BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF013C21

Length=666
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011100175.1|  PREDICTED: monosaccharide-sensing protein 2-...    238   6e-70   Sesamum indicum [beniseed]
gb|ABK29441.1|  sugar transport protein                                 226   2e-69   Coffea canephora [robusta coffee]
gb|EYU43535.1|  hypothetical protein MIMGU_mgv1a002513mg                235   3e-69   Erythranthe guttata [common monkey flower]
ref|XP_006342166.1|  PREDICTED: monosaccharide-sensing protein 2-...    236   4e-69   Solanum tuberosum [potatoes]
gb|EYU43534.1|  hypothetical protein MIMGU_mgv1a001953mg                236   6e-69   Erythranthe guttata [common monkey flower]
gb|EPS65490.1|  hypothetical protein M569_09283                         234   2e-68   Genlisea aurea
ref|NP_001190922.1|  monosaccharide-sensing protein 2                   229   6e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009595864.1|  PREDICTED: monosaccharide-sensing protein 2        232   1e-67   Nicotiana tomentosiformis
ref|NP_001289848.1|  monosaccharide-sensing protein 2                   231   2e-67   Solanum lycopersicum
dbj|BAH57059.1|  AT4G35300                                              228   2e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009796447.1|  PREDICTED: monosaccharide-sensing protein 2-...    230   8e-67   Nicotiana sylvestris
gb|KJB14186.1|  hypothetical protein B456_002G113400                    224   3e-66   Gossypium raimondii
ref|NP_849565.1|  monosaccharide-sensing protein 2                      228   3e-66   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195256.3|  monosaccharide-sensing protein 2                      228   4e-66   Arabidopsis thaliana [mouse-ear cress]
gb|KHN20087.1|  Monosaccharide-sensing protein 2                        227   8e-66   Glycine soja [wild soybean]
ref|XP_002867077.1|  hypothetical protein ARALYDRAFT_491117             227   9e-66   
gb|ABR25915.1|  sugar transporter type 2a                               212   1e-65   Oryza sativa Indica Group [Indian rice]
ref|XP_003527273.1|  PREDICTED: monosaccharide-sensing protein 2-...    226   1e-65   Glycine max [soybeans]
gb|KJB77473.1|  hypothetical protein B456_012G139000                    222   1e-65   Gossypium raimondii
emb|CDP07261.1|  unnamed protein product                                226   2e-65   Coffea canephora [robusta coffee]
ref|XP_007135975.1|  hypothetical protein PHAVU_009G007600g             225   5e-65   Phaseolus vulgaris [French bean]
gb|KHN33775.1|  Monosaccharide-sensing protein 2                        225   5e-65   Glycine soja [wild soybean]
ref|XP_006577928.1|  PREDICTED: monosaccharide-sensing protein 2-...    224   7e-65   Glycine max [soybeans]
gb|KJB14185.1|  hypothetical protein B456_002G113400                    224   8e-65   Gossypium raimondii
gb|KHG10189.1|  Monosaccharide-sensing 2 -like protein                  224   9e-65   Gossypium arboreum [tree cotton]
ref|XP_011074068.1|  PREDICTED: monosaccharide-sensing protein 2-...    224   1e-64   Sesamum indicum [beniseed]
ref|XP_010446942.1|  PREDICTED: monosaccharide-sensing protein 2        224   1e-64   Camelina sativa [gold-of-pleasure]
gb|KJB14177.1|  hypothetical protein B456_002G113400                    224   1e-64   Gossypium raimondii
ref|XP_006486570.1|  PREDICTED: monosaccharide-sensing protein 2-...    224   1e-64   Citrus sinensis [apfelsine]
gb|KDO68402.1|  hypothetical protein CISIN_1g004750mg                   224   1e-64   Citrus sinensis [apfelsine]
ref|XP_006422393.1|  hypothetical protein CICLE_v10027893mg             223   2e-64   
ref|XP_008358445.1|  PREDICTED: monosaccharide-sensing protein 2-...    212   2e-64   
ref|XP_010432297.1|  PREDICTED: monosaccharide-sensing protein 2-...    223   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_004500833.1|  PREDICTED: monosaccharide-sensing protein 2-...    223   2e-64   Cicer arietinum [garbanzo]
emb|CDX69128.1|  BnaC01g03250D                                          222   2e-64   
emb|CDY65623.1|  BnaCnng48010D                                          222   3e-64   Brassica napus [oilseed rape]
ref|XP_006283193.1|  hypothetical protein CARUB_v10004225mg             223   3e-64   Capsella rubella
ref|XP_003603869.1|  Monosaccharide-sensing protein                     222   4e-64   
ref|XP_010061214.1|  PREDICTED: monosaccharide-sensing protein 2-...    223   4e-64   Eucalyptus grandis [rose gum]
gb|KHG04802.1|  Monosaccharide-sensing protein 2                        222   4e-64   Gossypium arboreum [tree cotton]
ref|XP_003603868.1|  Monosaccharide-sensing protein                     222   4e-64   Medicago truncatula
ref|XP_009103100.1|  PREDICTED: monosaccharide-sensing protein 2        222   5e-64   
gb|KJB79729.1|  hypothetical protein B456_013G064200                    218   6e-64   Gossypium raimondii
ref|XP_007018122.1|  Tonoplast monosaccharide transporter2 isoform 4    222   6e-64   
gb|KHG04801.1|  Monosaccharide-sensing protein 2                        222   7e-64   Gossypium arboreum [tree cotton]
ref|XP_007018119.1|  Tonoplast monosaccharide transporter2 isoform 1    222   7e-64   
gb|KJB77472.1|  hypothetical protein B456_012G139000                    221   1e-63   Gossypium raimondii
ref|XP_008237926.1|  PREDICTED: monosaccharide-sensing protein 2        221   2e-63   Prunus mume [ume]
ref|XP_010094525.1|  Monosaccharide-sensing protein 2                   220   2e-63   Morus notabilis
ref|XP_010437493.1|  PREDICTED: monosaccharide-sensing protein 2-...    220   3e-63   
gb|AJO70165.1|  tonoplast monosaccharide transporters 1                 220   3e-63   Camellia sinensis [black tea]
ref|XP_007043079.1|  Tonoplast monosaccharide transporter2              220   3e-63   
ref|XP_008373385.1|  PREDICTED: monosaccharide-sensing protein 2-...    220   4e-63   
ref|XP_007210337.1|  hypothetical protein PRUPE_ppa001932mg             219   5e-63   Prunus persica
dbj|BAJ87413.1|  predicted protein                                      213   1e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004500684.1|  PREDICTED: monosaccharide-sensing protein 2-...    218   1e-62   
ref|XP_003604104.1|  Monosaccharide-sensing protein                     218   1e-62   Medicago truncatula
ref|XP_007137297.1|  hypothetical protein PHAVU_009G115500g             218   2e-62   Phaseolus vulgaris [French bean]
ref|XP_010066352.1|  PREDICTED: monosaccharide-sensing protein 2-...    218   3e-62   Eucalyptus grandis [rose gum]
gb|KJB79728.1|  hypothetical protein B456_013G064200                    217   4e-62   Gossypium raimondii
gb|KHG05233.1|  Monosaccharide-sensing 2 -like protein                  217   5e-62   Gossypium arboreum [tree cotton]
gb|KHN19961.1|  Monosaccharide-sensing protein 2                        216   9e-62   Glycine soja [wild soybean]
ref|XP_003526737.1|  PREDICTED: monosaccharide-sensing protein 2-...    216   1e-61   Glycine max [soybeans]
ref|XP_003543932.1|  PREDICTED: monosaccharide-sensing protein 2-...    216   1e-61   
gb|KHN33643.1|  Monosaccharide-sensing protein 2                        216   1e-61   Glycine soja [wild soybean]
ref|XP_003518591.1|  PREDICTED: monosaccharide-sensing protein 2-...    215   1e-61   Glycine max [soybeans]
ref|XP_010266257.1|  PREDICTED: monosaccharide-sensing protein 2 ...    216   2e-61   Nelumbo nucifera [Indian lotus]
ref|XP_010090703.1|  Monosaccharide-sensing protein 2                   215   2e-61   Morus notabilis
gb|KHN46863.1|  Monosaccharide-sensing protein 2                        215   2e-61   Glycine soja [wild soybean]
ref|XP_008440928.1|  PREDICTED: LOW QUALITY PROTEIN: monosacchari...    214   3e-61   
ref|XP_010686712.1|  PREDICTED: monosaccharide-sensing protein 2        214   3e-61   Beta vulgaris subsp. vulgaris [field beet]
emb|CDI66591.1|  putative sugar transporter type 2a protein             214   4e-61   Saccharum hybrid cultivar R570
ref|XP_004289029.1|  PREDICTED: monosaccharide-sensing protein 2-...    214   5e-61   Fragaria vesca subsp. vesca
ref|XP_002510716.1|  sugar transporter, putative                        214   5e-61   Ricinus communis
emb|CBI40753.3|  unnamed protein product                                213   5e-61   Vitis vinifera
gb|EMS49950.1|  Monosaccharide-sensing protein 2                        213   5e-61   Triticum urartu
ref|XP_006412119.1|  hypothetical protein EUTSA_v10024517mg             214   7e-61   Eutrema salsugineum [saltwater cress]
ref|XP_010539774.1|  PREDICTED: monosaccharide-sensing protein 1-...    213   9e-61   Tarenaya hassleriana [spider flower]
emb|CDI66586.1|  putative sugar transporter type 2a protein             213   1e-60   Saccharum hybrid cultivar R570
emb|CAN59780.1|  hypothetical protein VITISV_024656                     213   1e-60   Vitis vinifera
ref|NP_001267873.1|  hexose transporter-like                            213   1e-60   Vitis vinifera
ref|XP_006647093.1|  PREDICTED: monosaccharide-sensing protein 2-...    213   1e-60   Oryza brachyantha
gb|AIQ77649.1|  tonoplastic transporter 1                               213   1e-60   Vitis vinifera
gb|EAY85098.1|  hypothetical protein OsI_06450                          212   1e-60   Oryza sativa Indica Group [Indian rice]
ref|NP_001046359.1|  Os02g0229400                                       213   1e-60   
dbj|BAJ89532.1|  predicted protein                                      213   2e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW64229.1|  hypothetical protein EUGRSUZ_G01880                     213   2e-60   Eucalyptus grandis [rose gum]
gb|AAX47312.1|  hexose transporter 6                                    213   2e-60   Vitis vinifera
gb|EAZ22316.1|  hypothetical protein OsJ_05971                          213   2e-60   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004300112.1|  PREDICTED: monosaccharide-sensing protein 2        212   3e-60   Fragaria vesca subsp. vesca
ref|XP_010909820.1|  PREDICTED: monosaccharide-sensing protein 2-...    212   3e-60   Elaeis guineensis
emb|CDY31497.1|  BnaC05g16060D                                          210   3e-60   Brassica napus [oilseed rape]
ref|XP_008464819.1|  PREDICTED: monosaccharide-sensing protein 2-...    211   4e-60   Cucumis melo [Oriental melon]
ref|XP_009340799.1|  PREDICTED: monosaccharide-sensing protein 2-...    211   4e-60   Pyrus x bretschneideri [bai li]
ref|XP_010029562.1|  PREDICTED: monosaccharide-sensing protein 2-...    211   5e-60   Eucalyptus grandis [rose gum]
ref|XP_010680636.1|  PREDICTED: monosaccharide-sensing protein 2-...    211   5e-60   Beta vulgaris subsp. vulgaris [field beet]
gb|EMT06669.1|  Monosaccharide-sensing protein 2                        211   6e-60   
ref|XP_009608796.1|  PREDICTED: monosaccharide-sensing protein 2-...    211   6e-60   Nicotiana tomentosiformis
ref|XP_004134823.1|  PREDICTED: monosaccharide-sensing protein 2-...    211   7e-60   
gb|KDO85210.1|  hypothetical protein CISIN_1g004673mg                   207   7e-60   Citrus sinensis [apfelsine]
ref|XP_004169167.1|  PREDICTED: LOW QUALITY PROTEIN: monosacchari...    211   7e-60   
emb|CDY29502.1|  BnaA06g14680D                                          210   7e-60   Brassica napus [oilseed rape]
gb|KGN49001.1|  hypothetical protein Csa_6G509700                       211   8e-60   Cucumis sativus [cucumbers]
ref|XP_009763350.1|  PREDICTED: monosaccharide-sensing protein 2-...    211   9e-60   Nicotiana sylvestris
ref|XP_010690557.1|  PREDICTED: monosaccharide-sensing protein 2        211   9e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011040809.1|  PREDICTED: monosaccharide-sensing protein 2-...    211   1e-59   Populus euphratica
ref|XP_004951395.1|  PREDICTED: monosaccharide-sensing protein 2-...    210   1e-59   Setaria italica
ref|XP_010548175.1|  PREDICTED: monosaccharide-sensing protein 2        210   1e-59   Tarenaya hassleriana [spider flower]
ref|XP_009149562.1|  PREDICTED: monosaccharide-sensing protein 1        210   1e-59   Brassica rapa
gb|AFW59276.1|  hypothetical protein ZEAMMB73_154299                    209   2e-59   
ref|XP_009390770.1|  PREDICTED: monosaccharide-sensing protein 2-...    210   2e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008645619.1|  PREDICTED: monosaccharide-sensing protein 2-...    210   2e-59   Zea mays [maize]
emb|CBI37732.3|  unnamed protein product                                208   2e-59   Vitis vinifera
ref|XP_008778122.1|  PREDICTED: monosaccharide-sensing protein 2-...    209   2e-59   
ref|XP_008448165.1|  PREDICTED: monosaccharide-sensing protein 2        209   3e-59   Cucumis melo [Oriental melon]
ref|XP_003571780.1|  PREDICTED: monosaccharide-sensing protein 2-...    209   3e-59   Brachypodium distachyon [annual false brome]
gb|AIN39841.1|  hypothetical protein                                    209   3e-59   Zoysia matrella [Japanese carpet grass]
ref|XP_004154526.1|  PREDICTED: monosaccharide-sensing protein 2-...    209   3e-59   
ref|XP_004139974.1|  PREDICTED: monosaccharide-sensing protein 2-...    209   3e-59   
ref|XP_002282975.1|  PREDICTED: monosaccharide-sensing protein 2        209   3e-59   Vitis vinifera
ref|XP_010537220.1|  PREDICTED: monosaccharide-sensing protein 1-...    209   4e-59   Tarenaya hassleriana [spider flower]
ref|XP_009392211.1|  PREDICTED: monosaccharide-sensing protein 2-...    209   4e-59   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ90138.1|  predicted protein                                      209   5e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002467580.1|  hypothetical protein SORBIDRAFT_01g030430          209   5e-59   Sorghum bicolor [broomcorn]
emb|CDP01766.1|  unnamed protein product                                208   5e-59   Coffea canephora [robusta coffee]
emb|CAD58958.1|  hexose transporter                                     208   6e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFP89954.1|  tonoplastic transporter 2                               208   6e-59   Vitis vinifera
ref|XP_008382498.1|  PREDICTED: monosaccharide-sensing protein 2-...    208   8e-59   
ref|XP_010678631.1|  PREDICTED: monosaccharide-sensing protein 2-...    208   8e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007142576.1|  hypothetical protein PHAVU_008G292400g             208   8e-59   Phaseolus vulgaris [French bean]
ref|XP_009401004.1|  PREDICTED: monosaccharide-sensing protein 2-...    207   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003574265.1|  PREDICTED: monosaccharide-sensing protein 2-...    207   1e-58   Brachypodium distachyon [annual false brome]
gb|KDO85208.1|  hypothetical protein CISIN_1g004673mg                   207   1e-58   Citrus sinensis [apfelsine]
ref|XP_006435423.1|  hypothetical protein CICLE_v10000400mg             207   2e-58   Citrus clementina [clementine]
emb|CDP14489.1|  unnamed protein product                                207   2e-58   Coffea canephora [robusta coffee]
ref|XP_002520608.1|  sugar transporter, putative                        207   2e-58   Ricinus communis
ref|XP_009397963.1|  PREDICTED: monosaccharide-sensing protein 2-...    206   3e-58   
gb|ABK29442.1|  sugar transport protein                                 191   4e-58   Coffea canephora [robusta coffee]
ref|NP_001065182.1|  Os10g0539900                                       206   6e-58   
ref|XP_006416357.1|  hypothetical protein EUTSA_v10006916mg             206   6e-58   Eutrema salsugineum [saltwater cress]
dbj|BAJ33724.1|  unnamed protein product                                206   6e-58   Eutrema halophilum
gb|EEC67373.1|  hypothetical protein OsI_34495                          205   7e-58   Oryza sativa Indica Group [Indian rice]
emb|CAN80213.1|  hypothetical protein VITISV_042076                     205   8e-58   Vitis vinifera
ref|XP_010270527.1|  PREDICTED: monosaccharide-sensing protein 2        205   1e-57   Nelumbo nucifera [Indian lotus]
emb|CBI21577.3|  unnamed protein product                                204   1e-57   Vitis vinifera
ref|XP_010459775.1|  PREDICTED: monosaccharide-sensing protein 1-...    204   1e-57   Camelina sativa [gold-of-pleasure]
gb|EPS57524.1|  hypothetical protein M569_17293                         204   2e-57   Genlisea aurea
ref|XP_010477336.1|  PREDICTED: monosaccharide-sensing protein 1        204   2e-57   Camelina sativa [gold-of-pleasure]
gb|EMS63940.1|  Monosaccharide-sensing protein 2                        204   2e-57   Triticum urartu
tpg|DAA46101.1|  TPA: hypothetical protein ZEAMMB73_051534              196   2e-57   
ref|XP_002276373.1|  PREDICTED: monosaccharide-sensing protein 2        204   2e-57   Vitis vinifera
gb|EMT29091.1|  Monosaccharide-sensing protein 2                        204   3e-57   
ref|XP_009372620.1|  PREDICTED: monosaccharide-sensing protein 2        204   3e-57   Pyrus x bretschneideri [bai li]
gb|AAO37640.1|  putative sugar transporter type 2a                      204   3e-57   Saccharum hybrid cultivar Q117
tpg|DAA46100.1|  TPA: hypothetical protein ZEAMMB73_051534              198   6e-57   
gb|KDP36756.1|  hypothetical protein JCGZ_08047                         202   9e-57   Jatropha curcas
ref|XP_009110209.1|  PREDICTED: monosaccharide-sensing protein 1        202   1e-56   Brassica rapa
emb|CDX96618.1|  BnaA08g21610D                                          202   1e-56   
emb|CDY33650.1|  BnaC08g19500D                                          202   1e-56   Brassica napus [oilseed rape]
ref|XP_010063149.1|  PREDICTED: monosaccharide-sensing protein 2-...    202   1e-56   Eucalyptus grandis [rose gum]
ref|XP_009333794.1|  PREDICTED: monosaccharide-sensing protein 2-...    201   2e-56   
ref|XP_002307812.1|  hypothetical protein POPTR_0005s27680g             201   2e-56   Populus trichocarpa [western balsam poplar]
ref|XP_011098017.1|  PREDICTED: monosaccharide-sensing protein 2-...    201   2e-56   Sesamum indicum [beniseed]
ref|XP_007201798.1|  hypothetical protein PRUPE_ppa001957mg             201   2e-56   Prunus persica
ref|XP_008377843.1|  PREDICTED: monosaccharide-sensing protein 2-...    201   2e-56   
ref|XP_006306868.1|  hypothetical protein CARUB_v10008415mg             201   3e-56   
ref|XP_009341490.1|  PREDICTED: monosaccharide-sensing protein 2-...    201   4e-56   Pyrus x bretschneideri [bai li]
gb|KDP47010.1|  hypothetical protein JCGZ_10737                         200   5e-56   Jatropha curcas
ref|XP_008235816.1|  PREDICTED: monosaccharide-sensing protein 2        200   5e-56   Prunus mume [ume]
ref|XP_004290074.1|  PREDICTED: monosaccharide-sensing protein 2        200   5e-56   Fragaria vesca subsp. vesca
ref|XP_004983796.1|  PREDICTED: monosaccharide-sensing protein 2-...    200   5e-56   Setaria italica
ref|XP_010503840.1|  PREDICTED: monosaccharide-sensing protein 3-...    200   6e-56   Camelina sativa [gold-of-pleasure]
ref|NP_173508.1|  tonoplast monosaccharide transporter1                 200   6e-56   Arabidopsis thaliana [mouse-ear cress]
gb|AAD30608.1|AC007369_18  Sugar transporter                            200   7e-56   Arabidopsis thaliana [mouse-ear cress]
emb|CAN64713.1|  hypothetical protein VITISV_043728                     185   7e-56   Vitis vinifera
ref|XP_009359630.1|  PREDICTED: monosaccharide-sensing protein 2-...    200   8e-56   
ref|XP_009359631.1|  PREDICTED: monosaccharide-sensing protein 2-...    199   8e-56   
ref|XP_009359629.1|  PREDICTED: monosaccharide-sensing protein 2-...    200   9e-56   Pyrus x bretschneideri [bai li]
ref|XP_006403910.1|  hypothetical protein EUTSA_v10011113mg             199   9e-56   Eutrema salsugineum [saltwater cress]
ref|XP_010940242.1|  PREDICTED: monosaccharide-sensing protein 2-...    199   1e-55   Elaeis guineensis
gb|EMT28528.1|  Monosaccharide-sensing protein 3                        196   1e-55   
ref|XP_009115837.1|  PREDICTED: monosaccharide-sensing protein 3        199   1e-55   Brassica rapa
ref|XP_010515555.1|  PREDICTED: monosaccharide-sensing protein 3        199   2e-55   Camelina sativa [gold-of-pleasure]
gb|KCW55684.1|  hypothetical protein EUGRSUZ_I01534                     190   2e-55   Eucalyptus grandis [rose gum]
ref|XP_010426703.1|  PREDICTED: monosaccharide-sensing protein 3-...    199   2e-55   Camelina sativa [gold-of-pleasure]
gb|EYU30848.1|  hypothetical protein MIMGU_mgv1a001984mg                199   2e-55   Erythranthe guttata [common monkey flower]
ref|XP_007204446.1|  hypothetical protein PRUPE_ppa026426mg             198   4e-55   Prunus persica
ref|XP_006384856.1|  transporter-related family protein                 198   4e-55   
ref|NP_001151936.1|  LOC100285573                                       198   4e-55   Zea mays [maize]
gb|ACG25339.1|  hexose transporter                                      197   5e-55   Zea mays [maize]
ref|NP_001147067.1|  hexose transporter                                 197   5e-55   Zea mays [maize]
ref|XP_004978456.1|  PREDICTED: monosaccharide-sensing protein 2-...    197   6e-55   
gb|KFK34392.1|  hypothetical protein AALP_AA5G139300                    197   6e-55   Arabis alpina [alpine rockcress]
ref|XP_008242106.1|  PREDICTED: monosaccharide-sensing protein 2-...    197   7e-55   Prunus mume [ume]
ref|XP_002893133.1|  hypothetical protein ARALYDRAFT_472320             196   1e-54   
ref|XP_009589978.1|  PREDICTED: monosaccharide-sensing protein 2-...    196   1e-54   Nicotiana tomentosiformis
ref|XP_008392888.1|  PREDICTED: monosaccharide-sensing protein 2-...    192   1e-54   
ref|XP_009775817.1|  PREDICTED: monosaccharide-sensing protein 2-...    196   2e-54   Nicotiana sylvestris
ref|XP_011099908.1|  PREDICTED: monosaccharide-sensing protein 2-...    196   2e-54   Sesamum indicum [beniseed]
ref|XP_006343319.1|  PREDICTED: monosaccharide-sensing protein 2-...    195   4e-54   Solanum tuberosum [potatoes]
ref|NP_001190054.1|  tonoplast monosaccharide transporter3              195   5e-54   Arabidopsis thaliana [mouse-ear cress]
dbj|BAI94493.1|  sugar transporter                                      194   5e-54   Dianthus caryophyllus [carnation]
ref|XP_008812559.1|  PREDICTED: monosaccharide-sensing protein 2-...    194   5e-54   Phoenix dactylifera
ref|XP_009148978.1|  PREDICTED: monosaccharide-sensing protein 3        194   6e-54   Brassica rapa
ref|NP_001280690.1|  monosaccharide-sensing protein 2-like              194   6e-54   Solanum lycopersicum
ref|XP_009776539.1|  PREDICTED: monosaccharide-sensing protein 2-...    194   1e-53   Nicotiana sylvestris
ref|XP_009622210.1|  PREDICTED: monosaccharide-sensing protein 2-...    194   1e-53   Nicotiana tomentosiformis
ref|XP_006292750.1|  hypothetical protein CARUB_v10018997mg             193   2e-53   
emb|CDX78009.1|  BnaA09g32040D                                          192   2e-53   
ref|XP_004144248.1|  PREDICTED: monosaccharide-sensing protein 2-...    192   2e-53   Cucumis sativus [cucumbers]
ref|XP_006855646.1|  hypothetical protein AMTR_s00044p00110510          192   3e-53   
emb|CDX73717.1|  BnaC08g22860D                                          192   3e-53   
ref|XP_002312798.1|  transporter-related family protein                 192   4e-53   
ref|XP_004964709.1|  PREDICTED: monosaccharide-sensing protein 2-...    192   6e-53   Setaria italica
ref|XP_011000869.1|  PREDICTED: monosaccharide-sensing protein 2-...    192   6e-53   Populus euphratica
ref|XP_008786687.1|  PREDICTED: monosaccharide-sensing protein 2-...    191   9e-53   Phoenix dactylifera
ref|XP_002877807.1|  predicted protein                                  190   2e-52   
emb|CDY16303.1|  BnaC01g23380D                                          189   2e-52   Brassica napus [oilseed rape]
ref|XP_004977696.1|  PREDICTED: monosaccharide-sensing protein 2-...    179   3e-52   Setaria italica
ref|XP_002300629.1|  hypothetical protein POPTR_0002s00760g             190   3e-52   Populus trichocarpa [western balsam poplar]
ref|XP_010028861.1|  PREDICTED: LOW QUALITY PROTEIN: monosacchari...    189   3e-52   
emb|CDY33276.1|  BnaA01g19430D                                          189   3e-52   Brassica napus [oilseed rape]
ref|NP_190717.1|  tonoplast monosaccharide transporter3                 189   3e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006662557.1|  PREDICTED: monosaccharide-sensing protein 2-...    189   4e-52   
ref|XP_007203009.1|  hypothetical protein PRUPE_ppa017631mg             189   6e-52   Prunus persica
ref|NP_001067890.1|  Os11g0475600                                       189   6e-52   
gb|EAY80902.1|  hypothetical protein OsI_36080                          189   7e-52   Oryza sativa Indica Group [Indian rice]
ref|XP_008242155.1|  PREDICTED: monosaccharide-sensing protein 2-...    188   8e-52   Prunus mume [ume]
