA  731

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTENKTMTL AHEGLI +
Sbjct  732  GGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTENKTMTLSAHEGLIAA  791

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            L+VST  GLVASASHDK +KLWK
Sbjct  792  LSVSTGTGLVASASHDKYVKLWK  814



>ref|XP_008219868.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Prunus 
mume]
Length=923

 Score =   263 bits (671),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LAAAA+NVVSILDVETQ CR +L+GHTKP+HSVCWDPSGE LASVSEDSVRVWTLGS
Sbjct  781  GRFLAAAADNVVSILDVETQACRHSLQGHTKPVHSVCWDPSGEFLASVSEDSVRVWTLGS  840

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS NG+KFHSCVFHP+Y+SLLVIGCYQSLELWNMTENKTMTL AH+GLI +
Sbjct  841  GGEGECVHELSCNGSKFHSCVFHPTYTSLLVIGCYQSLELWNMTENKTMTLSAHDGLIAA  900

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA+STV GLVASASHDK +KLWK
Sbjct  901  LAMSTVTGLVASASHDKFVKLWK  923



>ref|XP_008219867.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Prunus 
mume]
Length=924

 Score =   263 bits (671),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LAAAA+NVVSILDVETQ CR +L+GHTKP+HSVCWDPSGE LASVSEDSVRVWTLGS
Sbjct  782  GRFLAAAADNVVSILDVETQACRHSLQGHTKPVHSVCWDPSGEFLASVSEDSVRVWTLGS  841

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS NG+KFHSCVFHP+Y+SLLVIGCYQSLELWNMTENKTMTL AH+GLI +
Sbjct  842  GGEGECVHELSCNGSKFHSCVFHPTYTSLLVIGCYQSLELWNMTENKTMTLSAHDGLIAA  901

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA+STV GLVASASHDK +KLWK
Sbjct  902  LAMSTVTGLVASASHDKFVKLWK  924



>ref|XP_003550163.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform 1 
[Glycine max]
Length=903

 Score =   262 bits (670),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ  R +LKGHTK I SVCWDPSGE LASVSEDSVRVWTLGS
Sbjct  761  GRYLAAAAENVVSILDVETQASRYSLKGHTKSIRSVCWDPSGEFLASVSEDSVRVWTLGS  820

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP+YSSLLV+GCYQSLELWNMTENKTMTL AHEGLI +
Sbjct  821  GSEGECVHELSCNGNKFHSCVFHPTYSSLLVVGCYQSLELWNMTENKTMTLSAHEGLIAA  880

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GLVASASHDK +KLWK
Sbjct  881  LAVSTVNGLVASASHDKFVKLWK  903



>gb|KDO79602.1| hypothetical protein CISIN_1g002471mg [Citrus sinensis]
Length=567

 Score =   256 bits (653),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILD ETQ CR +L+GHTKPI SVCWDPSGE LASVSEDSVRVWT+GS
Sbjct  425  GRYLAAAAENVVSILDAETQACRLSLQGHTKPIDSVCWDPSGELLASVSEDSVRVWTVGS  484

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSLELWNM+ENKTMTL AHEGLI +
Sbjct  485  GSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSLELWNMSENKTMTLTAHEGLIAA  544

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  G VASASHDK +KLWK
Sbjct  545  LAVSTETGYVASASHDKFVKLWK  567



>ref|XP_003550164.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform 2 
[Glycine max]
Length=912

 Score =   262 bits (669),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ  R +LKGHTK I SVCWDPSGE LASVSEDSVRVWTLGS
Sbjct  770  GRYLAAAAENVVSILDVETQASRYSLKGHTKSIRSVCWDPSGEFLASVSEDSVRVWTLGS  829

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP+YSSLLV+GCYQSLELWNMTENKTMTL AHEGLI +
Sbjct  830  GSEGECVHELSCNGNKFHSCVFHPTYSSLLVVGCYQSLELWNMTENKTMTLSAHEGLIAA  889

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GLVASASHDK +KLWK
Sbjct  890  LAVSTVNGLVASASHDKFVKLWK  912



>ref|XP_009372954.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Pyrus x bretschneideri]
Length=903

 Score =   261 bits (668),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE LASVSEDSVRVWTLG+
Sbjct  761  GRLLAAAAENVVSILDVETQACRHSLQGHTKPIHSVCWDPSGEFLASVSEDSVRVWTLGA  820

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTENKTMTL AHEGLI +
Sbjct  821  GGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTENKTMTLSAHEGLIAA  880

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            L+VST  GLVASASHDK +KLWK
Sbjct  881  LSVSTGTGLVASASHDKYVKLWK  903



>ref|XP_009372955.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X5 
[Pyrus x bretschneideri]
Length=897

 Score =   261 bits (668),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE LASVSEDSVRVWTLG+
Sbjct  755  GRLLAAAAENVVSILDVETQACRHSLQGHTKPIHSVCWDPSGEFLASVSEDSVRVWTLGA  814

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTENKTMTL AHEGLI +
Sbjct  815  GGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTENKTMTLSAHEGLIAA  874

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            L+VST  GLVASASHDK +KLWK
Sbjct  875  LSVSTGTGLVASASHDKYVKLWK  897



>ref|XP_009372950.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Pyrus x bretschneideri]
Length=913

 Score =   261 bits (668),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE LASVSEDSVRVWTLG+
Sbjct  771  GRLLAAAAENVVSILDVETQACRHSLQGHTKPIHSVCWDPSGEFLASVSEDSVRVWTLGA  830

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTENKTMTL AHEGLI +
Sbjct  831  GGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTENKTMTLSAHEGLIAA  890

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            L+VST  GLVASASHDK +KLWK
Sbjct  891  LSVSTGTGLVASASHDKYVKLWK  913



>ref|XP_009372951.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Pyrus x bretschneideri]
Length=912

 Score =   261 bits (668),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE LASVSEDSVRVWTLG+
Sbjct  770  GRLLAAAAENVVSILDVETQACRHSLQGHTKPIHSVCWDPSGEFLASVSEDSVRVWTLGA  829

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTENKTMTL AHEGLI +
Sbjct  830  GGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTENKTMTLSAHEGLIAA  889

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            L+VST  GLVASASHDK +KLWK
Sbjct  890  LSVSTGTGLVASASHDKYVKLWK  912



>ref|XP_007013777.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 1 [Theobroma cacao]
 ref|XP_007013779.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 1 [Theobroma cacao]
 gb|EOY31396.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 1 [Theobroma cacao]
 gb|EOY31398.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 1 [Theobroma cacao]
Length=910

 Score =   261 bits (668),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAAAAENVVSILD ETQTCR +L+GHTKPIHSVCWD SGE LASVSEDSVRVWTLGS
Sbjct  768  GKYLAAAAENVVSILDTETQTCRHSLQGHTKPIHSVCWDTSGELLASVSEDSVRVWTLGS  827

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSLELWNMTENKTMTL AH+GLI +
Sbjct  828  GSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSLELWNMTENKTMTLAAHDGLIAA  887

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V GLV+SASHDKI+KLWK
Sbjct  888  LAVSPVTGLVSSASHDKIVKLWK  910



>ref|XP_007013778.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 2 [Theobroma cacao]
 gb|EOY31397.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 2 [Theobroma cacao]
Length=919

 Score =   261 bits (667),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAAAAENVVSILD ETQTCR +L+GHTKPIHSVCWD SGE LASVSEDSVRVWTLGS
Sbjct  777  GKYLAAAAENVVSILDTETQTCRHSLQGHTKPIHSVCWDTSGELLASVSEDSVRVWTLGS  836

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSLELWNMTENKTMTL AH+GLI +
Sbjct  837  GSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSLELWNMTENKTMTLAAHDGLIAA  896

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V GLV+SASHDKI+KLWK
Sbjct  897  LAVSPVTGLVSSASHDKIVKLWK  919



>ref|XP_010112086.1| Transcriptional corepressor LEUNIG [Morus notabilis]
 gb|EXC32583.1| Transcriptional corepressor LEUNIG [Morus notabilis]
Length=924

 Score =   261 bits (666),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAEN+VSILDVETQ CR +L+GHTKP+HSVCWDPSGE LASVSEDSVRVWTLGS
Sbjct  782  GRYLAAAAENIVSILDVETQACRHSLQGHTKPVHSVCWDPSGEFLASVSEDSVRVWTLGS  841

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS +GNKFHSCVFHP+Y SLLV+GCYQSLELWNM+ENKTMTL AHEGLI +
Sbjct  842  GSEGECVHELSCSGNKFHSCVFHPTYPSLLVVGCYQSLELWNMSENKTMTLSAHEGLIAA  901

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS + GLVASASHDK +KLWK
Sbjct  902  LAVSPLTGLVASASHDKYVKLWK  924



>ref|XP_007221603.1| hypothetical protein PRUPE_ppa026892mg [Prunus persica]
 gb|EMJ22802.1| hypothetical protein PRUPE_ppa026892mg [Prunus persica]
Length=420

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LAAAA+N VSILDVETQ CR +L+G TKP+HSVCWDPSGE LASVSEDSVRVWTLGS
Sbjct  278  GRFLAAAADNAVSILDVETQACRHSLQGQTKPVHSVCWDPSGEFLASVSEDSVRVWTLGS  337

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G E  CVHELS NG KFHSCVFHP+Y+SLLVIGCYQSLELWNMTENK MTL AH+GLI +
Sbjct  338  GGERECVHELSCNGTKFHSCVFHPTYTSLLVIGCYQSLELWNMTENKIMTLSAHDGLIDA  397

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            L +STV GLVASASHDK  KLWK
Sbjct  398  LTMSTVTGLVASASHDKFFKLWK  420



>ref|XP_002515595.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF47044.1| WD-repeat protein, putative [Ricinus communis]
Length=708

 Score =   257 bits (656),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAA AENVVSILDVETQ CR +L+GHT  IHSVCWDPSGE LASVSEDSVRVW LGS
Sbjct  566  GRYLAAVAENVVSILDVETQACRHSLQGHTNSIHSVCWDPSGEFLASVSEDSVRVWRLGS  625

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG+CVH+LS NGNKFHSCVFHP+Y SLLVIGCYQSLELWNMTENKTMTL AHEGLI +
Sbjct  626  GSEGDCVHDLSCNGNKFHSCVFHPTYPSLLVIGCYQSLELWNMTENKTMTLAAHEGLIAA  685

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V G+VASASHDK +KLWK
Sbjct  686  LAVSPVTGVVASASHDKFVKLWK  708



>ref|XP_010526195.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Tarenaya hassleriana]
Length=829

 Score =   258 bits (658),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVS+LDVETQ CR +L+GH   IHSVCWDPSGE LASVSEDSVRVW+LGS
Sbjct  687  GRYLAAAAENVVSVLDVETQACRHSLQGHNNRIHSVCWDPSGEFLASVSEDSVRVWSLGS  746

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKF SCVFHPSY SLLVIGCYQSLELWNM+ENKTMTLPAHEG I +
Sbjct  747  GSEGECVHELSCNGNKFQSCVFHPSYPSLLVIGCYQSLELWNMSENKTMTLPAHEGRIAA  806

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK +KLWK
Sbjct  807  LAVSTATGLVASASHDKFVKLWK  829



>gb|KDO79600.1| hypothetical protein CISIN_1g002471mg [Citrus sinensis]
 gb|KDO79601.1| hypothetical protein CISIN_1g002471mg [Citrus sinensis]
Length=792

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILD ETQ CR +L+GHTKPI SVCWDPSGE LASVSEDSVRVWT+GS
Sbjct  650  GRYLAAAAENVVSILDAETQACRLSLQGHTKPIDSVCWDPSGELLASVSEDSVRVWTVGS  709

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSLELWNM+ENKTMTL AHEGLI +
Sbjct  710  GSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSLELWNMSENKTMTLTAHEGLIAA  769

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  G VASASHDK +KLWK
Sbjct  770  LAVSTETGYVASASHDKFVKLWK  792



>ref|XP_007225320.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
 gb|EMJ26519.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
Length=890

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LAAAA+NVVSILDVETQ CR +L+GH+KP+HSVCWDPSGE LASVSEDSVRVWTL S
Sbjct  748  GRFLAAAADNVVSILDVETQACRHSLQGHSKPVHSVCWDPSGEFLASVSEDSVRVWTLRS  807

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS NG+KFHSCVFHP+Y+SLLVIGCYQSLELWNMTENKTMTL AH+GLI +
Sbjct  808  GGEGECVHELSCNGSKFHSCVFHPTYTSLLVIGCYQSLELWNMTENKTMTLSAHDGLIAA  867

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA+STV GLVASASHDK +KLWK
Sbjct  868  LAMSTVTGLVASASHDKFVKLWK  890



>ref|XP_007225321.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
 gb|EMJ26520.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
Length=893

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LAAAA+NVVSILDVETQ CR +L+GH+KP+HSVCWDPSGE LASVSEDSVRVWTL S
Sbjct  751  GRFLAAAADNVVSILDVETQACRHSLQGHSKPVHSVCWDPSGEFLASVSEDSVRVWTLRS  810

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS NG+KFHSCVFHP+Y+SLLVIGCYQSLELWNMTENKTMTL AH+GLI +
Sbjct  811  GGEGECVHELSCNGSKFHSCVFHPTYTSLLVIGCYQSLELWNMTENKTMTLSAHDGLIAA  870

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA+STV GLVASASHDK +KLWK
Sbjct  871  LAMSTVTGLVASASHDKFVKLWK  893



>ref|XP_007225322.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
 gb|EMJ26521.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
Length=899

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LAAAA+NVVSILDVETQ CR +L+GH+KP+HSVCWDPSGE LASVSEDSVRVWTL S
Sbjct  757  GRFLAAAADNVVSILDVETQACRHSLQGHSKPVHSVCWDPSGEFLASVSEDSVRVWTLRS  816

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS NG+KFHSCVFHP+Y+SLLVIGCYQSLELWNMTENKTMTL AH+GLI +
Sbjct  817  GGEGECVHELSCNGSKFHSCVFHPTYTSLLVIGCYQSLELWNMTENKTMTLSAHDGLIAA  876

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA+STV GLVASASHDK +KLWK
Sbjct  877  LAMSTVTGLVASASHDKFVKLWK  899



>ref|XP_010526194.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Tarenaya hassleriana]
Length=911

 Score =   257 bits (657),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVS+LDVETQ CR +L+GH   IHSVCWDPSGE LASVSEDSVRVW+LGS
Sbjct  769  GRYLAAAAENVVSVLDVETQACRHSLQGHNNRIHSVCWDPSGEFLASVSEDSVRVWSLGS  828

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKF SCVFHPSY SLLVIGCYQSLELWNM+ENKTMTLPAHEG I +
Sbjct  829  GSEGECVHELSCNGNKFQSCVFHPSYPSLLVIGCYQSLELWNMSENKTMTLPAHEGRIAA  888

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK +KLWK
Sbjct  889  LAVSTATGLVASASHDKFVKLWK  911



>ref|XP_007013780.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 4 [Theobroma cacao]
 gb|EOY31399.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 4 [Theobroma cacao]
Length=911

 Score =   257 bits (656),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 132/144 (92%), Gaps = 1/144 (1%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAAAAENVVSILD ETQTCR +L+GHTKPIHSVCWD SGE LASVSEDSVRVWTLGS
Sbjct  768  GKYLAAAAENVVSILDTETQTCRHSLQGHTKPIHSVCWDTSGELLASVSEDSVRVWTLGS  827

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCY-QSLELWNMTENKTMTLPAHEGLIX  301
            G+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCY QSLELWNMTENKTMTL AH+GLI 
Sbjct  828  GSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQQSLELWNMTENKTMTLAAHDGLIA  887

Query  300  SLAVSTVAGLVASASHDKIIKLWK  229
            +LAVS V GLV+SASHDKI+KLWK
Sbjct  888  ALAVSPVTGLVSSASHDKIVKLWK  911



>ref|XP_011026513.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Populus euphratica]
Length=945

 Score =   256 bits (655),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAAA ENVVSILDVETQ CR +L+GHTK IHSVCWDPSGE+LAS SEDSVRVWTLGS
Sbjct  803  GKYLAAATENVVSILDVETQACRHSLQGHTKAIHSVCWDPSGEYLASASEDSVRVWTLGS  862

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGN+FHSCVFHP++ SLLVIGCYQSLELWNM+ENKTMTLPAH+G I +
Sbjct  863  GSEGECVHELSCNGNEFHSCVFHPTFPSLLVIGCYQSLELWNMSENKTMTLPAHDGQIAA  922

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV G VASASHDK++KLWK
Sbjct  923  LAVSTVTGTVASASHDKLVKLWK  945



>gb|KDO79597.1| hypothetical protein CISIN_1g002471mg [Citrus sinensis]
Length=903

 Score =   256 bits (654),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILD ETQ CR +L+GHTKPI SVCWDPSGE LASVSEDSVRVWT+GS
Sbjct  761  GRYLAAAAENVVSILDAETQACRLSLQGHTKPIDSVCWDPSGELLASVSEDSVRVWTVGS  820

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSLELWNM+ENKTMTL AHEGLI +
Sbjct  821  GSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSLELWNMSENKTMTLTAHEGLIAA  880

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  G VASASHDK +KLWK
Sbjct  881  LAVSTETGYVASASHDKFVKLWK  903



>ref|XP_011026514.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Populus euphratica]
Length=937

 Score =   256 bits (655),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAAA ENVVSILDVETQ CR +L+GHTK IHSVCWDPSGE+LAS SEDSVRVWTLGS
Sbjct  795  GKYLAAATENVVSILDVETQACRHSLQGHTKAIHSVCWDPSGEYLASASEDSVRVWTLGS  854

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGN+FHSCVFHP++ SLLVIGCYQSLELWNM+ENKTMTLPAH+G I +
Sbjct  855  GSEGECVHELSCNGNEFHSCVFHPTFPSLLVIGCYQSLELWNMSENKTMTLPAHDGQIAA  914

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV G VASASHDK++KLWK
Sbjct  915  LAVSTVTGTVASASHDKLVKLWK  937



>ref|XP_006476206.1| PREDICTED: transcriptional corepressor LEUNIG-like [Citrus sinensis]
 gb|KDO79595.1| hypothetical protein CISIN_1g002471mg [Citrus sinensis]
Length=918

 Score =   256 bits (654),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILD ETQ CR +L+GHTKPI SVCWDPSGE LASVSEDSVRVWT+GS
Sbjct  776  GRYLAAAAENVVSILDAETQACRLSLQGHTKPIDSVCWDPSGELLASVSEDSVRVWTVGS  835

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSLELWNM+ENKTMTL AHEGLI +
Sbjct  836  GSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSLELWNMSENKTMTLTAHEGLIAA  895

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  G VASASHDK +KLWK
Sbjct  896  LAVSTETGYVASASHDKFVKLWK  918



>ref|XP_006450544.1| hypothetical protein CICLE_v10007390mg [Citrus clementina]
 gb|ESR63784.1| hypothetical protein CICLE_v10007390mg [Citrus clementina]
Length=920

 Score =   256 bits (654),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILD ETQ CR +L+GHTKPI SVCWDPSGE LASVSEDSVRVWT+GS
Sbjct  778  GRYLAAAAENVVSILDAETQACRLSLQGHTKPIDSVCWDPSGELLASVSEDSVRVWTVGS  837

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSLELWNM+ENKTMTL AHEGLI +
Sbjct  838  GSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSLELWNMSENKTMTLTAHEGLIAA  897