ref|XP_011034826.1|  PREDICTED: monosaccharide-sensing protein 2-...    188   1e-51   Populus euphratica
ref|XP_011041174.1|  PREDICTED: monosaccharide-sensing protein 2-...    187   2e-51   Populus euphratica
ref|XP_003560303.1|  PREDICTED: monosaccharide-sensing protein 2-...    187   3e-51   Brachypodium distachyon [annual false brome]
ref|XP_002439068.1|  hypothetical protein SORBIDRAFT_10g031000          184   2e-50   Sorghum bicolor [broomcorn]
dbj|BAK02857.1|  predicted protein                                      183   5e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB12351.1|  hypothetical protein B456_002G014400                    182   2e-49   Gossypium raimondii
gb|KJB12354.1|  hypothetical protein B456_002G014400                    182   2e-49   Gossypium raimondii
ref|XP_004289030.1|  PREDICTED: monosaccharide-sensing protein 2        182   2e-49   Fragaria vesca subsp. vesca
ref|XP_009359632.1|  PREDICTED: monosaccharide-sensing protein 2-...    178   3e-48   Pyrus x bretschneideri [bai li]
gb|EYU40481.1|  hypothetical protein MIMGU_mgv1a001997mg                178   3e-48   Erythranthe guttata [common monkey flower]
gb|EMS60524.1|  Monosaccharide-sensing protein 3                        174   5e-48   Triticum urartu
gb|KJB31963.1|  hypothetical protein B456_005G216600                    177   1e-47   Gossypium raimondii
ref|XP_006649210.1|  PREDICTED: monosaccharide-sensing protein 2-...    176   1e-47   
gb|EMT02609.1|  Monosaccharide-sensing protein 3                        176   2e-47   
ref|XP_011022133.1|  PREDICTED: monosaccharide-sensing protein 2-...    176   2e-47   Populus euphratica
ref|XP_002306419.1|  hypothetical protein POPTR_0005s10180g             176   2e-47   
ref|XP_010097645.1|  Monosaccharide-sensing protein 3                   176   2e-47   Morus notabilis
gb|EMS63099.1|  Monosaccharide-sensing protein 3                        176   2e-47   Triticum urartu
gb|KHG14026.1|  Monosaccharide-sensing 2 -like protein                  176   3e-47   Gossypium arboreum [tree cotton]
gb|EMT01868.1|  Monosaccharide-sensing protein 2                        172   2e-46   
ref|XP_004954530.1|  PREDICTED: monosaccharide-sensing protein 2-...    172   5e-46   Setaria italica
gb|EAY88138.1|  hypothetical protein OsI_09573                          171   1e-45   Oryza sativa Indica Group [Indian rice]
dbj|BAD23011.1|  putative hexose transporter                            170   2e-45   Oryza sativa Japonica Group [Japonica rice]
gb|KHG00737.1|  Monosaccharide-sensing 2 -like protein                  169   7e-45   Gossypium arboreum [tree cotton]
gb|KDP43790.1|  hypothetical protein JCGZ_22417                         169   9e-45   Jatropha curcas
ref|XP_006653836.1|  PREDICTED: monosaccharide-sensing protein 2-...    164   3e-43   Oryza brachyantha
gb|AGT16371.1|  hexose transporter                                      163   5e-43   Saccharum hybrid cultivar R570
emb|CAA90628.1|  sugar transporter                                      162   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010029563.1|  PREDICTED: monosaccharide-sensing protein 2-...    162   1e-42   Eucalyptus grandis [rose gum]
gb|EEE58264.1|  hypothetical protein OsJ_09268                          161   2e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002979533.1|  hypothetical protein SELMODRAFT_111167             162   2e-42   
gb|EAY88374.1|  hypothetical protein OsI_09831                          161   2e-42   Oryza sativa Indica Group [Indian rice]
gb|AAN17390.1|  Putative sugar transporter protein                      161   2e-42   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA85398.1|  unnamed protein product                                162   3e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003573173.1|  PREDICTED: monosaccharide-sensing protein 2-...    160   5e-42   Brachypodium distachyon [annual false brome]
ref|XP_002977746.1|  hypothetical protein SELMODRAFT_10582              160   7e-42   
ref|XP_003562146.1|  PREDICTED: monosaccharide-sensing protein 2-...    159   2e-41   
ref|XP_001784511.1|  predicted protein                                  158   4e-41   
ref|XP_003629095.1|  Monosaccharide-sensing protein                     157   1e-40   
ref|XP_004509464.1|  PREDICTED: monosaccharide-sensing protein 2-...    157   1e-40   Cicer arietinum [garbanzo]
ref|XP_007156262.1|  hypothetical protein PHAVU_003G271500g             152   4e-39   Phaseolus vulgaris [French bean]
ref|XP_001761207.1|  predicted protein                                  151   1e-38   
ref|XP_003548779.1|  PREDICTED: monosaccharide-sensing protein 3-...    150   3e-38   Glycine max [soybeans]
ref|XP_007158028.1|  hypothetical protein PHAVU_002G118100g             150   5e-38   Phaseolus vulgaris [French bean]
ref|XP_002970170.1|  hypothetical protein SELMODRAFT_231525             150   6e-38   
gb|KHN35942.1|  Monosaccharide-sensing protein 3                        149   6e-38   Glycine soja [wild soybean]
ref|XP_003517121.1|  PREDICTED: monosaccharide-sensing protein 2-...    149   7e-38   
ref|XP_004977442.1|  PREDICTED: monosaccharide-sensing protein 2-...    139   2e-37   
ref|XP_003537696.1|  PREDICTED: monosaccharide-sensing protein 2-...    148   2e-37   Glycine max [soybeans]
emb|CAD58959.1|  sugar transporter                                      147   4e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001754179.1|  predicted protein                                  144   3e-36   
gb|AES95370.2|  tonoplast monosaccharide transporter 2                  145   4e-36   
ref|XP_004512287.1|  PREDICTED: monosaccharide-sensing protein 2-...    144   4e-36   
ref|XP_003612412.1|  Monosaccharide-sensing protein                     144   5e-36   
gb|AFK36736.1|  unknown                                                 139   6e-36   
ref|XP_001773057.1|  predicted protein                                  144   7e-36   
ref|XP_002981960.1|  hypothetical protein SELMODRAFT_179172             142   3e-35   
ref|XP_002978337.1|  hypothetical protein SELMODRAFT_268165             141   7e-35   
ref|XP_002982939.1|  hypothetical protein SELMODRAFT_445340             139   2e-34   
ref|XP_009387331.1|  PREDICTED: monosaccharide-sensing protein 1-...    137   5e-34   
ref|XP_010237536.1|  PREDICTED: monosaccharide-sensing protein 2-...    136   7e-34   
ref|XP_003577342.1|  PREDICTED: monosaccharide-sensing protein 2-...    135   5e-33   
ref|XP_006663052.1|  PREDICTED: monosaccharide-sensing protein 2-...    132   8e-32   
gb|ABA94777.1|  Sugar transporter, putative, expressed                  131   1e-31   
gb|ABA94776.1|  Sugar transporter, putative, expressed                  131   1e-31   
gb|EEC68553.1|  hypothetical protein OsI_36866                          131   1e-31   
ref|XP_002986014.1|  hypothetical protein SELMODRAFT_182142             126   2e-29   
ref|XP_002981894.1|  hypothetical protein SELMODRAFT_179271             126   2e-29   
ref|XP_003614108.1|  Monosaccharide-sensing protein                     125   4e-29   
ref|XP_004979746.1|  PREDICTED: monosaccharide-sensing protein 3-...    123   1e-28   
ref|NP_001140361.1|  uncharacterized protein LOC100272411               118   1e-27   
ref|XP_008676725.1|  PREDICTED: uncharacterized protein LOC100272...    118   2e-27   
gb|AAN40021.1|  putative sugar transporter protein                      119   3e-27   
ref|XP_002449882.1|  hypothetical protein SORBIDRAFT_05g024860          119   4e-27   
gb|AAM94321.1|  putative sugar transporter                              119   4e-27   
ref|XP_008676723.1|  PREDICTED: uncharacterized protein LOC100272...    118   7e-27   
ref|XP_008242156.1|  PREDICTED: monosaccharide-sensing protein 2-...    110   2e-26   
ref|XP_002453101.1|  hypothetical protein SORBIDRAFT_04g038470          108   5e-26   
gb|ABK93009.1|  unknown                                                 105   2e-25   
ref|WP_018699802.1|  hypothetical protein                             93.6    1e-18   
ref|WP_019233467.1|  sugar:proton symporter                           93.6    1e-18   
ref|WP_031563482.1|  sugar:proton symporter                           91.7    6e-18   
ref|WP_028380912.1|  sugar:proton symporter                           91.7    6e-18   
ref|WP_028379283.1|  sugar:proton symporter                           89.4    4e-17   
ref|WP_027228917.1|  sugar:proton symporter                           89.4    4e-17   
ref|WP_028378007.1|  sugar:proton symporter                           89.4    4e-17   
ref|WP_018631168.1|  hypothetical protein                             89.0    5e-17   
ref|WP_003635103.1|  sugar:proton symporter                           89.0    6e-17   
ref|WP_043236249.1|  sugar transporter                                88.6    6e-17   
ref|WP_027269579.1|  sugar:proton symporter                           88.2    9e-17   
ref|WP_029557156.1|  sugar transporter                                87.8    1e-16   
ref|WP_024277537.1|  sugar transporter                                87.8    1e-16   
ref|WP_035714084.1|  sugar transporter                                87.0    2e-16   
ref|WP_041339107.1|  major facilitator transporter                    87.0    2e-16   
ref|XP_005174792.1|  PREDICTED: facilitated trehalose transporter...  88.2    3e-16   
gb|ABS66075.1|  sugar transporter                                     87.0    3e-16   
ref|WP_013644894.1|  major facilitator transporter                    86.3    4e-16   
ref|WP_020694258.1|  hypothetical protein                             86.3    4e-16   
ref|WP_007765369.1|  MFS transporter                                  85.9    5e-16   
ref|WP_010621797.1|  MFS transporter                                  85.9    6e-16   
ref|WP_041576361.1|  sugar transporter                                85.9    6e-16   
gb|ABM54152.1|  sugar transporter                                     85.5    6e-16   
ref|WP_041882616.1|  sugar:proton symporter                           85.9    7e-16   
emb|CEG58058.1|  putative metabolite transport protein YwtG           85.5    8e-16   
ref|XP_003693200.1|  PREDICTED: solute carrier family 2, facilita...  85.9    9e-16   
gb|EEF77612.1|  transporter, major facilitator family protein         83.6    9e-16   
ref|WP_028383633.1|  sugar:proton symporter                           85.5    9e-16   
ref|XP_006621467.1|  PREDICTED: solute carrier family 2, facilita...  85.9    9e-16   
ref|WP_006872344.1|  sugar:proton symporter                           85.5    1e-15   
ref|WP_025519285.1|  sugar:proton symporter                           83.6    1e-15   
ref|WP_028555263.1|  MFS transporter                                  85.1    1e-15   
gb|EFB42172.1|  hypothetical protein pah_c014o100                     84.7    1e-15   
ref|WP_027223498.1|  sugar:proton symporter                           85.1    1e-15   
ref|WP_027222610.1|  sugar:proton symporter                           85.1    1e-15   
ref|WP_036745963.1|  major facilitator transporter                    84.7    1e-15   
ref|WP_010946170.1|  sugar:proton symporter                           85.1    1e-15   
ref|WP_027266629.1|  sugar:proton symporter                           85.1    1e-15   
ref|WP_035891457.1|  sugar:proton symporter                           85.1    1e-15   
ref|WP_007560303.1|  MFS transporter                                  84.7    1e-15   
gb|ERG08448.1|  sugar transporter                                     82.4    1e-15   
ref|WP_010654727.1|  sugar:proton symporter                           84.7    1e-15   
ref|WP_033012988.1|  major facilitator transporter                    82.0    1e-15   
ref|XP_003398790.1|  PREDICTED: solute carrier family 2, facilita...  85.1    1e-15   
ref|WP_033027706.1|  major facilitator transporter                    82.0    2e-15   
ref|WP_032827048.1|  MULTISPECIES: major facilitator transporter      82.0    2e-15   
dbj|GAK28219.1|  sugar transporter                                    79.7    2e-15   
ref|XP_003489694.1|  PREDICTED: solute carrier family 2, facilita...  84.7    2e-15   
ref|WP_019234077.1|  hypothetical protein                             84.0    2e-15   
ref|WP_018577072.1|  sugar:proton symporter                           84.3    2e-15   
ref|WP_043553534.1|  major facilitator transporter                    84.0    2e-15   
ref|WP_014216842.1|  sugar:proton symporter                           84.0    3e-15   
ref|XP_009024311.1|  hypothetical protein HELRODRAFT_114157           84.0    3e-15   
ref|WP_032845792.1|  MULTISPECIES: MFS transporter                    84.0    3e-15   
ref|WP_033012985.1|  major facilitator transporter                    82.0    3e-15   
ref|WP_004306567.1|  MFS transporter                                  84.0    3e-15   
gb|KFC79470.1|  sugar-proton symporter                                84.0    3e-15   
ref|WP_034793608.1|  MFS transporter                                  84.0    3e-15   
ref|WP_004307928.1|  MULTISPECIES: MFS transporter                    83.6    3e-15   
gb|ERG08434.1|  sugar transporter                                     81.6    3e-15   
gb|EIY61831.1|  sugar porter (SP) family MFS transporter              84.0    3e-15   
ref|WP_027219158.1|  sugar:proton symporter                           83.6    4e-15   
ref|WP_011214682.1|  sugar:proton symporter                           83.6    4e-15   
ref|WP_014841005.1|  sugar:proton symporter                           83.6    4e-15   
ref|XP_004992344.1|  hypothetical protein PTSG_06943                  84.0    4e-15   
ref|WP_044639214.1|  MFS transporter                                  83.6    4e-15   
sp|B3MG58.2|TRET1_DROAN  RecName: Full=Facilitated trehalose tran...  84.7    4e-15   
ref|XP_001959931.1|  GF13114                                          84.7    4e-15   
ref|WP_035352377.1|  hypothetical protein                             83.6    4e-15   
ref|WP_027264806.1|  sugar:proton symporter                           83.6    4e-15   
ref|WP_011405548.1|  major facilitator transporter                    83.6    4e-15   
ref|WP_022277842.1|  sugar porter (SP) family MFS transporter         83.6    4e-15   
ref|XP_005704896.1|  MFS transporter, SP family, sugar:H+ symporter   83.6    4e-15   
ref|WP_011213069.1|  sugar:proton symporter                           83.6    4e-15   
ref|WP_016710574.1|  major facilitator transporter                    83.2    5e-15   
ref|WP_011945599.1|  sugar:proton symporter                           83.6    5e-15   
ref|WP_020429182.1|  hypothetical protein                             80.9    5e-15   
ref|XP_003699336.1|  PREDICTED: solute carrier family 2, facilita...  83.6    5e-15   
ref|WP_027224240.1|  sugar:proton symporter                           83.2    5e-15   
ref|WP_014843330.1|  sugar:proton symporter                           83.2    5e-15   
ref|WP_025849336.1|  MFS transporter                                  83.2    5e-15   
gb|ERH62287.1|  MFS transporter                                       83.2    5e-15   
ref|XP_004339367.1|  transporter, major facilitator superfamily p...  83.6    6e-15   
ref|WP_012169786.1|  sugar transporter                                83.2    6e-15   
ref|WP_035155729.1|  MFS transporter                                  83.2    6e-15   
emb|CBH25983.1|  putative sugar-transporter subfamily                 83.2    6e-15   
dbj|GAN28872.1|  putative metabolite transport protein CsbC           83.2    6e-15   
ref|WP_038622452.1|  major facilitator transporter                    82.8    6e-15   
ref|XP_008596447.1|  hexose transporter                               83.6    7e-15   
gb|KGQ07113.1|  Putative polyol transporter 1                         83.6    7e-15   
ref|WP_039074963.1|  metabolite transporter CsbC                      82.8    7e-15   
ref|WP_021481038.1|  major facilitator transporter                    82.8    8e-15   
ref|XP_001422705.1|  MFS family transporter: hexose                   82.8    8e-15   
sp|Q291H8.3|TRET1_DROPS  RecName: Full=Facilitated trehalose tran...  83.6    8e-15   
sp|B4GAP7.2|TRET1_DROPE  RecName: Full=Facilitated trehalose tran...  83.6    8e-15   
gb|KFF54976.1|  metabolite transporter CsbC                           82.4    8e-15   
ref|WP_009000594.1|  MFS transporter                                  82.4    8e-15   
ref|WP_014866604.1|  major facilitator transporter                    82.8    8e-15   
ref|WP_018754345.1|  MFS transporter                                  82.4    8e-15   
ref|XP_001360559.2|  GA15593                                          83.6    8e-15   
ref|XP_002016109.1|  GL11419                                          83.6    8e-15   
ref|XP_003082978.1|  hexose transporter (ISS)                         83.2    8e-15   
emb|CEG02078.1|  Major facilitator superfamily domain, general su...  83.2    9e-15   
ref|WP_005679385.1|  MULTISPECIES: MFS transporter                    82.4    9e-15   
ref|WP_014666032.1|  major facilitator transporter                    82.4    9e-15   
ref|WP_038828964.1|  metabolite transporter CsbC                      82.4    9e-15   
ref|WP_038428086.1|  metabolite transporter CsbC                      82.4    9e-15   
ref|WP_033611623.1|  MFS transporter                                  82.4    9e-15   
ref|WP_044654006.1|  MFS transporter                                  82.4    9e-15   
ref|WP_003326199.1|  MULTISPECIES: major facilitator transporter      82.4    9e-15   
ref|WP_033011127.1|  hypothetical protein                             77.8    9e-15   
ref|XP_787337.3|  PREDICTED: facilitated trehalose transporter Tr...  82.4    9e-15   
ref|WP_009283556.1|  sugar transporter                                82.4    1e-14   
gb|AJT41974.1|  major facilitator transporter                         82.4    1e-14   
ref|WP_038954325.1|  hypothetical protein                             77.8    1e-14   
gb|KFA22558.1|  major facilitator transporter                         77.8    1e-14   
ref|WP_040081246.1|  metabolite transporter CsbC                      82.0    1e-14   
gb|KJC63930.1|  major facilitator transporter                         82.4    1e-14   
ref|WP_043085813.1|  major facilitator transporter                    78.2    1e-14   
emb|CDL60973.1|  sugar-proton symporter                               80.5    1e-14   
gb|AES71915.2|  sugar porter (SP) family MFS transporter              82.4    1e-14   
ref|WP_026974727.1|  MFS transporter                                  82.0    1e-14   
ref|WP_014368462.1|  MFS transporter                                  82.0    1e-14   
ref|WP_013914552.1|  MFS transporter                                  82.0    1e-14   
ref|WP_024572430.1|  metabolite transporter CsbC                      82.0    1e-14   
ref|WP_003219045.1|  MULTISPECIES: major facilitator transporter      82.0    1e-14   
ref|XP_003601664.1|  hypothetical protein MTR_3g084110                82.4    1e-14   
ref|WP_043090971.1|  hypothetical protein                             78.2    1e-14   
sp|B4LPX5.2|TRET1_DROVI  RecName: Full=Facilitated trehalose tran...  83.2    1e-14   
ref|XP_002050122.1|  GJ20366                                          83.2    1e-14   
ref|WP_044442034.1|  major facilitator transporter                    82.0    1e-14   
ref|WP_040679904.1|  MFS transporter                                  82.0    1e-14   
gb|KFK78858.1|  putative metabolite transport protein CsbC            82.0    1e-14   
ref|WP_024610330.1|  major facilitator transporter                    82.0    1e-14   
ref|WP_024594228.1|  major facilitator transporter                    82.0    1e-14   
ref|WP_019183278.1|  major facilitator transporter                    82.0    1e-14   
ref|WP_010536987.1|  MFS transporter                                  82.0    1e-14   
ref|XP_001986495.1|  GH21392                                          82.8    1e-14   
ref|XP_002733383.2|  PREDICTED: solute carrier family 2, facilita...  80.5    1e-14   
ref|WP_033028785.1|  MULTISPECIES: major facilitator transporter      82.0    1e-14   
ref|WP_042504924.1|  major facilitator transporter                    77.8    1e-14   
ref|WP_028551479.1|  MFS transporter                                  82.0    1e-14   
gb|KGT84775.1|  hypothetical protein OC00_06535                       77.8    1e-14   
ref|WP_026144597.1|  hypothetical protein                             77.8    1e-14   
ref|WP_033484407.1|  MULTISPECIES: major facilitator transporter      77.8    2e-14   
ref|XP_010686665.1|  PREDICTED: inositol transporter 4-like           82.4    2e-14   
ref|WP_007375162.1|  glucose transport protein                        81.6    2e-14   
ref|WP_010790464.1|  Major myo-inositol transporter IolT              81.6    2e-14   
emb|CDL51605.1|  sugar-proton symporter                               80.1    2e-14   
ref|WP_013924234.1|  major facilitator transporter                    81.6    2e-14   
gb|EES68295.2|  sugar porter (SP) family MFS transporter              81.6    2e-14   
ref|WP_022471577.1|  sugar porter (SP) family MFS transporter         81.6    2e-14   
gb|EOS00445.1|  sugar porter (SP) family MFS transporter              81.6    2e-14   
ref|WP_025119916.1|  MULTISPECIES: MFS transporter                    81.6    2e-14   
ref|WP_038689086.1|  major facilitator transporter                    81.6    2e-14   
ref|WP_011109239.1|  MFS transporter                                  81.6    2e-14   
ref|XP_005174793.1|  PREDICTED: facilitated trehalose transporter...  81.6    2e-14   
ref|WP_032840525.1|  MFS transporter                                  81.6    2e-14   
sp|B4KR05.2|TRET1_DROMO  RecName: Full=Facilitated trehalose tran...  82.4    2e-14   
ref|WP_022301214.1|  sugar porter (SP) family MFS transporter         81.6    2e-14   
ref|XP_002006426.1|  GI18572                                          82.4    2e-14   
ref|WP_037505586.1|  sugar:proton symporter                           81.3    2e-14   
ref|WP_032813586.1|  MFS transporter                                  81.3    2e-14   
ref|XP_002777372.1|  hexose transporter, putative                     80.1    2e-14   
ref|WP_008760064.1|  MFS transporter                                  81.3    2e-14   
dbj|GAK78547.1|  putative sugar transporter                           80.5    2e-14   
ref|XP_005705489.1|  MFS transporter, SP family, sugar:H+ symporter   81.6    2e-14   
ref|WP_008650091.1|  MFS transporter                                  81.3    2e-14   
gb|KIN05737.1|  hypothetical protein OIDMADRAFT_189244                82.0    2e-14   
ref|WP_040220875.1|  MFS transporter                                  81.3    2e-14   
ref|WP_039185836.1|  MFS transporter                                  81.3    2e-14   
ref|WP_004092209.1|  MFS transporter                                  81.3    2e-14   
ref|XP_001748408.1|  hypothetical protein                             81.6    2e-14   
ref|WP_020090293.1|  MFS transporter                                  81.3    2e-14   
ref|WP_033184756.1|  major facilitator transporter                    81.3    2e-14   
gb|AAT89285.1|  sugar transporter                                     81.3    2e-14   
ref|WP_022521950.1|  Glucose transport protein (fragment)             77.0    2e-14   
dbj|BAI87684.2|  hypothetical protein BSNT_10673                      80.1    2e-14   
ref|WP_006990987.1|  D-xylose-proton symporter                        81.3    2e-14   
gb|KJF41716.1|  MFS transporter                                       77.8    2e-14   
ref|XP_002091187.1|  GE12373                                          82.0    3e-14   
ref|WP_036593689.1|  sugar transporter                                80.9    3e-14   
ref|WP_041767588.1|  major facilitator transporter                    81.3    3e-14   
ref|XP_002066107.1|  GK22112                                          82.0    3e-14   
ref|XP_005707000.1|  MFS transporter, SP family, sugar:H+ symporter   81.3    3e-14   
ref|WP_035078795.1|  hypothetical protein                             81.3    3e-14   
ref|WP_026962475.1|  MFS transporter                                  80.9    3e-14   
ref|WP_014839210.1|  MFS transporter                                  80.9    3e-14   
ref|WP_038424775.1|  MFS transporter                                  80.9    3e-14   
ref|WP_014230379.1|  MFS transporter                                  80.9    3e-14   
ref|WP_011576447.1|  major facilitator transporter                    80.9    3e-14   
ref|WP_025106590.1|  MULTISPECIES: MFS transporter                    80.9    3e-14   
ref|WP_008913094.1|  sugar transporter                                80.9    3e-14   



>ref|XP_011100175.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=740

 Score =   238 bits (608),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 143/153 (93%), Gaps = 2/153 (1%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLL+TIPV I SLV LV+GNV N G+VAHAV+STICV++YFC+FVMGYGPIPNIL
Sbjct  588  SGRRSLLLTTIPVLIISLVALVIGNVFNFGTVAHAVISTICVVIYFCTFVMGYGPIPNIL  647

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALVFWICDVIVTY+LPVMLSS+GLAGVFGIYAVVCV+SWIF+F
Sbjct  648  CSEIFPTRVRGICIAICALVFWICDVIVTYTLPVMLSSIGLAGVFGIYAVVCVVSWIFIF  707

Query  293  LRVPETKGMPLEVITEFFAVGARQAEM--AKNE  201
            LRVPETKGMPLEVITEFFAVGA+QA    AKNE
Sbjct  708  LRVPETKGMPLEVITEFFAVGAKQAAAGSAKNE  740



>gb|ABK29441.1| sugar transport protein, partial [Coffea canephora]
Length=290

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRR LLLSTIPV   SLV+LV+ NV++LG++AHAV+ST+CV+LYFC FVMGYGP+PNI
Sbjct  142  LSGRRALLLSTIPVLTVSLVILVVANVVDLGTIAHAVMSTLCVVLYFCCFVMGYGPVPNI  201

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LCAEIFPTRVRG CIAIC+LV+WICDVIVTY+LPV+LSS+GLAGVFGIYAVVCVISW+FV
Sbjct  202  LCAEIFPTRVRGLCIAICSLVYWICDVIVTYTLPVLLSSIGLAGVFGIYAVVCVISWVFV  261

Query  296  FLRVPETKGMPLEVITEFFAVGARQ  222
            FLRVPETKGMPLEVITEFFAVGA++
Sbjct  262  FLRVPETKGMPLEVITEFFAVGAKK  286



>gb|EYU43535.1| hypothetical protein MIMGU_mgv1a002513mg [Erythranthe guttata]
Length=665

 Score =   235 bits (600),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 142/151 (94%), Gaps = 2/151 (1%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLL+TIPV I SL+ LV+GNV + G+VAHAV+ST+CVI+YFC+FVMGYGPIPNIL
Sbjct  517  AGRRSLLLTTIPVLILSLIALVIGNVFDFGTVAHAVISTVCVIVYFCTFVMGYGPIPNIL  576

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALVFWICDVIVTYSLPVMLSS+GLAGVFGIYAVVCVISW+F+F
Sbjct  577  CSEIFPTRVRGICIAICALVFWICDVIVTYSLPVMLSSIGLAGVFGIYAVVCVISWVFIF  636

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            LRVPETKGMPLEVITEFFAVGA+Q   AK+E
Sbjct  637  LRVPETKGMPLEVITEFFAVGAKQG--AKSE  665



>ref|XP_006342166.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006342167.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Solanum 
tuberosum]
Length=737

 Score =   236 bits (602),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLL TIPV I SL+ LV+GN INLGSVAHAV+STICVILYFC FV GYGPIPNIL
Sbjct  587  AGRRSLLLYTIPVLILSLICLVIGNTINLGSVAHAVVSTICVILYFCFFVTGYGPIPNIL  646

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALVFWICDVIVTY+LPVML+S+GL+GVFGIYA+VCVISWIFVF
Sbjct  647  CSEIFPTRVRGLCIAICALVFWICDVIVTYTLPVMLNSIGLSGVFGIYAIVCVISWIFVF  706

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            LRVPETKGMPLEVITEFFAVGARQA +AK+E
Sbjct  707  LRVPETKGMPLEVITEFFAVGARQAAIAKHE  737



>gb|EYU43534.1| hypothetical protein MIMGU_mgv1a001953mg [Erythranthe guttata]
Length=734

 Score =   236 bits (601),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLL+T+PV I SL+ LV+GNV + G++AHA++ST CV++YFC+FVMGYGPIPNIL
Sbjct  584  AGRRSLLLTTLPVLIISLIALVIGNVFDFGTLAHAIISTTCVVIYFCTFVMGYGPIPNIL  643

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALVFWICDVIVTYSLPVMLSS+GLAGVFGIYAVVCVISW+F+F
Sbjct  644  CSEIFPTRVRGICIAICALVFWICDVIVTYSLPVMLSSIGLAGVFGIYAVVCVISWVFIF  703

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            LRVPETKGMPLEVITEFFAVGA+Q+  AK E
Sbjct  704  LRVPETKGMPLEVITEFFAVGAKQSAAAKGE  734



>gb|EPS65490.1| hypothetical protein M569_09283 [Genlisea aurea]
Length=734

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLL+TIPV I SL++LV+GNV++LG+VAHAV+STICV++YFC+FVMGYGPIPNIL
Sbjct  583  AGRRSLLLTTIPVLIVSLIILVIGNVVHLGTVAHAVVSTICVVIYFCTFVMGYGPIPNIL  642

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG  IAIC+LVFWICDVIVTY+LPVMLSS+GLAGVFGIYAVVC ISW+F+F
Sbjct  643  CSEIFPTRVRGIAIAICSLVFWICDVIVTYTLPVMLSSIGLAGVFGIYAVVCAISWVFIF  702

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            LRVPETKGMPLEVITEFFAVGA+Q E +KN+
Sbjct  703  LRVPETKGMPLEVITEFFAVGAKQIEESKNQ  733



>ref|NP_001190922.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 gb|AEE86496.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
Length=542

 Score =   229 bits (584),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRRTLLL+TIP+ I SL+VLV+ N++++ S+ HAVLST+ V+LYFC FVMG+GP PNI
Sbjct  391  LSGRRTLLLTTIPILIASLLVLVISNLVHMNSIVHAVLSTVSVVLYFCFFVMGFGPAPNI  450

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LC+EIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GLAGVFG+YA+VC ISW+FV
Sbjct  451  LCSEIFPTRVRGICIAICALTFWICDIIVTYSLPVLLKSIGLAGVFGMYAIVCCISWVFV  510

Query  296  FLRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            F++VPETKGMPLEVITEFF+VGARQAE AKNE
Sbjct  511  FIKVPETKGMPLEVITEFFSVGARQAEAAKNE  542



>ref|XP_009595864.1| PREDICTED: monosaccharide-sensing protein 2 [Nicotiana tomentosiformis]
 ref|XP_009595865.1| PREDICTED: monosaccharide-sensing protein 2 [Nicotiana tomentosiformis]
 ref|XP_009595866.1| PREDICTED: monosaccharide-sensing protein 2 [Nicotiana tomentosiformis]
Length=738

 Score =   232 bits (592),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRRTLLL TIPV I SL++LV+GN +NLGSVAHAV+ST+CVILYFC FV GYGPIPNIL
Sbjct  588  AGRRTLLLYTIPVLILSLILLVIGNTVNLGSVAHAVVSTVCVILYFCFFVTGYGPIPNIL  647

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICALVFWICDVIVTY+LPVMLSS+GLAGVFGIYAVVCVISW FVF
Sbjct  648  CAEIFPTRVRGLCIAICALVFWICDVIVTYTLPVMLSSIGLAGVFGIYAVVCVISWFFVF  707

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            LRVPETKGMPLEVITEFFAVGARQA MAK+E
Sbjct  708  LRVPETKGMPLEVITEFFAVGARQAAMAKHE  738



>ref|NP_001289848.1| monosaccharide-sensing protein 2 [Solanum lycopersicum]
 dbj|BAO96237.1| tonoplast monosaccharide transporter 2 [Solanum lycopersicum]
Length=738

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 142/152 (93%), Gaps = 1/152 (1%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLL TIPV I SL+ LV+GN +NLGSVAHAV+STICVILYFC FV GYGPIPNIL
Sbjct  587  AGRRSLLLYTIPVLILSLICLVIGNTVNLGSVAHAVVSTICVILYFCFFVTGYGPIPNIL  646

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALVFWICDVIVTY+LPVML+S+GL+GVFGIYA+VCVISWIFVF
Sbjct  647  CSEIFPTRVRGLCIAICALVFWICDVIVTYTLPVMLNSIGLSGVFGIYAIVCVISWIFVF  706

Query  293  LRVPETKGMPLEVITEFFAVGARQ-AEMAKNE  201
            LRVPETKGMPLEVITEFFAVGARQ A +AK+E
Sbjct  707  LRVPETKGMPLEVITEFFAVGARQAAAIAKHE  738



>dbj|BAH57059.1| AT4G35300 [Arabidopsis thaliana]
Length=585

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRRTLLL+TIP+ I SL+VLV+ N++++ S+ HAVLST+ V+LYFC FVMG+GP PNI
Sbjct  434  LSGRRTLLLTTIPILIASLLVLVISNLVHMNSIVHAVLSTVSVVLYFCFFVMGFGPAPNI  493

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LC+EIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GLAGVFG+YA+VC ISW+FV
Sbjct  494  LCSEIFPTRVRGICIAICALTFWICDIIVTYSLPVLLKSIGLAGVFGMYAIVCCISWVFV  553

Query  296  FLRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            F++VPETKGMPLEVITEFF+VGARQAE AKNE
Sbjct  554  FIKVPETKGMPLEVITEFFSVGARQAEAAKNE  585



>ref|XP_009796447.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009796448.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009796450.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=738

 Score =   230 bits (586),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRRTLLL TIPV I SL++LV+GN +NLGSVAHAV+ST+CVILYFC FV GYGPIPNIL
Sbjct  588  AGRRTLLLYTIPVLILSLILLVIGNTVNLGSVAHAVVSTVCVILYFCFFVTGYGPIPNIL  647

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICALVFWICDVIVTY+LPVML S+GLAGVFGIYAVVCVISW FVF
Sbjct  648  CAEIFPTRVRGLCIAICALVFWICDVIVTYTLPVMLRSIGLAGVFGIYAVVCVISWFFVF  707

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            LRVPETKGMPLEVITEFFAVGARQA MAK+E
Sbjct  708  LRVPETKGMPLEVITEFFAVGARQAAMAKHE  738



>gb|KJB14186.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
Length=524

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL+TIPV I SL++LV   +++LG+V +A +ST CVI+YFC FVMGYGPIPNIL
Sbjct  374  SGRRRLLLTTIPVLIVSLIILVFSELVDLGTVVNAAISTACVIVYFCCFVMGYGPIPNIL  433

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALV+WI D+IVTY+LPVMLSS+GLAG+FGIYAVVC+ISW+FVF
Sbjct  434  CSEIFPTRVRGLCIAICALVYWIGDIIVTYTLPVMLSSIGLAGIFGIYAVVCLISWVFVF  493

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFFAVGARQA   KNE
Sbjct  494  LKVPETKGMPLEVITEFFAVGARQAGATKNE  524



>ref|NP_849565.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 ref|NP_001190923.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 gb|AAM19835.1| AT4g35300/F23E12_140 [Arabidopsis thaliana]
 gb|AEE86493.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 gb|AEE86497.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
Length=739

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRRTLLL+TIP+ I SL+VLV+ N++++ S+ HAVLST+ V+LYFC FVMG+GP PNI
Sbjct  588  LSGRRTLLLTTIPILIASLLVLVISNLVHMNSIVHAVLSTVSVVLYFCFFVMGFGPAPNI  647

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LC+EIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GLAGVFG+YA+VC ISW+FV
Sbjct  648  LCSEIFPTRVRGICIAICALTFWICDIIVTYSLPVLLKSIGLAGVFGMYAIVCCISWVFV  707

Query  296  FLRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            F++VPETKGMPLEVITEFF+VGARQAE AKNE
Sbjct  708  FIKVPETKGMPLEVITEFFSVGARQAEAAKNE  739



>ref|NP_195256.3| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 ref|NP_001154287.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 sp|Q8LPQ8.2|MSSP2_ARATH RecName: Full=Monosaccharide-sensing protein 2; AltName: Full=Sugar 
transporter MSSP2 [Arabidopsis thaliana]
 emb|CAA18739.1| putative sugar transporter protein [Arabidopsis thaliana]
 emb|CAB80247.1| putative sugar transporter protein [Arabidopsis thaliana]
 emb|CAD58692.1| monosaccharide sensing protein 2 [Arabidopsis thaliana]
 gb|AEE86494.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 gb|AEE86495.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
Length=729

 Score =   228 bits (581),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRRTLLL+TIP+ I SL+VLV+ N++++ S+ HAVLST+ V+LYFC FVMG+GP PNI
Sbjct  578  LSGRRTLLLTTIPILIASLLVLVISNLVHMNSIVHAVLSTVSVVLYFCFFVMGFGPAPNI  637

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LC+EIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GLAGVFG+YA+VC ISW+FV
Sbjct  638  LCSEIFPTRVRGICIAICALTFWICDIIVTYSLPVLLKSIGLAGVFGMYAIVCCISWVFV  697

Query  296  FLRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            F++VPETKGMPLEVITEFF+VGARQAE AKNE
Sbjct  698  FIKVPETKGMPLEVITEFFSVGARQAEAAKNE  729



>gb|KHN20087.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=712

 Score =   227 bits (578),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL+TIPV I SL++LV+G+++N G+VAHA +ST+CV++YFC FVMGYGPIPNIL
Sbjct  562  SGRRQLLLTTIPVLIVSLIILVIGSLVNFGNVAHAAISTVCVVVYFCCFVMGYGPIPNIL  621

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALVFWI D+I+TYSLPVMLSS+GL GVF IYAVVC ISWIFVF
Sbjct  622  CSEIFPTRVRGLCIAICALVFWIGDIIITYSLPVMLSSLGLGGVFAIYAVVCFISWIFVF  681

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVI+EFF+VGA+QA  AKNE
Sbjct  682  LKVPETKGMPLEVISEFFSVGAKQAASAKNE  712



>ref|XP_002867077.1| hypothetical protein ARALYDRAFT_491117 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43336.1| hypothetical protein ARALYDRAFT_491117 [Arabidopsis lyrata subsp. 
lyrata]
Length=739

 Score =   227 bits (579),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRRTLLL+TIP+ I SL+VLV+ N++++ S+ HAVLST+ V+LYFC FVMG+GP PNI
Sbjct  588  LSGRRTLLLTTIPILIASLLVLVISNLVHMNSIVHAVLSTVSVVLYFCFFVMGFGPAPNI  647

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LC+EIFPTRVRG CIAICAL FW+CD+IVTYSLPV+L S+GLAGVFG+YA+VC ISW+FV
Sbjct  648  LCSEIFPTRVRGICIAICALTFWVCDIIVTYSLPVLLKSIGLAGVFGMYAIVCCISWVFV  707

Query  296  FLRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            F++VPETKGMPLEVITEFF+VGARQAE AKNE
Sbjct  708  FIKVPETKGMPLEVITEFFSVGARQAEAAKNE  739



>gb|ABR25915.1| sugar transporter type 2a [Oryza sativa Indica Group]
Length=178

 Score =   212 bits (540),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL TIPV I SLVVLV+ NVI+LG+VAHA LSTI VI+YFC FVMG+GPIPNIL
Sbjct  29   SGRRFLLLGTIPVLIASLVVLVVSNVIDLGTVAHAALSTISVIIYFCCFVMGFGPIPNIL  88

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML+++GLAGVFGIYAVVC I+++FVF
Sbjct  89   CAEIFPTRVRGICIAICALTFWIGDIIVTYSLPVMLNAIGLAGVFGIYAVVCSIAFVFVF  148

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAK  207
            L+VPETKGMPLEVITEFFAVGA+Q +  K
Sbjct  149  LKVPETKGMPLEVITEFFAVGAKQMQATK  177



>ref|XP_003527273.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Glycine 
max]
 ref|XP_006581130.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Glycine 
max]
Length=737

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL+TIPV I SL++LV+G+++N G+VAHA +ST+CV++YFC FVMGYGPIPNIL
Sbjct  587  SGRRQLLLTTIPVLIVSLIILVIGSLVNFGNVAHAAISTVCVVVYFCCFVMGYGPIPNIL  646

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALVFWI D+I+TYSLPVMLSS+GL GVF IYAVVC ISWIFVF
Sbjct  647  CSEIFPTRVRGLCIAICALVFWIGDIIITYSLPVMLSSLGLGGVFAIYAVVCFISWIFVF  706

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVI+EFF+VGA+QA  AKNE
Sbjct  707  LKVPETKGMPLEVISEFFSVGAKQAASAKNE  737



>gb|KJB77473.1| hypothetical protein B456_012G139000 [Gossypium raimondii]
Length=523

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLLST+PV I SL+VLV+G+V+ +G+V HA +ST+ V+LYFC FVMG+GPIPNIL
Sbjct  373  AGRRSLLLSTLPVLIISLLVLVIGSVVKMGNVVHAAISTVSVVLYFCFFVMGFGPIPNIL  432

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIA+CAL FWICD+IVTYSLPV+L S+GLAGVFG+YAVVCVISW+FVF
Sbjct  433  CAEIFPTRVRGICIAMCALTFWICDIIVTYSLPVLLKSVGLAGVFGMYAVVCVISWVFVF  492

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFF+VGA+Q   AKN 
Sbjct  493  LKVPETKGMPLEVITEFFSVGAKQVAAAKNN  523



>emb|CDP07261.1| unnamed protein product [Coffea canephora]
Length=737

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRR LLLSTIPV   SLV+LV+ NV++LG++AHAV+ST+CV+LYFC FVMGYGP+PNI
Sbjct  589  LSGRRALLLSTIPVLTVSLVILVVANVVDLGTIAHAVMSTLCVVLYFCCFVMGYGPVPNI  648

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LCAEIFPTRVRG CIAIC+LV+WICDVIVTY+LPV+LSS+GLAGVFGIYAVVCVISW+FV
Sbjct  649  LCAEIFPTRVRGLCIAICSLVYWICDVIVTYTLPVLLSSIGLAGVFGIYAVVCVISWVFV  708

Query  296  FLRVPETKGMPLEVITEFFAVGARQ  222
            FLRVPETKGMPLEVITEFFAVGA++
Sbjct  709  FLRVPETKGMPLEVITEFFAVGAKK  733



>ref|XP_007135975.1| hypothetical protein PHAVU_009G007600g [Phaseolus vulgaris]
 gb|ESW07969.1| hypothetical protein PHAVU_009G007600g [Phaseolus vulgaris]
Length=736

 Score =   225 bits (573),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL+TIPV I SL++LV+G+++N G+V HA +ST CV++YFC FVMGYGPIPNIL
Sbjct  586  SGRRQLLLTTIPVLIVSLIILVIGSLVNFGNVVHAAISTTCVVVYFCCFVMGYGPIPNIL  645

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALVFWI D+I+TYSLPVMLSS+GL GVF IYAVVC ISWIFVF
Sbjct  646  CSEIFPTRVRGLCIAICALVFWIGDIIITYSLPVMLSSLGLGGVFAIYAVVCFISWIFVF  705

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVI+EFF+VGARQA  AKNE
Sbjct  706  LKVPETKGMPLEVISEFFSVGARQAATAKNE  736



>gb|KHN33775.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=737

 Score =   225 bits (573),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL+TIPV I SL++LV+G+++N G+VAHA +ST+CV++YFC FVMGYGPIPNIL
Sbjct  587  SGRRQLLLTTIPVLIVSLIILVIGSLVNFGNVAHAAISTVCVVVYFCCFVMGYGPIPNIL  646

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALVFWI D+I+TYSLPVML S+GL GVF IYAVVC ISWIFVF
Sbjct  647  CSEIFPTRVRGLCIAICALVFWIGDIIITYSLPVMLGSLGLGGVFAIYAVVCFISWIFVF  706

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVI+EFF+VGA+QA  AKNE
Sbjct  707  LKVPETKGMPLEVISEFFSVGAKQAASAKNE  737



>ref|XP_006577928.1| PREDICTED: monosaccharide-sensing protein 2-like [Glycine max]
Length=738

 Score =   224 bits (572),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL+TIPV I SL++LV+G+++N G+VAHA +ST+CV++YFC FVMGYGPIPNIL
Sbjct  588  SGRRQLLLTTIPVLIGSLIILVIGSLVNFGNVAHAAISTVCVVVYFCCFVMGYGPIPNIL  647

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALVFWI D+I+TYSLPVML S+GL GVF IYAVVC ISWIFVF
Sbjct  648  CSEIFPTRVRGLCIAICALVFWIGDIIITYSLPVMLGSLGLGGVFAIYAVVCFISWIFVF  707

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVI+EFF+VGA+QA  AKNE
Sbjct  708  LKVPETKGMPLEVISEFFSVGAKQAASAKNE  738



>gb|KJB14185.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
Length=691

 Score =   224 bits (570),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL+TIPV I SL++LV   +++LG+V +A +ST CVI+YFC FVMGYGPIPNIL
Sbjct  541  SGRRRLLLTTIPVLIVSLIILVFSELVDLGTVVNAAISTACVIVYFCCFVMGYGPIPNIL  600

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALV+WI D+IVTY+LPVMLSS+GLAG+FGIYAVVC+ISW+FVF
Sbjct  601  CSEIFPTRVRGLCIAICALVYWIGDIIVTYTLPVMLSSIGLAGIFGIYAVVCLISWVFVF  660

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFFAVGARQA   KNE
Sbjct  661  LKVPETKGMPLEVITEFFAVGARQAGATKNE  691



>gb|KHG10189.1| Monosaccharide-sensing 2 -like protein [Gossypium arboreum]
Length=739

 Score =   224 bits (571),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL+TIPV I SL++LV   +++LG+V +A +ST CVI+YFC FVMGYGPIPNIL
Sbjct  589  SGRRRLLLTTIPVLIVSLIILVFSELVDLGTVVNAAISTACVIVYFCCFVMGYGPIPNIL  648

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALV+WI D+IVTY+LPVMLSS+GLAG+FGIYAVVC+ISW+FVF
Sbjct  649  CSEIFPTRVRGLCIAICALVYWIGDIIVTYTLPVMLSSIGLAGIFGIYAVVCLISWVFVF  708

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFFAVGARQA   KNE
Sbjct  709  LKVPETKGMPLEVITEFFAVGARQAGATKNE  739



>ref|XP_011074068.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011074069.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=739

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLL+TIPV I +L+ LV+GNV + G+VAHAV+STICV++YFC+FVMGYGPIPNIL
Sbjct  589  SGRRSLLLTTIPVLIVALIALVIGNVFDFGTVAHAVISTICVVIYFCTFVMGYGPIPNIL  648

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALVFWICDVIVTY+LPVMLSS+GLAGVFGIYAVVCVISWIF+F
Sbjct  649  CSEIFPTRVRGICIAICALVFWICDVIVTYTLPVMLSSIGLAGVFGIYAVVCVISWIFIF  708

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            LRVPETKGMPLEVITEFFAVGA+QA  AK+E
Sbjct  709  LRVPETKGMPLEVITEFFAVGAKQAAAAKHE  739



>ref|XP_010446942.1| PREDICTED: monosaccharide-sensing protein 2 [Camelina sativa]
 ref|XP_010446943.1| PREDICTED: monosaccharide-sensing protein 2 [Camelina sativa]
 ref|XP_010446944.1| PREDICTED: monosaccharide-sensing protein 2 [Camelina sativa]
Length=739

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRRTLLL+TIP+ I SL+VLV+ N++ + S+ HAVLST+ V+LYFC FVMG+GP PNI
Sbjct  588  LSGRRTLLLTTIPILIASLLVLVISNIVQMNSIVHAVLSTVSVVLYFCFFVMGFGPAPNI  647

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LC+EIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GLAGVFG+YAVVC ISW+FV
Sbjct  648  LCSEIFPTRVRGICIAICALTFWICDIIVTYSLPVLLKSVGLAGVFGMYAVVCCISWVFV  707

Query  296  FLRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            F++VPETKGMPLEVITEFF++GARQAE AK++
Sbjct  708  FIKVPETKGMPLEVITEFFSLGARQAEAAKHD  739



>gb|KJB14177.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14178.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14179.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14180.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14181.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14184.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
Length=739

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL+TIPV I SL++LV   +++LG+V +A +ST CVI+YFC FVMGYGPIPNIL
Sbjct  589  SGRRRLLLTTIPVLIVSLIILVFSELVDLGTVVNAAISTACVIVYFCCFVMGYGPIPNIL  648

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALV+WI D+IVTY+LPVMLSS+GLAG+FGIYAVVC+ISW+FVF
Sbjct  649  CSEIFPTRVRGLCIAICALVYWIGDIIVTYTLPVMLSSIGLAGIFGIYAVVCLISWVFVF  708

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFFAVGARQA   KNE
Sbjct  709  LKVPETKGMPLEVITEFFAVGARQAGATKNE  739



>ref|XP_006486570.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006486571.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Citrus 
sinensis]
Length=732

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLLSTIP+ I SLVVLVL +VI +GSV HA +ST+ V+LYFC FVMG+GPIPNIL
Sbjct  582  SGRRTLLLSTIPILITSLVVLVLSSVIKMGSVVHASISTVSVVLYFCCFVMGFGPIPNIL  641

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALVFWI D+IVTYSLPV+L+S+GLAGVFG+YAVVCVISWIFVF
Sbjct  642  CSEIFPTRVRGICIAICALVFWIGDIIVTYSLPVLLNSVGLAGVFGMYAVVCVISWIFVF  701

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            ++VPETKGMPLEVITEFFAVGA QA+ AKN 
Sbjct  702  IKVPETKGMPLEVITEFFAVGASQADAAKNN  732



>gb|KDO68402.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
 gb|KDO68403.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
 gb|KDO68404.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
Length=732

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLLSTIP+ I SLVVLVL +VI +GSV HA +ST+ V+LYFC FVMG+GPIPNIL
Sbjct  582  SGRRTLLLSTIPILITSLVVLVLSSVIKMGSVVHASISTVSVVLYFCCFVMGFGPIPNIL  641