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  G VASASHDK +KLWK
Sbjct  898  LAVSTETGYVASASHDKFVKLWK  920



>gb|KDO79596.1| hypothetical protein CISIN_1g002471mg [Citrus sinensis]
Length=913

 Score =   256 bits (654),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILD ETQ CR +L+GHTKPI SVCWDPSGE LASVSEDSVRVWT+GS
Sbjct  771  GRYLAAAAENVVSILDAETQACRLSLQGHTKPIDSVCWDPSGELLASVSEDSVRVWTVGS  830

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSLELWNM+ENKTMTL AHEGLI +
Sbjct  831  GSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSLELWNMSENKTMTLTAHEGLIAA  890

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  G VASASHDK +KLWK
Sbjct  891  LAVSTETGYVASASHDKFVKLWK  913



>ref|XP_011026512.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Populus euphratica]
Length=949

 Score =   256 bits (655),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAAA ENVVSILDVETQ CR +L+GHTK IHSVCWDPSGE+LAS SEDSVRVWTLGS
Sbjct  807  GKYLAAATENVVSILDVETQACRHSLQGHTKAIHSVCWDPSGEYLASASEDSVRVWTLGS  866

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGN+FHSCVFHP++ SLLVIGCYQSLELWNM+ENKTMTLPAH+G I +
Sbjct  867  GSEGECVHELSCNGNEFHSCVFHPTFPSLLVIGCYQSLELWNMSENKTMTLPAHDGQIAA  926

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV G VASASHDK++KLWK
Sbjct  927  LAVSTVTGTVASASHDKLVKLWK  949



>ref|XP_006450543.1| hypothetical protein CICLE_v10007390mg [Citrus clementina]
 gb|ESR63783.1| hypothetical protein CICLE_v10007390mg [Citrus clementina]
Length=917

 Score =   256 bits (654),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILD ETQ CR +L+GHTKPI SVCWDPSGE LASVSEDSVRVWT+GS
Sbjct  775  GRYLAAAAENVVSILDAETQACRLSLQGHTKPIDSVCWDPSGELLASVSEDSVRVWTVGS  834

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSLELWNM+ENKTMTL AHEGLI +
Sbjct  835  GSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSLELWNMSENKTMTLTAHEGLIAA  894

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  G VASASHDK +KLWK
Sbjct  895  LAVSTETGYVASASHDKFVKLWK  917



>gb|KDO79598.1| hypothetical protein CISIN_1g002471mg [Citrus sinensis]
Length=915

 Score =   256 bits (654),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILD ETQ CR +L+GHTKPI SVCWDPSGE LASVSEDSVRVWT+GS
Sbjct  773  GRYLAAAAENVVSILDAETQACRLSLQGHTKPIDSVCWDPSGELLASVSEDSVRVWTVGS  832

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSLELWNM+ENKTMTL AHEGLI +
Sbjct  833  GSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSLELWNMSENKTMTLTAHEGLIAA  892

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  G VASASHDK +KLWK
Sbjct  893  LAVSTETGYVASASHDKFVKLWK  915



>ref|XP_006371728.1| LEUNIG family protein [Populus trichocarpa]
 gb|ERP49525.1| LEUNIG family protein [Populus trichocarpa]
Length=953

 Score =   256 bits (655),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAAAAENVVSILDVETQ CR +L+GHTK IHSVCWDPSGE+LASVSEDSVRVWTLGS
Sbjct  811  GKYLAAAAENVVSILDVETQACRHSLQGHTKAIHSVCWDPSGEYLASVSEDSVRVWTLGS  870

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGN+FHSCVFHP++ SLLVIGCYQSLELWNM+ENKTMTL AH+G I +
Sbjct  871  GSEGECVHELSCNGNEFHSCVFHPTFPSLLVIGCYQSLELWNMSENKTMTLAAHDGQIAA  930

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV G++ASASHDK +KLWK
Sbjct  931  LAVSTVTGMLASASHDKFVKLWK  953



>ref|XP_010526193.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Tarenaya hassleriana]
Length=958

 Score =   256 bits (655),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVS+LDVETQ CR +L+GH   IHSVCWDPSGE LASVSEDSVRVW+LGS
Sbjct  816  GRYLAAAAENVVSVLDVETQACRHSLQGHNNRIHSVCWDPSGEFLASVSEDSVRVWSLGS  875

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKF SCVFHPSY SLLVIGCYQSLELWNM+ENKTMTLPAHEG I +
Sbjct  876  GSEGECVHELSCNGNKFQSCVFHPSYPSLLVIGCYQSLELWNMSENKTMTLPAHEGRIAA  935

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK +KLWK
Sbjct  936  LAVSTATGLVASASHDKFVKLWK  958



>ref|XP_010526192.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Tarenaya hassleriana]
Length=960

 Score =   256 bits (655),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVS+LDVETQ CR +L+GH   IHSVCWDPSGE LASVSEDSVRVW+LGS
Sbjct  818  GRYLAAAAENVVSVLDVETQACRHSLQGHNNRIHSVCWDPSGEFLASVSEDSVRVWSLGS  877

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKF SCVFHPSY SLLVIGCYQSLELWNM+ENKTMTLPAHEG I +
Sbjct  878  GSEGECVHELSCNGNKFQSCVFHPSYPSLLVIGCYQSLELWNMSENKTMTLPAHEGRIAA  937

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK +KLWK
Sbjct  938  LAVSTATGLVASASHDKFVKLWK  960



>ref|XP_011026511.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Populus euphratica]
Length=954

 Score =   256 bits (655),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAAA ENVVSILDVETQ CR +L+GHTK IHSVCWDPSGE+LAS SEDSVRVWTLGS
Sbjct  812  GKYLAAATENVVSILDVETQACRHSLQGHTKAIHSVCWDPSGEYLASASEDSVRVWTLGS  871

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGN+FHSCVFHP++ SLLVIGCYQSLELWNM+ENKTMTLPAH+G I +
Sbjct  872  GSEGECVHELSCNGNEFHSCVFHPTFPSLLVIGCYQSLELWNMSENKTMTLPAHDGQIAA  931

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV G VASASHDK++KLWK
Sbjct  932  LAVSTVTGTVASASHDKLVKLWK  954



>ref|XP_003522634.1| PREDICTED: transcriptional corepressor LEUNIG-like isoformX2 
[Glycine max]
Length=903

 Score =   256 bits (653),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAEN+VSI DVETQ CR +LKGHTKP+  VCWDPSGE LASVSEDSVRVWTLGS
Sbjct  761  GRYLAAAAENIVSIFDVETQACRYSLKGHTKPVDCVCWDPSGELLASVSEDSVRVWTLGS  820

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFH+ VFHP+Y SLLVIGCYQSLELWNM+ENKTMTL AH+GLI S
Sbjct  821  GSEGECVHELSCNGNKFHASVFHPTYPSLLVIGCYQSLELWNMSENKTMTLSAHDGLITS  880

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GLVASASHDK +KLWK
Sbjct  881  LAVSTVNGLVASASHDKFLKLWK  903



>ref|XP_006578171.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Glycine max]
Length=907

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAEN+VSI DVETQ CR +LKGHTKP+  VCWDPSGE LASVSEDSVRVWTLGS
Sbjct  765  GRYLAAAAENIVSIFDVETQACRYSLKGHTKPVDCVCWDPSGELLASVSEDSVRVWTLGS  824

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFH+ VFHP+Y SLLVIGCYQSLELWNM+ENKTMTL AH+GLI S
Sbjct  825  GSEGECVHELSCNGNKFHASVFHPTYPSLLVIGCYQSLELWNMSENKTMTLSAHDGLITS  884

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GLVASASHDK +KLWK
Sbjct  885  LAVSTVNGLVASASHDKFLKLWK  907



>ref|XP_009377500.1| PREDICTED: transcriptional corepressor LEUNIG isoform X6 [Pyrus 
x bretschneideri]
Length=816

 Score =   254 bits (650),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE LASVSEDSVRVWTLG+
Sbjct  665  GRFLAAAAENVVSILDVETQNCRHSLQGHTKPIHSVCWDPSGEFLASVSEDSVRVWTLGA  724

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTENKTMTL AH+GLI +
Sbjct  725  GGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTENKTMTLSAHDGLIAA  784

Query  297  LAVSTVAGLVASASHDKIIK  238
            L+VSTV GLVASASHD + K
Sbjct  785  LSVSTVTGLVASASHDNLSK  804



>ref|XP_004501292.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Cicer arietinum]
Length=888

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAEN+VSILDVETQ CR +LKGHTK I SVCWDPSGE LASVSEDSVR+WTLG+
Sbjct  746  GRYLAAAAENIVSILDVETQACRYSLKGHTKTIDSVCWDPSGELLASVSEDSVRIWTLGT  805

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NG+KFHSCVFHP+Y SLLVIGCYQSLELWNM ENKTMTL AH+GLI +
Sbjct  806  GSEGECVHELSCNGSKFHSCVFHPTYPSLLVIGCYQSLELWNMAENKTMTLSAHDGLITA  865

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            L+VSTV GLVASASHDK IKLWK
Sbjct  866  LSVSTVNGLVASASHDKFIKLWK  888



>ref|XP_003522633.1| PREDICTED: transcriptional corepressor LEUNIG-like isoformX1 
[Glycine max]
Length=912

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAEN+VSI DVETQ CR +LKGHTKP+  VCWDPSGE LASVSEDSVRVWTLGS
Sbjct  770  GRYLAAAAENIVSIFDVETQACRYSLKGHTKPVDCVCWDPSGELLASVSEDSVRVWTLGS  829

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFH+ VFHP+Y SLLVIGCYQSLELWNM+ENKTMTL AH+GLI S
Sbjct  830  GSEGECVHELSCNGNKFHASVFHPTYPSLLVIGCYQSLELWNMSENKTMTLSAHDGLITS  889

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GLVASASHDK +KLWK
Sbjct  890  LAVSTVNGLVASASHDKFLKLWK  912



>ref|XP_010249918.1| PREDICTED: LOW QUALITY PROTEIN: transcriptional corepressor LEUNIG 
[Nelumbo nucifera]
Length=897

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAAENVVSILDVETQ  R +L+GHTKP+HSVCWDPSGE LASVSEDSVRVWT GS
Sbjct  755  GRCLAAAAENVVSILDVETQMSRHSLQGHTKPVHSVCWDPSGELLASVSEDSVRVWTFGS  814

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GNEG CVHELS NGNKFHSCVFHPSY SLLVIGCYQSLELWNM ENKTMT+ AHEGLI +
Sbjct  815  GNEGECVHELSCNGNKFHSCVFHPSYPSLLVIGCYQSLELWNMAENKTMTMSAHEGLIAA  874

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS   GLVASASHDK +KLWK
Sbjct  875  LAVSNATGLVASASHDKYVKLWK  897



>ref|XP_004501291.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Cicer arietinum]
Length=897

 Score =   255 bits (651),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAEN+VSILDVETQ CR +LKGHTK I SVCWDPSGE LASVSEDSVR+WTLG+
Sbjct  755  GRYLAAAAENIVSILDVETQACRYSLKGHTKTIDSVCWDPSGELLASVSEDSVRIWTLGT  814

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NG+KFHSCVFHP+Y SLLVIGCYQSLELWNM ENKTMTL AH+GLI +
Sbjct  815  GSEGECVHELSCNGSKFHSCVFHPTYPSLLVIGCYQSLELWNMAENKTMTLSAHDGLITA  874

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            L+VSTV GLVASASHDK IKLWK
Sbjct  875  LSVSTVNGLVASASHDKFIKLWK  897



>ref|XP_004501290.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Cicer arietinum]
Length=904

 Score =   255 bits (651),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAEN+VSILDVETQ CR +LKGHTK I SVCWDPSGE LASVSEDSVR+WTLG+
Sbjct  762  GRYLAAAAENIVSILDVETQACRYSLKGHTKTIDSVCWDPSGELLASVSEDSVRIWTLGT  821

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NG+KFHSCVFHP+Y SLLVIGCYQSLELWNM ENKTMTL AH+GLI +
Sbjct  822  GSEGECVHELSCNGSKFHSCVFHPTYPSLLVIGCYQSLELWNMAENKTMTLSAHDGLITA  881

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            L+VSTV GLVASASHDK IKLWK
Sbjct  882  LSVSTVNGLVASASHDKFIKLWK  904



>ref|XP_009377497.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Pyrus 
x bretschneideri]
Length=906

 Score =   255 bits (651),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE LASVSEDSVRVWTLG+
Sbjct  755  GRFLAAAAENVVSILDVETQNCRHSLQGHTKPIHSVCWDPSGEFLASVSEDSVRVWTLGA  814

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTENKTMTL AH+GLI +
Sbjct  815  GGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTENKTMTLSAHDGLIAA  874

Query  297  LAVSTVAGLVASASHDKIIK  238
            L+VSTV GLVASASHD + K
Sbjct  875  LSVSTVTGLVASASHDNLSK  894



>ref|XP_009377494.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Pyrus 
x bretschneideri]
Length=915

 Score =   255 bits (651),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE LASVSEDSVRVWTLG+
Sbjct  764  GRFLAAAAENVVSILDVETQNCRHSLQGHTKPIHSVCWDPSGEFLASVSEDSVRVWTLGA  823

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTENKTMTL AH+GLI +
Sbjct  824  GGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTENKTMTLSAHDGLIAA  883

Query  297  LAVSTVAGLVASASHDKIIK  238
            L+VSTV GLVASASHD + K
Sbjct  884  LSVSTVTGLVASASHDNLSK  903



>ref|XP_009377498.1| PREDICTED: transcriptional corepressor LEUNIG isoform X4 [Pyrus 
x bretschneideri]
Length=899

 Score =   254 bits (650),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE LASVSEDSVRVWTLG+
Sbjct  748  GRFLAAAAENVVSILDVETQNCRHSLQGHTKPIHSVCWDPSGEFLASVSEDSVRVWTLGA  807

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTENKTMTL AH+GLI +
Sbjct  808  GGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTENKTMTLSAHDGLIAA  867

Query  297  LAVSTVAGLVASASHDKIIK  238
            L+VSTV GLVASASHD + K
Sbjct  868  LSVSTVTGLVASASHDNLSK  887



>ref|XP_010548472.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Tarenaya hassleriana]
Length=894

 Score =   254 bits (648),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+L A AENVVS+LDVETQ CR +L+GH+ PIHSVCWDPSG+ LASVSEDSVRVW+LGS
Sbjct  752  GRFLVAGAENVVSVLDVETQACRHSLQGHSNPIHSVCWDPSGDFLASVSEDSVRVWSLGS  811

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM+ENKTM LPAH+GLI +
Sbjct  812  GTEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSLELWNMSENKTMALPAHDGLIAA  871

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK++KLWK
Sbjct  872  LAVSTATGLVASASHDKLVKLWK  894



>ref|XP_010548470.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Tarenaya hassleriana]
Length=904

 Score =   253 bits (647),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+L A AENVVS+LDVETQ CR +L+GH+ PIHSVCWDPSG+ LASVSEDSVRVW+LGS
Sbjct  762  GRFLVAGAENVVSVLDVETQACRHSLQGHSNPIHSVCWDPSGDFLASVSEDSVRVWSLGS  821

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM+ENKTM LPAH+GLI +
Sbjct  822  GTEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSLELWNMSENKTMALPAHDGLIAA  881

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK++KLWK
Sbjct  882  LAVSTATGLVASASHDKLVKLWK  904



>ref|XP_010548471.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Tarenaya hassleriana]
Length=899

 Score =   253 bits (647),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+L A AENVVS+LDVETQ CR +L+GH+ PIHSVCWDPSG+ LASVSEDSVRVW+LGS
Sbjct  757  GRFLVAGAENVVSVLDVETQACRHSLQGHSNPIHSVCWDPSGDFLASVSEDSVRVWSLGS  816

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM+ENKTM LPAH+GLI +
Sbjct  817  GTEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSLELWNMSENKTMALPAHDGLIAA  876

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK++KLWK
Sbjct  877  LAVSTATGLVASASHDKLVKLWK  899



>ref|XP_006581384.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Glycine max]
Length=883

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAEN+VSI DVETQ CR +LKGHTKP+  VCWDPSGE LASVSEDSVRVWTLGS
Sbjct  741  GRYLAAAAENIVSIFDVETQVCRYSLKGHTKPVVCVCWDPSGELLASVSEDSVRVWTLGS  800

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G++G CVHELS NGNKFH  VFHP+Y SLLVIGCYQSLELWNM+ENKTMTL AH+GLI S
Sbjct  801  GSDGECVHELSCNGNKFHKSVFHPTYPSLLVIGCYQSLELWNMSENKTMTLSAHDGLITS  860

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GLVASASHDK +KLWK
Sbjct  861  LAVSTVNGLVASASHDKFLKLWK  883



>ref|XP_003526430.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Glycine max]
Length=892

 Score =   252 bits (644),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAEN+VSI DVETQ CR +LKGHTKP+  VCWDPSGE LASVSEDSVRVWTLGS
Sbjct  750  GRYLAAAAENIVSIFDVETQVCRYSLKGHTKPVVCVCWDPSGELLASVSEDSVRVWTLGS  809

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G++G CVHELS NGNKFH  VFHP+Y SLLVIGCYQSLELWNM+ENKTMTL AH+GLI S
Sbjct  810  GSDGECVHELSCNGNKFHKSVFHPTYPSLLVIGCYQSLELWNMSENKTMTLSAHDGLITS  869

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GLVASASHDK +KLWK
Sbjct  870  LAVSTVNGLVASASHDKFLKLWK  892



>ref|XP_006581383.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Glycine max]
Length=887

 Score =   252 bits (643),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAEN+VSI DVETQ CR +LKGHTKP+  VCWDPSGE LASVSEDSVRVWTLGS
Sbjct  745  GRYLAAAAENIVSIFDVETQVCRYSLKGHTKPVVCVCWDPSGELLASVSEDSVRVWTLGS  804

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G++G CVHELS NGNKFH  VFHP+Y SLLVIGCYQSLELWNM+ENKTMTL AH+GLI S
Sbjct  805  GSDGECVHELSCNGNKFHKSVFHPTYPSLLVIGCYQSLELWNMSENKTMTLSAHDGLITS  864

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GLVASASHDK +KLWK
Sbjct  865  LAVSTVNGLVASASHDKFLKLWK  887



>gb|KDP32298.1| hypothetical protein JCGZ_13223 [Jatropha curcas]
Length=935

 Score =   252 bits (643),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE+LASVSEDSVRVW LGS
Sbjct  782  GRYLAAAAENVVSILDVETQVCRHSLQGHTKPIHSVCWDPSGEYLASVSEDSVRVWRLGS  841

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG  VH+L+ NGNKFHSCVFHP+Y SLLV+GCYQSLELW MTENKTM+L AHEGLI +
Sbjct  842  GSEGEFVHDLTCNGNKFHSCVFHPTYPSLLVLGCYQSLELWKMTENKTMSLSAHEGLIAA  901

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA+S V GLVAS  HDK +KLWK
Sbjct  902  LAISPVTGLVASVGHDKFVKLWK  924



>gb|KFK29865.1| hypothetical protein AALP_AA7G189100 [Arabis alpina]
Length=926

 Score =   251 bits (641),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAA+A NVVS+LDVETQ CR +L+GH+ PI+SVCWDPSG+ LASVSED V+VWTLG+
Sbjct  784  GKYLAASAANVVSVLDVETQACRHSLQGHSNPINSVCWDPSGDFLASVSEDMVKVWTLGT  843

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM+ENKTMTLPAH+GLI S
Sbjct  844  GSEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSLELWNMSENKTMTLPAHDGLIAS  903

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK++KLWK
Sbjct  904  LAVSTATGLVASASHDKLVKLWK  926



>ref|XP_010670737.1| PREDICTED: transcriptional corepressor LEUNIG [Beta vulgaris 
subsp. vulgaris]
Length=930

 Score =   251 bits (641),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENV+SILDVETQ C+  L+GHTK IHSVCWD SGE LASVSEDSVRVW+LG 
Sbjct  788  GRYLAAAAENVISILDVETQACQHRLQGHTKQIHSVCWDTSGEFLASVSEDSVRVWSLGL  847

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GNEG CVHELS NGNKF+SC FHP+YSSLLVIGCYQS+ELWNM+ENKTMTL AH+GLI +
Sbjct  848  GNEGECVHELSCNGNKFYSCAFHPTYSSLLVIGCYQSMELWNMSENKTMTLSAHDGLIAA  907

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            L+VS+V GLVASASHDK +KLWK
Sbjct  908  LSVSSVTGLVASASHDKFVKLWK  930



>ref|XP_010914979.1| PREDICTED: transcriptional corepressor LEUNIG-like [Elaeis guineensis]
Length=772

 Score =   249 bits (635),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ C  +L+GHTK + SVCWDP+G+ L SVSEDSVRVW+L S
Sbjct  630  GRYLAAAAENVVSILDVETQACLHSLEGHTKHVDSVCWDPTGQLLVSVSEDSVRVWSLSS  689

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GNEG CVHELS NGNKFHSCVFHPSY SLLVIGCYQSLELW+M ENKTMTLPAHEGLI +
Sbjct  690  GNEGECVHELSCNGNKFHSCVFHPSYPSLLVIGCYQSLELWDMDENKTMTLPAHEGLIAA  749

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V GLVASASHDK +KLW+
Sbjct  750  LAVSNVNGLVASASHDKFVKLWR  772



>ref|XP_009138136.1| PREDICTED: transcriptional corepressor LEUNIG-like [Brassica 
rapa]
Length=902

 Score =   250 bits (638),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAA++ NVVS+LDVETQ CR +L+GHT PI+SVCWDPSG+ LA+VSED V+VWTLG+
Sbjct  760  GKYLAASSSNVVSVLDVETQACRHSLQGHTNPINSVCWDPSGDFLATVSEDMVKVWTLGT  819

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM+ENKTM LPAHEGLI S
Sbjct  820  GSEGECVHELSCNGNKFQSCVFHPTYPSLLVIGCYQSLELWNMSENKTMALPAHEGLIAS  879

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK++KLWK
Sbjct  880  LAVSTATGLVASASHDKLVKLWK  902



>gb|KJB83300.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
 gb|KJB83310.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=936

 Score =   250 bits (639),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAAAAENVVSILD ETQTCR +L+GHTK IHSVCWDPSGE LASVSEDSVRVW+  S
Sbjct  794  GKYLAAAAENVVSILDTETQTCRHSLQGHTKLIHSVCWDPSGELLASVSEDSVRVWSFAS  853

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHPS+ SLLVIGCYQSLELWNM+ENKTMTL AHEGLI +
Sbjct  854  GSEGECVHELSCNGNKFHSCVFHPSFQSLLVIGCYQSLELWNMSENKTMTLSAHEGLIAA  913

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V  LV+SASHDK +KLWK
Sbjct  914  LAVSPVTRLVSSASHDKFVKLWK  936



>gb|KJB83302.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
 gb|KJB83307.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=941

 Score =   250 bits (638),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAAAAENVVSILD ETQTCR +L+GHTK IHSVCWDPSGE LASVSEDSVRVW+  S
Sbjct  799  GKYLAAAAENVVSILDTETQTCRHSLQGHTKLIHSVCWDPSGELLASVSEDSVRVWSFAS  858

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHPS+ SLLVIGCYQSLELWNM+ENKTMTL AHEGLI +
Sbjct  859  GSEGECVHELSCNGNKFHSCVFHPSFQSLLVIGCYQSLELWNMSENKTMTLSAHEGLIAA  918

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V  LV+SASHDK +KLWK
Sbjct  919  LAVSPVTRLVSSASHDKFVKLWK  941



>gb|KJB83312.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=935

 Score =   250 bits (638),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAAAAENVVSILD ETQTCR +L+GHTK IHSVCWDPSGE LASVSEDSVRVW+  S
Sbjct  793  GKYLAAAAENVVSILDTETQTCRHSLQGHTKLIHSVCWDPSGELLASVSEDSVRVWSFAS  852

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHPS+ SLLVIGCYQSLELWNM+ENKTMTL AHEGLI +
Sbjct  853  GSEGECVHELSCNGNKFHSCVFHPSFQSLLVIGCYQSLELWNMSENKTMTLSAHEGLIAA  912

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V  LV+SASHDK +KLWK
Sbjct  913  LAVSPVTRLVSSASHDKFVKLWK  935



>emb|CDX72364.1| BnaC07g43860D [Brassica napus]
Length=694

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAA++ NVVS+LDVETQ CR +L+GH  PI+SVCWDPSG+ LA+VSED V+VWTLG+
Sbjct  552  GKYLAASSSNVVSVLDVETQACRHSLQGHANPINSVCWDPSGDFLATVSEDMVKVWTLGT  611

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG C+HELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM+ENKTM LPAHEGLI S
Sbjct  612  GSEGECIHELSCNGNKFSSCVFHPTYPSLLVIGCYQSLELWNMSENKTMALPAHEGLIAS  671

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK++KLWK
Sbjct  672  LAVSTATGLVASASHDKLVKLWK  694



>gb|KJB83314.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=945

 Score =   250 bits (638),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAAAAENVVSILD ETQTCR +L+GHTK IHSVCWDPSGE LASVSEDSVRVW+  S
Sbjct  803  GKYLAAAAENVVSILDTETQTCRHSLQGHTKLIHSVCWDPSGELLASVSEDSVRVWSFAS  862

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHPS+ SLLVIGCYQSLELWNM+ENKTMTL AHEGLI +
Sbjct  863  GSEGECVHELSCNGNKFHSCVFHPSFQSLLVIGCYQSLELWNMSENKTMTLSAHEGLIAA  922

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V  LV+SASHDK +KLWK
Sbjct  923  LAVSPVTRLVSSASHDKFVKLWK  945



>gb|KJB83304.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
 gb|KJB83309.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=950

 Score =   250 bits (638),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAAAAENVVSILD ETQTCR +L+GHTK IHSVCWDPSGE LASVSEDSVRVW+  S
Sbjct  808  GKYLAAAAENVVSILDTETQTCRHSLQGHTKLIHSVCWDPSGELLASVSEDSVRVWSFAS  867

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHPS+ SLLVIGCYQSLELWNM+ENKTMTL AHEGLI +
Sbjct  868  GSEGECVHELSCNGNKFHSCVFHPSFQSLLVIGCYQSLELWNMSENKTMTLSAHEGLIAA  927

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V  LV+SASHDK +KLWK
Sbjct  928  LAVSPVTRLVSSASHDKFVKLWK  950



>emb|CDY13494.1| BnaA03g52120D [Brassica napus]
Length=887

 Score =   249 bits (636),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAA++ NVVS+LDVETQ CR +L+GHT PI+SVCWDPSG+ LA+VSED V+VWTLG+
Sbjct  745  GKYLAASSSNVVSVLDVETQACRHSLQGHTNPINSVCWDPSGDFLATVSEDMVKVWTLGT  804

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM+ENKTM LPAHEGLI S
Sbjct  805  GSEGECVHELSCNGNKFQSCVFHPTYPSLLVIGCYQSLELWNMSENKTMALPAHEGLIAS  864

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK++KLWK
Sbjct  865  LAVSTATGLVASASHDKLVKLWK  887



>gb|KDP23675.1| hypothetical protein JCGZ_23508 [Jatropha curcas]
Length=299

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAA EN V+++DVETQ C  +L+GH KPIH VCWDPSGE++ASVSED+VR+WT+GS
Sbjct  157  GRYLAAAEENFVAVIDVETQACLHSLEGHVKPIHFVCWDPSGEYIASVSEDTVRIWTIGS  216

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GNEG C+HELSS+ N+FHSCVFHP+  SLL+IGCYQ+L++WNM ENKT+TLPAHEGLI S
Sbjct  217  GNEGECIHELSSDSNRFHSCVFHPTNPSLLIIGCYQTLKIWNMIENKTVTLPAHEGLIAS  276

Query  297  LAVSTVAGLVASASHDKIIKLW  232
            LAVSTV  LVASASHDK +KLW
Sbjct  277  LAVSTVNRLVASASHDKFVKLW  298



>ref|XP_010049009.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Eucalyptus grandis]
Length=322

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G YLAAAA+NV+SILDVETQ CRQTL+GHTK I SVCWD +G+ +ASVSEDSVRVW +GS
Sbjct  180  GMYLAAAADNVLSILDVETQACRQTLQGHTKAIDSVCWDSTGDLVASVSEDSVRVWAVGS  239

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+E +CVHELS NGNK HSCVFHP+Y SLLVIGC+Q+LELWNM ENKTM LPAH+GLI +
Sbjct  240  GSEWDCVHELSCNGNKAHSCVFHPTYPSLLVIGCHQTLELWNMAENKTMALPAHDGLISA  299

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V GLVASASHDK +KLWK
Sbjct  300  LAVSNVTGLVASASHDKTVKLWK  322



>emb|CDY23331.1| BnaA08g12150D [Brassica napus]
Length=912

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAA++ NVVS+LDVETQ CR +L+GH   I+SVCWDPSG+ LASVSED V+VWTLG+
Sbjct  770  GKYLAASSANVVSVLDVETQACRHSLQGHANQINSVCWDPSGDFLASVSEDMVKVWTLGT  829

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM+ENKTMTLPAHEGLI S
Sbjct  830  GSEGECVHELSCNGNKFQSCVFHPTYPSLLVIGCYQSLELWNMSENKTMTLPAHEGLIAS  889

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK++KLWK
Sbjct  890  LAVSTATGLVASASHDKLVKLWK  912



>ref|XP_010049010.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Eucalyptus grandis]
Length=299

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G YLAAAA+NV+SILDVETQ CRQTL+GHTK I SVCWD +G+ +ASVSEDSVRVW +GS
Sbjct  157  GMYLAAAADNVLSILDVETQACRQTLQGHTKAIDSVCWDSTGDLVASVSEDSVRVWAVGS  216

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+E +CVHELS NGNK HSCVFHP+Y SLLVIGC+Q+LELWNM ENKTM LPAH+GLI +
Sbjct  217  GSEWDCVHELSCNGNKAHSCVFHPTYPSLLVIGCHQTLELWNMAENKTMALPAHDGLISA  276

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V GLVASASHDK +KLWK
Sbjct  277  LAVSNVTGLVASASHDKTVKLWK  299



>emb|CDY51674.1| BnaC03g67130D [Brassica napus]
Length=884

 Score =   248 bits (632),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAA++ NVVS+LDVETQ CR +L+GH   I+SVCWDPSG+ LASVSED V+VWTLG+
Sbjct  742  GKYLAASSANVVSVLDVETQACRHSLQGHANQINSVCWDPSGDFLASVSEDMVKVWTLGT  801

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM+ENKTMTLPAHEGLI S
Sbjct  802  GSEGECVHELSCNGNKFQSCVFHPTYPSLLVIGCYQSLELWNMSENKTMTLPAHEGLIAS  861

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK++KLWK
Sbjct  862  LAVSTATGLVASASHDKLVKLWK  884



>ref|XP_006412457.1| hypothetical protein EUTSA_v10024343mg [Eutrema salsugineum]
 gb|ESQ53910.1| hypothetical protein EUTSA_v10024343mg [Eutrema salsugineum]
Length=917

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAA++ NVVS+LDVETQ CR +L+GH   I+SVCWDPSG+ LASVSED V+VWTLG+
Sbjct  775  GKYLAASSANVVSVLDVETQACRHSLQGHANSINSVCWDPSGDFLASVSEDMVKVWTLGT  834

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM+ENKTMTLPAHEGLI S
Sbjct  835  GSEGECVHELSCNGNKFQSCVFHPTYPSLLVIGCYQSLELWNMSENKTMTLPAHEGLIAS  894

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK++KLWK
Sbjct  895  LAVSTATGLVASASHDKLVKLWK  917



>ref|XP_009108869.1| PREDICTED: transcriptional corepressor LEUNIG [Brassica rapa]
Length=908

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAA++ NVVS+LDVETQ CR +L+GH   I+SVCWDPSG+ LASVSED V+VWTLG+
Sbjct  766  GKYLAASSANVVSVLDVETQACRHSLQGHANQINSVCWDPSGDFLASVSEDMVKVWTLGT  825

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM+ENKTMTLPAHEGLI S
Sbjct  826  GSEGECVHELSCNGNKFQSCVFHPTYPSLLVIGCYQSLELWNMSENKTMTLPAHEGLIAS  885

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK++KLWK
Sbjct  886  LAVSTSTGLVASASHDKLVKLWK  908



>gb|KFK29867.1| hypothetical protein AALP_AA7G189300 [Arabis alpina]
Length=382

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAA++ NVVSILDVETQ CR +L+GH+ PI+SVCWDPSG+ LASVS+D V+VWTLG+
Sbjct  240  GKYLAASSANVVSILDVETQACRYSLQGHSTPINSVCWDPSGDFLASVSKDKVKVWTLGT  299

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NG+ F SCVFHP+Y SLLVIGCYQSLELWNM E+KTMTLPAHE LI S
Sbjct  300  GSEGECVHELSFNGSNFLSCVFHPAYPSLLVIGCYQSLELWNMLEHKTMTLPAHEALIAS  359

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHD+++KLWK
Sbjct  360  LAVSTATGLVASASHDQLVKLWK  382



>ref|XP_007137062.1| hypothetical protein PHAVU_009G096600g [Phaseolus vulgaris]
 gb|ESW09056.1| hypothetical protein PHAVU_009G096600g [Phaseolus vulgaris]
Length=982

 Score =   247 bits (631),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAEN+VSI DVETQ CR +LKGHTK +  VCWDPSGE LASVSEDSV+VW+LGS
Sbjct  840  GRYLAAAAENIVSIFDVETQACRFSLKGHTKTVDCVCWDPSGELLASVSEDSVKVWSLGS  899

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NG+KFH+CVFHP+Y SLL IGCYQSLELWNM+ENKTMTL AH+GLI +
Sbjct  900  GSEGECVHELSCNGSKFHACVFHPTYPSLLAIGCYQSLELWNMSENKTMTLSAHDGLITA  959

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GLVASASHDK +KLWK
Sbjct  960  LAVSTVNGLVASASHDKFLKLWK  982



>ref|XP_002514368.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF48322.1| WD-repeat protein, putative [Ricinus communis]
Length=547

 Score =   240 bits (613),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAAENV+SILDVETQ CR  L+GH  PIHSVCWDPSGE+LASVS+D VRVWT+GS
Sbjct  405  GRILAAAAENVISILDVETQQCRLKLQGHRNPIHSVCWDPSGEYLASVSDDLVRVWTVGS  464

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G++G C+HELS  GNKFH+CVFHP++SSLL+IGCY++LELWNM E KTMTLPAH+ L+ +
Sbjct  465  GSKGECMHELSCTGNKFHTCVFHPTFSSLLIIGCYETLELWNMAEKKTMTLPAHDKLVSA  524

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V GLVASASHDK+IKLWK
Sbjct  525  LAVSNVTGLVASASHDKLIKLWK  547



>ref|XP_007137063.1| hypothetical protein PHAVU_009G096600g [Phaseolus vulgaris]
 gb|ESW09057.1| hypothetical protein PHAVU_009G096600g [Phaseolus vulgaris]
Length=991

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAEN+VSI DVETQ CR +LKGHTK +  VCWDPSGE LASVSEDSV+VW+LGS
Sbjct  849  GRYLAAAAENIVSIFDVETQACRFSLKGHTKTVDCVCWDPSGELLASVSEDSVKVWSLGS  908

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NG+KFH+CVFHP+Y SLL IGCYQSLELWNM+ENKTMTL AH+GLI +
Sbjct  909  GSEGECVHELSCNGSKFHACVFHPTYPSLLAIGCYQSLELWNMSENKTMTLSAHDGLITA  968

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GLVASASHDK +KLWK
Sbjct  969  LAVSTVNGLVASASHDKFLKLWK  991



>ref|XP_010049007.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010049008.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Eucalyptus grandis]
Length=325

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G YLAAAA+NV+SILDVETQ CRQTL+GHTK I SVCWD +G+ +ASVSEDSVRVW +GS
Sbjct  183  GMYLAAAADNVLSILDVETQACRQTLQGHTKAIDSVCWDSTGDLVASVSEDSVRVWAVGS  242

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+E +CVHELS NGNK HSCVFHP+Y SLLVIGC+Q+LELWNM ENKTM LPAH+GLI +
Sbjct  243  GSEWDCVHELSCNGNKAHSCVFHPTYPSLLVIGCHQTLELWNMAENKTMALPAHDGLISA  302

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V GLVASASHDK +KLWK
Sbjct  303  LAVSNVTGLVASASHDKTVKLWK  325



>gb|KFK29866.1| hypothetical protein AALP_AA7G189300 [Arabis alpina]
Length=388

 Score =   236 bits (601),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAA++ NVVSILDVETQ CR +L+GH+ PI+SVCWDPSG+ LASVS+D V+VWTLG+
Sbjct  246  GKYLAASSANVVSILDVETQACRYSLQGHSTPINSVCWDPSGDFLASVSKDKVKVWTLGT  305

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NG+ F SCVFHP+Y SLLVIGCYQSLELWNM E+KTMTLPAHE LI S
Sbjct  306  GSEGECVHELSFNGSNFLSCVFHPAYPSLLVIGCYQSLELWNMLEHKTMTLPAHEALIAS  365

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHD+++KLWK
Sbjct  366  LAVSTATGLVASASHDQLVKLWK  388



>ref|XP_010915804.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Elaeis 
guineensis]
Length=895

 Score =   246 bits (627),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAA+N +SILDVETQ CR  LKGH K + SVCW+PSGE LASVSEDSV+VW+LGS
Sbjct  753  GRYLAAAADNAISILDVETQVCRNLLKGHRKHVDSVCWNPSGELLASVSEDSVKVWSLGS  812

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHE+S NG+KFHSCVFHP+Y SLLVIGCYQSLELW+M ENKTMTLPAH+GLI +
Sbjct  813  GSEGECVHEMSCNGSKFHSCVFHPAYPSLLVIGCYQSLELWDMPENKTMTLPAHDGLIAA  872

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V GLVASASHDK +KLWK
Sbjct  873  LAVSNVTGLVASASHDKFVKLWK  895



>ref|XP_010915881.1| PREDICTED: transcriptional corepressor LEUNIG isoform X4 [Elaeis 
guineensis]
Length=891

 Score =   245 bits (626),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAA+N +SILDVETQ CR  LKGH K + SVCW+PSGE LASVSEDSV+VW+LGS
Sbjct  749  GRYLAAAADNAISILDVETQVCRNLLKGHRKHVDSVCWNPSGELLASVSEDSVKVWSLGS  808

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHE+S NG+KFHSCVFHP+Y SLLVIGCYQSLELW+M ENKTMTLPAH+GLI +
Sbjct  809  GSEGECVHEMSCNGSKFHSCVFHPAYPSLLVIGCYQSLELWDMPENKTMTLPAHDGLIAA  868