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALVFWI D+IVTYSLPV+L+S+GLAGVFG+YAVVCVISWIFVF
Sbjct  642  CSEIFPTRVRGICIAICALVFWIGDIIVTYSLPVLLNSVGLAGVFGMYAVVCVISWIFVF  701

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            ++VPETKGMPLEVITEFFAVGA QA+ AKN 
Sbjct  702  IKVPETKGMPLEVITEFFAVGASQADAAKNN  732



>ref|XP_006422393.1| hypothetical protein CICLE_v10027893mg [Citrus clementina]
 gb|ESR35633.1| hypothetical protein CICLE_v10027893mg [Citrus clementina]
Length=732

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLLSTIP+ I SLVVLVL +VI +GSV HA +ST+ V+LYFC FVMG+GPIPNIL
Sbjct  582  SGRRTLLLSTIPILITSLVVLVLSSVIKMGSVVHASISTVSVVLYFCCFVMGFGPIPNIL  641

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALVFWI D+IVTYSLPV+L S+GLAGVFG+YAVVCVISWIFVF
Sbjct  642  CSEIFPTRVRGICIAICALVFWIGDIIVTYSLPVLLKSVGLAGVFGMYAVVCVISWIFVF  701

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            ++VPETKGMPLEVITEFFAVGA QA+ AKN 
Sbjct  702  IKVPETKGMPLEVITEFFAVGASQADAAKNN  732



>ref|XP_008358445.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=256

 Score =   212 bits (539),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLL TIPV + SLV+LVLG+++N+GSV +A +ST+ V+LYFC FVMG+GPIPNIL
Sbjct  106  AGRRSLLLGTIPVLVASLVILVLGSLVNMGSVVNASVSTVSVVLYFCFFVMGFGPIPNIL  165

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML S+GLAGVFG+YAVV VI++IF+F
Sbjct  166  CAEIFPTRVRGLCIAICALTFWIGDIIVTYSLPVMLKSVGLAGVFGMYAVVSVIAFIFIF  225

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFF+VGA+QA  AKN 
Sbjct  226  LKVPETKGMPLEVITEFFSVGAKQASAAKNN  256



>ref|XP_010432297.1| PREDICTED: monosaccharide-sensing protein 2-like [Camelina sativa]
 ref|XP_010432298.1| PREDICTED: monosaccharide-sensing protein 2-like [Camelina sativa]
Length=739

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRRTLLL+TIP+ I SL+VLV+ N++++ S+ HAVLST+ V+LYFC FVMG+GP PNI
Sbjct  588  LSGRRTLLLTTIPILIASLLVLVISNIVHMNSIVHAVLSTVSVVLYFCFFVMGFGPAPNI  647

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LC+EIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GLAGVFG+YA+VC ISW+FV
Sbjct  648  LCSEIFPTRVRGICIAICALTFWICDIIVTYSLPVLLKSVGLAGVFGMYAIVCCISWVFV  707

Query  296  FLRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            F++VPETKGMPLEVITEFF++GARQAE AK++
Sbjct  708  FIKVPETKGMPLEVITEFFSLGARQAEAAKHD  739



>ref|XP_004500833.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004500834.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Cicer 
arietinum]
Length=736

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL TIPV I SLV+L+LG++++ G+V HA +ST+CV++YFC FVM YGPIPNIL
Sbjct  586  SGRRQLLLVTIPVLIASLVILILGSIVDFGNVVHAAISTVCVVVYFCFFVMAYGPIPNIL  645

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALVFWI D+IVTYSLPVMLSS+GL+GVFG+YAVVC+ISWIFV+
Sbjct  646  CSEIFPTRVRGLCIAICALVFWIGDIIVTYSLPVMLSSLGLSGVFGVYAVVCLISWIFVY  705

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFF+VG++QA  AKNE
Sbjct  706  LKVPETKGMPLEVITEFFSVGSKQAASAKNE  736



>emb|CDX69128.1| BnaC01g03250D [Brassica napus]
Length=683

 Score =   222 bits (566),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRRTLLL+TIP+ I SL+VLV+ N++++ S+ HAVLST+ V+LYFC FVMG+GP PNI
Sbjct  532  LSGRRTLLLTTIPILIASLIVLVISNLVHMNSIVHAVLSTVSVVLYFCFFVMGFGPTPNI  591

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LC+EIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GLAGVFG+YAVVC ISW FV
Sbjct  592  LCSEIFPTRVRGICIAICALTFWICDIIVTYSLPVLLKSIGLAGVFGMYAVVCCISWAFV  651

Query  296  FLRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            +L+VPETKGMPLEVITEFF++GARQAE  KN 
Sbjct  652  YLKVPETKGMPLEVITEFFSLGARQAEAEKNN  683



>emb|CDY65623.1| BnaCnng48010D [Brassica napus]
Length=675

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRRTLLL+TIP+ I SL+VLV+ N++++ S+ HAVLST+ V+LYFC FVMG+GP PNI
Sbjct  524  LSGRRTLLLTTIPILIASLIVLVISNLVHMNSIVHAVLSTVSVVLYFCFFVMGFGPTPNI  583

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LC+EIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GLAGVFG+YAVVC ISW FV
Sbjct  584  LCSEIFPTRVRGICIAICALTFWICDIIVTYSLPVLLKSIGLAGVFGMYAVVCCISWAFV  643

Query  296  FLRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            +L+VPETKGMPLEVITEFF++GARQAE  KN 
Sbjct  644  YLKVPETKGMPLEVITEFFSLGARQAEAEKNN  675



>ref|XP_006283193.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
 ref|XP_006283194.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
 gb|EOA16091.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
 gb|EOA16092.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
Length=740

 Score =   223 bits (568),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRRTLLL+TIP+ I SL+VLV+ N++++ S+ HAVLST+ V+LYFC FVMG+GP PNI
Sbjct  589  LSGRRTLLLTTIPILIASLLVLVISNLVHMNSIVHAVLSTVSVVLYFCFFVMGFGPAPNI  648

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LC+EIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GLAGVFG+YA+VC ISW+FV
Sbjct  649  LCSEIFPTRVRGICIAICALTFWICDIIVTYSLPVLLKSIGLAGVFGMYAIVCCISWVFV  708

Query  296  FLRVPETKGMPLEVITEFFAVGARQAEMAK  207
            F++VPETKGMPLEVITEFF+VGARQAE AK
Sbjct  709  FMKVPETKGMPLEVITEFFSVGARQAEAAK  738



>ref|XP_003603869.1| Monosaccharide-sensing protein [Medicago truncatula]
Length=689

 Score =   222 bits (565),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR LLL TIPV I SLV+LVLG+VI+ GSV HA +ST+CV++YFC FVMGYGPIPNIL
Sbjct  539  TGRRQLLLVTIPVLIVSLVILVLGSVIDFGSVVHAAISTVCVVVYFCFFVMGYGPIPNIL  598

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALVFWI D+IVTYSLPVMLSS+GLAGVFG+YA+VC ISW+FV+
Sbjct  599  CSEIFPTRVRGLCIAICALVFWIGDIIVTYSLPVMLSSLGLAGVFGVYAIVCCISWVFVY  658

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFF+VG++Q+  AKNE
Sbjct  659  LKVPETKGMPLEVITEFFSVGSKQSAAAKNE  689



>ref|XP_010061214.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW68134.1| hypothetical protein EUGRSUZ_F01805 [Eucalyptus grandis]
Length=735

 Score =   223 bits (567),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLL+TIPV I +LVVLV+  ++ + +V +A++ST CVI+YFC FVM YGP+PNIL
Sbjct  585  SGRRTLLLTTIPVLIVTLVVLVIFEMLTISTVVNAIISTACVIIYFCCFVMAYGPVPNIL  644

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALV+WICD+IVTY+LPVMLS+ GLAG+FGIYAVVCVISW+FVF
Sbjct  645  CSEIFPTRVRGLCIAICALVYWICDIIVTYTLPVMLSAFGLAGIFGIYAVVCVISWVFVF  704

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFF+VGARQ   AKNE
Sbjct  705  LKVPETKGMPLEVITEFFSVGARQVAAAKNE  735



>gb|KHG04802.1| Monosaccharide-sensing protein 2 [Gossypium arboreum]
 gb|KHG22590.1| Monosaccharide-sensing protein 2 [Gossypium arboreum]
Length=690

 Score =   222 bits (565),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLLST+PV I SL+VLV+G+V+ +G+V HA +ST+ V+LYFC FVMG+GPIPNIL
Sbjct  540  AGRRSLLLSTLPVLIISLLVLVIGSVVKMGNVVHAAISTVSVVLYFCFFVMGFGPIPNIL  599

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIA+CAL FWICD+IVTYSLPV+L S+GLAGVFG+YAVVCVISW+FVF
Sbjct  600  CAEIFPTRVRGLCIAMCALTFWICDIIVTYSLPVLLKSVGLAGVFGMYAVVCVISWVFVF  659

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFF+VGA+Q   AKN 
Sbjct  660  LKVPETKGMPLEVITEFFSVGAKQVAAAKNN  690



>ref|XP_003603868.1| Monosaccharide-sensing protein [Medicago truncatula]
 gb|AES74119.1| tonoplast monosaccharide transporter 2 [Medicago truncatula]
Length=730

 Score =   222 bits (566),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR LLL TIPV I SLV+LVLG+VI+ GSV HA +ST+CV++YFC FVMGYGPIPNIL
Sbjct  580  TGRRQLLLVTIPVLIVSLVILVLGSVIDFGSVVHAAISTVCVVVYFCFFVMGYGPIPNIL  639

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALVFWI D+IVTYSLPVMLSS+GLAGVFG+YA+VC ISW+FV+
Sbjct  640  CSEIFPTRVRGLCIAICALVFWIGDIIVTYSLPVMLSSLGLAGVFGVYAIVCCISWVFVY  699

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFF+VG++Q+  AKNE
Sbjct  700  LKVPETKGMPLEVITEFFSVGSKQSAAAKNE  730



>ref|XP_009103100.1| PREDICTED: monosaccharide-sensing protein 2 [Brassica rapa]
 ref|XP_009103156.1| PREDICTED: monosaccharide-sensing protein 2 [Brassica rapa]
 emb|CDX75492.1| BnaA01g02100D [Brassica napus]
Length=740

 Score =   222 bits (566),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRRTLLL+TIP+ I SL+VLV+ N++++ S+ HAVLST+ V+LYFC FVMG+GP PNI
Sbjct  589  LSGRRTLLLTTIPILIASLIVLVISNLVHMNSIVHAVLSTVSVVLYFCFFVMGFGPTPNI  648

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LC+EIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GLAGVFG+YAVVC ISW FV
Sbjct  649  LCSEIFPTRVRGICIAICALTFWICDIIVTYSLPVLLKSIGLAGVFGMYAVVCCISWAFV  708

Query  296  FLRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            +L VPETKGMPLEVITEFF+VGARQAE  KN 
Sbjct  709  YLEVPETKGMPLEVITEFFSVGARQAEAEKNN  740



>gb|KJB79729.1| hypothetical protein B456_013G064200 [Gossypium raimondii]
Length=526

 Score =   218 bits (556),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLL+T+PV I SLVVLV+ +V+ +GSV HA +ST+ V+LYFC FVMG+GPIPNIL
Sbjct  376  AGRRSLLLNTLPVLIISLVVLVVASVVKMGSVVHASISTVSVVLYFCFFVMGFGPIPNIL  435

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWICD+IVTYSLP++L S+GLAGVFG+YAVVCVISW+FVF
Sbjct  436  CAEIFPTRVRGICIAICALTFWICDIIVTYSLPLLLKSVGLAGVFGMYAVVCVISWVFVF  495

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFFAVGA+Q    K+ 
Sbjct  496  LKVPETKGMPLEVITEFFAVGAKQIAATKDN  526



>ref|XP_007018122.1| Tonoplast monosaccharide transporter2 isoform 4 [Theobroma cacao]
 gb|EOY15347.1| Tonoplast monosaccharide transporter2 isoform 4 [Theobroma cacao]
Length=740

 Score =   222 bits (566),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL+TIPV I SL++LV   +++LG+V +A +ST CVI+YFC FVMGYGPIPNIL
Sbjct  590  SGRRRLLLTTIPVLIVSLIILVFSEIVDLGTVVNAAISTACVIIYFCCFVMGYGPIPNIL  649

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALV+WI D+IVTY+LPVMLSS+GLAGVFGIYAVVCVIS +FVF
Sbjct  650  CSEIFPTRVRGLCIAICALVYWIGDIIVTYTLPVMLSSIGLAGVFGIYAVVCVISLVFVF  709

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFFAVGARQA   KNE
Sbjct  710  LKVPETKGMPLEVITEFFAVGARQAAATKNE  740



>gb|KHG04801.1| Monosaccharide-sensing protein 2 [Gossypium arboreum]
 gb|KHG22589.1| Monosaccharide-sensing protein 2 [Gossypium arboreum]
Length=740

 Score =   222 bits (565),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLLST+PV I SL+VLV+G+V+ +G+V HA +ST+ V+LYFC FVMG+GPIPNIL
Sbjct  590  AGRRSLLLSTLPVLIISLLVLVIGSVVKMGNVVHAAISTVSVVLYFCFFVMGFGPIPNIL  649

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIA+CAL FWICD+IVTYSLPV+L S+GLAGVFG+YAVVCVISW+FVF
Sbjct  650  CAEIFPTRVRGLCIAMCALTFWICDIIVTYSLPVLLKSVGLAGVFGMYAVVCVISWVFVF  709

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFF+VGA+Q   AKN 
Sbjct  710  LKVPETKGMPLEVITEFFSVGAKQVAAAKNN  740



>ref|XP_007018119.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 ref|XP_007018120.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 ref|XP_007018121.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 gb|EOY15344.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 gb|EOY15345.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 gb|EOY15346.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
Length=739

 Score =   222 bits (565),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL+TIPV I SL++LV   +++LG+V +A +ST CVI+YFC FVMGYGPIPNIL
Sbjct  589  SGRRRLLLTTIPVLIVSLIILVFSEIVDLGTVVNAAISTACVIIYFCCFVMGYGPIPNIL  648

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALV+WI D+IVTY+LPVMLSS+GLAGVFGIYAVVCVIS +FVF
Sbjct  649  CSEIFPTRVRGLCIAICALVYWIGDIIVTYTLPVMLSSIGLAGVFGIYAVVCVISLVFVF  708

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFFAVGARQA   KNE
Sbjct  709  LKVPETKGMPLEVITEFFAVGARQAAATKNE  739



>gb|KJB77472.1| hypothetical protein B456_012G139000 [Gossypium raimondii]
 gb|KJB77475.1| hypothetical protein B456_012G139000 [Gossypium raimondii]
Length=740

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLLST+PV I SL+VLV+G+V+ +G+V HA +ST+ V+LYFC FVMG+GPIPNIL
Sbjct  590  AGRRSLLLSTLPVLIISLLVLVIGSVVKMGNVVHAAISTVSVVLYFCFFVMGFGPIPNIL  649

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIA+CAL FWICD+IVTYSLPV+L S+GLAGVFG+YAVVCVISW+FVF
Sbjct  650  CAEIFPTRVRGICIAMCALTFWICDIIVTYSLPVLLKSVGLAGVFGMYAVVCVISWVFVF  709

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFF+VGA+Q   AKN 
Sbjct  710  LKVPETKGMPLEVITEFFSVGAKQVAAAKNN  740



>ref|XP_008237926.1| PREDICTED: monosaccharide-sensing protein 2 [Prunus mume]
Length=739

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRRTLLL+TIPV + SL++L++ N+++LG+V HA LSTICVI+YFC FVM YGPIPNIL
Sbjct  589  AGRRTLLLTTIPVLVVSLIILIIANLVSLGTVLHAALSTICVIIYFCVFVMAYGPIPNIL  648

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALV+WI D+IVTYSLP +L S+GLAGVFGIYAVVCVIS+IF+F
Sbjct  649  CSEIFPTRVRGLCIAICALVYWIGDIIVTYSLPDLLDSIGLAGVFGIYAVVCVISFIFIF  708

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFFAVGARQ   AK+E
Sbjct  709  LKVPETKGMPLEVITEFFAVGARQVAAAKSE  739



>ref|XP_010094525.1| Monosaccharide-sensing protein 2 [Morus notabilis]
 gb|EXB56279.1| Monosaccharide-sensing protein 2 [Morus notabilis]
Length=739

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL+TIPV I +LV+LV+GN +++GSV HAV+ST+CV++YFC F M YGPIPNIL
Sbjct  589  SGRRRLLLTTIPVLIVALVILVIGNFLSMGSVIHAVISTVCVVVYFCCFAMAYGPIPNIL  648

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALVFW+ D+IVTY+LPVMLSS+GLAG+FGIYA+VC+ISWIFVF
Sbjct  649  CSEIFPTRVRGLCIAICALVFWVGDIIVTYTLPVMLSSIGLAGIFGIYAIVCIISWIFVF  708

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFFA+GAR+   AK +
Sbjct  709  LKVPETKGMPLEVITEFFAIGAREVAEAKKD  739



>ref|XP_010437493.1| PREDICTED: monosaccharide-sensing protein 2-like [Camelina sativa]
Length=739

 Score =   220 bits (561),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRRTLLL+TIP+ I SL+VLV+ N++ + S+ HAVLST  V+LYFC FVMG+GP PNI
Sbjct  588  LSGRRTLLLTTIPILIASLLVLVVSNIVQMNSIVHAVLSTASVVLYFCFFVMGFGPAPNI  647

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LC+EIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GLAGVFG+YA+VC ISW+FV
Sbjct  648  LCSEIFPTRVRGICIAICALTFWICDIIVTYSLPVLLKSVGLAGVFGMYAIVCCISWVFV  707

Query  296  FLRVPETKGMPLEVITEFFAVGARQAEMAK  207
            F++VPETKGMPLEVITEFF++GARQAE AK
Sbjct  708  FIKVPETKGMPLEVITEFFSLGARQAEAAK  737



>gb|AJO70165.1| tonoplast monosaccharide transporters 1 [Camellia sinensis]
Length=736

 Score =   220 bits (560),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRRTLLL+TIPV + SLV+LV+  +I+LGSV  AV+STICV++YFC FV GYGP+PNIL
Sbjct  586  AGRRTLLLTTIPVLVVSLVILVITELIDLGSVPEAVISTICVVVYFCCFVTGYGPVPNIL  645

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CI ICALV+WI D+IVTYSLPV+L+S+GL GVFGIYA+VCVISWIF++
Sbjct  646  CAEIFPTRVRGLCITICALVYWIGDIIVTYSLPVLLTSIGLDGVFGIYAIVCVISWIFIY  705

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFFAVGARQAE AK E
Sbjct  706  LKVPETKGMPLEVITEFFAVGARQAEAAKTE  736



>ref|XP_007043079.1| Tonoplast monosaccharide transporter2 [Theobroma cacao]
 gb|EOX98910.1| Tonoplast monosaccharide transporter2 [Theobroma cacao]
Length=739

 Score =   220 bits (560),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLL+TIPV I SL++LV+G+V+ +G+V HA +ST+ V+LYFC FVMG+GPIPNIL
Sbjct  589  AGRRSLLLTTIPVLIISLLILVIGSVVKMGNVVHAAISTVSVVLYFCFFVMGFGPIPNIL  648

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GLAGVFG+YAVVCVISW+FVF
Sbjct  649  CAEIFPTRVRGICIAICALTFWICDIIVTYSLPVLLKSVGLAGVFGMYAVVCVISWVFVF  708

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFF+VGARQ   AKN 
Sbjct  709  LKVPETKGMPLEVITEFFSVGARQVAAAKNN  739



>ref|XP_008373385.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=739

 Score =   220 bits (560),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR LLL+TIPV I +L++LV+ N++ LGSV HAVLST CVI+YFC FVM YGPIPNIL
Sbjct  589  TGRRMLLLTTIPVLIVALIILVVTNLLTLGSVLHAVLSTTCVIVYFCVFVMAYGPIPNIL  648

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALV+WI D+IVTYSLPVML SMGL+G FGIYA VCVIS++F+F
Sbjct  649  CSEIFPTRVRGLCIAICALVYWIGDIIVTYSLPVMLDSMGLSGAFGIYAAVCVISFVFIF  708

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFF+VGARQ   AKNE
Sbjct  709  LKVPETKGMPLEVITEFFSVGARQVAAAKNE  739



>ref|XP_007210337.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
 ref|XP_007210338.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
 gb|EMJ11536.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
 gb|EMJ11537.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
Length=739

 Score =   219 bits (559),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLL+TIPV + +L++L++ N++ LG+V HA LS ICVI+YFC FVM YGPIPNIL
Sbjct  589  SGRRTLLLATIPVLVVTLIILIIANLVTLGTVLHAALSVICVIVYFCCFVMAYGPIPNIL  648

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALV+WI D+IVTY+LPV+L S+GLAG+FGIYAVVCVIS+IF+F
Sbjct  649  CSEIFPTRVRGLCIAICALVYWIGDIIVTYTLPVLLDSIGLAGIFGIYAVVCVISFIFIF  708

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFFAVGARQ   AK+E
Sbjct  709  LKVPETKGMPLEVITEFFAVGARQVAAAKSE  739



>dbj|BAJ87413.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=431

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL TIP+ I SL+VLV+ NVI L +V HAVLST+ VI+YFC FVMG+GPIPNIL
Sbjct  282  SGRRFLLLGTIPILIASLIVLVVSNVITLSTVPHAVLSTVSVIVYFCCFVMGFGPIPNIL  341

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWICD+IVTYSLPVML+++GLAGVFGIYA+VC I+++FV+
Sbjct  342  CAEIFPTRVRGVCIAICALTFWICDIIVTYSLPVMLNAIGLAGVFGIYAIVCCIAFVFVY  401

Query  293  LRVPETKGMPLEVITEFFAVGARQAE  216
            L+VPETKGMPLEVITEFFAVGA+QA+
Sbjct  402  LKVPETKGMPLEVITEFFAVGAKQAQ  427



>ref|XP_004500684.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004500685.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Cicer 
arietinum]
Length=740

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLL+TIPV I SL++LVLG+ ++LGS A+A +STI V++YFC FVMG+GPIPNIL
Sbjct  590  SGRRTLLLTTIPVLIVSLLILVLGSFVDLGSTANASISTISVVIYFCFFVMGFGPIPNIL  649

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWICD+IVTYSLPVML+SMGL GVFG+YAVVC I+W+FV+
Sbjct  650  CAEIFPTRVRGLCIAICALTFWICDIIVTYSLPVMLNSMGLGGVFGLYAVVCFIAWVFVY  709

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVI EFF+VGA+QAE AK+ 
Sbjct  710  LKVPETKGMPLEVIIEFFSVGAKQAETAKHN  740



>ref|XP_003604104.1| Monosaccharide-sensing protein [Medicago truncatula]
 gb|AES74355.1| tonoplast monosaccharide transporter 2 [Medicago truncatula]
Length=744

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLL+TIPV I SL +LVLG++++LG  A+A +STI V++YFCSFVMG+GP+PNIL
Sbjct  590  SGRRTLLLTTIPVLIVSLFILVLGSLVDLGDTANASISTISVVVYFCSFVMGFGPVPNIL  649

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWICD+IVTYSLPVML+S+GL GVFG+YAVVC I+W+FVF
Sbjct  650  CAEIFPTRVRGLCIAICALTFWICDIIVTYSLPVMLNSVGLGGVFGLYAVVCCIAWVFVF  709

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVI EFF+VGA+Q + AK+ 
Sbjct  710  LKVPETKGMPLEVIIEFFSVGAKQIDAAKHN  740



>ref|XP_007137297.1| hypothetical protein PHAVU_009G115500g [Phaseolus vulgaris]
 gb|ESW09291.1| hypothetical protein PHAVU_009G115500g [Phaseolus vulgaris]
Length=739

 Score =   218 bits (555),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLL+TIPV I SL++LVLG++++LGS A+A +STI VI+YFC FVMG+GPIPNIL
Sbjct  587  SGRRTLLLTTIPVLIASLLILVLGSLVDLGSTANASISTISVIVYFCFFVMGFGPIPNIL  646

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWICD+IVTY+LPVML+S+GLAGVFGIYAVVC I+W+FVF
Sbjct  647  CAEIFPTRVRGLCIAICALTFWICDIIVTYTLPVMLNSIGLAGVFGIYAVVCFIAWVFVF  706

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAK  207
            L+VPETKGMPLEVI EFF+VGA+Q + AK
Sbjct  707  LKVPETKGMPLEVIIEFFSVGAKQVDDAK  735



>ref|XP_010066352.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 ref|XP_010066353.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 ref|XP_010066354.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 ref|XP_010066355.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW64228.1| hypothetical protein EUGRSUZ_G01880 [Eucalyptus grandis]
Length=740

 Score =   218 bits (554),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLLSTIP+ I SL++LVL +VI++GSV HAV+ST+ V+LYFC FVMG+GP+PNIL
Sbjct  590  AGRRSLLLSTIPILIASLIILVLSSVISMGSVVHAVISTVSVVLYFCFFVMGFGPVPNIL  649

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWI D++VTYSLPVML S+GLAGVFG+YA+VC+ISW FVF
Sbjct  650  CAEIFPTRVRGLCIAICALTFWIGDIVVTYSLPVMLKSVGLAGVFGMYAIVCLISWGFVF  709

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            ++VPETKGMPLEVITEFF+VGARQA  A+N 
Sbjct  710  MKVPETKGMPLEVITEFFSVGARQAVAARNN  740



>gb|KJB79728.1| hypothetical protein B456_013G064200 [Gossypium raimondii]
Length=739

 Score =   217 bits (553),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLL+T+PV I SLVVLV+ +V+ +GSV HA +ST+ V+LYFC FVMG+GPIPNIL
Sbjct  589  AGRRSLLLNTLPVLIISLVVLVVASVVKMGSVVHASISTVSVVLYFCFFVMGFGPIPNIL  648