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V GLVASASHDK +KLWK
Sbjct  869  LAVSNVTGLVASASHDKFVKLWK  891



>gb|KJB83303.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
 gb|KJB83311.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=942

 Score =   246 bits (627),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 128/144 (89%), Gaps = 1/144 (1%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLK-GHTKPIHSVCWDPSGEHLASVSEDSVRVWTLG  481
            G+YLAAAAENVVSILD ETQTCR +L+ GHTK IHSVCWDPSGE LASVSEDSVRVW+  
Sbjct  799  GKYLAAAAENVVSILDTETQTCRHSLQQGHTKLIHSVCWDPSGELLASVSEDSVRVWSFA  858

Query  480  SGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIX  301
            SG+EG CVHELS NGNKFHSCVFHPS+ SLLVIGCYQSLELWNM+ENKTMTL AHEGLI 
Sbjct  859  SGSEGECVHELSCNGNKFHSCVFHPSFQSLLVIGCYQSLELWNMSENKTMTLSAHEGLIA  918

Query  300  SLAVSTVAGLVASASHDKIIKLWK  229
            +LAVS V  LV+SASHDK +KLWK
Sbjct  919  ALAVSPVTRLVSSASHDKFVKLWK  942



>ref|XP_010915729.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Elaeis 
guineensis]
Length=901

 Score =   245 bits (626),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAA+N +SILDVETQ CR  LKGH K + SVCW+PSGE LASVSEDSV+VW+LGS
Sbjct  759  GRYLAAAADNAISILDVETQVCRNLLKGHRKHVDSVCWNPSGELLASVSEDSVKVWSLGS  818

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHE+S NG+KFHSCVFHP+Y SLLVIGCYQSLELW+M ENKTMTLPAH+GLI +
Sbjct  819  GSEGECVHEMSCNGSKFHSCVFHPAYPSLLVIGCYQSLELWDMPENKTMTLPAHDGLIAA  878

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V GLVASASHDK +KLWK
Sbjct  879  LAVSNVTGLVASASHDKFVKLWK  901



>gb|KJB83301.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
 gb|KJB83308.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=937

 Score =   246 bits (627),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 128/144 (89%), Gaps = 1/144 (1%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLK-GHTKPIHSVCWDPSGEHLASVSEDSVRVWTLG  481
            G+YLAAAAENVVSILD ETQTCR +L+ GHTK IHSVCWDPSGE LASVSEDSVRVW+  
Sbjct  794  GKYLAAAAENVVSILDTETQTCRHSLQQGHTKLIHSVCWDPSGELLASVSEDSVRVWSFA  853

Query  480  SGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIX  301
            SG+EG CVHELS NGNKFHSCVFHPS+ SLLVIGCYQSLELWNM+ENKTMTL AHEGLI 
Sbjct  854  SGSEGECVHELSCNGNKFHSCVFHPSFQSLLVIGCYQSLELWNMSENKTMTLSAHEGLIA  913

Query  300  SLAVSTVAGLVASASHDKIIKLWK  229
            +LAVS V  LV+SASHDK +KLWK
Sbjct  914  ALAVSPVTRLVSSASHDKFVKLWK  937



>ref|XP_010915657.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Elaeis 
guineensis]
Length=904

 Score =   245 bits (626),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAA+N +SILDVETQ CR  LKGH K + SVCW+PSGE LASVSEDSV+VW+LGS
Sbjct  762  GRYLAAAADNAISILDVETQVCRNLLKGHRKHVDSVCWNPSGELLASVSEDSVKVWSLGS  821

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHE+S NG+KFHSCVFHP+Y SLLVIGCYQSLELW+M ENKTMTLPAH+GLI +
Sbjct  822  GSEGECVHEMSCNGSKFHSCVFHPAYPSLLVIGCYQSLELWDMPENKTMTLPAHDGLIAA  881

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V GLVASASHDK +KLWK
Sbjct  882  LAVSNVTGLVASASHDKFVKLWK  904



>gb|AAG32022.1|AF277458_1 LEUNIG [Arabidopsis thaliana]
Length=931

 Score =   245 bits (626),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAA++ N+V++LDVETQ  R +L+GH  PI+SVCWDPSG+ LASVSED V+VWTLG+
Sbjct  789  GKYLAASSANLVNVLDVETQAIRHSLQGHANPINSVCWDPSGDFLASVSEDMVKVWTLGT  848

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM+ENKTMTLPAHEGLI S
Sbjct  849  GSEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSLELWNMSENKTMTLPAHEGLITS  908

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK++KLWK
Sbjct  909  LAVSTATGLVASASHDKLVKLWK  931



>ref|XP_002869264.1| hypothetical protein ARALYDRAFT_491464 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45523.1| hypothetical protein ARALYDRAFT_491464 [Arabidopsis lyrata subsp. 
lyrata]
Length=920

 Score =   245 bits (625),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAA++ N+V++LDVETQ  R +L+GH  PI+SVCWDPSG+ LASVSED V+VWTLG+
Sbjct  778  GKYLAASSANLVNVLDVETQAIRHSLQGHANPINSVCWDPSGDFLASVSEDMVKVWTLGT  837

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM+ENKTMTLPAHEGLI S
Sbjct  838  GSEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSLELWNMSENKTMTLPAHEGLITS  897

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK++KLWK
Sbjct  898  LAVSTATGLVASASHDKLVKLWK  920



>gb|KJB83305.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
 gb|KJB83306.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=951

 Score =   245 bits (626),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 128/144 (89%), Gaps = 1/144 (1%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLK-GHTKPIHSVCWDPSGEHLASVSEDSVRVWTLG  481
            G+YLAAAAENVVSILD ETQTCR +L+ GHTK IHSVCWDPSGE LASVSEDSVRVW+  
Sbjct  808  GKYLAAAAENVVSILDTETQTCRHSLQQGHTKLIHSVCWDPSGELLASVSEDSVRVWSFA  867

Query  480  SGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIX  301
            SG+EG CVHELS NGNKFHSCVFHPS+ SLLVIGCYQSLELWNM+ENKTMTL AHEGLI 
Sbjct  868  SGSEGECVHELSCNGNKFHSCVFHPSFQSLLVIGCYQSLELWNMSENKTMTLSAHEGLIA  927

Query  300  SLAVSTVAGLVASASHDKIIKLWK  229
            +LAVS V  LV+SASHDK +KLWK
Sbjct  928  ALAVSPVTRLVSSASHDKFVKLWK  951



>ref|XP_010432701.1| PREDICTED: transcriptional corepressor LEUNIG-like [Camelina 
sativa]
Length=941

 Score =   245 bits (625),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAA++ N+V++LDVETQ  R +L+GH  PI+SVCWDPSG+ LASVSED V+VWTLG+
Sbjct  799  GKYLAASSANLVNVLDVETQAIRHSLQGHANPINSVCWDPSGDFLASVSEDMVKVWTLGT  858

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM+ENKTMTLPAHEGLI S
Sbjct  859  GSEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSLELWNMSENKTMTLPAHEGLIAS  918

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK++KLWK
Sbjct  919  LAVSTATGLVASASHDKLVKLWK  941



>ref|XP_010447372.1| PREDICTED: transcriptional corepressor LEUNIG [Camelina sativa]
Length=925

 Score =   245 bits (625),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAA++ N+V++LDVETQ  R +L+GH  PI+SVCWDPSG+ LASVSED V+VWTLG+
Sbjct  783  GKYLAASSANLVNVLDVETQAIRHSLQGHANPINSVCWDPSGDFLASVSEDMVKVWTLGT  842

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM+ENKTMTLPAHEGLI S
Sbjct  843  GSEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSLELWNMSENKTMTLPAHEGLIAS  902

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK++KLWK
Sbjct  903  LAVSTATGLVASASHDKLVKLWK  925



>ref|NP_567896.1| transcriptional corepressor LEUNIG [Arabidopsis thaliana]
 sp|Q9FUY2.2|LEUNG_ARATH RecName: Full=Transcriptional corepressor LEUNIG [Arabidopsis 
thaliana]
 gb|AEE86076.1| transcriptional corepressor LEUNIG [Arabidopsis thaliana]
Length=931

 Score =   245 bits (625),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAA++ N+V++LDVETQ  R +L+GH  PI+SVCWDPSG+ LASVSED V+VWTLG+
Sbjct  789  GKYLAASSANLVNVLDVETQAIRHSLQGHANPINSVCWDPSGDFLASVSEDMVKVWTLGT  848

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM+ENKTMTLPAHEGLI S
Sbjct  849  GSEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSLELWNMSENKTMTLPAHEGLITS  908

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK++KLWK
Sbjct  909  LAVSTATGLVASASHDKLVKLWK  931



>emb|CAB43692.1| putative protein [Arabidopsis thaliana]
 emb|CAB79972.1| putative protein [Arabidopsis thaliana]
Length=930

 Score =   245 bits (625),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAA++ N+V++LDVETQ  R +L+GH  PI+SVCWDPSG+ LASVSED V+VWTLG+
Sbjct  788  GKYLAASSANLVNVLDVETQAIRHSLQGHANPINSVCWDPSGDFLASVSEDMVKVWTLGT  847

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM+ENKTMTLPAHEGLI S
Sbjct  848  GSEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSLELWNMSENKTMTLPAHEGLITS  907

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK++KLWK
Sbjct  908  LAVSTATGLVASASHDKLVKLWK  930



>gb|KEH35932.1| transcriptional corepressor leunig-like protein [Medicago truncatula]
Length=904

 Score =   244 bits (624),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 126/143 (88%), Gaps = 4/143 (3%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAEN+VSILDVETQ CR +LKGHTK I SVCWDPSGE LASVSEDSVR+WTL  
Sbjct  766  GRYLAAAAENIVSILDVETQACRYSLKGHTKTIDSVCWDPSGELLASVSEDSVRIWTL--  823

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
              EG CVHELS NG+KFHSCVFHP++ SLLVIGCYQSLELWNM ENKTMTL AH+GLI +
Sbjct  824  --EGECVHELSCNGSKFHSCVFHPTFPSLLVIGCYQSLELWNMAENKTMTLSAHDGLITA  881

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GLVASASHDK IKLWK
Sbjct  882  LAVSTVNGLVASASHDKFIKLWK  904



>ref|NP_001190891.1| transcriptional corepressor LEUNIG [Arabidopsis thaliana]
 gb|AEE86077.1| transcriptional corepressor LEUNIG [Arabidopsis thaliana]
Length=969

 Score =   245 bits (625),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAA++ N+V++LDVETQ  R +L+GH  PI+SVCWDPSG+ LASVSED V+VWTLG+
Sbjct  827  GKYLAASSANLVNVLDVETQAIRHSLQGHANPINSVCWDPSGDFLASVSEDMVKVWTLGT  886

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM+ENKTMTLPAHEGLI S
Sbjct  887  GSEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSLELWNMSENKTMTLPAHEGLITS  946

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK++KLWK
Sbjct  947  LAVSTATGLVASASHDKLVKLWK  969



>gb|AES73711.2| transcriptional corepressor leunig-like protein [Medicago truncatula]
Length=897

 Score =   244 bits (623),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 126/143 (88%), Gaps = 4/143 (3%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAEN+VSILDVETQ CR +LKGHTK I SVCWDPSGE LASVSEDSVR+WTL  
Sbjct  759  GRYLAAAAENIVSILDVETQACRYSLKGHTKTIDSVCWDPSGELLASVSEDSVRIWTL--  816

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
              EG CVHELS NG+KFHSCVFHP++ SLLVIGCYQSLELWNM ENKTMTL AH+GLI +
Sbjct  817  --EGECVHELSCNGSKFHSCVFHPTFPSLLVIGCYQSLELWNMAENKTMTLSAHDGLITA  874

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GLVASASHDK IKLWK
Sbjct  875  LAVSTVNGLVASASHDKFIKLWK  897



>ref|XP_003603460.1| NAD(P)H-quinone oxidoreductase subunit [Medicago truncatula]
Length=941

 Score =   244 bits (622),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 126/143 (88%), Gaps = 4/143 (3%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAEN+VSILDVETQ CR +LKGHTK I SVCWDPSGE LASVSEDSVR+WTL  
Sbjct  803  GRYLAAAAENIVSILDVETQACRYSLKGHTKTIDSVCWDPSGELLASVSEDSVRIWTL--  860

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
              EG CVHELS NG+KFHSCVFHP++ SLLVIGCYQSLELWNM ENKTMTL AH+GLI +
Sbjct  861  --EGECVHELSCNGSKFHSCVFHPTFPSLLVIGCYQSLELWNMAENKTMTLSAHDGLITA  918

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GLVASASHDK IKLWK
Sbjct  919  LAVSTVNGLVASASHDKFIKLWK  941



>ref|XP_008811606.1| PREDICTED: LOW QUALITY PROTEIN: transcriptional corepressor LEUNIG 
[Phoenix dactylifera]
Length=911

 Score =   243 bits (620),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAA+N +SILDVETQ CRQ L+GH K + SVCW+PSGE LASVSEDSVRVW+LGS
Sbjct  769  GRYLAAAADNTISILDVETQACRQMLQGHRKHVDSVCWNPSGELLASVSEDSVRVWSLGS  828

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NG+KFHSCVFHP+Y SLLVIGCYQSLELW+M EN T+TL AHEGLI +
Sbjct  829  GSEGECVHELSCNGSKFHSCVFHPTYPSLLVIGCYQSLELWDMAENNTITLGAHEGLIAA  888

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V GLVASASHDK IKLWK
Sbjct  889  LAVSNVTGLVASASHDKFIKLWK  911



>emb|CDX68860.1| BnaC01g05930D [Brassica napus]
Length=908

 Score =   243 bits (619),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAA++ NVVS+LDVETQ CR +L+GHT  I+SVCWD SG+ LA+VSED V+VWT G+
Sbjct  766  GKYLAASSANVVSVLDVETQACRHSLQGHTNQINSVCWDASGDFLATVSEDMVKVWTFGT  825

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GNEG CVHELS NGNKF SCVFHP+Y SLLV+GCYQSLELWNM++NKTMTLPAH+GLI S
Sbjct  826  GNEGECVHELSCNGNKFQSCVFHPTYPSLLVVGCYQSLELWNMSQNKTMTLPAHDGLITS  885

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK++KLWK
Sbjct  886  LAVSTATGLVASASHDKLVKLWK  908



>ref|XP_009125860.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Brassica 
rapa]
Length=925

 Score =   242 bits (618),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAA++ NVVS+LDVETQ CR +L+GHT  I+SVCWD SG+ LA+VSED V+VWT G+
Sbjct  783  GKYLAASSANVVSVLDVETQACRHSLQGHTNQINSVCWDASGDFLATVSEDMVKVWTFGT  842

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GNEG CVHELS NGNKF SCVFHP+Y SLLV+GCYQSLELWNM++NKTMTLPAH+GLI S
Sbjct  843  GNEGECVHELSCNGNKFQSCVFHPTYPSLLVVGCYQSLELWNMSQNKTMTLPAHDGLIAS  902

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK++KLWK
Sbjct  903  LAVSTATGLVASASHDKLVKLWK  925



>ref|XP_009125852.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Brassica 
rapa]
Length=926

 Score =   242 bits (618),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAA++ NVVS+LDVETQ CR +L+GHT  I+SVCWD SG+ LA+VSED V+VWT G+
Sbjct  784  GKYLAASSANVVSVLDVETQACRHSLQGHTNQINSVCWDASGDFLATVSEDMVKVWTFGT  843

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GNEG CVHELS NGNKF SCVFHP+Y SLLV+GCYQSLELWNM++NKTMTLPAH+GLI S
Sbjct  844  GNEGECVHELSCNGNKFQSCVFHPTYPSLLVVGCYQSLELWNMSQNKTMTLPAHDGLIAS  903

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK++KLWK
Sbjct  904  LAVSTATGLVASASHDKLVKLWK  926



>ref|XP_009125844.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Brassica 
rapa]
Length=933

 Score =   242 bits (618),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAA++ NVVS+LDVETQ CR +L+GHT  I+SVCWD SG+ LA+VSED V+VWT G+
Sbjct  791  GKYLAASSANVVSVLDVETQACRHSLQGHTNQINSVCWDASGDFLATVSEDMVKVWTFGT  850

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GNEG CVHELS NGNKF SCVFHP+Y SLLV+GCYQSLELWNM++NKTMTLPAH+GLI S
Sbjct  851  GNEGECVHELSCNGNKFQSCVFHPTYPSLLVVGCYQSLELWNMSQNKTMTLPAHDGLIAS  910

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST  GLVASASHDK++KLWK
Sbjct  911  LAVSTATGLVASASHDKLVKLWK  933



>gb|KCW81465.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
 gb|KCW81466.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
 gb|KCW81472.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
 gb|KCW81473.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
 gb|KCW81474.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
 gb|KCW81475.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
Length=899

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAA+NV+SILDVETQ CRQTL+GHTK I SVCWD +G+ +ASVSEDSVRVW +GS
Sbjct  757  GRYLAAAADNVLSILDVETQACRQTLQGHTKAIDSVCWDSTGDLVASVSEDSVRVWAVGS  816

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+E +CVHELS NGNK HSCVFHP+Y SLLVIGCYQ+LELWNM ENKTM LPAH+GLI +
Sbjct  817  GSEWDCVHELSCNGNKAHSCVFHPTYPSLLVIGCYQTLELWNMAENKTMALPAHDGLISA  876

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V GLVASASHDK +KLWK
Sbjct  877  LAVSNVTGLVASASHDKTVKLWK  899



>ref|XP_010049005.1| PREDICTED: transcriptional corepressor LEUNIG [Eucalyptus grandis]
 ref|XP_010049006.1| PREDICTED: transcriptional corepressor LEUNIG [Eucalyptus grandis]
Length=910

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAA+NV+SILDVETQ CRQTL+GHTK I SVCWD +G+ +ASVSEDSVRVW +GS
Sbjct  768  GRYLAAAADNVLSILDVETQACRQTLQGHTKAIDSVCWDSTGDLVASVSEDSVRVWAVGS  827

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+E +CVHELS NGNK HSCVFHP+Y SLLVIGCYQ+LELWNM ENKTM LPAH+GLI +
Sbjct  828  GSEWDCVHELSCNGNKAHSCVFHPTYPSLLVIGCYQTLELWNMAENKTMALPAHDGLISA  887

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V GLVASASHDK +KLWK
Sbjct  888  LAVSNVTGLVASASHDKTVKLWK  910



>emb|CDX75254.1| BnaA01g04480D [Brassica napus]
Length=1117

 Score =   242 bits (617),  Expect = 4e-70, Method: Composition-based stats.
 Identities = 109/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  657   GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
             G+YLAA++ NVVS+LDVETQ CR +L+GHT  I+SVCWD SG+ LA+VSED V+VWT G+
Sbjct  975   GKYLAASSANVVSVLDVETQACRHSLQGHTNQINSVCWDASGDFLATVSEDMVKVWTFGT  1034

Query  477   GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
             GNEG CVHELS NGNKF SCVFHP+Y SLLV+GCYQSLELWNM++NKTMTLPAH+GLI S
Sbjct  1035  GNEGECVHELSCNGNKFQSCVFHPTYPSLLVVGCYQSLELWNMSQNKTMTLPAHDGLIAS  1094

Query  297   LAVSTVAGLVASASHDKIIKLWK  229
             LAVST  GLVASASHDK++KLWK
Sbjct  1095  LAVSTATGLVASASHDKLVKLWK  1117