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWICD+IVTYSLP++L S+GLAGVFG+YAVVCVISW+FVF
Sbjct  649  CAEIFPTRVRGICIAICALTFWICDIIVTYSLPLLLKSVGLAGVFGMYAVVCVISWVFVF  708

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFFAVGA+Q    K+ 
Sbjct  709  LKVPETKGMPLEVITEFFAVGAKQIAATKDN  739



>gb|KHG05233.1| Monosaccharide-sensing 2 -like protein [Gossypium arboreum]
Length=739

 Score =   217 bits (552),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLL+T+PV I SLVVLV+ +V+ +GSV HA +ST+ V+LYFC FVMG+GPIPNIL
Sbjct  589  AGRRSLLLNTLPVLIISLVVLVVASVVKMGSVVHASISTVSVVLYFCFFVMGFGPIPNIL  648

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWICD+IVTYSLP++L S+GLAGVFG+YAVVCVISW+FVF
Sbjct  649  CAEIFPTRVRGICIAICALTFWICDIIVTYSLPLLLKSVGLAGVFGMYAVVCVISWVFVF  708

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFFAVGA+Q    K+ 
Sbjct  709  LKVPETKGMPLEVITEFFAVGAKQIAATKDN  739



>gb|KHN19961.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=723

 Score =   216 bits (550),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLLSTIPV I +L++LVLG++++LG+ A+A +STI VI+YFC FVMG+GPIPNIL
Sbjct  573  SGRRTLLLSTIPVLIVALLILVLGSLVDLGTTANASISTISVIVYFCFFVMGFGPIPNIL  632

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWICD+IVTY+LPVML+S+GLAGVFGIYAV C I+W+FVF
Sbjct  633  CAEIFPTRVRGLCIAICALTFWICDIIVTYTLPVMLNSLGLAGVFGIYAVACFIAWVFVF  692

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVI EFF+VGA+Q + AK+ 
Sbjct  693  LKVPETKGMPLEVIIEFFSVGAKQVDDAKHN  723



>ref|XP_003526737.1| PREDICTED: monosaccharide-sensing protein 2-like isoform 1 [Glycine 
max]
Length=738

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLLSTIPV I +L++LVLG++++LG+ A+A +STI VI+YFC FVMG+GPIPNIL
Sbjct  588  SGRRTLLLSTIPVLIVALLILVLGSLVDLGTTANASISTISVIVYFCFFVMGFGPIPNIL  647

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWICD+IVTY+LPVML+S+GLAGVFGIYAV C I+W+FVF
Sbjct  648  CAEIFPTRVRGLCIAICALTFWICDIIVTYTLPVMLNSLGLAGVFGIYAVACFIAWVFVF  707

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVI EFF+VGA+Q + AK+ 
Sbjct  708  LKVPETKGMPLEVIIEFFSVGAKQVDDAKHN  738



>ref|XP_003543932.1| PREDICTED: monosaccharide-sensing protein 2-like [Glycine max]
Length=734

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLLSTIPV I +L++LVLG++++LGS A+A +STI VI+YFC FVMG+GPIPNIL
Sbjct  584  SGRRTLLLSTIPVLIAALLILVLGSLVDLGSTANASISTISVIVYFCFFVMGFGPIPNIL  643

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWICD+IVTY+LPVML+S+GLAGVFGIYAVVC I+W+FVF
Sbjct  644  CAEIFPTRVRGLCIAICALTFWICDIIVTYTLPVMLNSVGLAGVFGIYAVVCFIAWVFVF  703

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVI EFF+VGA+Q + AK+ 
Sbjct  704  LKVPETKGMPLEVIIEFFSVGAKQFDDAKHN  734



>gb|KHN33643.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=734

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLLSTIPV I +L++LVLG++++LGS A+A +STI VI+YFC FVMG+GPIPNIL
Sbjct  584  SGRRTLLLSTIPVLIAALLILVLGSLVDLGSTANASISTISVIVYFCFFVMGFGPIPNIL  643

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWICD+IVTY+LPVML+S+GLAGVFGIYAVVC I+W+FVF
Sbjct  644  CAEIFPTRVRGLCIAICALTFWICDIIVTYTLPVMLNSVGLAGVFGIYAVVCFIAWVFVF  703

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVI EFF+VGA+Q + AK+ 
Sbjct  704  LKVPETKGMPLEVIIEFFSVGAKQFDDAKHN  734



>ref|XP_003518591.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Glycine 
max]
 ref|XP_006575765.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Glycine 
max]
 ref|XP_006575766.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X3 [Glycine 
max]
 gb|KHN29885.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=711

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLL+TIPV I SL++LV+G+++ L S  +A +ST  VI+YFC FVMG+GPIPNIL
Sbjct  559  SGRRTLLLTTIPVLIVSLLILVIGSLVELDSTINAFISTSSVIVYFCCFVMGFGPIPNIL  618

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICAL FWICD+IVTY+LPVML+S+GL GVFG+YAVVC+I+W+FVF
Sbjct  619  CSEIFPTRVRGLCIAICALTFWICDIIVTYTLPVMLNSVGLGGVFGMYAVVCIIAWVFVF  678

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            L+VPETKGMPLEVI EFF+VGA+QA++A N
Sbjct  679  LKVPETKGMPLEVIIEFFSVGAKQAQVANN  708



>ref|XP_010266257.1| PREDICTED: monosaccharide-sensing protein 2 isoform X1 [Nelumbo 
nucifera]
Length=742

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 136/151 (90%), Gaps = 1/151 (1%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL+TIP+ I SLVVLV+ N++ + SV HA+LSTI V++YFC FV G+GPIPNIL
Sbjct  593  SGRRRLLLTTIPILIVSLVVLVVSNIVTMNSVVHAILSTISVVVYFCCFVTGFGPIPNIL  652

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALVFWI D+IVTY+LPVML+S+GLAGVFGIYAVVC ISW+FVF
Sbjct  653  CSEIFPTRVRGVCIAICALVFWIGDIIVTYTLPVMLTSIGLAGVFGIYAVVCCISWVFVF  712

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFFAVGARQA  AKN+
Sbjct  713  LKVPETKGMPLEVITEFFAVGARQA-AAKND  742



>ref|XP_010090703.1| Monosaccharide-sensing protein 2 [Morus notabilis]
 gb|EXB40422.1| Monosaccharide-sensing protein 2 [Morus notabilis]
Length=740

 Score =   215 bits (548),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLL+TIP+ I SL+VLVLG+V+NLG V HA +ST  V+LYFC FVMG+GPIPNIL
Sbjct  590  SGRRSLLLNTIPILIVSLLVLVLGSVVNLGKVFHATISTASVVLYFCFFVMGFGPIPNIL  649

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML ++GLAGVFG+YAVVC+ISW+FVF
Sbjct  650  CAEIFPTRVRGLCIAICALTFWIGDIIVTYSLPVMLKAVGLAGVFGMYAVVCIISWVFVF  709

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFF+VGA+Q   AKN+
Sbjct  710  LKVPETKGMPLEVITEFFSVGAKQVAAAKND  740



>gb|KHN46863.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=717

 Score =   215 bits (548),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLL+TIPV I SL++LV+G+++ L S  +A +ST  VI+YFC FVMG+GPIPNIL
Sbjct  567  SGRRTLLLTTIPVLIVSLLILVIGSLVELDSTINAFISTSSVIVYFCCFVMGFGPIPNIL  626

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICAL FWICD+IVTY+LPVML+S+GL GVFG+YAVVC+I+W+FVF
Sbjct  627  CSEIFPTRVRGLCIAICALTFWICDIIVTYTLPVMLNSVGLGGVFGMYAVVCIIAWVFVF  686

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            L+VPETKGMPLEVI EFF+VGA+QA++A N
Sbjct  687  LKVPETKGMPLEVIIEFFSVGAKQAQVANN  716



>ref|XP_008440928.1| PREDICTED: LOW QUALITY PROTEIN: monosaccharide-sensing protein 
2 [Cucumis melo]
Length=725

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLLSTIPV I SL+VLV+G+++++GSVA+A +STI VI YFC FVMG+GP+PNIL
Sbjct  577  AGRRSLLLSTIPVLIISLIVLVVGSMVDMGSVANATISTISVIAYFCCFVMGFGPVPNIL  636

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIA+CAL FWI D+IVTYSLPVML+S+GL GVFG YA++C+ISWIFVF
Sbjct  637  CSEIFPTRVRGLCIAMCALTFWIGDIIVTYSLPVMLNSIGLGGVFGAYAIICIISWIFVF  696

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAK  207
            L+VPETKGMPLEVI++FFAVGA+QA+ A 
Sbjct  697  LKVPETKGMPLEVISDFFAVGAKQADNAD  725



>ref|XP_010686712.1| PREDICTED: monosaccharide-sensing protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=735

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLL+TIPV I SLV+LV+   +++GSV HAV+S ICVI+YFC+FVM YGPIPNIL
Sbjct  585  SGRRSLLLATIPVLIASLVILVISCTVSMGSVIHAVISIICVIVYFCTFVMAYGPIPNIL  644

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAIC LVFWICD+IVTYSLPVML+S+GL G+F IYAVVCVIS +FV+
Sbjct  645  CSEIFPTRVRGVCIAICGLVFWICDIIVTYSLPVMLNSIGLGGIFAIYAVVCVISLVFVY  704

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFF+V  +Q E AK E
Sbjct  705  LKVPETKGMPLEVITEFFSVDPKQLEAAKAE  735



>emb|CDI66591.1| putative sugar transporter type 2a protein [Saccharum hybrid 
cultivar R570]
Length=745

 Score =   214 bits (546),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRR LLL TIP+ I SLV+LV+ NVI+LG+VAHAVLST+ VI+YFC FVMG+GPIPNI
Sbjct  596  LSGRRFLLLGTIPILIASLVILVVSNVIDLGTVAHAVLSTVSVIIYFCCFVMGFGPIPNI  655

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LCAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML+++GLAGVFGIYAVVC+I+++FV
Sbjct  656  LCAEIFPTRVRGLCIAICALTFWIGDIIVTYSLPVMLNAIGLAGVFGIYAVVCLIAFVFV  715

Query  296  FLRVPETKGMPLEVITEFFAVGARQA  219
            FL+VPETKGMPLEVITEFFAVGA+QA
Sbjct  716  FLKVPETKGMPLEVITEFFAVGAKQA  741



>ref|XP_004289029.1| PREDICTED: monosaccharide-sensing protein 2-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011461449.1| PREDICTED: monosaccharide-sensing protein 2-like [Fragaria vesca 
subsp. vesca]
Length=760

 Score =   214 bits (546),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLL T+P+   +L+VL+ G ++N+GSV +A +STI V+LYFC+FVMG+GPIPNIL
Sbjct  608  AGRRSLLLGTLPILTVTLLVLIFGQLVNMGSVVNATISTISVVLYFCTFVMGFGPIPNIL  667

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICAL FWI D+IVTY+LP++L+S+GLAGVF IYAVVC ISW+FVF
Sbjct  668  CSEIFPTRVRGLCIAICALTFWIGDIIVTYTLPILLTSIGLAGVFAIYAVVCTISWVFVF  727

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAK  207
            L+VPETKGMPLEVI+EFFAVGA+QAEMA+
Sbjct  728  LKVPETKGMPLEVISEFFAVGAKQAEMAE  756



>ref|XP_002510716.1| sugar transporter, putative [Ricinus communis]
 gb|EEF52903.1| sugar transporter, putative [Ricinus communis]
Length=739

 Score =   214 bits (545),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL+TIPV I SLV+L++G  I+LG+VA+A +ST CV++YFC FV  YGPIPNIL
Sbjct  589  SGRRALLLTTIPVLIGSLVILIIGESIDLGTVANAAVSTACVVIYFCCFVTAYGPIPNIL  648

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALV+WI D+IVTY+LPVML+S+GL G+F I+AV+C ISW+FVF
Sbjct  649  CSEIFPTRVRGLCIAICALVYWIADIIVTYTLPVMLTSIGLEGIFIIFAVMCAISWVFVF  708

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFFAVGARQA+ AKNE
Sbjct  709  LKVPETKGMPLEVITEFFAVGARQADAAKNE  739



>emb|CBI40753.3| unnamed protein product [Vitis vinifera]
Length=662

 Score =   213 bits (542),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  650  GRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNILC  471
            GRR LLL+TIPV I +L+VLV+G+++   +V HA +ST CVI+YFC FV  YGPIPNILC
Sbjct  513  GRRRLLLTTIPVLIVTLLVLVIGDLVTTTTVIHAAISTACVIIYFCCFVTAYGPIPNILC  572

Query  470  AEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVFL  291
            +EIFPTRVRG CIAICALV+WI D+IVTY+LPVML+S+GL G+FGIYAVVCVISW+FVFL
Sbjct  573  SEIFPTRVRGLCIAICALVYWIGDIIVTYTLPVMLTSIGLTGIFGIYAVVCVISWVFVFL  632

Query  290  RVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            +VPETKGMPLEVI EFFAVGARQ   AKN+
Sbjct  633  KVPETKGMPLEVIAEFFAVGARQVTAAKND  662



>gb|EMS49950.1| Monosaccharide-sensing protein 2 [Triticum urartu]
Length=686

 Score =   213 bits (543),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL TIP+ I SL+VLV+ NVINL +V HAVLST+ VI+YFC FVMG+GPIPNIL
Sbjct  537  SGRRFLLLGTIPILIASLIVLVVSNVINLSTVPHAVLSTVSVIVYFCCFVMGFGPIPNIL  596

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWICD+IVTYSLPVML+++GLAGVFGIYAVVC I+++FV+
Sbjct  597  CAEIFPTRVRGVCIAICALTFWICDIIVTYSLPVMLNAIGLAGVFGIYAVVCCIAFVFVY  656

Query  293  LRVPETKGMPLEVITEFFAVGARQAE  216
            L+VPETKGMPLEVITEFFAVGA+QA+
Sbjct  657  LKVPETKGMPLEVITEFFAVGAKQAQ  682



>ref|XP_006412119.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 ref|XP_006412120.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 ref|XP_006412121.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 gb|ESQ53572.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 gb|ESQ53573.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 gb|ESQ53574.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
Length=734

 Score =   214 bits (544),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRRTLLL+TIP+ I SL+VLV+ N++++ S+ HAVLST+ V+LYFC FVMG+GP PNI
Sbjct  585  LSGRRTLLLTTIPILIASLIVLVISNLVHMNSILHAVLSTVSVVLYFCFFVMGFGPTPNI  644

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LC+EIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GLAGVFG+YAVVC ISW+FV
Sbjct  645  LCSEIFPTRVRGICIAICALTFWICDIIVTYSLPVLLKSIGLAGVFGMYAVVCCISWVFV  704

Query  296  FLRVPETKGMPLEVITEFFAVGARQA  219
            +++VPETKGMPLEVITEFF++GARQA
Sbjct  705  YIQVPETKGMPLEVITEFFSLGARQA  730



>ref|XP_010539774.1| PREDICTED: monosaccharide-sensing protein 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010539775.1| PREDICTED: monosaccharide-sensing protein 1-like isoform X2 [Tarenaya 
hassleriana]
Length=723

 Score =   213 bits (543),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL+TIPV I SL+VLVL  ++++ +V +A +ST CV++YFC FVMGYGPIPNIL
Sbjct  573  SGRRALLLATIPVLIASLLVLVLSELVHISTVINAAISTACVVIYFCCFVMGYGPIPNIL  632

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICA+VFW+ D+IVTYSLPV+LSS+GL GVF IYA VCV+SWIFVF
Sbjct  633  CSEIFPTRVRGLCIAICAMVFWVGDIIVTYSLPVLLSSIGLVGVFSIYAAVCVVSWIFVF  692

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            L+VPETKGMPLEVITEFFA GA+Q + AK+
Sbjct  693  LKVPETKGMPLEVITEFFAYGAQQDQSAKD  722



>emb|CDI66586.1| putative sugar transporter type 2a protein [Saccharum hybrid 
cultivar R570]
 emb|CDI66607.1| putative sugar transporter type 2a protein [Saccharum hybrid 
cultivar R570]
Length=745

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRR LLL TIP+ I SLV+LV+ NVI+LG+VAHA LST+ VI+YFC FVMG+GPIPNI
Sbjct  596  LSGRRFLLLGTIPILIASLVILVVSNVIDLGTVAHAALSTVSVIIYFCCFVMGFGPIPNI  655

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LCAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML+++GLAGVFGIYAVVC+I+++FV
Sbjct  656  LCAEIFPTRVRGLCIAICALTFWIGDIIVTYSLPVMLNAIGLAGVFGIYAVVCLIAFVFV  715

Query  296  FLRVPETKGMPLEVITEFFAVGARQA  219
            FL+VPETKGMPLEVITEFFAVGA+QA
Sbjct  716  FLKVPETKGMPLEVITEFFAVGAKQA  741



>emb|CAN59780.1| hypothetical protein VITISV_024656 [Vitis vinifera]
Length=740

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  650  GRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNILC  471
            GRR LLL+TIPV I +L+VLV+G+++   +V HA +ST CVI+YFC FV  YGPIPNILC
Sbjct  591  GRRRLLLTTIPVLIVTLLVLVIGDLVTTTTVIHAAISTACVIIYFCCFVTAYGPIPNILC  650

Query  470  AEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVFL  291
            +EIFPTRVRG CIAICALV+WI D+IVTY+LPVML+S+GL G+FGIYAVVCVISW+FVFL
Sbjct  651  SEIFPTRVRGLCIAICALVYWIGDIIVTYTLPVMLTSIGLTGIFGIYAVVCVISWVFVFL  710

Query  290  RVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            +VPETKGMPLEVI EFFAVGARQ   AKN+
Sbjct  711  KVPETKGMPLEVIAEFFAVGARQVTAAKND  740



>ref|NP_001267873.1| hexose transporter-like [Vitis vinifera]
 gb|AAY40466.1| putative hexose transporter [Vitis vinifera]
 gb|ADP37147.1| putative tonoplastic monosaccharide transporter [Vitis vinifera]
Length=740

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  650  GRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNILC  471
            GRR LLL+TIPV I +L+VLV+G+++   +V HA +ST CVI+YFC FV  YGPIPNILC
Sbjct  591  GRRRLLLTTIPVLIVTLLVLVIGDLVTTTTVIHAAISTACVIIYFCCFVTAYGPIPNILC  650

Query  470  AEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVFL  291
            +EIFPTRVRG CIAICALV+WI D+IVTY+LPVML+S+GL G+FGIYAVVCVISW+FVFL
Sbjct  651  SEIFPTRVRGLCIAICALVYWIGDIIVTYTLPVMLTSIGLTGIFGIYAVVCVISWVFVFL  710

Query  290  RVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            +VPETKGMPLEVI EFFAVGARQ   AKN+
Sbjct  711  KVPETKGMPLEVIAEFFAVGARQVTAAKND  740



>ref|XP_006647093.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006647094.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Oryza 
brachyantha]
Length=746

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL TIPV I SLV+LV+ NVI+LG+V HA LST+ VI+YFC FVMG+GPIPNIL
Sbjct  597  SGRRFLLLGTIPVLIASLVILVVSNVIDLGTVPHAALSTVSVIIYFCCFVMGFGPIPNIL  656

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML+++GLAGVFGIYAVVC+I+++FVF
Sbjct  657  CAEIFPTRVRGICIAICALTFWIGDIIVTYSLPVMLNAIGLAGVFGIYAVVCLIAFVFVF  716

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAK  207
            L+VPETKGMPLEVITEFFAVGA+Q + AK
Sbjct  717  LKVPETKGMPLEVITEFFAVGAKQMQAAK  745



>gb|AIQ77649.1| tonoplastic transporter 1 [Vitis vinifera]
Length=740

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  650  GRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNILC  471
            GRR LLL+TIPV I +L+VLV+G+++   +V HA +ST CVI+YFC FV  YGPIPNILC
Sbjct  591  GRRRLLLTTIPVLIVTLLVLVIGDLVTTTTVIHAAISTACVIIYFCCFVTAYGPIPNILC  650

Query  470  AEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVFL  291
            +EIFPTRVRG CIAICALV+WI D+IVTY+LPVML+S+GL G+FGIYAVVCVISW+FVFL
Sbjct  651  SEIFPTRVRGLCIAICALVYWIGDIIVTYTLPVMLTSIGLTGIFGIYAVVCVISWVFVFL  710

Query  290  RVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            +VPETKGMPLEVI EFFAVGARQ   AKN+
Sbjct  711  KVPETKGMPLEVIAEFFAVGARQVTAAKND  740



>gb|EAY85098.1| hypothetical protein OsI_06450 [Oryza sativa Indica Group]
Length=689

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL TIPV I SLVVLV+ NVI+LG+VAHA LSTI VI+YFC FVMG+GPIPNIL
Sbjct  540  SGRRFLLLGTIPVLIASLVVLVVSNVIDLGTVAHAALSTISVIIYFCCFVMGFGPIPNIL  599

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML+++GLAGVFGIYAVVC I+++FVF
Sbjct  600  CAEIFPTRVRGICIAICALTFWIGDIIVTYSLPVMLNAIGLAGVFGIYAVVCSIAFVFVF  659

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAK  207
            L+VPETKGMPLEVITEFFAVGA+Q +  K
Sbjct  660  LKVPETKGMPLEVITEFFAVGAKQMQATK  688



>ref|NP_001046359.1| Os02g0229400 [Oryza sativa Japonica Group]
 dbj|BAD26163.1| putative hexose transporter [Oryza sativa Japonica Group]
 dbj|BAF08273.1| Os02g0229400 [Oryza sativa Japonica Group]
 gb|ADG21983.1| tonoplast monosaccharide transporter 2 [Oryza sativa Japonica 
Group]
Length=746

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL TIPV I SLVVLV+ NVI+LG+VAHA LSTI VI+YFC FVMG+GPIPNIL
Sbjct  597  SGRRFLLLGTIPVLIASLVVLVVSNVIDLGTVAHAALSTISVIIYFCCFVMGFGPIPNIL  656

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML+++GLAGVFGIYAVVC I+++FVF
Sbjct  657  CAEIFPTRVRGICIAICALTFWIGDIIVTYSLPVMLNAIGLAGVFGIYAVVCSIAFVFVF  716

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAK  207
            L+VPETKGMPLEVITEFFAVGA+Q +  K
Sbjct  717  LKVPETKGMPLEVITEFFAVGAKQMQATK  745



>dbj|BAJ89532.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL TIP+ I SL+VLV+ NVI L +V HAVLST+ VI+YFC FVMG+GPIPNIL
Sbjct  595  SGRRFLLLGTIPILIASLIVLVVSNVITLSTVPHAVLSTVSVIVYFCCFVMGFGPIPNIL  654

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWICD+IVTYSLPVML+++GLAGVFGIYA+VC I+++FV+
Sbjct  655  CAEIFPTRVRGVCIAICALTFWICDIIVTYSLPVMLNAIGLAGVFGIYAIVCCIAFVFVY  714

Query  293  LRVPETKGMPLEVITEFFAVGARQAE  216
            L+VPETKGMPLEVITEFFAVGA+QA+
Sbjct  715  LKVPETKGMPLEVITEFFAVGAKQAQ  740



>gb|KCW64229.1| hypothetical protein EUGRSUZ_G01880 [Eucalyptus grandis]
Length=739

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -2

Query  644  RTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNILCAE  465
            R+LLLSTIP+ I SL++LVL +VI++GSV HAV+ST+ V+LYFC FVMG+GP+PNILCAE
Sbjct  592  RSLLLSTIPILIASLIILVLSSVISMGSVVHAVISTVSVVLYFCFFVMGFGPVPNILCAE  651

Query  464  IFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVFLRV  285
            IFPTRVRG CIAICAL FWI D++VTYSLPVML S+GLAGVFG+YA+VC+ISW FVF++V
Sbjct  652  IFPTRVRGLCIAICALTFWIGDIVVTYSLPVMLKSVGLAGVFGMYAIVCLISWGFVFMKV  711

Query  284  PETKGMPLEVITEFFAVGARQAEMAKNE  201
            PETKGMPLEVITEFF+VGARQA  A+N 
Sbjct  712  PETKGMPLEVITEFFSVGARQAVAARNN  739



>gb|AAX47312.1| hexose transporter 6 [Vitis vinifera]
Length=740

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  650  GRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNILC  471
            GRR +LL+TIPV I +L+VLV+G+++   +V HA +ST CVI+YFC FV  YGPIPNILC
Sbjct  591  GRRRMLLTTIPVLIVTLLVLVIGDLVTTTTVIHAAISTACVIIYFCCFVTAYGPIPNILC  650

Query  470  AEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVFL  291
            +EIFPTRVRG CIAICALV+WI D+IVTY+LPVML+S+GL G+FGIYAVVCVISW+FVFL
Sbjct  651  SEIFPTRVRGLCIAICALVYWIGDIIVTYTLPVMLTSIGLTGIFGIYAVVCVISWVFVFL  710

Query  290  RVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            +VPETKGMPLEVI EFFAVGARQ   AKN+
Sbjct  711  KVPETKGMPLEVIAEFFAVGARQVTAAKND  740



>gb|EAZ22316.1| hypothetical protein OsJ_05971 [Oryza sativa Japonica Group]
Length=775

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL TIPV I SLVVLV+ NVI+LG+VAHA LSTI VI+YFC FVMG+GPIPNIL
Sbjct  626  SGRRFLLLGTIPVLIASLVVLVVSNVIDLGTVAHAALSTISVIIYFCCFVMGFGPIPNIL  685

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML+++GLAGVFGIYAVVC I+++FVF
Sbjct  686  CAEIFPTRVRGICIAICALTFWIGDIIVTYSLPVMLNAIGLAGVFGIYAVVCSIAFVFVF  745

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAK  207
            L+VPETKGMPLEVITEFFAVGA+Q +  K
Sbjct  746  LKVPETKGMPLEVITEFFAVGAKQMQATK  774



>ref|XP_004300112.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
 ref|XP_011465026.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
Length=738

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR LLLST+PV I SL++LV+ N+++L SV  A +ST CV++YFC FVM YGPIPNIL
Sbjct  588  AGRRMLLLSTLPVLIVSLILLVIANLVSLSSVVEAAISTTCVVIYFCVFVMAYGPIPNIL  647

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALV+WI D+I+TYSLPV+L S+GLAG+FG+YA+VCVIS +F++
Sbjct  648  CSEIFPTRVRGLCIAICALVYWISDIIITYSLPVLLDSIGLAGIFGLYAIVCVISLVFIY  707

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFF+VGARQ   AKNE
Sbjct  708  LKVPETKGMPLEVITEFFSVGARQIAAAKNE  738



>ref|XP_010909820.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909821.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909822.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909823.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909824.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909825.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909826.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909827.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909828.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909829.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
Length=747

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 134/150 (89%), Gaps = 2/150 (1%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLLSTIP+ I SL+VLV+ N+++LG+V HAVLST+ VI YFC FVMG+GPIPNIL
Sbjct  600  SGRRFLLLSTIPILIASLLVLVVSNLVDLGTVVHAVLSTVSVIAYFCCFVMGFGPIPNIL  659

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FW  D+IVTY+LPVMLSS+GLAGVFGIYA VC+IS +FVF
Sbjct  660  CAEIFPTRVRGVCIAICALTFWFGDIIVTYTLPVMLSSIGLAGVFGIYACVCIISLVFVF  719

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            L+VPETKGMPLEVITEFFAVGA+QA  AKN
Sbjct  720  LKVPETKGMPLEVITEFFAVGAKQA--AKN  747



>emb|CDY31497.1| BnaC05g16060D [Brassica napus]
Length=632

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL TIPV I SLV L +  ++ +  V +A LST+CV+LY C FVMGYGPIPNIL
Sbjct  481  SGRRALLLWTIPVLIVSLVALFISELVQISKVVNAALSTVCVVLYICFFVMGYGPIPNIL  540

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICA+VFWICD+IVTYSLPV+LSS+GL GVF IYA VCVISW+FV+
Sbjct  541  CSEIFPTRVRGLCIAICAMVFWICDIIVTYSLPVLLSSIGLVGVFSIYAAVCVISWVFVY  600

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVIT++FA GA+ +  +K++
Sbjct  601  LKVPETKGMPLEVITDYFAFGAQASAPSKDD  631



>ref|XP_008464819.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
 ref|XP_008464820.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
 ref|XP_008464821.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
 ref|XP_008464822.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
Length=729

 Score =   211 bits (538),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL+TIPV I SL+VLV+  +I + ++ +A +STICV++YFC FVMGYGPIPNIL
Sbjct  579  SGRRRLLLATIPVLIVSLLVLVVFELITVSTIVNAAISTICVVVYFCIFVMGYGPIPNIL  638

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICA+VFW  D+IVTYSLPVMLS++GLAGVFGIYAVVC+ISWIFV+
Sbjct  639  CSEIFPTRVRGLCIAICAMVFWTGDIIVTYSLPVMLSAIGLAGVFGIYAVVCIISWIFVY  698

Query  293  LRVPETKGMPLEVITEFFAVGARQA  219
            L+VPETKGMPLEVI EFF+VGARQA
Sbjct  699  LKVPETKGMPLEVIAEFFSVGARQA  723



>ref|XP_009340799.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
 ref|XP_009340800.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   211 bits (538),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLL TIPV I SLV+LVLG+++N+GSV +A +ST+ V+LYFC FVMG+GPIPNIL
Sbjct  586  AGRRSLLLGTIPVLIVSLVILVLGSLVNMGSVVNASVSTVSVVLYFCFFVMGFGPIPNIL  645

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML S+GLAGVFG+YAVV VI++IF+F
Sbjct  646  CAEIFPTRVRGLCIAICALTFWIGDIIVTYSLPVMLKSVGLAGVFGMYAVVSVIAFIFIF  705

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFF+VGA+QA  AKN 
Sbjct  706  LKVPETKGMPLEVITEFFSVGAKQASAAKNN  736



>ref|XP_010029562.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW56480.1| hypothetical protein EUGRSUZ_I02208 [Eucalyptus grandis]
Length=731

 Score =   211 bits (538),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRR+LLLSTIPV IFSL +LVL +VIN+ ++ +A++ST  VI+YFC FVMG+GPIPNI
Sbjct  581  LSGRRSLLLSTIPVLIFSLFILVLSSVINISTMVNAMISTTSVIVYFCFFVMGFGPIPNI  640

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LC+EIFPTRVRG CIAICAL FWI D+IVTY+LP+MLSS+GL GVF IYAVVC+ SW FV
Sbjct  641  LCSEIFPTRVRGICIAICALTFWIGDIIVTYTLPLMLSSIGLIGVFAIYAVVCIASWFFV  700

Query  296  FLRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            FL+VPETKGMPLEVI+EFFAVGA+QA  A +
Sbjct  701  FLKVPETKGMPLEVISEFFAVGAKQASTATD  731



>ref|XP_010680636.1| PREDICTED: monosaccharide-sensing protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=728

 Score =   211 bits (538),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 130/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL+T+PV I SL++LVL NVI +G+V HA LSTI V++YFC FVMG+GPIPNIL
Sbjct  578  SGRRFLLLNTLPVLIGSLIILVLSNVIEMGTVLHATLSTISVVVYFCCFVMGFGPIPNIL  637

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAIC+L FW  D+IVTYSLP +LSS+GLAGVFGIYAVVC++SW FV+
Sbjct  638  CSEIFPTRVRGLCIAICSLTFWFGDIIVTYSLPALLSSIGLAGVFGIYAVVCIVSWFFVY  697

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
              VPETKGMPLEVI+EFF VGARQAE  KN
Sbjct  698  FMVPETKGMPLEVISEFFNVGARQAEAEKN  727



>gb|EMT06669.1| Monosaccharide-sensing protein 2 [Aegilops tauschii]
Length=787

 Score =   211 bits (538),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL TIP+ I SL+VLV+ NVINL +V HAVLST+ VI+YFC FVMG+GPIPNIL
Sbjct  638  SGRRFLLLGTIPILIASLIVLVVSNVINLSTVPHAVLSTVSVIVYFCCFVMGFGPIPNIL  697

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTR RG CIAICAL FWICD+IVTYSLPVML+++GLAGVFGIYAVVC I+++FV+
Sbjct  698  CAEIFPTRARGVCIAICALTFWICDIIVTYSLPVMLNAIGLAGVFGIYAVVCCIAFVFVY  757

Query  293  LRVPETKGMPLEVITEFFAVGARQAE  216
            L+VPETKGMPLEVITEFFAVGA+QA+
Sbjct  758  LKVPETKGMPLEVITEFFAVGAKQAQ  783



>ref|XP_009608796.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009608797.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009608798.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
Length=734

 Score =   211 bits (537),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLL TIP+ I +L+VLV+G+++++GSVA A +ST+CV++YFCSFVMG+GPIPNIL
Sbjct  585  SGRRSLLLGTIPILIIALIVLVIGSLVSMGSVAKAAISTVCVVMYFCSFVMGFGPIPNIL  644

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALVFWI D+IVTY+LPVMLSS+GLAGVFGIYA+VCVISWIFVF
Sbjct  645  CSEIFPTRVRGICIAICALVFWIGDIIVTYTLPVMLSSIGLAGVFGIYAIVCVISWIFVF  704

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            L+VPETKGMPLEVI+EFFA+GARQA  AKN
Sbjct  705  LKVPETKGMPLEVISEFFALGARQAAAAKN  734



>ref|XP_004134823.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
Length=722

 Score =   211 bits (536),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLLSTIPV I SL+VLV+G+++++GSVA+A +STI VI YFC FVMG+GP+PNIL
Sbjct  577  AGRRSLLLSTIPVLIISLIVLVIGSMVDMGSVANATISTISVIAYFCCFVMGFGPVPNIL  636

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIA+CAL FW  D+IVTYSLPVML+S+GL GVFG YA++C+ISWIFVF
Sbjct  637  CSEIFPTRVRGLCIAMCALTFWTGDIIVTYSLPVMLNSIGLGGVFGAYAIICIISWIFVF  696

Query  293  LRVPETKGMPLEVITEFFAVGARQAE  216
            L+VPETKGMPLEVI++FFAVGA+QA+
Sbjct  697  LKVPETKGMPLEVISDFFAVGAKQAD  722



>gb|KDO85210.1| hypothetical protein CISIN_1g004673mg [Citrus sinensis]
Length=523

 Score =   207 bits (528),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 126/150 (84%), Gaps = 1/150 (1%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVA-HAVLSTICVILYFCSFVMGYGPIPNI  477
            +GRR LLL+TIPV I SL++LV+   + L S    A +ST CVI+YFC FV  YGPIPNI
Sbjct  374  AGRRKLLLTTIPVLIVSLIILVISETLQLISPVLKAGISTACVIIYFCCFVAAYGPIPNI  433

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LCAEIFPT+VRG CIAICA+ +WICD+IVTY+LPVMLSS+GLAG FG+YAVVC ISW+FV
Sbjct  434  LCAEIFPTKVRGICIAICAMAYWICDIIVTYTLPVMLSSIGLAGAFGVYAVVCFISWVFV  493

Query  296  FLRVPETKGMPLEVITEFFAVGARQAEMAK  207
            FLRVPETKGMPLEVITEFFAVGARQA  A 
Sbjct  494  FLRVPETKGMPLEVITEFFAVGARQATKAD  523



>ref|XP_004169167.1| PREDICTED: LOW QUALITY PROTEIN: monosaccharide-sensing protein 
2-like [Cucumis sativus]
Length=722

 Score =   211 bits (536),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLLSTIPV I SL+VLV+G+++++GSVA+A +STI VI YFC FVMG+GP+PNIL
Sbjct  577  AGRRSLLLSTIPVLIISLIVLVIGSMVDMGSVANATISTISVIAYFCCFVMGFGPVPNIL  636

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIA+CAL FW  D+IVTYSLPVML+S+GL GVFG YA++C+ISWIFVF
Sbjct  637  CSEIFPTRVRGLCIAMCALTFWTGDIIVTYSLPVMLNSIGLGGVFGAYAIICIISWIFVF  696

Query  293  LRVPETKGMPLEVITEFFAVGARQAE  216
            L+VPETKGMPLEVI++FFAVGA+QA+
Sbjct  697  LKVPETKGMPLEVISDFFAVGAKQAD  722



>emb|CDY29502.1| BnaA06g14680D [Brassica napus]
Length=659

 Score =   210 bits (534),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL TIPV I SLV L +  ++ +  V +A LST+CV+LY C FVMGYGPIPNIL
Sbjct  508  SGRRALLLWTIPVLIVSLVALFISELVQISKVVNAALSTVCVVLYICFFVMGYGPIPNIL  567

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICA+VFWICD+IVTYSLPV+LSS+GL GVF IYA VCVISW+FV+
Sbjct  568  CSEIFPTRVRGLCIAICAMVFWICDIIVTYSLPVLLSSIGLVGVFSIYAAVCVISWVFVY  627

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVIT++FA GA+ +  +K++
Sbjct  628  LKVPETKGMPLEVITDYFAFGAQASAPSKDD  658



>gb|KGN49001.1| hypothetical protein Csa_6G509700 [Cucumis sativus]
Length=768

 Score =   211 bits (537),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLLSTIPV I SL+VLV+G+++++GSVA+A +STI VI YFC FVMG+GP+PNIL
Sbjct  623  AGRRSLLLSTIPVLIISLIVLVIGSMVDMGSVANATISTISVIAYFCCFVMGFGPVPNIL  682

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIA+CAL FW  D+IVTYSLPVML+S+GL GVFG YA++C+ISWIFVF
Sbjct  683  CSEIFPTRVRGLCIAMCALTFWTGDIIVTYSLPVMLNSIGLGGVFGAYAIICIISWIFVF  742

Query  293  LRVPETKGMPLEVITEFFAVGARQAE  216
            L+VPETKGMPLEVI++FFAVGA+QA+
Sbjct  743  LKVPETKGMPLEVISDFFAVGAKQAD  768



>ref|XP_009763350.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009763351.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009763352.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=734

 Score =   211 bits (536),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLL TIP+ I +L+VLV+GN++++G+VA A +ST+CV++YFCSFVMG+GPIPNIL
Sbjct  585  SGRRSLLLGTIPILIIALIVLVIGNLVSMGTVAKAAISTVCVVMYFCSFVMGFGPIPNIL  644

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALVFWI D+IVTY+LPVMLSS+GLAGVFGIYA+VCVISWIFVF
Sbjct  645  CSEIFPTRVRGICIAICALVFWIGDIIVTYTLPVMLSSIGLAGVFGIYAIVCVISWIFVF  704

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            L+VPETKGMPLEVI+EFFA+GARQA  AKN
Sbjct  705  LKVPETKGMPLEVISEFFALGARQAAAAKN  734



>ref|XP_010690557.1| PREDICTED: monosaccharide-sensing protein 2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010690558.1| PREDICTED: monosaccharide-sensing protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=739

 Score =   211 bits (536),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLL+TIPV   SLVVL+LGN+I + +  HAV+ST+ V+LYFC FVMG+GPIPNIL
Sbjct  589  SGRRTLLLTTIPVLFLSLVVLILGNIIKMSTTVHAVISTVSVVLYFCFFVMGFGPIPNIL  648

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTR+RG CIAICAL FWI D+IVT +LP+ML+++GLAGVFG YAVV VI+WIF+F
Sbjct  649  CAEIFPTRIRGVCIAICALTFWIGDIIVTDTLPIMLNAVGLAGVFGFYAVVSVIAWIFIF  708

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFFA+GARQ    K+ 
Sbjct  709  LKVPETKGMPLEVITEFFALGARQPSEDKDN  739



>ref|XP_011040809.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011040810.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011040811.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=738

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLL+TIPV I SL++LVLG++++LGSV +A +ST+ V+LYFC FVMG+GPIPNIL
Sbjct  588  SGRRTLLLTTIPVLIVSLILLVLGSMVDLGSVVNASISTVSVVLYFCFFVMGFGPIPNIL  647

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWICD+IVTY+LPVML S+GLAGVFG+YAVVC+IS++FV+
Sbjct  648  CAEIFPTRVRGLCIAICALTFWICDIIVTYTLPVMLKSVGLAGVFGLYAVVCIISFVFVY  707

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVI+EFFAVGA+Q   AK  
Sbjct  708  LKVPETKGMPLEVISEFFAVGAKQVAAAKEN  738



>ref|XP_004951395.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=745

 Score =   210 bits (535),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRR LLL TIP+ I SLVVLV+ NV++LG+V HA LST+ VI+YFC FVMG+GPIPNI
Sbjct  596  LSGRRFLLLGTIPILIASLVVLVISNVVDLGTVPHAALSTVSVIIYFCCFVMGFGPIPNI  655

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LCAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML+++GLAGVFGIYAVVC+IS++FV
Sbjct  656  LCAEIFPTRVRGLCIAICALTFWIGDIIVTYSLPVMLNAIGLAGVFGIYAVVCMISFVFV  715

Query  296  FLRVPETKGMPLEVITEFFAVGARQA  219
            FL+VPETKGMPLEVI+EFFAVGA+QA
Sbjct  716  FLKVPETKGMPLEVISEFFAVGAKQA  741



>ref|XP_010548175.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
 ref|XP_010548176.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
 ref|XP_010548177.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
 ref|XP_010548178.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
Length=742

 Score =   210 bits (535),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLL TIP+ I SL+VLV+ N++++ +V HA LST+ ++LYFC FVMG+GP+PNIL
Sbjct  592  SGRRSLLLGTIPILIGSLIVLVVSNLVHMDNVVHAALSTVSIVLYFCFFVMGFGPVPNIL  651

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FW  ++I+TY+LPV+L S+GLAGVFG+YA+VC +SWIFVF
Sbjct  652  CAEIFPTRVRGICIAICALAFWTGNIIITYTLPVLLKSIGLAGVFGMYAIVCCVSWIFVF  711

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            ++VPETKGMPLEVI+EFF+VGARQA  AK++
Sbjct  712  VKVPETKGMPLEVISEFFSVGARQAAAAKDD  742



>ref|XP_009149562.1| PREDICTED: monosaccharide-sensing protein 1 [Brassica rapa]
 ref|XP_009149563.1| PREDICTED: monosaccharide-sensing protein 1 [Brassica rapa]
Length=721

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL TIPV I SLV L +  ++ +  V +A LST+CV+LY C FVMGYGPIPNIL
Sbjct  570  SGRRALLLWTIPVLIVSLVALFISELVQISKVVNAALSTVCVVLYICFFVMGYGPIPNIL  629

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICA+VFWICD+IVTYSLPV+LSS+GL GVF IYA VCVISW+FV+
Sbjct  630  CSEIFPTRVRGLCIAICAMVFWICDIIVTYSLPVLLSSIGLVGVFSIYAAVCVISWVFVY  689

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVIT++FA GA+ +  +K++
Sbjct  690  LKVPETKGMPLEVITDYFAFGAQASAPSKDD  720



>gb|AFW59276.1| hypothetical protein ZEAMMB73_154299 [Zea mays]
Length=640

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRR LLL TIP+ I SLV+LV+ N+I+LG++AHA+LST+ VI+YFC FVMG+GPIPNI
Sbjct  491  LSGRRFLLLGTIPILIASLVILVVSNLIDLGTLAHALLSTVSVIVYFCCFVMGFGPIPNI  550

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LCAEIFPTRVRG CIAICA  FWI D+IVTYSLPVML+++GLAGVF IYAVVC+IS++FV
Sbjct  551  LCAEIFPTRVRGLCIAICAFTFWIGDIIVTYSLPVMLNAIGLAGVFSIYAVVCLISFVFV  610

Query  296  FLRVPETKGMPLEVITEFFAVGARQA  219
            FL+VPETKGMPLEVITEFFAVGA+QA
Sbjct  611  FLKVPETKGMPLEVITEFFAVGAKQA  636



>ref|XP_009390770.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=741

 Score =   210 bits (534),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 135/151 (89%), Gaps = 1/151 (1%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRR LLL TIP+ I SL+VLV+ N++ LG+V HAVLST+ VI+YFC FVMG+GP+PNI
Sbjct  592  MSGRRFLLLFTIPILIASLIVLVVANLVELGNVVHAVLSTVSVIVYFCCFVMGFGPVPNI  651

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LCAEIFPTRVRG CIAICAL FWI D+IVTY+LPVML ++GLAGVFGIYA+VCVI+++FV
Sbjct  652  LCAEIFPTRVRGVCIAICALTFWIGDIIVTYTLPVMLDTIGLAGVFGIYAIVCVIAFVFV  711

Query  296  FLRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            FL+VPETKGMPLEVITEFFAVGA+QA  A+N
Sbjct  712  FLKVPETKGMPLEVITEFFAVGAKQA-AARN  741



>ref|XP_008645619.1| PREDICTED: monosaccharide-sensing protein 2-like [Zea mays]
 ref|XP_008645620.1| PREDICTED: monosaccharide-sensing protein 2-like [Zea mays]
 gb|AFW59275.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_154299 [Zea 
mays]
 gb|AFW71237.1| hypothetical protein ZEAMMB73_210614 [Zea mays]
Length=745

 Score =   210 bits (534),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRR LLL TIP+ I SLV+LV+ N+I+LG++AHA+LST+ VI+YFC FVMG+GPIPNI
Sbjct  596  LSGRRFLLLGTIPILIASLVILVVSNLIDLGTLAHALLSTVSVIVYFCCFVMGFGPIPNI  655

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LCAEIFPTRVRG CIAICA  FWI D+IVTYSLPVML+++GLAGVF IYAVVC+IS++FV
Sbjct  656  LCAEIFPTRVRGLCIAICAFTFWIGDIIVTYSLPVMLNAIGLAGVFSIYAVVCLISFVFV  715

Query  296  FLRVPETKGMPLEVITEFFAVGARQA  219
            FL+VPETKGMPLEVITEFFAVGA+QA
Sbjct  716  FLKVPETKGMPLEVITEFFAVGAKQA  741



>emb|CBI37732.3| unnamed protein product [Vitis vinifera]
Length=644

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 133/150 (89%), Gaps = 1/150 (1%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLLSTIPV I +L +LVLG+++N+G V HA +ST  VI+YFC FVMG+GP+PNIL
Sbjct  496  SGRRSLLLSTIPVLIIALSILVLGSLVNMGDVVHAAISTASVIIYFCCFVMGFGPVPNIL  555

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWI D+IVTY+LP+ML+S+GLAGVFG+YAVVC+ISW+FVF
Sbjct  556  CAEIFPTRVRGLCIAICALSFWIGDIIVTYTLPLMLTSVGLAGVFGMYAVVCLISWVFVF  615

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            L+VPETKGMPLEVI+EFFAVGA  A   KN
Sbjct  616  LKVPETKGMPLEVISEFFAVGA-SAGQKKN  644



>ref|XP_008778122.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778123.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778124.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778125.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778126.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
Length=747

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLLSTIP+ I +L+VLV+ N++++G+VAHAVLST  VI YFC FVMG+GP+PNIL
Sbjct  600  SGRRFLLLSTIPILIAALLVLVVANLVDIGTVAHAVLSTFSVIAYFCCFVMGFGPVPNIL  659

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FW  D+IVTY+LPVML+S+GLAGVFGIYA VCVIS +FVF
Sbjct  660  CAEIFPTRVRGVCIAICALTFWFGDIIVTYTLPVMLTSIGLAGVFGIYACVCVISLVFVF  719

Query  293  LRVPETKGMPLEVITEFFAVGARQA  219
            L+VPETKGMPLEVITEFFAVGA+QA
Sbjct  720  LKVPETKGMPLEVITEFFAVGAKQA  744



>ref|XP_008448165.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448166.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448167.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448168.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448169.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448170.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448171.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
Length=733

 Score =   209 bits (533),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLL TIP  I SL++LV+G+++ +GS+ +A +ST+ V++YFC FVMG+GPIPNIL
Sbjct  583  SGRRTLLLWTIPALIASLIILVIGSLVQMGSIVNASISTVSVVVYFCFFVMGFGPIPNIL  642

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWI D+IVTY+LPV+L+S+GL GVFG+YAVVC+ISW+FVF
Sbjct  643  CAEIFPTRVRGLCIAICALTFWIGDIIVTYTLPVLLNSIGLGGVFGMYAVVCIISWVFVF  702

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            L+VPETKGMPLEVITEFF+VGA+Q   AKN
Sbjct  703  LKVPETKGMPLEVITEFFSVGAKQLLAAKN  732



>ref|XP_003571780.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=749

 Score =   209 bits (533),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL TIP+ I SLVVLV+ NVINL +V HAVLST+ VI+YFC FVMG+GPIPNIL
Sbjct  600  SGRRFLLLGTIPILIASLVVLVVSNVINLSTVPHAVLSTVSVIVYFCCFVMGFGPIPNIL  659

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML+++GLAGVFGIYAVVC I+++FV+
Sbjct  660  CAEIFPTRVRGLCIAICALTFWIGDIIVTYSLPVMLNAIGLAGVFGIYAVVCCIAFVFVY  719

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAK  207
            L+VPETKGMPLEVITEFFAVGA+QA   K
Sbjct  720  LKVPETKGMPLEVITEFFAVGAKQAMTNK  748



>gb|AIN39841.1| hypothetical protein [Zoysia matrella]
Length=744

 Score =   209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL TIPV I SL++LV+ NVI+ G+V HA LST+ VI+YFC FVMG+GPIPNIL
Sbjct  596  SGRRFLLLGTIPVLIASLIILVVSNVIDFGTVPHAALSTVSVIIYFCCFVMGFGPIPNIL  655

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICA+ FWI D+IVTYSLPVML+++GLAGVFGIYAVVC I+++FVF
Sbjct  656  CAEIFPTRVRGLCIAICAMTFWIGDIIVTYSLPVMLNAIGLAGVFGIYAVVCAIAFVFVF  715

Query  293  LRVPETKGMPLEVITEFFAVGARQA  219
            L+VPETKGMPLEVITEFFAVGA+QA
Sbjct  716  LKVPETKGMPLEVITEFFAVGAKQA  740



>ref|XP_004154526.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
Length=733

 Score =   209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLL TIP  I SLV+LV+G+++ +GS+ +A +ST+ V++YFC FVMG+GPIPNIL
Sbjct  583  SGRRTLLLWTIPALIASLVILVIGSLVQMGSILNASISTVSVVVYFCFFVMGFGPIPNIL  642

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWI D+IVTY+LPV+L+S+GL GVFG+YAVVC+ISW+FVF
Sbjct  643  CAEIFPTRVRGLCIAICALTFWIGDIIVTYTLPVLLNSIGLGGVFGMYAVVCIISWVFVF  702

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            L+VPETKGMPLEVITEFF+VGA+Q   AKN
Sbjct  703  LKVPETKGMPLEVITEFFSVGAKQLLSAKN  732



>ref|XP_004139974.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
 gb|KGN46648.1| hypothetical protein Csa_6G118280 [Cucumis sativus]
Length=733

 Score =   209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLL TIP  I SLV+LV+G+++ +GS+ +A +ST+ V++YFC FVMG+GPIPNIL
Sbjct  583  SGRRTLLLWTIPALIASLVILVIGSLVQMGSILNASISTVSVVVYFCFFVMGFGPIPNIL  642