>ref|XP_009407640.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Musa acuminata subsp. malaccensis]
Length=761

 Score =   239 bits (610),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAAENVVSILDVETQ C   L+GH K + SVCWDPSGE + SVSEDSVRVW+LGS
Sbjct  619  GRCLAAAAENVVSILDVETQACLHQLQGHAKHVDSVCWDPSGELVVSVSEDSVRVWSLGS  678

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+E +CVHELS NGNKFHSC FHP+Y SLLVIGCYQSLELW+M E+KTMTLPAHEGLI +
Sbjct  679  GSEADCVHELSCNGNKFHSCAFHPTYPSLLVIGCYQSLELWDMNESKTMTLPAHEGLIAA  738

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V GLVASASHDK +KLWK
Sbjct  739  LAVSNVNGLVASASHDKFVKLWK  761



>ref|XP_002969651.1| hypothetical protein SELMODRAFT_410492 [Selaginella moellendorffii]
 gb|EFJ29739.1| hypothetical protein SELMODRAFT_410492 [Selaginella moellendorffii]
Length=835

 Score =   239 bits (611),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAAENVVSI DV+ +TCR +L+ HTKP+HSVCWD +G++LASVSEDSVRVWTL S
Sbjct  693  GRLLAAAAENVVSIFDVDAETCRHSLQRHTKPVHSVCWDQNGDYLASVSEDSVRVWTLRS  752

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G +G CVHEL SNGNKFHSCVFHPSY SLL+IGCY+SLELWNM ENK+MT+PAH+GLI +
Sbjct  753  GGDGECVHELCSNGNKFHSCVFHPSYPSLLIIGCYESLELWNMVENKSMTIPAHQGLIAA  812

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S   G+VASASHDK +KLW+
Sbjct  813  LAQSPATGMVASASHDKCVKLWR  835



>ref|XP_002970913.1| hypothetical protein SELMODRAFT_94317 [Selaginella moellendorffii]
 gb|EFJ28239.1| hypothetical protein SELMODRAFT_94317 [Selaginella moellendorffii]
Length=860

 Score =   239 bits (611),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAAENVVSI DV+ +TCR +L+ HTKP+HSVCWD +G++LASVSEDSVRVWTL S
Sbjct  718  GRLLAAAAENVVSIFDVDAETCRHSLQRHTKPVHSVCWDQNGDYLASVSEDSVRVWTLRS  777

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G +G CVHEL SNGNKFHSCVFHPSY SLL+IGCY+SLELWNM ENK+MT+PAH+GLI +
Sbjct  778  GGDGECVHELCSNGNKFHSCVFHPSYPSLLIIGCYESLELWNMVENKSMTIPAHQGLIAA  837

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S   G+VASASHDK +KLW+
Sbjct  838  LAQSPATGMVASASHDKCVKLWR  860



>gb|KCW81467.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
 gb|KCW81468.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
Length=899

 Score =   239 bits (610),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAA+NV+SILDVETQ CRQTL+GHTK I SVCWD +G+ +ASVSEDSVRVW +GS
Sbjct  757  GRYLAAAADNVLSILDVETQACRQTLQGHTKAIDSVCWDSTGDLVASVSEDSVRVWAVGS  816

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+E +CVHELS NGNK HSCVFHP+Y SLLVIGC+Q+LELWNM ENKTM LPAH+GLI +
Sbjct  817  GSEWDCVHELSCNGNKAHSCVFHPTYPSLLVIGCHQTLELWNMAENKTMALPAHDGLISA  876

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V GLVASASHDK +KLWK
Sbjct  877  LAVSNVTGLVASASHDKTVKLWK  899



>gb|KJB64525.1| hypothetical protein B456_010G053000 [Gossypium raimondii]
Length=943

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLA AAENVVSILD ETQTCR +L+GHTK IHSVCWD SGE LASVSEDSVRVW+  S
Sbjct  797  GKYLALAAENVVSILDAETQTCRHSLQGHTKLIHSVCWDLSGELLASVSEDSVRVWSFRS  856

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP+  SLLVIGCYQSLELWNMTE KT TL AHEGLI +
Sbjct  857  GSEGECVHELSCNGNKFHSCVFHPTSPSLLVIGCYQSLELWNMTEGKTKTLSAHEGLIAA  916

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V GLV+SASHDK IKLWK
Sbjct  917  LAVSPVTGLVSSASHDKFIKLWK  939



>gb|KJB64523.1| hypothetical protein B456_010G053000 [Gossypium raimondii]
Length=942

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLA AAENVVSILD ETQTCR +L+GHTK IHSVCWD SGE LASVSEDSVRVW+  S
Sbjct  796  GKYLALAAENVVSILDAETQTCRHSLQGHTKLIHSVCWDLSGELLASVSEDSVRVWSFRS  855

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP+  SLLVIGCYQSLELWNMTE KT TL AHEGLI +
Sbjct  856  GSEGECVHELSCNGNKFHSCVFHPTSPSLLVIGCYQSLELWNMTEGKTKTLSAHEGLIAA  915

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V GLV+SASHDK IKLWK
Sbjct  916  LAVSPVTGLVSSASHDKFIKLWK  938



>gb|KJB64522.1| hypothetical protein B456_010G053000 [Gossypium raimondii]
Length=933

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLA AAENVVSILD ETQTCR +L+GHTK IHSVCWD SGE LASVSEDSVRVW+  S
Sbjct  787  GKYLALAAENVVSILDAETQTCRHSLQGHTKLIHSVCWDLSGELLASVSEDSVRVWSFRS  846

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP+  SLLVIGCYQSLELWNMTE KT TL AHEGLI +
Sbjct  847  GSEGECVHELSCNGNKFHSCVFHPTSPSLLVIGCYQSLELWNMTEGKTKTLSAHEGLIAA  906

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V GLV+SASHDK IKLWK
Sbjct  907  LAVSPVTGLVSSASHDKFIKLWK  929



>ref|XP_009407638.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=889

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAAENVVSILDVETQ C   L+GH K + SVCWDPSGE + SVSEDSVRVW+LGS
Sbjct  747  GRCLAAAAENVVSILDVETQACLHQLQGHAKHVDSVCWDPSGELVVSVSEDSVRVWSLGS  806

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+E +CVHELS NGNKFHSC FHP+Y SLLVIGCYQSLELW+M E+KTMTLPAHEGLI +
Sbjct  807  GSEADCVHELSCNGNKFHSCAFHPTYPSLLVIGCYQSLELWDMNESKTMTLPAHEGLIAA  866

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V GLVASASHDK +KLWK
Sbjct  867  LAVSNVNGLVASASHDKFVKLWK  889



>ref|XP_009407639.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=888

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAAENVVSILDVETQ C   L+GH K + SVCWDPSGE + SVSEDSVRVW+LGS
Sbjct  746  GRCLAAAAENVVSILDVETQACLHQLQGHAKHVDSVCWDPSGELVVSVSEDSVRVWSLGS  805

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+E +CVHELS NGNKFHSC FHP+Y SLLVIGCYQSLELW+M E+KTMTLPAHEGLI +
Sbjct  806  GSEADCVHELSCNGNKFHSCAFHPTYPSLLVIGCYQSLELWDMNESKTMTLPAHEGLIAA  865

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V GLVASASHDK +KLWK
Sbjct  866  LAVSNVNGLVASASHDKFVKLWK  888



>ref|XP_008445143.1| PREDICTED: LOW QUALITY PROTEIN: transcriptional corepressor LEUNIG 
[Cucumis melo]
Length=899

 Score =   238 bits (608),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRY AA  +N+VSI DVETQ    +L+GHTK + S+CWDPSGE LASVSEDSVRVWTL S
Sbjct  757  GRYFAAVVDNIVSIFDVETQARLHSLRGHTKTVQSLCWDPSGEFLASVSEDSVRVWTLAS  816

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GNEG  +HELS NGNKFHSCVFHP+YS+LLVIGCY+SLELWN TENKTMTL AHEGL+ S
Sbjct  817  GNEGESIHELSCNGNKFHSCVFHPTYSTLLVIGCYESLELWNTTENKTMTLSAHEGLVSS  876

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVST +GLVASASHD+ IKLWK
Sbjct  877  LAVSTASGLVASASHDRFIKLWK  899



>ref|XP_010925121.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Elaeis guineensis]
Length=868

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAA+N +S++DVET+ CRQTLKGH   + S+CW+PSG+ LASVSEDSVRVW+ GS
Sbjct  726  GRYLAAAADNNISMIDVETRVCRQTLKGHRNHVDSLCWNPSGDLLASVSEDSVRVWSFGS  785

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP++ SLLVIGCYQSLELW+M E+KTMTLPAHEGLI +
Sbjct  786  GSEGECVHELSCNGNKFHSCVFHPTHPSLLVIGCYQSLELWDMPESKTMTLPAHEGLIAA  845

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V G VASASHDK IKLWK
Sbjct  846  LAVSNVTGSVASASHDKFIKLWK  868



>ref|XP_010925120.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Elaeis guineensis]
Length=877

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAA+N +S++DVET+ CRQTLKGH   + S+CW+PSG+ LASVSEDSVRVW+ GS
Sbjct  735  GRYLAAAADNNISMIDVETRVCRQTLKGHRNHVDSLCWNPSGDLLASVSEDSVRVWSFGS  794

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP++ SLLVIGCYQSLELW+M E+KTMTLPAHEGLI +
Sbjct  795  GSEGECVHELSCNGNKFHSCVFHPTHPSLLVIGCYQSLELWDMPESKTMTLPAHEGLIAA  854

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V G VASASHDK IKLWK
Sbjct  855  LAVSNVTGSVASASHDKFIKLWK  877



>gb|KCW81469.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
 gb|KCW81470.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
Length=899

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G YLAAAA+NV+SILDVETQ CRQTL+GHTK I SVCWD +G+ +ASVSEDSVRVW +GS
Sbjct  757  GMYLAAAADNVLSILDVETQACRQTLQGHTKAIDSVCWDSTGDLVASVSEDSVRVWAVGS  816

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+E +CVHELS NGNK HSCVFHP+Y SLLVIGC+Q+LELWNM ENKTM LPAH+GLI +
Sbjct  817  GSEWDCVHELSCNGNKAHSCVFHPTYPSLLVIGCHQTLELWNMAENKTMALPAHDGLISA  876

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V GLVASASHDK +KLWK
Sbjct  877  LAVSNVTGLVASASHDKTVKLWK  899



>gb|KCW81471.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
Length=899

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G YLAAAA+NV+SILDVETQ CRQTL+GHTK I SVCWD +G+ +ASVSEDSVRVW +GS
Sbjct  757  GMYLAAAADNVLSILDVETQACRQTLQGHTKAIDSVCWDSTGDLVASVSEDSVRVWAVGS  816

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+E +CVHELS NGNK HSCVFHP+Y SLLVIGC+Q+LELWNM ENKTM LPAH+GLI +
Sbjct  817  GSEWDCVHELSCNGNKAHSCVFHPTYPSLLVIGCHQTLELWNMAENKTMALPAHDGLISA  876

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V GLVASASHDK +KLWK
Sbjct  877  LAVSNVTGLVASASHDKTVKLWK  899



>gb|KGN62903.1| hypothetical protein Csa_2G379340 [Cucumis sativus]
Length=838

 Score =   234 bits (597),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRY +A  +N+V+I DVETQ    +L+GHTK + S+CWDPSGE LASVSEDSVRVWTL S
Sbjct  696  GRYFSAVVDNIVTIFDVETQARVHSLRGHTKTVQSLCWDPSGEFLASVSEDSVRVWTLAS  755

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GNEG  +HELS NGNKFHSCVFHP+YS+LLVIGCY+SLELWN TENKTMTL AHEGL+ S
Sbjct  756  GNEGESIHELSCNGNKFHSCVFHPTYSTLLVIGCYESLELWNTTENKTMTLSAHEGLVSS  815

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS  +GLVASASHD+ IKLWK
Sbjct  816  LAVSAASGLVASASHDRFIKLWK  838



>gb|KHN08101.1| Transcriptional corepressor LEUNIG [Glycine soja]
Length=901

 Score =   234 bits (597),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 123/143 (86%), Gaps = 6/143 (4%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAEN+VSI DVETQ CR +LKGHTKP+  VCWDPSGE LASVSEDSVRVWTLGS
Sbjct  765  GRYLAAAAENIVSIFDVETQACRYSLKGHTKPVDCVCWDPSGELLASVSEDSVRVWTLGS  824

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFH+ VFHP+Y SLL      SLELWNM+ENKTMTL AH+GLI S
Sbjct  825  GSEGECVHELSCNGNKFHASVFHPTYPSLL------SLELWNMSENKTMTLSAHDGLITS  878

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GLVASASHDK +KLWK
Sbjct  879  LAVSTVNGLVASASHDKFLKLWK  901



>ref|XP_004138746.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform 2 
[Cucumis sativus]
Length=891

 Score =   234 bits (597),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRY +A  +N+V+I DVETQ    +L+GHTK + S+CWDPSGE LASVSEDSVRVWTL S
Sbjct  749  GRYFSAVVDNIVTIFDVETQARVHSLRGHTKTVQSLCWDPSGEFLASVSEDSVRVWTLAS  808

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GNEG  +HELS NGNKFHSCVFHP+YS+LLVIGCY+SLELWN TENKTMTL AHEGL+ S
Sbjct  809  GNEGESIHELSCNGNKFHSCVFHPTYSTLLVIGCYESLELWNTTENKTMTLSAHEGLVSS  868

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS  +GLVASASHD+ IKLWK
Sbjct  869  LAVSAASGLVASASHDRFIKLWK  891



>ref|XP_004168288.1| PREDICTED: transcriptional corepressor LEUNIG-like [Cucumis sativus]
Length=900

 Score =   234 bits (597),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRY +A  +N+V+I DVETQ    +L+GHTK + S+CWDPSGE LASVSEDSVRVWTL S
Sbjct  758  GRYFSAVVDNIVTIFDVETQARVHSLRGHTKTVQSLCWDPSGEFLASVSEDSVRVWTLAS  817

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GNEG  +HELS NGNKFHSCVFHP+YS+LLVIGCY+SLELWN TENKTMTL AHEGL+ S
Sbjct  818  GNEGESIHELSCNGNKFHSCVFHPTYSTLLVIGCYESLELWNTTENKTMTLSAHEGLVSS  877

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS  +GLVASASHD+ IKLWK
Sbjct  878  LAVSAASGLVASASHDRFIKLWK  900



>ref|XP_004138745.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform 1 
[Cucumis sativus]
Length=900

 Score =   234 bits (597),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRY +A  +N+V+I DVETQ    +L+GHTK + S+CWDPSGE LASVSEDSVRVWTL S
Sbjct  758  GRYFSAVVDNIVTIFDVETQARVHSLRGHTKTVQSLCWDPSGEFLASVSEDSVRVWTLAS  817

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GNEG  +HELS NGNKFHSCVFHP+YS+LLVIGCY+SLELWN TENKTMTL AHEGL+ S
Sbjct  818  GNEGESIHELSCNGNKFHSCVFHPTYSTLLVIGCYESLELWNTTENKTMTLSAHEGLVSS  877

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS  +GLVASASHD+ IKLWK
Sbjct  878  LAVSAASGLVASASHDRFIKLWK  900



>ref|XP_002531278.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF31091.1| WD-repeat protein, putative [Ricinus communis]
Length=316

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRY+AAA ENVVS+LDVETQ C ++L+GH +PIH VCW+PSGE++ASVSED+VRVW LGS
Sbjct  174  GRYVAAAEENVVSVLDVETQACLRSLQGHYRPIHYVCWNPSGEYVASVSEDAVRVWALGS  233

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GN+G C+HELS    KFHSC+FHP+  SLL+IG YQSL +W+MTENKTM LPAHE +I S
Sbjct  234  GNDGECIHELSLKNTKFHSCIFHPTNPSLLIIGSYQSLVIWDMTENKTMVLPAHEAIIAS  293

Query  297  LAVSTVAGLVASASHDKIIKLW  232
            LAVST   L+ASASHDK++KLW
Sbjct  294  LAVSTATRLIASASHDKLVKLW  315



>gb|KDP32334.1| hypothetical protein JCGZ_13259 [Jatropha curcas]
Length=852

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAAEN++SILDVETQ CR  L+GH   IHSVCWDPSGE++ASVS+D VRVWT+GS
Sbjct  710  GRILAAAAENIISILDVETQVCRLKLQGHKNHIHSVCWDPSGEYVASVSDDLVRVWTVGS  769

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G++G  +HELS +GNKFH+CVFHP+YSSLL+IGCY++LELWN+ ENKTMTLPAH+ L+ +
Sbjct  770  GSKGEYIHELSCSGNKFHTCVFHPTYSSLLIIGCYETLELWNLAENKTMTLPAHDKLVSA  829

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V GLVASASHDK++K WK
Sbjct  830  LAVSNVTGLVASASHDKMVKFWK  852



>ref|XP_008394021.1| PREDICTED: transcriptional corepressor LEUNIG-like [Malus domestica]
Length=342

 Score =   221 bits (563),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LA AAENVV ILDVET+ CR +L+GHTKPIHSVCWDPSGE LASVS+DSVRVW LG+
Sbjct  192  GRFLATAAENVVHILDVETZACRHSLQGHTKPIHSVCWDPSGEFLASVSDDSVRVWALGA  251

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G EG CVHELS  GNKF SCVFH +Y+SLLVIGCYQ+LELWNMTENK MTLPAHEGLI S
Sbjct  252  GGEGECVHELSCXGNKFQSCVFHHTYTSLLVIGCYQTLELWNMTENKVMTLPAHEGLIAS  311

Query  297  LAVSTVAG  274
            LAVS V G
Sbjct  312  LAVSNVTG  319



>gb|EPS73524.1| hypothetical protein M569_01232, partial [Genlisea aurea]
Length=340

 Score =   221 bits (562),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LAAAAENVVSILD ET  C  +LK HTKPI S+CWD SGE LASVSEDSV+VWT  S
Sbjct  198  GRFLAAAAENVVSILDAETLNCLHSLKSHTKPIQSMCWDQSGELLASVSEDSVKVWTFRS  257

Query  477  G-NEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIX  301
            G +EG CVH+LS N +KFHSC FHP+YSS+L+IGCYQSLELWNM EN T++LPAH+GLI 
Sbjct  258  GASEGECVHQLSCNVSKFHSCAFHPTYSSVLIIGCYQSLELWNMNENATVSLPAHDGLIA  317

Query  300  SLAVSTVAGLVASASHDKIIKLW  232
            SLAVS  AGLVASA HDK++KLW
Sbjct  318  SLAVSPAAGLVASAGHDKVVKLW  340



>gb|KHN16498.1| Transcriptional corepressor LEUNIG [Glycine soja]
Length=886

 Score =   231 bits (589),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 122/143 (85%), Gaps = 6/143 (4%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAEN+VSI DVETQ CR +LKGHTKP+  VCWDPSGE LASVSEDSVRVWTLGS
Sbjct  750  GRYLAAAAENIVSIFDVETQVCRYSLKGHTKPVVCVCWDPSGELLASVSEDSVRVWTLGS  809

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G++G CVHELS NGNKFH  VFHP+Y SLL      SLELWNM+ENKTMTL AH+GLI S
Sbjct  810  GSDGECVHELSCNGNKFHKSVFHPTYPSLL------SLELWNMSENKTMTLSAHDGLITS  863