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWI D+IVTY+LPV+L+S+GL GVFG+YAVVC+ISW+FVF
Sbjct  643  CAEIFPTRVRGLCIAICALTFWIGDIIVTYTLPVLLNSIGLGGVFGMYAVVCIISWVFVF  702

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            L+VPETKGMPLEVITEFF+VGA+Q   AKN
Sbjct  703  LKVPETKGMPLEVITEFFSVGAKQLLSAKN  732



>ref|XP_002282975.1| PREDICTED: monosaccharide-sensing protein 2 [Vitis vinifera]
 gb|ADP37148.1| putative tonoplastic monosaccharide transporter [Vitis vinifera]
Length=739

 Score =   209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 133/150 (89%), Gaps = 1/150 (1%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLLSTIPV I +L +LVLG+++N+G V HA +ST  VI+YFC FVMG+GP+PNIL
Sbjct  591  SGRRSLLLSTIPVLIIALSILVLGSLVNMGDVVHAAISTASVIIYFCCFVMGFGPVPNIL  650

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWI D+IVTY+LP+ML+S+GLAGVFG+YAVVC+ISW+FVF
Sbjct  651  CAEIFPTRVRGLCIAICALSFWIGDIIVTYTLPLMLTSVGLAGVFGMYAVVCLISWVFVF  710

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            L+VPETKGMPLEVI+EFFAVGA  A   KN
Sbjct  711  LKVPETKGMPLEVISEFFAVGA-SAGQKKN  739



>ref|XP_010537220.1| PREDICTED: monosaccharide-sensing protein 1-like [Tarenaya hassleriana]
 ref|XP_010537221.1| PREDICTED: monosaccharide-sensing protein 1-like [Tarenaya hassleriana]
 ref|XP_010537222.1| PREDICTED: monosaccharide-sensing protein 1-like [Tarenaya hassleriana]
Length=735

 Score =   209 bits (532),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLLSTIPV I SL+VLVL  ++++ +V +A +ST CV++YFC FVMGYGPIPNIL
Sbjct  585  SGRRALLLSTIPVLIVSLLVLVLSELVHISTVVNAAISTGCVVIYFCCFVMGYGPIPNIL  644

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICA+VFW+ D+IVTYSLPV+L S+GL GVFGIYA VC++SWIFVF
Sbjct  645  CSEIFPTRVRGLCIAICAIVFWVGDIIVTYSLPVLLGSIGLVGVFGIYAAVCIVSWIFVF  704

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            L+VPETKGMPLEVITEFFA GA+Q   AK+
Sbjct  705  LKVPETKGMPLEVITEFFAYGAQQDLSAKD  734



>ref|XP_009392211.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=732

 Score =   209 bits (531),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLL+TIPV I SLV LVL N+++LGSVAHA+ STICV++YFC FVMG+GPIPNIL
Sbjct  585  SGRRSLLLATIPVLIVSLVGLVLTNLVDLGSVAHAIFSTICVVVYFCCFVMGFGPIPNIL  644

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAIC+L FW CD+IVTYSLPVML+++GLAGVFGIYA+VCVI+ +FVF
Sbjct  645  CSEIFPTRVRGVCIAICSLTFWFCDIIVTYSLPVMLNTIGLAGVFGIYAIVCVIALVFVF  704

Query  293  LRVPETKGMPLEVITEFFAVGARQ  222
            L++PETKGMPLEVI EFF VG++Q
Sbjct  705  LKIPETKGMPLEVIIEFFNVGSKQ  728



>dbj|BAJ90138.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=743

 Score =   209 bits (531),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLLSTIPV I +L +LVL NV+++G++ HA LSTI VI+YFC FVMG+GPIPNIL
Sbjct  594  SGRRFLLLSTIPVLIVALAILVLVNVLDVGTMVHAALSTISVIVYFCFFVMGFGPIPNIL  653

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPT VRG CIAICAL FWI D+IVTY+LPVML+++GLAGVFGIYAVVC+I+++FV+
Sbjct  654  CAEIFPTSVRGICIAICALTFWIGDIIVTYTLPVMLNAIGLAGVFGIYAVVCMIAFVFVY  713

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            ++VPETKGMPLEVITEFF+VGA+Q + A +
Sbjct  714  MKVPETKGMPLEVITEFFSVGAKQGKEATD  743



>ref|XP_002467580.1| hypothetical protein SORBIDRAFT_01g030430 [Sorghum bicolor]
 gb|EER94578.1| hypothetical protein SORBIDRAFT_01g030430 [Sorghum bicolor]
Length=740

 Score =   209 bits (531),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRR LLL+TIP+ I +L +LV+ N++++G++ HA LSTI VI+YFC FVMG+GPIPNI
Sbjct  589  MSGRRFLLLATIPILIVALAILVVVNIVDVGTMVHAALSTISVIVYFCFFVMGFGPIPNI  648

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LCAEIFPT VRG CIAICAL FWI D+IVTY+LPVML+++GLAGVFGIYAVVC+++ +FV
Sbjct  649  LCAEIFPTTVRGICIAICALTFWIGDIIVTYTLPVMLNAIGLAGVFGIYAVVCILALVFV  708

Query  296  FLRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            F++VPETKGMPLEVITEFF+VGA+QA+ A+ +
Sbjct  709  FIKVPETKGMPLEVITEFFSVGAKQAKEARED  740



>emb|CDP01766.1| unnamed protein product [Coffea canephora]
Length=724

 Score =   208 bits (530),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 107/112 (96%), Gaps = 0/112 (0%)
 Frame = -2

Query  557  AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  378
            AHAV+STI V++YFC FVMG+GP+PNILCAEIFPTR RG CIAICALVFWICD+IVTYSL
Sbjct  607  AHAVVSTISVVVYFCCFVMGFGPVPNILCAEIFPTRTRGLCIAICALVFWICDIIVTYSL  666

Query  377  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQ  222
            PVMLSS+GLAGVFGIYAVVC ISW+FVFL+VPETKGMPLEVITEFFAVGA+Q
Sbjct  667  PVMLSSIGLAGVFGIYAVVCAISWVFVFLKVPETKGMPLEVITEFFAVGAKQ  718



>emb|CAD58958.1| hexose transporter [Hordeum vulgare subsp. vulgare]
Length=743

 Score =   208 bits (530),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLLSTIPV I +L +LVL NV+++G++ HA LSTI VI+YFC FVMG+GPIPNIL
Sbjct  594  SGRRFLLLSTIPVLIVALAILVLVNVLDVGTMVHAALSTISVIVYFCFFVMGFGPIPNIL  653

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPT VRG CIAICAL FWI D+IVTY+LPVML+++GLAGVFGIYAVVC+I+++FV+
Sbjct  654  CAEIFPTSVRGICIAICALTFWIGDIIVTYTLPVMLNAIGLAGVFGIYAVVCMIAFVFVY  713

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            ++VPETKGMPLEVITEFF+VGA+Q + A +
Sbjct  714  MKVPETKGMPLEVITEFFSVGAKQGKEATD  743



>gb|AFP89954.1| tonoplastic transporter 2 [Vitis vinifera]
Length=739

 Score =   208 bits (530),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 133/150 (89%), Gaps = 1/150 (1%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLLSTIPV I +L +LVLG+++N+G V HA +ST  VI+YFC FVMG+GP+PNIL
Sbjct  591  SGRRSLLLSTIPVLIIALAILVLGSLVNMGDVVHAAISTASVIIYFCCFVMGFGPVPNIL  650

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWI D+IVTY+LP+ML+S+GLAGVFG+YA+VC+ISW+FVF
Sbjct  651  CAEIFPTRVRGLCIAICALSFWIGDIIVTYTLPLMLTSVGLAGVFGMYAIVCLISWVFVF  710

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            L+VPETKGMPLEVI+EFFAVGA  A   KN
Sbjct  711  LKVPETKGMPLEVISEFFAVGA-SAGQKKN  739



>ref|XP_008382498.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
 ref|XP_008382499.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=736

 Score =   208 bits (529),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLL TIPV + SLV+LVLG+++N+GSV +A +ST+ V+LYFC FVMG+GPIPNIL
Sbjct  586  AGRRSLLLGTIPVLVXSLVILVLGSLVNMGSVVNASVSTVSVVLYFCFFVMGFGPIPNIL  645

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML S+GLAGVFG+YAVV VI++IF+F
Sbjct  646  CAEIFPTRVRGLCIAICALTFWIGDIIVTYSLPVMLKSVGLAGVFGMYAVVSVIAFIFIF  705

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFF+VGA+QA  AKN 
Sbjct  706  LKVPETKGMPLEVITEFFSVGAKQASAAKNN  736



>ref|XP_010678631.1| PREDICTED: monosaccharide-sensing protein 2-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010678632.1| PREDICTED: monosaccharide-sensing protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=735

 Score =   208 bits (529),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRRTLLL+TIPV   SLVVL+L NVI + +  +AV+ST+ V+LYFC FVMG+GPIPNI
Sbjct  588  LSGRRTLLLTTIPVLFLSLVVLILANVIKMNTTVYAVVSTVAVVLYFCFFVMGFGPIPNI  647

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LCAEIFPT++RG CIAICAL FWICD+IVTY+LP+ML ++GLAG+FG YAVV +I+WIF+
Sbjct  648  LCAEIFPTKIRGVCIAICALTFWICDIIVTYTLPMMLKAVGLAGLFGFYAVVILIAWIFI  707

Query  296  FLRVPETKGMPLEVITEFFAVGARQA  219
            FL+VPETKGMPLEVITEFFA+GARQA
Sbjct  708  FLKVPETKGMPLEVITEFFALGARQA  733



>ref|XP_007142576.1| hypothetical protein PHAVU_008G292400g [Phaseolus vulgaris]
 gb|ESW14570.1| hypothetical protein PHAVU_008G292400g [Phaseolus vulgaris]
Length=732

 Score =   208 bits (529),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 134/148 (91%), Gaps = 2/148 (1%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLL+TIPV + SL++LV+G++I+  S  +A +ST+ VI+YFC FVMG+GPIPNIL
Sbjct  580  SGRRTLLLTTIPVLVASLLILVVGSLIDFNSGVNAFISTLSVIVYFCCFVMGFGPIPNIL  639

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICAL FWICD+IVTY+LPVML+S+GL GVFG+YAVVC+++W+FVF
Sbjct  640  CSEIFPTRVRGLCIAICALTFWICDIIVTYTLPVMLNSVGLGGVFGMYAVVCIVAWVFVF  699

Query  293  LRVPETKGMPLEVITEFFAVG--ARQAE  216
            L+VPETKGMPLEVITEFF+VG  A+QAE
Sbjct  700  LKVPETKGMPLEVITEFFSVGAKAKQAE  727



>ref|XP_009401004.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009401005.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=738

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLLSTIPV I SLVVLV+ N++++G+V HAVLST+ V++YFC FVMG+GPIPNIL
Sbjct  591  SGRRFLLLSTIPVLISSLVVLVVANLVDMGTVVHAVLSTVSVVIYFCCFVMGFGPIPNIL  650

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWI D+IVTY+LPVML+S+GLAGVFGIYAVVC I+ +FVF
Sbjct  651  CAEIFPTRVRGVCIAICALTFWIGDIIVTYTLPVMLNSIGLAGVFGIYAVVCTIALVFVF  710

Query  293  LRVPETKGMPLEVITEFFAVGARQA  219
            L+VPETKGMPLEVI E FAVGA+QA
Sbjct  711  LKVPETKGMPLEVIMEIFAVGAKQA  735



>ref|XP_003574265.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=741

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL+TIP+ I +L +LVL N++++G++ HA LSTI VI+YFC FVMG+GPIPNIL
Sbjct  592  SGRRFLLLTTIPILIVALAILVLVNILDVGTMVHAALSTISVIVYFCFFVMGFGPIPNIL  651

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPT VRG CIAICAL FWI D+IVTY+LPVML+++GLAGVFGIYAVVC+++++FV+
Sbjct  652  CAEIFPTSVRGICIAICALTFWIGDIIVTYTLPVMLNAIGLAGVFGIYAVVCILAFVFVY  711

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            ++VPETKGMPLEVITEFF+VGA+Q + A++
Sbjct  712  MKVPETKGMPLEVITEFFSVGAKQGKEARD  741



>gb|KDO85208.1| hypothetical protein CISIN_1g004673mg [Citrus sinensis]
Length=706

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 126/150 (84%), Gaps = 1/150 (1%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVA-HAVLSTICVILYFCSFVMGYGPIPNI  477
            +GRR LLL+TIPV I SL++LV+   + L S    A +ST CVI+YFC FV  YGPIPNI
Sbjct  557  AGRRKLLLTTIPVLIVSLIILVISETLQLISPVLKAGISTACVIIYFCCFVAAYGPIPNI  616

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LCAEIFPT+VRG CIAICA+ +WICD+IVTY+LPVMLSS+GLAG FG+YAVVC ISW+FV
Sbjct  617  LCAEIFPTKVRGICIAICAMAYWICDIIVTYTLPVMLSSIGLAGAFGVYAVVCFISWVFV  676

Query  296  FLRVPETKGMPLEVITEFFAVGARQAEMAK  207
            FLRVPETKGMPLEVITEFFAVGARQA  A 
Sbjct  677  FLRVPETKGMPLEVITEFFAVGARQATKAD  706



>ref|XP_006435423.1| hypothetical protein CICLE_v10000400mg [Citrus clementina]
 ref|XP_006473839.1| PREDICTED: monosaccharide-sensing protein 2-like [Citrus sinensis]
 gb|ESR48663.1| hypothetical protein CICLE_v10000400mg [Citrus clementina]
 gb|KDO85209.1| hypothetical protein CISIN_1g004673mg [Citrus sinensis]
Length=738

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 126/150 (84%), Gaps = 1/150 (1%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVA-HAVLSTICVILYFCSFVMGYGPIPNI  477
            +GRR LLL+TIPV I SL++LV+   + L S    A +ST CVI+YFC FV  YGPIPNI
Sbjct  589  AGRRKLLLTTIPVLIVSLIILVISETLQLISPVLKAGISTACVIIYFCCFVAAYGPIPNI  648

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LCAEIFPT+VRG CIAICA+ +WICD+IVTY+LPVMLSS+GLAG FG+YAVVC ISW+FV
Sbjct  649  LCAEIFPTKVRGICIAICAMAYWICDIIVTYTLPVMLSSIGLAGAFGVYAVVCFISWVFV  708

Query  296  FLRVPETKGMPLEVITEFFAVGARQAEMAK  207
            FLRVPETKGMPLEVITEFFAVGARQA  A 
Sbjct  709  FLRVPETKGMPLEVITEFFAVGARQATKAD  738



>emb|CDP14489.1| unnamed protein product [Coffea canephora]
Length=742

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 134/152 (88%), Gaps = 1/152 (1%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLL TIPV + +LV+LV+G+V+N+G V +A +ST+CV+LYFC FVMG+GP+PNIL
Sbjct  591  AGRRSLLLWTIPVLLITLVILVIGSVVNMGKVGNAAVSTVCVVLYFCFFVMGFGPVPNIL  650

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIA+C L +WI D+IVTY+LPVMLSSMGL GVFG YAVVC+ISW F F
Sbjct  651  CSEIFPTRVRGVCIALCCLTYWIGDIIVTYTLPVMLSSMGLGGVFGTYAVVCIISWFFAF  710

Query  293  LRVPETKGMPLEVITEFFAVGARQA-EMAKNE  201
            L+VPETKGMPLEVI+EFF+VGARQA  +AKN 
Sbjct  711  LKVPETKGMPLEVISEFFSVGARQAVAIAKNN  742



>ref|XP_002520608.1| sugar transporter, putative [Ricinus communis]
 gb|EEF41781.1| sugar transporter, putative [Ricinus communis]
Length=740

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLL TIPV I SL+VLVLG+ +NLGSV +A +ST  VI+YFC FVMG+GPIPNIL
Sbjct  590  SGRRSLLLCTIPVLIVSLLVLVLGSAVNLGSVINASISTASVIVYFCCFVMGFGPIPNIL  649

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML S+GLAGVFG+YAVVC+IS +FV+
Sbjct  650  CAEIFPTRVRGLCIAICALTFWIGDIIVTYSLPVMLKSIGLAGVFGLYAVVCIISLVFVY  709

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFF+VGARQA  AK+ 
Sbjct  710  LKVPETKGMPLEVITEFFSVGARQAAAAKDN  740



>ref|XP_009397963.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397964.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397965.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=738

 Score =   206 bits (525),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLLSTIPV I SLVVLV+ N++++G+V HAVLST+ V++YFC FVMG+GPIPNIL
Sbjct  591  SGRRFLLLSTIPVLIASLVVLVVANLVDMGTVVHAVLSTVSVVVYFCCFVMGFGPIPNIL  650

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FW  D+IVTY+LPV+L+ +GLAGVFGIYAVVC ++ +FVF
Sbjct  651  CAEIFPTRVRGVCIAICALTFWFGDIIVTYTLPVLLNMIGLAGVFGIYAVVCTLALVFVF  710

Query  293  LRVPETKGMPLEVITEFFAVGARQAEM  213
            L+VPETKGMPLEVITEFFAVGA+QA +
Sbjct  711  LKVPETKGMPLEVITEFFAVGAKQAAL  737



>gb|ABK29442.1| sugar transport protein, partial [Coffea canephora]
Length=134

 Score =   191 bits (486),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 106/120 (88%), Gaps = 1/120 (1%)
 Frame = -2

Query  557  AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  378
             +A +ST+CV+LYFC FVMG+GP+PNILC+EIFPTRVRG CIA+C L +WI D+IVTY+L
Sbjct  15   GNAAVSTVCVVLYFCFFVMGFGPVPNILCSEIFPTRVRGVCIALCCLTYWIGDIIVTYTL  74

Query  377  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA-EMAKNE  201
            PVMLSSMGL GVFG YAVVC+ISW F FL+VPETKGMPLEVI+EFF+VGARQA  +AKN 
Sbjct  75   PVMLSSMGLGGVFGTYAVVCIISWFFAFLKVPETKGMPLEVISEFFSVGARQAVAIAKNN  134



>ref|NP_001065182.1| Os10g0539900 [Oryza sativa Japonica Group]
 gb|AAG46115.1|AC073166_13 putative sugar transporter [Oryza sativa Japonica Group]
 gb|ABB47937.2| hexose transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27096.1| Os10g0539900 [Oryza sativa Japonica Group]
 gb|EAZ16837.1| hypothetical protein OsJ_32308 [Oryza sativa Japonica Group]
 gb|ADG21982.1| tonoplast monosaccharide transporter 1 [Oryza sativa Japonica 
Group]
Length=740

 Score =   206 bits (523),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRR LLL+TIP+ I +L +L+L N++++G++ HA LST+ VILYFC FVMG+GPIPNI
Sbjct  592  MSGRRFLLLATIPILIVALAILILVNILDVGTMVHASLSTVSVILYFCFFVMGFGPIPNI  651

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LCAEIFPT VRG CIAICAL FWI D+IVTY+LPVML+++GLAGVFGIYAVVC+++++FV
Sbjct  652  LCAEIFPTTVRGICIAICALTFWIGDIIVTYTLPVMLNAIGLAGVFGIYAVVCILAFLFV  711

Query  296  FLRVPETKGMPLEVITEFFAVGARQAE  216
            F++VPETKGMPLEVITEFF+VGA+QA+
Sbjct  712  FMKVPETKGMPLEVITEFFSVGAKQAK  738



>ref|XP_006416357.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
 ref|XP_006416358.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
 gb|ESQ34710.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
 gb|ESQ34711.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
Length=733

 Score =   206 bits (523),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL TIPV I SL+VLV   ++++  V +A LST CV+LYFC FVMGYGPIPNIL
Sbjct  583  SGRRALLLWTIPVLIISLIVLVFSELVHISKVINAALSTACVVLYFCFFVMGYGPIPNIL  642

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICA+VFWI D+IVTYSLPV+LSS+GL GVF IYA VCVISWIFV+
Sbjct  643  CSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLPVLLSSIGLVGVFSIYAAVCVISWIFVY  702

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            L+VPETKGMPLEVIT++FA GA+ +  +K+
Sbjct  703  LKVPETKGMPLEVITDYFAFGAQASAPSKD  732



>dbj|BAJ33724.1| unnamed protein product [Thellungiella halophila]
Length=733

 Score =   206 bits (523),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL TIPV I SL+VLV   ++++  V +A LST CV+LYFC FVMGYGPIPNIL
Sbjct  583  SGRRALLLWTIPVLIISLIVLVFSELVHISKVINAALSTACVVLYFCFFVMGYGPIPNIL  642

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICA+VFWI D+IVTYSLPV+LSS+GL GVF IYA VCVISWIFV+
Sbjct  643  CSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLPVLLSSIGLVGVFSIYAAVCVISWIFVY  702

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            L+VPETKGMPLEVIT++FA GA+ +  +K+
Sbjct  703  LKVPETKGMPLEVITDYFAFGAQASAPSKD  732



>gb|EEC67373.1| hypothetical protein OsI_34495 [Oryza sativa Indica Group]
Length=718

 Score =   205 bits (522),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRR LLL+TIP+ I +L +L+L N++++G++ HA LST+ VILYFC FVMG+GPIPNI
Sbjct  570  MSGRRFLLLATIPILIVALAILILVNILDVGTMVHASLSTVSVILYFCFFVMGFGPIPNI  629

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LCAEIFPT VRG CIAICAL FWI D+IVTY+LPVML+++GLAGVFGIYAVVC+++++FV
Sbjct  630  LCAEIFPTTVRGICIAICALTFWIGDIIVTYTLPVMLNAIGLAGVFGIYAVVCILAFLFV  689

Query  296  FLRVPETKGMPLEVITEFFAVGARQAE  216
            F++VPETKGMPLEVITEFF+VGA+QA+
Sbjct  690  FMKVPETKGMPLEVITEFFSVGAKQAK  716



>emb|CAN80213.1| hypothetical protein VITISV_042076 [Vitis vinifera]
Length=739

 Score =   205 bits (522),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 131/150 (87%), Gaps = 1/150 (1%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLLSTIPV I +L +LVLG+++N+G V HA +ST  VI+YFC FVMG+GP+PNIL
Sbjct  591  SGRRSLLLSTIPVLIIALAILVLGSLVNMGDVVHAAISTASVIIYFCCFVMGFGPVPNIL  650

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWI D+IVTY+LP+ML+S+GLAGVFG+YA VC+ISW+FVF
Sbjct  651  CAEIFPTRVRGLCIAICALSFWIGDIIVTYTLPLMLTSVGLAGVFGMYAXVCLISWVFVF  710

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            L+VPETKGMPLEVI+EFFAVG   A   KN
Sbjct  711  LKVPETKGMPLEVISEFFAVGX-SAGQKKN  739



>ref|XP_010270527.1| PREDICTED: monosaccharide-sensing protein 2 [Nelumbo nucifera]
 ref|XP_010270528.1| PREDICTED: monosaccharide-sensing protein 2 [Nelumbo nucifera]
Length=740

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLLSTIP+ I SLVVLV+ N + + SV HAVLST  V++YFC FVMG+GPIPNIL
Sbjct  591  AGRRSLLLSTIPILIVSLVVLVISNALTMSSVVHAVLSTASVLVYFCCFVMGFGPIPNIL  650

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALVFW  D+IVTYSLP+ML+S+GL+GVFGIY+ VC I+ +FVF
Sbjct  651  CSEIFPTRVRGLCIAICALVFWTGDIIVTYSLPMMLNSIGLSGVFGIYSAVCCIALVFVF  710

Query  293  LRVPETKGMPLEVITEFFAVGARQA  219
            L+VPETKGMPLEVITEFFAVGA+QA
Sbjct  711  LKVPETKGMPLEVITEFFAVGAKQA  735



>emb|CBI21577.3| unnamed protein product [Vitis vinifera]
Length=627

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 110/119 (92%), Gaps = 1/119 (1%)
 Frame = -2

Query  554  HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  375
            HA++ST+ V++YFC FVM +GPIPNILC+EIFPTRVRG CIA+CAL FWICD+IVTYSLP
Sbjct  509  HAIISTVSVVVYFCCFVMAFGPIPNILCSEIFPTRVRGLCIAVCALTFWICDIIVTYSLP  568

Query  374  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEM-AKNE  201
            VMLSS+GLAGVFGIYA+VC++SWIFVFL+VPETKGMPLEVI+EFFAVGA+QA   AKN 
Sbjct  569  VMLSSVGLAGVFGIYAIVCILSWIFVFLKVPETKGMPLEVISEFFAVGAKQAATDAKNN  627



>ref|XP_010459775.1| PREDICTED: monosaccharide-sensing protein 1-like [Camelina sativa]
Length=655

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLL TIPV I SL++LV+  ++++  V +A LST CV+LYFC FVMGYGPIPNIL
Sbjct  503  SGRRSLLLWTIPVLIVSLIILVISELVHISKVVNAALSTSCVVLYFCFFVMGYGPIPNIL  562

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICA+VFWI D+IVTYSLPV+LSS+GL GVF IYA VCVISWIFV+
Sbjct  563  CSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLPVLLSSIGLVGVFSIYAAVCVISWIFVY  622

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            ++VPETKGMPLEVIT++FA GA+    A ++
Sbjct  623  MKVPETKGMPLEVITDYFAFGAQAQASAPSK  653



>gb|EPS57524.1| hypothetical protein M569_17293, partial [Genlisea aurea]
Length=693

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR LLLSTIP+ + +L++LV+GNV++LGS+ HAV+ST+ VI+YFC FVMG+GP+PNIL
Sbjct  550  AGRRWLLLSTIPILLATLILLVVGNVVDLGSMVHAVVSTLSVIVYFCCFVMGFGPVPNIL  609