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GLVASASHDK +KLWK
Sbjct  864  LAVSTVNGLVASASHDKFLKLWK  886



>ref|XP_008390143.1| PREDICTED: transcriptional corepressor LEUNIG-like [Malus domestica]
Length=448

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAA+N VSILDVETQ CR  L+GH   +HSVCWDPSG++LASVS+D VRVWT+GS
Sbjct  306  GRNLAAAADNFVSILDVETQVCRLKLQGHKSAVHSVCWDPSGDYLASVSDDLVRVWTIGS  365

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
              +G  +HELS +GNKF++CVFHP+Y +LLVIGCY++LELWNMTENKTMTL AH+ L+ S
Sbjct  366  SCKGEFIHELSCSGNKFNTCVFHPTYPALLVIGCYETLELWNMTENKTMTLHAHDKLVSS  425

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS+  GLVASASHDK +KLWK
Sbjct  426  LAVSSATGLVASASHDKCVKLWK  448



>ref|XP_002962710.1| hypothetical protein SELMODRAFT_79275 [Selaginella moellendorffii]
 gb|EFJ36173.1| hypothetical protein SELMODRAFT_79275 [Selaginella moellendorffii]
Length=908

 Score =   226 bits (576),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAAENVVSI DV+T+TC  +L+ HTKP+HSVCWD +G+++ASVSEDSVRVW L +
Sbjct  767  GRLLAAAAENVVSIFDVDTETCVHSLQRHTKPVHSVCWDATGDYVASVSEDSVRVWAL-N  825

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G++G+C+HEL+ NGNKFHSCVFHP   +LLVIGCYQSLELWNM ENKTMT+PAH+GLI +
Sbjct  826  GSDGDCIHELNCNGNKFHSCVFHPKLPTLLVIGCYQSLELWNMQENKTMTIPAHDGLIAA  885

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S   G+VASASHDK ++LWK
Sbjct  886  LAQSPATGMVASASHDKCVRLWK  908



>ref|XP_002980381.1| hypothetical protein SELMODRAFT_112245 [Selaginella moellendorffii]
 gb|EFJ18641.1| hypothetical protein SELMODRAFT_112245 [Selaginella moellendorffii]
Length=913

 Score =   226 bits (575),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAAENVVSI DV+T+TC  +L+ HTKP+HSVCWD +G+++ASVSEDSVRVW L +
Sbjct  772  GRLLAAAAENVVSIFDVDTETCVHSLQRHTKPVHSVCWDATGDYVASVSEDSVRVWAL-N  830

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G++G+C+HEL+ NGNKFHSCVFHP   +LLVIGCYQSLELWNM ENKTMT+PAH+GLI +
Sbjct  831  GSDGDCIHELNCNGNKFHSCVFHPKLPTLLVIGCYQSLELWNMQENKTMTIPAHDGLIAA  890

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S   G+VASASHDK ++LWK
Sbjct  891  LAQSPATGMVASASHDKCVRLWK  913



>ref|XP_009405109.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=858

 Score =   225 bits (574),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRY+AAAAEN + +LDVETQ  R  L+GHTK + S+CW+PSG+ LASVSEDSVRVW+LGS
Sbjct  716  GRYIAAAAENAICVLDVETQVRRHLLQGHTKHVDSICWNPSGDILASVSEDSVRVWSLGS  775

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GN+  CVHELS  GNKFHSCVF P+Y SLLVIGCYQSLE+W+M ENKTM LPAH+GLI +
Sbjct  776  GNDSECVHELSCIGNKFHSCVFLPNYPSLLVIGCYQSLEIWDMKENKTMMLPAHDGLIAA  835

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS   G+VASASHDK +KLWK
Sbjct  836  LAVSNATGVVASASHDKCVKLWK  858



>gb|KDO80405.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=545

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAA EN +SILDVETQ CR  L+GH   +HSVCW+ SGE+LASVS++ VRVW++GS
Sbjct  403  GRILAAAIENYISILDVETQVCRLKLQGHKNQVHSVCWNTSGEYLASVSDELVRVWSIGS  462

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G++G C+HELS  GNKFHSCVFHP++ SLLVIGCY++LELWNMTENKT+TL AH+ L+ S
Sbjct  463  GSKGECIHELSCTGNKFHSCVFHPTFPSLLVIGCYETLELWNMTENKTLTLSAHDKLVSS  522

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA STV G+VASASHDK +K+WK
Sbjct  523  LAASTVNGMVASASHDKCVKIWK  545



>ref|XP_009405103.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=859

 Score =   225 bits (574),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRY+AAAAEN + +LDVETQ  R  L+GHTK + S+CW+PSG+ LASVSEDSVRVW+LGS
Sbjct  717  GRYIAAAAENAICVLDVETQVRRHLLQGHTKHVDSICWNPSGDILASVSEDSVRVWSLGS  776

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GN+  CVHELS  GNKFHSCVF P+Y SLLVIGCYQSLE+W+M ENKTM LPAH+GLI +
Sbjct  777  GNDSECVHELSCIGNKFHSCVFLPNYPSLLVIGCYQSLEIWDMKENKTMMLPAHDGLIAA  836

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS   G+VASASHDK +KLWK
Sbjct  837  LAVSNATGVVASASHDKCVKLWK  859



>ref|XP_009405115.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Musa acuminata subsp. malaccensis]
Length=846

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRY+AAAAEN + +LDVETQ  R  L+GHTK + S+CW+PSG+ LASVSEDSVRVW+LGS
Sbjct  704  GRYIAAAAENAICVLDVETQVRRHLLQGHTKHVDSICWNPSGDILASVSEDSVRVWSLGS  763

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            GN+  CVHELS  GNKFHSCVF P+Y SLLVIGCYQSLE+W+M ENKTM LPAH+GLI +
Sbjct  764  GNDSECVHELSCIGNKFHSCVFLPNYPSLLVIGCYQSLEIWDMKENKTMMLPAHDGLIAA  823

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS   G+VASASHDK +KLWK
Sbjct  824  LAVSNATGVVASASHDKCVKLWK  846



>ref|XP_010533194.1| PREDICTED: transcriptional corepressor LEUNIG-like [Tarenaya 
hassleriana]
Length=855

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAA+N VSILDVETQ CR+ L+GH   +HSVCWDPSGE+LASVS D VRVW++GS
Sbjct  713  GRILAAAADNYVSILDVETQVCRRKLQGHKGVVHSVCWDPSGEYLASVSSDMVRVWSIGS  772

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
             N+G C+HELSS+GNK+++CVFHP+Y+ LL+IGCY++LELWNM ENKTMTL AH+ L+ +
Sbjct  773  SNKGECIHELSSSGNKYNTCVFHPTYTPLLIIGCYETLELWNMAENKTMTLHAHDNLVSA  832

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S V+G++ASASHDK  K+WK
Sbjct  833  LAASNVSGMIASASHDKFFKIWK  855



>gb|KJB83315.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=928

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAAAAENVVSILD ETQTCR +L+GHTK IHSVCWDPSGE LASVSEDSVRVW+  S
Sbjct  799  GKYLAAAAENVVSILDTETQTCRHSLQGHTKLIHSVCWDPSGELLASVSEDSVRVWSFAS  858

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHPS+ SLLVIGCYQSLELWNM+ENKTMTL AHEGLI +
Sbjct  859  GSEGECVHELSCNGNKFHSCVFHPSFQSLLVIGCYQSLELWNMSENKTMTLSAHEGLIAA  918

Query  297  LAVSTV  280
            LAVS V
Sbjct  919  LAVSPV  924



>gb|KDO80403.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=761

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAA EN +SILDVETQ CR  L+GH   +HSVCW+ SGE+LASVS++ VRVW++GS
Sbjct  619  GRILAAAIENYISILDVETQVCRLKLQGHKNQVHSVCWNTSGEYLASVSDELVRVWSIGS  678

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G++G C+HELS  GNKFHSCVFHP++ SLLVIGCY++LELWNMTENKT+TL AH+ L+ S
Sbjct  679  GSKGECIHELSCTGNKFHSCVFHPTFPSLLVIGCYETLELWNMTENKTLTLSAHDKLVSS  738

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA STV G+VASASHDK +K+WK
Sbjct  739  LAASTVNGMVASASHDKCVKIWK  761



>gb|KDO80404.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=732

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAA EN +SILDVETQ CR  L+GH   +HSVCW+ SGE+LASVS++ VRVW++GS
Sbjct  590  GRILAAAIENYISILDVETQVCRLKLQGHKNQVHSVCWNTSGEYLASVSDELVRVWSIGS  649

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G++G C+HELS  GNKFHSCVFHP++ SLLVIGCY++LELWNMTENKT+TL AH+ L+ S
Sbjct  650  GSKGECIHELSCTGNKFHSCVFHPTFPSLLVIGCYETLELWNMTENKTLTLSAHDKLVSS  709

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA STV G+VASASHDK +K+WK
Sbjct  710  LAASTVNGMVASASHDKCVKIWK  732



>ref|XP_006838727.1| hypothetical protein AMTR_s00002p00252820 [Amborella trichopoda]
 gb|ERN01296.1| hypothetical protein AMTR_s00002p00252820 [Amborella trichopoda]
Length=854

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAAENVVSILDVE+Q C  +L+GH+KP+HS+CWD SG+++AS SEDSVRVW +G 
Sbjct  712  GRLLAAAAENVVSILDVESQVCCHSLQGHSKPVHSLCWDQSGDYVASASEDSVRVWAVGG  771

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
             + G CVHELS +GNKFHSCVFHP Y SLLV+GCYQSLELW+M+E K MT+PAHEGL+ +
Sbjct  772  RSRGECVHELSCHGNKFHSCVFHPIYPSLLVVGCYQSLELWDMSEGKCMTVPAHEGLVAA  831

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S V G VASASHDK +K+WK
Sbjct  832  LAASNVTGTVASASHDKHVKIWK  854



>ref|XP_006451037.1| hypothetical protein CICLE_v10007449mg [Citrus clementina]
 gb|ESR64277.1| hypothetical protein CICLE_v10007449mg [Citrus clementina]
Length=837

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAA EN +SILDVETQ CR  L+GH   +HSVCW+ SGE+LASVS++ VRVW++GS
Sbjct  695  GRILAAAVENYISILDVETQVCRLKLQGHKNQVHSVCWNTSGEYLASVSDELVRVWSIGS  754

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G++G C+HELS  GNKFHSCVFHP++ SLLVIGCY++LELWNMTENKT+TL AH+ L+ S
Sbjct  755  GSKGECIHELSCTGNKFHSCVFHPTFPSLLVIGCYETLELWNMTENKTLTLSAHDKLVSS  814

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA STV G+VASASHDK +K+WK
Sbjct  815  LAASTVNGMVASASHDKCVKIWK  837



>gb|KDO80395.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=835

 Score =   221 bits (562),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAA EN +SILDVETQ CR  L+GH   +HSVCW+ SGE+LASVS++ VRVW++GS
Sbjct  693  GRILAAAIENYISILDVETQVCRLKLQGHKNQVHSVCWNTSGEYLASVSDELVRVWSIGS  752

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G++G C+HELS  GNKFHSCVFHP++ SLLVIGCY++LELWNMTENKT+TL AH+ L+ S
Sbjct  753  GSKGECIHELSCTGNKFHSCVFHPTFPSLLVIGCYETLELWNMTENKTLTLSAHDKLVSS  812

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA STV G+VASASHDK +K+WK
Sbjct  813  LAASTVNGMVASASHDKCVKIWK  835



>ref|XP_006475763.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Citrus sinensis]
 gb|KDO80393.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=837

 Score =   221 bits (562),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAA EN +SILDVETQ CR  L+GH   +HSVCW+ SGE+LASVS++ VRVW++GS
Sbjct  695  GRILAAAIENYISILDVETQVCRLKLQGHKNQVHSVCWNTSGEYLASVSDELVRVWSIGS  754

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G++G C+HELS  GNKFHSCVFHP++ SLLVIGCY++LELWNMTENKT+TL AH+ L+ S
Sbjct  755  GSKGECIHELSCTGNKFHSCVFHPTFPSLLVIGCYETLELWNMTENKTLTLSAHDKLVSS  814

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA STV G+VASASHDK +K+WK
Sbjct  815  LAASTVNGMVASASHDKCVKIWK  837



>ref|XP_006475762.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Citrus sinensis]
 gb|KDO80392.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=842

 Score =   221 bits (562),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAA EN +SILDVETQ CR  L+GH   +HSVCW+ SGE+LASVS++ VRVW++GS
Sbjct  700  GRILAAAIENYISILDVETQVCRLKLQGHKNQVHSVCWNTSGEYLASVSDELVRVWSIGS  759

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G++G C+HELS  GNKFHSCVFHP++ SLLVIGCY++LELWNMTENKT+TL AH+ L+ S
Sbjct  760  GSKGECIHELSCTGNKFHSCVFHPTFPSLLVIGCYETLELWNMTENKTLTLSAHDKLVSS  819

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA STV G+VASASHDK +K+WK
Sbjct  820  LAASTVNGMVASASHDKCVKIWK  842



>gb|KDO80396.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=834

 Score =   221 bits (562),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAA EN +SILDVETQ CR  L+GH   +HSVCW+ SGE+LASVS++ VRVW++GS
Sbjct  692  GRILAAAIENYISILDVETQVCRLKLQGHKNQVHSVCWNTSGEYLASVSDELVRVWSIGS  751

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G++G C+HELS  GNKFHSCVFHP++ SLLVIGCY++LELWNMTENKT+TL AH+ L+ S
Sbjct  752  GSKGECIHELSCTGNKFHSCVFHPTFPSLLVIGCYETLELWNMTENKTLTLSAHDKLVSS  811

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA STV G+VASASHDK +K+WK
Sbjct  812  LAASTVNGMVASASHDKCVKIWK  834



>ref|XP_008386062.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Malus domestica]
Length=855

 Score =   220 bits (561),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAA+N VSILDVETQ CR  L+GH   +HSVCWDPSG++LASVS+D VRVWT+GS
Sbjct  713  GRNLAAAADNFVSILDVETQVCRLKLQGHKSAVHSVCWDPSGDYLASVSDDLVRVWTIGS  772

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
              +G  +HELS +GNKF++CVFHP+Y +LLVIGCY++LELWNMTENKTMTL AH+ L+ S
Sbjct  773  SCKGEFIHELSCSGNKFNTCVFHPTYPALLVIGCYETLELWNMTENKTMTLHAHDKLVSS  832

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS+  GLVASASHDK +KLWK
Sbjct  833  LAVSSATGLVASASHDKCVKLWK  855



>ref|XP_009371420.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Pyrus x bretschneideri]
Length=851

 Score =   220 bits (560),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAA+N VSILDVETQ CR  L+GH   +HSVCWDPSGE+LASVS+D VRVWT+GS
Sbjct  709  GRNLAAAADNFVSILDVETQICRLKLQGHKSTVHSVCWDPSGENLASVSDDLVRVWTVGS  768

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
              +G  +HELS +GNKF++CVFHPSY +LL+IGCY++LELWNM ENKTMTL AHE L+ S
Sbjct  769  SCKGEFIHELSCSGNKFNTCVFHPSYPALLIIGCYENLELWNMAENKTMTLHAHEKLVSS  828

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS+  GLVASASHDK +KLWK
Sbjct  829  LAVSSATGLVASASHDKCVKLWK  851



>gb|ACZ98534.1| LisH-SSDP-WD40 [Malus domestica]
Length=905

 Score =   220 bits (560),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAA+N VSILDVETQ CR  L+GH   +HSVCWDPSG++LASVS+D VRVWT+GS
Sbjct  715  GRNLAAAADNFVSILDVETQVCRLKLQGHKSAVHSVCWDPSGDYLASVSDDLVRVWTIGS  774

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
              +G  +HELS +GNKF++CVFHP+Y +LLVIGCY++LELWNMTENKTMTL AH+ L+ S
Sbjct  775  SCKGEFIHELSCSGNKFNTCVFHPTYPALLVIGCYETLELWNMTENKTMTLHAHDKLVSS  834

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS+  GLVASASHDK +KLWK
Sbjct  835  LAVSSATGLVASASHDKCVKLWK  857



>ref|XP_008386048.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Malus domestica]
Length=860

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAA+N VSILDVETQ CR  L+GH   +HSVCWDPSG++LASVS+D VRVWT+GS
Sbjct  718  GRNLAAAADNFVSILDVETQVCRLKLQGHKSAVHSVCWDPSGDYLASVSDDLVRVWTIGS  777

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
              +G  +HELS +GNKF++CVFHP+Y +LLVIGCY++LELWNMTENKTMTL AH+ L+ S
Sbjct  778  SCKGEFIHELSCSGNKFNTCVFHPTYPALLVIGCYETLELWNMTENKTMTLHAHDKLVSS  837

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS+  GLVASASHDK +KLWK
Sbjct  838  LAVSSATGLVASASHDKCVKLWK  860



>ref|XP_008386053.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Malus domestica]
Length=856

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAA+N VSILDVETQ CR  L+GH   +HSVCWDPSG++LASVS+D VRVWT+GS
Sbjct  714  GRNLAAAADNFVSILDVETQVCRLKLQGHKSAVHSVCWDPSGDYLASVSDDLVRVWTIGS  773

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
              +G  +HELS +GNKF++CVFHP+Y +LLVIGCY++LELWNMTENKTMTL AH+ L+ S
Sbjct  774  SCKGEFIHELSCSGNKFNTCVFHPTYPALLVIGCYETLELWNMTENKTMTLHAHDKLVSS  833

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS+  GLVASASHDK +KLWK
Sbjct  834  LAVSSATGLVASASHDKCVKLWK  856



>ref|XP_009371419.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Pyrus x bretschneideri]
Length=853

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAA+N VSILDVETQ CR  L+GH   +HSVCWDPSGE+LASVS+D VRVWT+GS
Sbjct  711  GRNLAAAADNFVSILDVETQICRLKLQGHKSTVHSVCWDPSGENLASVSDDLVRVWTVGS  770

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
              +G  +HELS +GNKF++CVFHPSY +LL+IGCY++LELWNM ENKTMTL AHE L+ S
Sbjct  771  SCKGEFIHELSCSGNKFNTCVFHPSYPALLIIGCYENLELWNMAENKTMTLHAHEKLVSS  830

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS+  GLVASASHDK +KLWK
Sbjct  831  LAVSSATGLVASASHDKCVKLWK  853



>gb|KHG05392.1| Transcriptional corepressor LEUNIG -like protein [Gossypium arboreum]
Length=755

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 119/143 (83%), Gaps = 6/143 (4%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLA AAENVVSILD ETQTCR +L+GHTK IHSVCWD SGE LASVSEDSVRVW+ GS
Sbjct  615  GKYLALAAENVVSILDAETQTCRYSLQGHTKLIHSVCWDLSGELLASVSEDSVRVWSFGS  674

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHP+  SLL      SLELWN+TE KT TL AHEGLI +
Sbjct  675  GSEGECVHELSCNGNKFHSCVFHPTSPSLL------SLELWNLTEGKTKTLSAHEGLIAA  728

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V GLV+SASHDK IKLWK
Sbjct  729  LAVSPVTGLVSSASHDKFIKLWK  751



>ref|XP_007013296.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 1 [Theobroma cacao]
 gb|EOY30915.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 1 [Theobroma cacao]
Length=863

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LAAAA+N VS+LDVE Q CR  L+GH   +HSVCWDP+GE LASVS+D VRVWT+ S
Sbjct  721  GRFLAAAADNSVSLLDVENQVCRAKLQGHKNAVHSVCWDPTGEFLASVSDDLVRVWTVSS  780

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G +G CVHEL+  GNKF++CVFHP+Y SLLVIGCY++LELWNMTENKT+TL AHE L+ +
Sbjct  781  GGKGECVHELNCTGNKFNTCVFHPTYPSLLVIGCYETLELWNMTENKTLTLHAHEKLVSA  840

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS    +VASASHDK +KLWK
Sbjct  841  LAVSNATSMVASASHDKCVKLWK  863



>ref|XP_010656383.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Vitis vinifera]
Length=870

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 121/144 (84%), Gaps = 2/144 (1%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAE VVSILDVETQ CRQ L+GH   + SVCWD SG +LA+VSED V+VWT+GS
Sbjct  728  GRYLAAAAEGVVSILDVETQACRQKLQGHKNHV-SVCWDSSGSYLATVSEDLVKVWTVGS  786

Query  477  GNEG-NCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIX  301
            G +   C+HEL  +GNKF+SC FHP+Y+SLLVIGCYQSLELWNMTENKTMTLPAH+ LI 
Sbjct  787  GGKAAECIHELHYSGNKFNSCAFHPTYTSLLVIGCYQSLELWNMTENKTMTLPAHDKLIS  846

Query  300  SLAVSTVAGLVASASHDKIIKLWK  229
            SLAVS V GLVASASHD  +KLWK
Sbjct  847  SLAVSNVTGLVASASHDNCVKLWK  870



>ref|XP_010656382.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Vitis vinifera]
 emb|CBI28132.3| unnamed protein product [Vitis vinifera]
Length=871

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 121/144 (84%), Gaps = 2/144 (1%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAE VVSILDVETQ CRQ L+GH   + SVCWD SG +LA+VSED V+VWT+GS
Sbjct  729  GRYLAAAAEGVVSILDVETQACRQKLQGHKNHV-SVCWDSSGSYLATVSEDLVKVWTVGS  787

Query  477  GNEG-NCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIX  301
            G +   C+HEL  +GNKF+SC FHP+Y+SLLVIGCYQSLELWNMTENKTMTLPAH+ LI 
Sbjct  788  GGKAAECIHELHYSGNKFNSCAFHPTYTSLLVIGCYQSLELWNMTENKTMTLPAHDKLIS  847

Query  300  SLAVSTVAGLVASASHDKIIKLWK  229
            SLAVS V GLVASASHD  +KLWK
Sbjct  848  SLAVSNVTGLVASASHDNCVKLWK  871



>gb|KHN15508.1| Transcriptional corepressor LEUNIG [Glycine soja]
Length=864

 Score =   218 bits (556),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 115/143 (80%), Gaps = 16/143 (11%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAENVVSILDVETQ  R +LKGHTK I SVCWDPSGE LASVSEDSVRVWTLGS
Sbjct  738  GRYLAAAAENVVSILDVETQASRYSLKGHTKSIRSVCWDPSGEFLASVSEDSVRVWTLGS  797

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSC                SLELWNMTENKTMTL AHEGLI +
Sbjct  798  GSEGECVHELSCNGNKFHSC----------------SLELWNMTENKTMTLSAHEGLIAA  841

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVSTV GLVASASHDK +KLWK
Sbjct  842  LAVSTVNGLVASASHDKFVKLWK  864



>ref|XP_008337351.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Malus domestica]
Length=854

 Score =   217 bits (553),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAA+N VSILDVETQ CR  L+GH   +HSVCWDPSGE+LASVS+D VRVWT+GS
Sbjct  712  GRNLAAAADNFVSILDVETQVCRLKLQGHKSHVHSVCWDPSGEYLASVSDDLVRVWTVGS  771

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
              +G  +HELS +GNKF +CVFHP+Y +LLVIGCY++LELWNM ENKTMTL AH+ L+ S
Sbjct  772  SCKGELIHELSCSGNKFKTCVFHPTYPALLVIGCYETLELWNMAENKTMTLHAHDKLVSS  831

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS   GLVASASHDK +KLWK
Sbjct  832  LAVSNATGLVASASHDKCVKLWK  854



>ref|XP_008337350.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Malus domestica]
Length=857

 Score =   217 bits (553),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAA+N VSILDVETQ CR  L+GH   +HSVCWDPSGE+LASVS+D VRVWT+GS
Sbjct  715  GRNLAAAADNFVSILDVETQVCRLKLQGHKSHVHSVCWDPSGEYLASVSDDLVRVWTVGS  774

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
              +G  +HELS +GNKF +CVFHP+Y +LLVIGCY++LELWNM ENKTMTL AH+ L+ S
Sbjct  775  SCKGELIHELSCSGNKFKTCVFHPTYPALLVIGCYETLELWNMAENKTMTLHAHDKLVSS  834

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS   GLVASASHDK +KLWK
Sbjct  835  LAVSNATGLVASASHDKCVKLWK  857



>ref|XP_008337347.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Malus domestica]
Length=863

 Score =   217 bits (553),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAA+N VSILDVETQ CR  L+GH   +HSVCWDPSGE+LASVS+D VRVWT+GS
Sbjct  721  GRNLAAAADNFVSILDVETQVCRLKLQGHKSHVHSVCWDPSGEYLASVSDDLVRVWTVGS  780

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
              +G  +HELS +GNKF +CVFHP+Y +LLVIGCY++LELWNM ENKTMTL AH+ L+ S
Sbjct  781  SCKGELIHELSCSGNKFKTCVFHPTYPALLVIGCYETLELWNMAENKTMTLHAHDKLVSS  840

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS   GLVASASHDK +KLWK
Sbjct  841  LAVSNATGLVASASHDKCVKLWK  863



>ref|XP_008337349.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Malus domestica]
Length=859

 Score =   217 bits (553),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAA+N VSILDVETQ CR  L+GH   +HSVCWDPSGE+LASVS+D VRVWT+GS
Sbjct  717  GRNLAAAADNFVSILDVETQVCRLKLQGHKSHVHSVCWDPSGEYLASVSDDLVRVWTVGS  776

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
              +G  +HELS +GNKF +CVFHP+Y +LLVIGCY++LELWNM ENKTMTL AH+ L+ S
Sbjct  777  SCKGELIHELSCSGNKFKTCVFHPTYPALLVIGCYETLELWNMAENKTMTLHAHDKLVSS  836

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS   GLVASASHDK +KLWK
Sbjct  837  LAVSNATGLVASASHDKCVKLWK  859



>ref|XP_009374058.1| PREDICTED: transcriptional corepressor LEUNIG-like [Pyrus x bretschneideri]
Length=843

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAA+N VSILDVETQ CR  L+GH   +HSVCW+PSGE+LASVS+D VRVWT+GS
Sbjct  701  GRNLAAAADNFVSILDVETQVCRLKLQGHKSGVHSVCWNPSGEYLASVSDDLVRVWTVGS  760

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
              +G  +HELS +GNKF++CVFHP+Y +LLVIGCY++LELWNM ENKTMTL AH+ L+ S
Sbjct  761  SCKGEFIHELSCSGNKFNTCVFHPTYPALLVIGCYETLELWNMAENKTMTLHAHDKLVSS  820

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS   GLVASASHDK +KLWK
Sbjct  821  LAVSNATGLVASASHDKCVKLWK  843



>ref|XP_009403018.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009403019.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=863

 Score =   215 bits (548),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLA AAEN + +LDVETQ  R  L+GHTK + S+CW+ SG+ LASVSEDSVRVW+ G 
Sbjct  721  GRYLAVAAENTICVLDVETQARRHLLQGHTKHVGSICWNSSGDCLASVSEDSVRVWSFGL  780

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG C+ ELS NGNKFHSCVFHPSY S LVIG Y+SLE+W+M ENKTMTL AH+GLI +
Sbjct  781  GSEGECMKELSCNGNKFHSCVFHPSYPSFLVIGSYRSLEIWDMNENKTMTLTAHDGLIAA  840

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V G++ASASHDK +KLWK
Sbjct  841  LAVSNVTGVIASASHDKCVKLWK  863



>ref|XP_009403020.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=858

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLA AAEN + +LDVETQ  R  L+GHTK + S+CW+ SG+ LASVSEDSVRVW+ G 
Sbjct  716  GRYLAVAAENTICVLDVETQARRHLLQGHTKHVGSICWNSSGDCLASVSEDSVRVWSFGL  775

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG C+ ELS NGNKFHSCVFHPSY S LVIG Y+SLE+W+M ENKTMTL AH+GLI +
Sbjct  776  GSEGECMKELSCNGNKFHSCVFHPSYPSFLVIGSYRSLEIWDMNENKTMTLTAHDGLIAA  835

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS V G++ASASHDK +KLWK
Sbjct  836  LAVSNVTGVIASASHDKCVKLWK  858



>ref|XP_009387170.1| PREDICTED: transcriptional corepressor LEUNIG-like [Musa acuminata 
subsp. malaccensis]
Length=887

 Score =   214 bits (546),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GRYLAAAAEN + ILDVETQ  R  L+GHTK + S+CW+ SG+ LASVSEDSVR+W+LG 
Sbjct  745  GRYLAAAAENTIGILDVETQARRHLLQGHTKHVISICWNSSGDRLASVSEDSVRIWSLGL  804

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G++G C+ EL+ +G KFHSCVFHPSY SLLVIGCYQSLELW+M ENKTM   AHEGLI +
Sbjct  805  GSDGECIKELNCSGTKFHSCVFHPSYPSLLVIGCYQSLELWDMNENKTMPSSAHEGLIAA  864

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S V G++AS SHDK +KLWK
Sbjct  865  LAASNVTGVIASVSHDKCVKLWK  887



>ref|XP_007204646.1| hypothetical protein PRUPE_ppa001612mg [Prunus persica]
 gb|EMJ05845.1| hypothetical protein PRUPE_ppa001612mg [Prunus persica]
Length=792

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAA+N VSILDVETQ C + L+GH   +HSVCWDPSG+ LASVS+D VRVW++ S
Sbjct  650  GRNLAAAADNFVSILDVETQACVRKLQGHKNLVHSVCWDPSGDFLASVSDDLVRVWSVVS  709

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
               G C+HELS +GNKF++CVFHP+  SLLVIGCY++LELWNMTENKTMTL AH+ L+ S
Sbjct  710  SARGECIHELSCSGNKFNTCVFHPTCPSLLVIGCYETLELWNMTENKTMTLHAHDKLVSS  769

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS   GLVASASHDK +KLWK
Sbjct  770  LAVSDATGLVASASHDKFVKLWK  792



>ref|XP_008242693.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Prunus mume]
Length=869

 Score =   214 bits (544),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAA+N VSILDVETQ C + L+GH   +HSVCWDPSG+ LASVS+D VRVW++GS
Sbjct  727  GRNLAAAADNYVSILDVETQACMRKLQGHKSLVHSVCWDPSGDFLASVSDDLVRVWSVGS  786

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
               G C+HELS +GNKF++CVFHP+  SLLVIGCY++LELWNM ENKTMTL AH+ L+ S
Sbjct  787  SVRGECIHELSCSGNKFNTCVFHPTCPSLLVIGCYETLELWNMNENKTMTLHAHDKLVSS  846

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS   GLVASASHDK +KLWK
Sbjct  847  LAVSDATGLVASASHDKCVKLWK  869



>ref|XP_008242692.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Prunus mume]
Length=874

 Score =   214 bits (544),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAA+N VSILDVETQ C + L+GH   +HSVCWDPSG+ LASVS+D VRVW++GS
Sbjct  732  GRNLAAAADNYVSILDVETQACMRKLQGHKSLVHSVCWDPSGDFLASVSDDLVRVWSVGS  791

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
               G C+HELS +GNKF++CVFHP+  SLLVIGCY++LELWNM ENKTMTL AH+ L+ S
Sbjct  792  SVRGECIHELSCSGNKFNTCVFHPTCPSLLVIGCYETLELWNMNENKTMTLHAHDKLVSS  851

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LAVS   GLVASASHDK +KLWK
Sbjct  852  LAVSDATGLVASASHDKCVKLWK  874



>ref|XP_010541891.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Tarenaya hassleriana]
Length=654

 Score =   211 bits (537),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 122/144 (85%), Gaps = 1/144 (1%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAA+N  SILDVETQ CR  L+GH   +HSVCWDPSGE+LA+VS D +RVW++GS
Sbjct  511  GRMLAAAADNYASILDVETQVCRCKLQGHKGLVHSVCWDPSGEYLATVSNDMIRVWSIGS  570

Query  477  GN-EGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIX  301
             + +G C+HELSS+GNKF++CVFHP+Y+S+L+IGCY++LELW+M ENKTMTL AHE  + 
Sbjct  571  SSSKGECIHELSSSGNKFNTCVFHPTYTSVLIIGCYETLELWDMAENKTMTLHAHEKRVS  630

Query  300  SLAVSTVAGLVASASHDKIIKLWK  229
            +LA S++ G+VASASHDK +K+WK
Sbjct  631  ALAASSITGMVASASHDKFMKIWK  654



>ref|XP_010541888.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Tarenaya hassleriana]
Length=776

 Score =   212 bits (539),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 122/144 (85%), Gaps = 1/144 (1%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAA+N  SILDVETQ CR  L+GH   +HSVCWDPSGE+LA+VS D +RVW++GS
Sbjct  633  GRMLAAAADNYASILDVETQVCRCKLQGHKGLVHSVCWDPSGEYLATVSNDMIRVWSIGS  692

Query  477  GN-EGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIX  301
             + +G C+HELSS+GNKF++CVFHP+Y+S+L+IGCY++LELW+M ENKTMTL AHE  + 
Sbjct  693  SSSKGECIHELSSSGNKFNTCVFHPTYTSVLIIGCYETLELWDMAENKTMTLHAHEKRVS  752

Query  300  SLAVSTVAGLVASASHDKIIKLWK  229
            +LA S++ G+VASASHDK +K+WK
Sbjct  753  ALAASSITGMVASASHDKFMKIWK  776



>ref|XP_010245980.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Nelumbo nucifera]
Length=772

 Score =   212 bits (539),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 119/143 (83%), Gaps = 3/143 (2%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+ LAAAA+NVVSI DVET      L+GH+K +HSVCWD +G+ LASVS+DSVRVW+L +
Sbjct  633  GQLLAAAADNVVSIFDVETDRLTHALQGHSKEVHSVCWDSTGDRLASVSQDSVRVWSLST  692

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G    C+HELSSN NKFHSCVFHP+Y +LLVIG YQSLELWNM+ENK+MT+PAHEG+I +
Sbjct  693  GE---CIHELSSNANKFHSCVFHPAYPTLLVIGGYQSLELWNMSENKSMTVPAHEGVIAA  749

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S V G+VASASHDK +KLWK
Sbjct  750  LAQSPVTGMVASASHDKSVKLWK  772



>ref|XP_010245978.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Nelumbo nucifera]
Length=802

 Score =   212 bits (539),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 119/143 (83%), Gaps = 3/143 (2%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+ LAAAA+NVVSI DVET      L+GH+K +HSVCWD +G+ LASVS+DSVRVW+L +
Sbjct  663  GQLLAAAADNVVSIFDVETDRLTHALQGHSKEVHSVCWDSTGDRLASVSQDSVRVWSLST  722

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G    C+HELSSN NKFHSCVFHP+Y +LLVIG YQSLELWNM+ENK+MT+PAHEG+I +
Sbjct  723  GE---CIHELSSNANKFHSCVFHPAYPTLLVIGGYQSLELWNMSENKSMTVPAHEGVIAA  779

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S V G+VASASHDK +KLWK
Sbjct  780  LAQSPVTGMVASASHDKSVKLWK  802



>ref|XP_010245981.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Nelumbo nucifera]
Length=758

 Score =   211 bits (538),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 119/143 (83%), Gaps = 3/143 (2%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+ LAAAA+NVVSI DVET      L+GH+K +HSVCWD +G+ LASVS+DSVRVW+L +
Sbjct  619  GQLLAAAADNVVSIFDVETDRLTHALQGHSKEVHSVCWDSTGDRLASVSQDSVRVWSLST  678

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G    C+HELSSN NKFHSCVFHP+Y +LLVIG YQSLELWNM+ENK+MT+PAHEG+I +
Sbjct  679  GE---CIHELSSNANKFHSCVFHPAYPTLLVIGGYQSLELWNMSENKSMTVPAHEGVIAA  735

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S V G+VASASHDK +KLWK
Sbjct  736  LAQSPVTGMVASASHDKSVKLWK  758



>ref|XP_010245979.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Nelumbo nucifera]
Length=788

 Score =   212 bits (539),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 119/143 (83%), Gaps = 3/143 (2%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+ LAAAA+NVVSI DVET      L+GH+K +HSVCWD +G+ LASVS+DSVRVW+L +
Sbjct  649  GQLLAAAADNVVSIFDVETDRLTHALQGHSKEVHSVCWDSTGDRLASVSQDSVRVWSLST  708

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G    C+HELSSN NKFHSCVFHP+Y +LLVIG YQSLELWNM+ENK+MT+PAHEG+I +
Sbjct  709  GE---CIHELSSNANKFHSCVFHPAYPTLLVIGGYQSLELWNMSENKSMTVPAHEGVIAA  765

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S V G+VASASHDK +KLWK
Sbjct  766  LAQSPVTGMVASASHDKSVKLWK  788



>ref|XP_010541890.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Tarenaya hassleriana]
Length=749

 Score =   211 bits (538),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 122/144 (85%), Gaps = 1/144 (1%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAA+N  SILDVETQ CR  L+GH   +HSVCWDPSGE+LA+VS D +RVW++GS
Sbjct  606  GRMLAAAADNYASILDVETQVCRCKLQGHKGLVHSVCWDPSGEYLATVSNDMIRVWSIGS  665

Query  477  GN-EGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIX  301
             + +G C+HELSS+GNKF++CVFHP+Y+S+L+IGCY++LELW+M ENKTMTL AHE  + 
Sbjct  666  SSSKGECIHELSSSGNKFNTCVFHPTYTSVLIIGCYETLELWDMAENKTMTLHAHEKRVS  725

Query  300  SLAVSTVAGLVASASHDKIIKLWK  229
            +LA S++ G+VASASHDK +K+WK
Sbjct  726  ALAASSITGMVASASHDKFMKIWK  749



>ref|XP_006857440.1| hypothetical protein AMTR_s00067p00167320 [Amborella trichopoda]
 gb|ERN18907.1| hypothetical protein AMTR_s00067p00167320 [Amborella trichopoda]
Length=839

 Score =   212 bits (539),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 117/143 (82%), Gaps = 2/143 (1%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+ LAAAAENVVSI DVET     TLK HTKP+HSVCWD SG++LASVSEDSVRVW+L S
Sbjct  699  GQLLAAAAENVVSIFDVETDRRTHTLKRHTKPVHSVCWDASGDYLASVSEDSVRVWSLAS  758

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G E  C+HEL+SNGN FHSCVFHPS+ +LLVIG YQ+LELWNM E+  M++ AHEGLI +
Sbjct  759  GEE--CIHELNSNGNNFHSCVFHPSFPTLLVIGGYQTLELWNMAEDSRMSIQAHEGLIAA  816

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S   G+VASASHDK +K+WK
Sbjct  817  LAQSPATGMVASASHDKCVKIWK  839



>ref|XP_010541889.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Tarenaya hassleriana]
Length=773

 Score =   211 bits (537),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 122/144 (85%), Gaps = 1/144 (1%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAA+N  SILDVETQ CR  L+GH   +HSVCWDPSGE+LA+VS D +RVW++GS
Sbjct  630  GRMLAAAADNYASILDVETQVCRCKLQGHKGLVHSVCWDPSGEYLATVSNDMIRVWSIGS  689

Query  477  GN-EGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIX  301
             + +G C+HELSS+GNKF++CVFHP+Y+S+L+IGCY++LELW+M ENKTMTL AHE  + 
Sbjct  690  SSSKGECIHELSSSGNKFNTCVFHPTYTSVLIIGCYETLELWDMAENKTMTLHAHEKRVS  749

Query  300  SLAVSTVAGLVASASHDKIIKLWK  229
            +LA S++ G+VASASHDK +K+WK
Sbjct  750  ALAASSITGMVASASHDKFMKIWK  773



>ref|XP_009372971.1| PREDICTED: transcriptional corepressor LEUNIG-like [Pyrus x bretschneideri]
Length=194

 Score =   198 bits (503),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAAENVVSILDVETQTCR +L+G TKPIHSVCWDPSGE LASVSEDSVRVWTLG+
Sbjct  85   GRLLAAAAENVVSILDVETQTCRHSLQGQTKPIHSVCWDPSGEFLASVSEDSVRVWTLGA  144

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTM  331
            G EG CVHELS NGNKFHSC+FHP+Y+SLLVIGCYQSLELWNMT N T+
Sbjct  145  GGEGECVHELSCNGNKFHSCLFHPTYTSLLVIGCYQSLELWNMTGNNTI  193



>gb|KHG11579.1| Transcriptional corepressor LEUNIG -like protein [Gossypium arboreum]
Length=774

 Score =   211 bits (536),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LAAA +N VS+LDVE Q CR  L+GH   IHSVCWD +GE LASVS+D VRVWT+GS
Sbjct  632  GRFLAAATDNSVSLLDVEAQVCRAKLQGHKSVIHSVCWDATGEFLASVSDDLVRVWTVGS  691

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
              +G CVHEL+  GNKF++CVFHPSYSSLLVIGCY++LELWNM ENK MT  AHE L+ +
Sbjct  692  SGKGECVHELNRTGNKFNTCVFHPSYSSLLVIGCYETLELWNMLENKIMTRHAHENLVSA  751

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA ST   +VASASHDK +KLWK
Sbjct  752  LAASTSTRMVASASHDKCVKLWK  774



>gb|KJB64845.1| hypothetical protein B456_010G067800 [Gossypium raimondii]
Length=846

 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LAAA +N VS+LDVE Q CR  L+GH   IHSVCWD +GE LASVS+D VRVWT+GS
Sbjct  704  GRFLAAATDNSVSLLDVEAQVCRAKLQGHKSVIHSVCWDATGEFLASVSDDLVRVWTVGS  763

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
              +G CVHEL+  GNKF++CVFHPSYSSLLVIGCY++LELWNM ENK MT  AHE L+ +
Sbjct  764  SGKGECVHELNRTGNKFNTCVFHPSYSSLLVIGCYETLELWNMLENKIMTRHAHENLVSA  823

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S    +VASASHDK +KLWK
Sbjct  824  LAASNSTRMVASASHDKCVKLWK  846



>gb|KJB64850.1| hypothetical protein B456_010G067800 [Gossypium raimondii]
Length=847

 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LAAA +N VS+LDVE Q CR  L+GH   IHSVCWD +GE LASVS+D VRVWT+GS
Sbjct  705  GRFLAAATDNSVSLLDVEAQVCRAKLQGHKSVIHSVCWDATGEFLASVSDDLVRVWTVGS  764

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
              +G CVHEL+  GNKF++CVFHPSYSSLLVIGCY++LELWNM ENK MT  AHE L+ +
Sbjct  765  SGKGECVHELNRTGNKFNTCVFHPSYSSLLVIGCYETLELWNMLENKIMTRHAHENLVSA  824

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S    +VASASHDK +KLWK
Sbjct  825  LAASNSTRMVASASHDKCVKLWK  847



>gb|KJB64846.1| hypothetical protein B456_010G067800 [Gossypium raimondii]
Length=867

 Score =   209 bits (533),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LAAA +N VS+LDVE Q CR  L+GH   IHSVCWD +GE LASVS+D VRVWT+GS
Sbjct  725  GRFLAAATDNSVSLLDVEAQVCRAKLQGHKSVIHSVCWDATGEFLASVSDDLVRVWTVGS  784

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
              +G CVHEL+  GNKF++CVFHPSYSSLLVIGCY++LELWNM ENK MT  AHE L+ +
Sbjct  785  SGKGECVHELNRTGNKFNTCVFHPSYSSLLVIGCYETLELWNMLENKIMTRHAHENLVSA  844

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S    +VASASHDK +KLWK
Sbjct  845  LAASNSTRMVASASHDKCVKLWK  867



>gb|KJB64849.1| hypothetical protein B456_010G067800 [Gossypium raimondii]
Length=882

 Score =   209 bits (532),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR+LAAA +N VS+LDVE Q CR  L+GH   IHSVCWD +GE LASVS+D VRVWT+GS
Sbjct  740  GRFLAAATDNSVSLLDVEAQVCRAKLQGHKSVIHSVCWDATGEFLASVSDDLVRVWTVGS  799

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
              +G CVHEL+  GNKF++CVFHPSYSSLLVIGCY++LELWNM ENK MT  AHE L+ +
Sbjct  800  SGKGECVHELNRTGNKFNTCVFHPSYSSLLVIGCYETLELWNMLENKIMTRHAHENLVSA  859

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S    +VASASHDK +KLWK
Sbjct  860  LAASNSTRMVASASHDKCVKLWK  882



>ref|NP_001042184.1| Os01g0177100 [Oryza sativa Japonica Group]
 dbj|BAD67818.1| putative transcriptional corepressor LEUNIG [Oryza sativa Japonica 
Group]
 dbj|BAF04098.1| Os01g0177100 [Oryza sativa Japonica Group]
Length=875

 Score =   209 bits (531),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 119/143 (83%), Gaps = 1/143 (1%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G YLA A+EN VSILDVETQ C +  +GHTK + SVCWDPSGE++ SVSED+V+VW++ +
Sbjct  734  GGYLAVASENAVSILDVETQACLRRFEGHTKHVDSVCWDPSGEYVVSVSEDTVKVWSVNA  793

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G++  CV ELS  G+KFHSC FHPSYSS+L+IGCYQSLELW+M+EN+TMTL AH+ LI +
Sbjct  794  GSDDRCVQELSCTGSKFHSCAFHPSYSSMLIIGCYQSLELWDMSENRTMTLAAHDSLITA  853

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S+ +GLVAS SHDK +KLWK
Sbjct  854  LA-SSSSGLVASTSHDKFVKLWK  875



>dbj|BAD67819.1| putative transcriptional corepressor LEUNIG [Oryza sativa Japonica 
Group]
 dbj|BAH00776.1| unnamed protein product [Oryza sativa Japonica Group]
Length=877

 Score =   209 bits (531),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 119/143 (83%), Gaps = 1/143 (1%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G YLA A+EN VSILDVETQ C +  +GHTK + SVCWDPSGE++ SVSED+V+VW++ +
Sbjct  736  GGYLAVASENAVSILDVETQACLRRFEGHTKHVDSVCWDPSGEYVVSVSEDTVKVWSVNA  795

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G++  CV ELS  G+KFHSC FHPSYSS+L+IGCYQSLELW+M+EN+TMTL AH+ LI +
Sbjct  796  GSDDRCVQELSCTGSKFHSCAFHPSYSSMLIIGCYQSLELWDMSENRTMTLAAHDSLITA  855

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S+ +GLVAS SHDK +KLWK
Sbjct  856  LA-SSSSGLVASTSHDKFVKLWK  877



>ref|NP_001137120.1| uncharacterized protein LOC100217300 [Zea mays]
 gb|ACF83305.1| unknown [Zea mays]
Length=152

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 113/145 (78%), Gaps = 2/145 (1%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQ-TCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLG  481
            G+YLAAA++  + ILD ETQ  CR  L+GH K I S+CWD +GE+LASVSEDSVR+W+  
Sbjct  8    GKYLAAASDKAIYILDGETQHACRSPLQGHNKNIQSLCWDSAGEYLASVSEDSVRIWSFS  67

Query  480  SGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTL-PAHEGLI  304
            SG EG  VHEL+ +GN+FHSCVFHP+Y SLLVIGCY+SLELW++ E  TMT   AH+GL+
Sbjct  68   SGREGEFVHELNRSGNQFHSCVFHPTYQSLLVIGCYESLELWDIREKNTMTFNNAHDGLV  127

Query  303  XSLAVSTVAGLVASASHDKIIKLWK  229
             +LA S+  G VAS SHD+ +KLWK
Sbjct  128  AALASSSATGKVASVSHDRTLKLWK  152



>ref|XP_010264093.1| PREDICTED: transcriptional corepressor LEUNIG-like [Nelumbo nucifera]
Length=799

 Score =   206 bits (525),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 117/143 (82%), Gaps = 3/143 (2%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+ LAAAA+N+VSI DVET       +GH+K +HSVCWD +G+ LASVS+DSVRVW++  
Sbjct  660  GQLLAAAADNIVSIFDVETDRQINAFQGHSKEVHSVCWDANGDLLASVSQDSVRVWSV--  717

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
             N G C+HEL+SN NKFHSCVFHP+Y SLLVIG YQSLELWNM ENK+MT+PAHEG+I +
Sbjct  718  -NTGECLHELNSNANKFHSCVFHPTYHSLLVIGGYQSLELWNMAENKSMTIPAHEGVIAA  776

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S V G+VASASHDK +KLWK
Sbjct  777  LAQSPVTGMVASASHDKSVKLWK  799



>ref|XP_008796439.1| PREDICTED: transcriptional corepressor LEUNIG-like [Phoenix dactylifera]
Length=646

 Score =   205 bits (521),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 118/143 (83%), Gaps = 3/143 (2%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAAAAENVVSI DVET     TL+GHTK + S+CWD SGE+LA VS+D V+VW+L  
Sbjct  507  GQYLAAAAENVVSIFDVETDRKTYTLQGHTKEVQSICWDNSGEYLACVSQDCVKVWSL--  564

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
             + G+ +HELSSNGNKFHSCVFHP+Y++LLVIG YQSLELWN+ EN+TMT+ AHEGLI +
Sbjct  565  -SRGDFIHELSSNGNKFHSCVFHPNYTNLLVIGGYQSLELWNVIENQTMTVQAHEGLIAA  623

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S   G+VASASHDK +KLWK
Sbjct  624  LAQSQATGMVASASHDKSVKLWK  646



>gb|KGN65390.1| hypothetical protein Csa_1G403660 [Cucumis sativus]
Length=708

 Score =   205 bits (522),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAA  VVSI+DVETQ CR  L+GH K IHSVCWDPSGE+LAS S+D  +VW  GS
Sbjct  566  GRTLAAAAGKVVSIIDVETQVCRLRLQGHKKKIHSVCWDPSGEYLASTSDDVAKVWKFGS  625

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G++G+C+HEL+ NGN FH+CVFHP+ +S+L+IG ++SLELW+MTENKT TL AHE L+ +
Sbjct  626  GSKGDCIHELNCNGNTFHTCVFHPTNTSVLIIGSHESLELWDMTENKTRTLQAHEKLVTA  685

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S   GL+ASASHD  +K+W+
Sbjct  686  LAASNATGLIASASHDDCVKIWQ  708



>ref|XP_008785183.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Phoenix dactylifera]
 ref|XP_008785184.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Phoenix dactylifera]
 ref|XP_008785185.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Phoenix dactylifera]
Length=799

 Score =   206 bits (524),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G  LAAAAENVVSI+DVET    +TL+GH K +HSVCWD +G+HLASVS+DSV+VW+L S
Sbjct  660  GHLLAAAAENVVSIIDVETDMKTRTLQGHNKVVHSVCWDANGDHLASVSQDSVKVWSLTS  719

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G    C+HELSSNGN+FHSC FHP Y  LLVIG YQ+LELWNM EN+TMT  AH+GLI +
Sbjct  720  GE---CIHELSSNGNQFHSCTFHPRYPKLLVIGGYQTLELWNMAENQTMTAQAHDGLIAA  776

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S V G+VASASHD+ +K+WK
Sbjct  777  LAQSPVTGIVASASHDRSVKIWK  799



>ref|XP_008785188.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Phoenix dactylifera]
Length=797

 Score =   206 bits (524),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G  LAAAAENVVSI+DVET    +TL+GH K +HSVCWD +G+HLASVS+DSV+VW+L S
Sbjct  658  GHLLAAAAENVVSIIDVETDMKTRTLQGHNKVVHSVCWDANGDHLASVSQDSVKVWSLTS  717

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G    C+HELSSNGN+FHSC FHP Y  LLVIG YQ+LELWNM EN+TMT  AH+GLI +
Sbjct  718  GE---CIHELSSNGNQFHSCTFHPRYPKLLVIGGYQTLELWNMAENQTMTAQAHDGLIAA  774

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S V G+VASASHD+ +K+WK
Sbjct  775  LAQSPVTGIVASASHDRSVKIWK  797



>ref|XP_008785186.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Phoenix dactylifera]
Length=798

 Score =   206 bits (524),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G  LAAAAENVVSI+DVET    +TL+GH K +HSVCWD +G+HLASVS+DSV+VW+L S
Sbjct  659  GHLLAAAAENVVSIIDVETDMKTRTLQGHNKVVHSVCWDANGDHLASVSQDSVKVWSLTS  718

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G    C+HELSSNGN+FHSC FHP Y  LLVIG YQ+LELWNM EN+TMT  AH+GLI +
Sbjct  719  GE---CIHELSSNGNQFHSCTFHPRYPKLLVIGGYQTLELWNMAENQTMTAQAHDGLIAA  775

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S V G+VASASHD+ +K+WK
Sbjct  776  LAQSPVTGIVASASHDRSVKIWK  798



>ref|XP_004149861.1| PREDICTED: transcriptional corepressor LEUNIG-like [Cucumis sativus]
Length=728

 Score =   205 bits (521),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            GR LAAAA  VVSI+DVETQ CR  L+GH K IHSVCWDPSGE+LAS S+D  +VW  GS
Sbjct  586  GRTLAAAAGKVVSIIDVETQVCRLRLQGHKKKIHSVCWDPSGEYLASTSDDVAKVWKFGS  645

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G++G+C+HEL+ NGN FH+CVFHP+ +S+L+IG ++SLELW+MTENKT TL AHE L+ +
Sbjct  646  GSKGDCIHELNCNGNTFHTCVFHPTNTSVLIIGSHESLELWDMTENKTRTLQAHEKLVTA  705

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S   GL+ASASHD  +K+W+
Sbjct  706  LAASNATGLIASASHDDCVKIWQ  728



>ref|XP_002518113.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF44246.1| WD-repeat protein, putative [Ricinus communis]
Length=782

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 118/143 (83%), Gaps = 3/143 (2%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G  LAAAAENVVSI DVET     +L+GH+  +HSVCWD +G++LASVS++SVRVW+L S
Sbjct  643  GHLLAAAAENVVSIFDVETDRQTHSLQGHSTEVHSVCWDVNGDYLASVSQESVRVWSLAS  702

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G    C+HELSS+GNKFHSCVFHPSYS+LLVIG YQSLELWNM ENK MT+PAHE +I +
Sbjct  703  GE---CIHELSSSGNKFHSCVFHPSYSTLLVIGGYQSLELWNMAENKCMTIPAHECVISA  759

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S V G+VASASHDK +K+WK
Sbjct  760  LAQSPVTGMVASASHDKCVKIWK  782



>gb|ACN37000.1| unknown [Zea mays]
Length=367

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 119/143 (83%), Gaps = 3/143 (2%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G++LAAAAENVVSI D+ET   + TL+GH   + SVCWD +GE++ASVS+D V+VW++ +
Sbjct  228  GQFLAAAAENVVSIFDIETHGKKYTLQGHNTDVQSVCWDNNGEYIASVSQDLVKVWSMST  287

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+   C++ELSSNGNKFHSCVFHPSYS+LLVIG YQSLE+WNM +N+++T+ AHEGLI +
Sbjct  288  GD---CIYELSSNGNKFHSCVFHPSYSNLLVIGGYQSLEVWNMVKNQSLTVQAHEGLIAA  344

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S V G++ASASHD  +K+WK
Sbjct  345  LAQSPVTGMIASASHDNSVKVWK  367



>gb|KHG28610.1| Transcriptional corepressor LEUNIG -like protein [Gossypium arboreum]
Length=870

 Score =   204 bits (518),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 113/140 (81%), Gaps = 8/140 (6%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G+YLAAAAENVVSILD ETQTCR +L+GHTK IHSVCWDPSGE LASVSED+VRVW+  S
Sbjct  734  GKYLAAAAENVVSILDTETQTCRHSLQGHTKLIHSVCWDPSGELLASVSEDAVRVWSFAS  793

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+EG CVHELS NGNKFHSCVFHPS+ SLL      SLELWNM+ENKTMTL AHEGLI +
Sbjct  794  GSEGECVHELSCNGNKFHSCVFHPSFQSLL------SLELWNMSENKTMTLSAHEGLIAA  847

Query  297  LAVSTVAGLVASASH--DKI  244
            LAVS V  L     H  DK+
Sbjct  848  LAVSPVTRLSEMTVHGLDKM  867



>ref|XP_003570372.1| PREDICTED: transcriptional corepressor LEUNIG [Brachypodium distachyon]
Length=800

 Score =   203 bits (517),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 118/143 (83%), Gaps = 3/143 (2%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G++LAAA ENVVSI DVET T + TL+GH   + SVCWD +G +LASVS+D V+VW++ S
Sbjct  661  GQFLAAATENVVSIFDVETHTKKYTLQGHNTDVQSVCWDNTGSYLASVSQDLVKVWSISS  720

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G+   C+HE+SSNGNKFHSCVFHPSY++LLVIG YQSLELWNM +N++MT+ AHEGLI +
Sbjct  721  GD---CIHEVSSNGNKFHSCVFHPSYTNLLVIGGYQSLELWNMVKNQSMTVQAHEGLIAA  777

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S V G+VASASHD  +KLWK
Sbjct  778  LAQSPVTGMVASASHDNSVKLWK  800



>ref|XP_006420880.1| hypothetical protein CICLE_v10004358mg [Citrus clementina]
 gb|ESR34120.1| hypothetical protein CICLE_v10004358mg [Citrus clementina]
Length=552

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 115/143 (80%), Gaps = 3/143 (2%)
 Frame = -2

Query  657  GRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDSVRVWTLGS  478
            G  LAAA+ENVVSI DVET     + KGH+  IHSVCWD +GE+LASVS+DSVRVW+L S
Sbjct  413  GLLLAAASENVVSIFDVETDRLTHSFKGHSTEIHSVCWDTNGEYLASVSQDSVRVWSLAS  472

Query  477  GNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLPAHEGLIXS  298
            G    C+HELSS+GNKFHSC+FHPSY +L+VIG YQSLELWNM ENK MT+ AH+ +I +
Sbjct  473  GE---CIHELSSSGNKFHSCIFHPSYPTLMVIGGYQSLELWNMAENKCMTIAAHDCVISA  529

Query  297  LAVSTVAGLVASASHDKIIKLWK  229
            LA S V G+VASASHDK +K+WK
Sbjct  530  LAQSPVTGMVASASHDKSVKIWK  552



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1028498319500