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CI ICAL FWI D+IVTYSLPVML S+GLAGVFGIYA VC  +W FVF
Sbjct  610  CAEIFPTRVRGLCIGICALTFWIGDIIVTYSLPVMLGSIGLAGVFGIYAAVCTAAWFFVF  669

Query  293  LRVPETKGMPLEVITEFFAVGARQ  222
            L+VPETKGMPLEVIT+FFAVGAR+
Sbjct  670  LKVPETKGMPLEVITDFFAVGARR  693



>ref|XP_010477336.1| PREDICTED: monosaccharide-sensing protein 1 [Camelina sativa]
 ref|XP_010477338.1| PREDICTED: monosaccharide-sensing protein 1 [Camelina sativa]
Length=734

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLL TIPV I SL++LV+  ++++  V +A LST CV+LYFC FVMGYGPIPNIL
Sbjct  582  SGRRSLLLWTIPVLIVSLIILVISELVHISKVVNAALSTSCVVLYFCFFVMGYGPIPNIL  641

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICA+VFWI D+IVTYSLPV+LSS+GL GVF IYA VCVISWIFV+
Sbjct  642  CSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLPVLLSSIGLVGVFSIYAAVCVISWIFVY  701

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            ++VPETKGMPLEVIT++FA GA+    A ++
Sbjct  702  MKVPETKGMPLEVITDYFAFGAQAQASAPSK  732



>gb|EMS63940.1| Monosaccharide-sensing protein 2 [Triticum urartu]
Length=743

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLLSTIPV I +L VLVL NV+++G++ HA LSTI VI+YFC FVMG+GPIPNIL
Sbjct  594  SGRRFLLLSTIPVLIVALAVLVLVNVLDVGTMVHAALSTISVIVYFCFFVMGFGPIPNIL  653

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPT VRG CIAICAL FWI D+IVTY+LPVML+++GLAGVFGIYA+VCV++++FV+
Sbjct  654  CAEIFPTSVRGICIAICALTFWIGDIIVTYTLPVMLNAIGLAGVFGIYAIVCVLAFVFVY  713

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            ++VPETKGMPLEVITEFF+VGA+Q + A +
Sbjct  714  MKVPETKGMPLEVITEFFSVGAKQGKEATD  743



>tpg|DAA46101.1| TPA: hypothetical protein ZEAMMB73_051534 [Zea mays]
Length=336

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL+TIPV I +L+VLV+ N++++G VAHA LST  VI+YFC FVMG+GP+PNIL
Sbjct  181  SGRRFLLLATIPVLIVALLVLVVSNIVDVGDVAHAALSTASVIVYFCFFVMGFGPVPNIL  240

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPT VRG CIAICAL FW+ D+IVTY+LPVML+ +GLAGVFG+YAVVCV++  FVF
Sbjct  241  CAEIFPTTVRGVCIAICALAFWLGDIIVTYTLPVMLNVVGLAGVFGVYAVVCVLALAFVF  300

Query  293  LRVPETKGMPLEVITEFFAVGARQAE  216
            ++VPETKGMPLEVITEFF+VGA+QA+
Sbjct  301  VKVPETKGMPLEVITEFFSVGAKQAK  326



>ref|XP_002276373.1| PREDICTED: monosaccharide-sensing protein 2 [Vitis vinifera]
 gb|ADP37149.1| putative tonoplastic monosaccharide transporter [Vitis vinifera]
Length=742

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 110/119 (92%), Gaps = 1/119 (1%)
 Frame = -2

Query  554  HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  375
            HA++ST+ V++YFC FVM +GPIPNILC+EIFPTRVRG CIA+CAL FWICD+IVTYSLP
Sbjct  624  HAIISTVSVVVYFCCFVMAFGPIPNILCSEIFPTRVRGLCIAVCALTFWICDIIVTYSLP  683

Query  374  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEM-AKNE  201
            VMLSS+GLAGVFGIYA+VC++SWIFVFL+VPETKGMPLEVI+EFFAVGA+QA   AKN 
Sbjct  684  VMLSSVGLAGVFGIYAIVCILSWIFVFLKVPETKGMPLEVISEFFAVGAKQAATDAKNN  742



>gb|EMT29091.1| Monosaccharide-sensing protein 2 [Aegilops tauschii]
Length=743

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLLSTIPV I +L VLVL NV+++G++ HA LSTI VI+YFC FVMG+GPIPNIL
Sbjct  594  SGRRFLLLSTIPVLIVALAVLVLVNVLDVGTMVHAALSTISVIIYFCFFVMGFGPIPNIL  653

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPT VRG CIAICAL FWI D+IVTY+LPVML+++GLAGVFGIYA+VC+++++FV+
Sbjct  654  CAEIFPTSVRGICIAICALTFWIGDIIVTYTLPVMLNAIGLAGVFGIYAIVCILAFVFVY  713

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            ++VPETKGMPLEVITEFF+VGA+Q + A +
Sbjct  714  MKVPETKGMPLEVITEFFSVGAKQGKEATD  743



>ref|XP_009372620.1| PREDICTED: monosaccharide-sensing protein 2 [Pyrus x bretschneideri]
Length=739

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL+TIPV I SL++LV+ N++ LGSV HA LSTICV++YFC FVM YGPIPNIL
Sbjct  589  SGRRMLLLTTIPVLIVSLIILVVTNLLTLGSVLHAALSTICVVVYFCVFVMAYGPIPNIL  648

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALV+WI D+I+TYSLPVML SMGL+G FGIYAVVCVIS++FVF
Sbjct  649  CSEIFPTRVRGLCIAICALVYWIGDIIITYSLPVMLDSMGLSGAFGIYAVVCVISFVFVF  708

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFF+VGARQ   AKNE
Sbjct  709  LKVPETKGMPLEVITEFFSVGARQVAAAKNE  739



>gb|AAO37640.1| putative sugar transporter type 2a [Saccharum hybrid cultivar 
Q117]
Length=745

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLLSTIPV I SL+VLV+ NVI LG+V HAVLSTI VI Y C F MG+GPIPNIL
Sbjct  597  SGRRFLLLSTIPVLIASLIVLVVSNVIELGTVVHAVLSTISVITYLCCFKMGFGPIPNIL  656

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAE FPTRVRG CIAICAL+FW+ D+IVTYSLPVML+++GL GVFGIYAV C I+++FV+
Sbjct  657  CAEFFPTRVRGICIAICALIFWVGDIIVTYSLPVMLNAIGLEGVFGIYAVACAIAFVFVY  716

Query  293  LRVPETKGMPLEVITEFFAVGARQA  219
            L+VPETKGMPLEVITEFFAVGA+QA
Sbjct  717  LKVPETKGMPLEVITEFFAVGAKQA  741



>tpg|DAA46100.1| TPA: hypothetical protein ZEAMMB73_051534 [Zea mays]
Length=457

 Score =   198 bits (504),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL+TIPV I +L+VLV+ N++++G VAHA LST  VI+YFC FVMG+GP+PNIL
Sbjct  302  SGRRFLLLATIPVLIVALLVLVVSNIVDVGDVAHAALSTASVIVYFCFFVMGFGPVPNIL  361

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPT VRG CIAICAL FW+ D+IVTY+LPVML+ +GLAGVFG+YAVVCV++  FVF
Sbjct  362  CAEIFPTTVRGVCIAICALAFWLGDIIVTYTLPVMLNVVGLAGVFGVYAVVCVLALAFVF  421

Query  293  LRVPETKGMPLEVITEFFAVGARQAE  216
            ++VPETKGMPLEVITEFF+VGA+QA+
Sbjct  422  VKVPETKGMPLEVITEFFSVGAKQAK  447



>gb|KDP36756.1| hypothetical protein JCGZ_08047 [Jatropha curcas]
Length=739

 Score =   202 bits (515),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLL+T+PV I SLV+L++G +++LG+VA+A +ST+CV++YFC FVM YGPIPNIL
Sbjct  589  SGRRTLLLTTLPVLIGSLVILLIGQLVDLGTVANAAISTVCVVIYFCCFVMAYGPIPNIL  648

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICALV+WI D+IVTY++PVML+S+GL G+F I+A++C ISW+FVF
Sbjct  649  CSEIFPTRVRGLCIAICALVYWIADIIVTYTVPVMLNSIGLTGIFIIFAIMCAISWVFVF  708

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFFAVGARQ   AKNE
Sbjct  709  LKVPETKGMPLEVITEFFAVGARQVAAAKNE  739



>ref|XP_009110209.1| PREDICTED: monosaccharide-sensing protein 1 [Brassica rapa]
Length=726

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL TIPV I SL+VLV+  ++++  V +A LST CVILYFC FVMGYGPIPNIL
Sbjct  574  SGRRALLLWTIPVLILSLIVLVISELVHISKVVNAALSTACVILYFCFFVMGYGPIPNIL  633

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICA+VFWI D+IVTYSLPV+LSS+GL GVF IY  VCVISWIFV+
Sbjct  634  CSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLPVLLSSIGLVGVFIIYGAVCVISWIFVY  693

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            ++VPETKGMPLEVIT++FA GA+    A ++
Sbjct  694  MKVPETKGMPLEVITDYFAFGAQAQASAPSK  724



>emb|CDX96618.1| BnaA08g21610D [Brassica napus]
Length=725

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL TIPV I SL+VLV+  ++++  V +A LST CVILYFC FVMGYGPIPNIL
Sbjct  573  SGRRALLLWTIPVLILSLIVLVISELVHISKVVNAALSTACVILYFCFFVMGYGPIPNIL  632

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICA+VFWI D+IVTYSLPV+LSS+GL GVF IY  VCVISWIFV+
Sbjct  633  CSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLPVLLSSIGLVGVFIIYGAVCVISWIFVY  692

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            ++VPETKGMPLEVIT++FA GA+    A ++
Sbjct  693  MKVPETKGMPLEVITDYFAFGAQAQASAPSK  723



>emb|CDY33650.1| BnaC08g19500D [Brassica napus]
Length=697

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL TIPV I SL+VLV+  ++++  V +A LST CVILYFC FVMGYGPIPNIL
Sbjct  545  SGRRALLLWTIPVLIVSLIVLVISELVHISKVVNAALSTACVILYFCFFVMGYGPIPNIL  604

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICA+VFWI D+IVTYSLPV+LSS+GL GVF IY  VCVISWIFV+
Sbjct  605  CSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLPVLLSSIGLVGVFIIYGAVCVISWIFVY  664

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            ++VPETKGMPLEVIT++FA GA+    A ++
Sbjct  665  MKVPETKGMPLEVITDYFAFGAQAQASAPSK  695



>ref|XP_010063149.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW70342.1| hypothetical protein EUGRSUZ_F03585 [Eucalyptus grandis]
Length=740

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLL+TIPV I +LVVLV+  +IN  S   + ++TICV++YFC F+  YGPIPNIL
Sbjct  590  SGRRTLLLTTIPVLIVTLVVLVIVELINSSSTVFSYIATICVVVYFCCFMTAYGPIPNIL  649

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CI ICALVFW+ D+IVT +LPV+L S+GLAG+FGIYA VCVISW+FVF
Sbjct  650  CSEIFPTRVRGLCITICALVFWLGDIIVTDTLPVLLESIGLAGIFGIYAAVCVISWVFVF  709

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFF+VGA+Q    KNE
Sbjct  710  LKVPETKGMPLEVITEFFSVGAKQIATTKNE  740



>ref|XP_009333794.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             +GRR+LLL TIPV I SLV+LVLG+++N+GSV +A +ST+ V+LYFC FVMG+GPIPNI
Sbjct  585  LAGRRSLLLGTIPVLIVSLVILVLGSLVNMGSVVNASVSTVSVVLYFCFFVMGFGPIPNI  644

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LCAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML S+GLAGVFG+YAVVCVI++IFV
Sbjct  645  LCAEIFPTRVRGLCIAICALTFWIGDIIVTYSLPVMLKSVGLAGVFGMYAVVCVIAFIFV  704

Query  296  FLRVPETKGMPLEVITEFFAVG  231
            FL+VPETKGMPLEVITEFF+VG
Sbjct  705  FLKVPETKGMPLEVITEFFSVG  726



>ref|XP_002307812.1| hypothetical protein POPTR_0005s27680g [Populus trichocarpa]
 gb|EEE94808.1| hypothetical protein POPTR_0005s27680g [Populus trichocarpa]
Length=738

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRRTLLL+TIPV I SL+VL++  ++ + SV +A + T CVI++ C FV  YGPIPNIL
Sbjct  589  AGRRTLLLTTIPVLILSLIVLIIFELVTVSSVVNAAILTACVIIFICCFVSAYGPIPNIL  648

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICA+V+WI D+IVTY+LPVMLSS+GL G+FGIYAVVC ISWIFVF
Sbjct  649  CSEIFPTRVRGLCIAICAMVYWIGDIIVTYTLPVMLSSIGLVGIFGIYAVVCAISWIFVF  708

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            L+VPETKGMPLEVITEFFAVGA+QA   K 
Sbjct  709  LKVPETKGMPLEVITEFFAVGAKQAAAKKE  738



>ref|XP_011098017.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011098018.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011098019.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=711

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 108/118 (92%), Gaps = 1/118 (1%)
 Frame = -2

Query  554  HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  375
            HAV+ST+ VI+YFC FVMG+GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTYSLP
Sbjct  594  HAVISTVSVIVYFCCFVMGFGPIPNILCSEIFPTRVRGICIAICALTFWIGDIIVTYSLP  653

Query  374  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQ-AEMAKN  204
            VML+S+GLAGVF IYAVVC I+W+FVFL+VPETKGMPLEVITEFFAVGA+Q A  AKN
Sbjct  654  VMLNSIGLAGVFSIYAVVCTIAWVFVFLKVPETKGMPLEVITEFFAVGAKQTAASAKN  711



>ref|XP_007201798.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 ref|XP_007201799.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 ref|XP_007201800.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 gb|EMJ02997.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 gb|EMJ02998.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 gb|EMJ02999.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
Length=736

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLL+TIP+ I SLV+LVLG+++N+GSV +A +ST+ V+LYFC FVMG+GP+PNIL
Sbjct  586  SGRRSLLLTTIPILIASLVILVLGSLVNMGSVVNASVSTVSVVLYFCFFVMGFGPVPNIL  645

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML S+GL GVFG+YAVVCVI+W+FVF
Sbjct  646  CAEIFPTRVRGLCIAICALAFWIGDIIVTYSLPVMLKSVGLGGVFGMYAVVCVIAWVFVF  705

Query  293  LRVPETKGMPLEVITEFFAVG  231
            L+VPETKGMPLEVI EFF+VG
Sbjct  706  LKVPETKGMPLEVIIEFFSVG  726



>ref|XP_008377843.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
 ref|XP_008377844.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=736

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             +GRR+LLL TIPV I SL +LVLG+++N+GSV +A +ST+ V+LYFC FVMG+GPIPNI
Sbjct  585  LAGRRSLLLGTIPVLIVSLAILVLGSLVNMGSVVNASVSTVSVVLYFCFFVMGFGPIPNI  644

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LCAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML S+GLAGVFG+YAVVCVI++IFV
Sbjct  645  LCAEIFPTRVRGLCIAICALTFWIGDIIVTYSLPVMLKSVGLAGVFGMYAVVCVIAFIFV  704

Query  296  FLRVPETKGMPLEVITEFFAVG  231
            FL+VPETKGMPLEVITEFF+VG
Sbjct  705  FLKVPETKGMPLEVITEFFSVG  726



>ref|XP_006306868.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 ref|XP_006306869.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 ref|XP_006306870.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 gb|EOA39766.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 gb|EOA39767.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 gb|EOA39768.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
Length=736

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLL TIPV I SL+VLV+  ++++  V +A LST CV+LYFC FVMGYGPIPNIL
Sbjct  582  SGRRSLLLWTIPVLIVSLIVLVISELVHISKVVNAALSTSCVVLYFCFFVMGYGPIPNIL  641

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICA+VFWI D+IVTYSLPV+LSS+GL GVF IYA VCVISWIFV+
Sbjct  642  CSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLPVLLSSIGLVGVFSIYAAVCVISWIFVY  701

Query  293  LRVPETKGMPLEVITEFFAVG  231
            ++VPETKGMPLEVIT++FA G
Sbjct  702  MKVPETKGMPLEVITDYFAFG  722



>ref|XP_009341490.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             +GRR+LLL TIPV I SLV+LVLG ++N+GSV +A +ST+ V+LYFC FVMG+GPIPNI
Sbjct  585  LAGRRSLLLGTIPVLIVSLVILVLGGLVNMGSVVNASVSTVSVVLYFCFFVMGFGPIPNI  644

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LCAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML S+GLAGVFG+YAVVCVI++IFV
Sbjct  645  LCAEIFPTRVRGICIAICALTFWIGDIIVTYSLPVMLKSVGLAGVFGMYAVVCVIAFIFV  704

Query  296  FLRVPETKGMPLEVITEFFAVG  231
            FL+VPETKGMPLEVITEFF+VG
Sbjct  705  FLKVPETKGMPLEVITEFFSVG  726



>gb|KDP47010.1| hypothetical protein JCGZ_10737 [Jatropha curcas]
Length=740

 Score =   200 bits (509),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLL TIP+ I SL++LVLG+ +NLG+V +A +ST  VI+YFC FVMG+GPIPNIL
Sbjct  590  SGRRSLLLCTIPILIVSLLILVLGSAVNLGNVVNASISTASVIIYFCCFVMGFGPIPNIL  649

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICAL FWI D+IVTY+LPVML SMGLAGVFG+YAVVC+IS  FV+
Sbjct  650  CSEIFPTRVRGLCIAICALTFWIGDIIVTYTLPVMLKSMGLAGVFGLYAVVCIISLGFVY  709

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFF++GA+QA  AKN+
Sbjct  710  LKVPETKGMPLEVITEFFSLGAKQAAAAKND  740



>ref|XP_008235816.1| PREDICTED: monosaccharide-sensing protein 2 [Prunus mume]
 ref|XP_008235817.1| PREDICTED: monosaccharide-sensing protein 2 [Prunus mume]
Length=736

 Score =   200 bits (509),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLL+TIPV I SLV+LVLG+++N+GS+ +A +ST+ V+LYFC FVMG+GP+PNIL
Sbjct  586  SGRRSLLLTTIPVLIASLVILVLGSLVNMGSIVNASVSTVSVVLYFCFFVMGFGPVPNIL  645

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML S+GL GVFG+Y VVCVI+W+FVF
Sbjct  646  CAEIFPTRVRGLCIAICALTFWIGDIIVTYSLPVMLKSVGLGGVFGMYGVVCVIAWVFVF  705

Query  293  LRVPETKGMPLEVITEFFAVG  231
            L+VPETKGMPLEVI EFF+VG
Sbjct  706  LKVPETKGMPLEVIIEFFSVG  726



>ref|XP_004290074.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
 ref|XP_011458100.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
Length=740

 Score =   200 bits (509),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLL+TIPV I SLV+LVLG+++N GSV +A +ST  V++YFCSFVMG+GP+PNIL
Sbjct  589  SGRRTLLLTTIPVLILSLVILVLGSLVNFGSVVNAAISTGSVVIYFCSFVMGFGPVPNIL  648

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GL+GVFG+YAVVCVI+WIFVF
Sbjct  649  CAEIFPTRVRGLCIAICALTFWICDIIVTYSLPVLLKSVGLSGVFGMYAVVCVIAWIFVF  708

Query  293  LRVPETKGMPLEVITEFF  240
            ++VPETKGMPLEVITEFF
Sbjct  709  IKVPETKGMPLEVITEFF  726



>ref|XP_004983796.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=739

 Score =   200 bits (509),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRR LLL+TIP+ I +L+VLV+ N++++G++ HA LSTI VI+YFC FVMG+GP+PNI
Sbjct  591  MSGRRFLLLATIPILIVALLVLVVVNIVDVGTMVHAALSTISVIVYFCFFVMGFGPVPNI  650

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LCAEIFPT VRG CIAICAL FWI D+IVTY+LPVML+++GLAGVFGIYAVVC+++ +FV
Sbjct  651  LCAEIFPTTVRGLCIAICALTFWIGDIIVTYTLPVMLNAIGLAGVFGIYAVVCILALVFV  710

Query  296  FLRVPETKGMPLEVITEFFAVGARQAE  216
            +++VPETKGMPLEVITEFF+VGA+QA+
Sbjct  711  YMKVPETKGMPLEVITEFFSVGAKQAK  737



>ref|XP_010503840.1| PREDICTED: monosaccharide-sensing protein 3-like [Camelina sativa]
Length=740

 Score =   200 bits (508),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLLSTIPV I SLV LV+G+++ LG   +A++ST  V +Y   FVMG+G IPNIL
Sbjct  586  AGRRSLLLSTIPVLILSLVTLVIGSLVKLGGTTNALISTASVTVYLSCFVMGFGAIPNIL  645

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPT VRG CI ICAL FWICD+IVTY+LPVML S+GLAGVFGIYAVVC +SW+FV+
Sbjct  646  CSEIFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSLGLAGVFGIYAVVCAVSWVFVY  705

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMA  210
            L+VPETKGMPLEVI+EFF+VGA+Q + A
Sbjct  706  LKVPETKGMPLEVISEFFSVGAKQQDAA  733



>ref|NP_173508.1| tonoplast monosaccharide transporter1 [Arabidopsis thaliana]
 sp|Q96290.2|MSSP1_ARATH RecName: Full=Monosaccharide-sensing protein 1; AltName: Full=Monosaccharide 
transporter 1; AltName: Full=Sugar transporter 
MSSP1; AltName: Full=Sugar transporter MT1 [Arabidopsis thaliana]
 gb|AAF80627.1|AC069251_20 F2D10.36 [Arabidopsis thaliana]
 gb|AEE30030.1| tonoplast monosaccharide transporter1 [Arabidopsis thaliana]
Length=734

 Score =   200 bits (508),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLL TIPV I SLVVLV+  +I++  V +A LST CV+LYFC FVMGYGPIPNIL
Sbjct  582  SGRRSLLLWTIPVLIVSLVVLVISELIHISKVVNAALSTGCVVLYFCFFVMGYGPIPNIL  641

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICA+VFWI D+IVTYSLPV+LSS+GL GVF IYA VCVISWIFV+
Sbjct  642  CSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLPVLLSSIGLVGVFSIYAAVCVISWIFVY  701

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            ++VPETKGMPLEVIT++FA GA+    A ++
Sbjct  702  MKVPETKGMPLEVITDYFAFGAQAQASAPSK  732



>gb|AAD30608.1|AC007369_18 Sugar transporter [Arabidopsis thaliana]
Length=734

 Score =   200 bits (508),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLL TIPV I SLVVLV+  +I++  V +A LST CV+LYFC FVMGYGPIPNIL
Sbjct  582  SGRRSLLLWTIPVLIVSLVVLVISELIHISKVVNAALSTGCVVLYFCFFVMGYGPIPNIL  641

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICA+VFWI D+IVTYSLPV+LSS+GL GVF IYA VCVISWIFV+
Sbjct  642  CSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLPVLLSSIGLVGVFSIYAAVCVISWIFVY  701

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            ++VPETKGMPLEVIT++FA GA+    A ++
Sbjct  702  MKVPETKGMPLEVITDYFAFGAQAQASAPSK  732



>emb|CAN64713.1| hypothetical protein VITISV_043728 [Vitis vinifera]
Length=120

 Score =   185 bits (470),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 105/117 (90%), Gaps = 2/117 (2%)
 Frame = -2

Query  554  HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  375
            HA +ST  VI+YFC FVMG+GP+PNILCAEIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  6    HAAISTASVIIYFCCFVMGFGPVPNILCAEIFPTRVRGLCIAICALSFWIGDIIVTYTLP  65

Query  374  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            +ML+S+GLAGVFG+YAVVC+ISW+FVFL+VPETKGMPLEVI+EFFAVG+   +  KN
Sbjct  66   LMLTSVGLAGVFGMYAVVCLISWVFVFLKVPETKGMPLEVISEFFAVGSSAGQ--KN  120



>ref|XP_009359630.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Pyrus 
x bretschneideri]
Length=743

 Score =   200 bits (508),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -2

Query  554  HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  375
            +A +STI V++YFC+FVMG+GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  625  NATISTISVVVYFCTFVMGFGPIPNILCSEIFPTRVRGMCIAICALTFWIGDIIVTYTLP  684

Query  374  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            +ML+S+GLAGVF IYAVVC ISW+FVFL+VPETKGMPLEVI+EFF+VGA+QAE+ + 
Sbjct  685  IMLTSIGLAGVFAIYAVVCTISWVFVFLKVPETKGMPLEVISEFFSVGAKQAEIDEK  741



>ref|XP_009359631.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X3 [Pyrus 
x bretschneideri]
Length=742

 Score =   199 bits (507),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -2

Query  554  HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  375
            +A +STI V++YFC+FVMG+GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  624  NATISTISVVVYFCTFVMGFGPIPNILCSEIFPTRVRGMCIAICALTFWIGDIIVTYTLP  683

Query  374  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            +ML+S+GLAGVF IYAVVC ISW+FVFL+VPETKGMPLEVI+EFF+VGA+QAE+ + 
Sbjct  684  IMLTSIGLAGVFAIYAVVCTISWVFVFLKVPETKGMPLEVISEFFSVGAKQAEIDEK  740



>ref|XP_009359629.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=753

 Score =   200 bits (508),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -2

Query  554  HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  375
            +A +STI V++YFC+FVMG+GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  635  NATISTISVVVYFCTFVMGFGPIPNILCSEIFPTRVRGMCIAICALTFWIGDIIVTYTLP  694

Query  374  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            +ML+S+GLAGVF IYAVVC ISW+FVFL+VPETKGMPLEVI+EFF+VGA+QAE+ + 
Sbjct  695  IMLTSIGLAGVFAIYAVVCTISWVFVFLKVPETKGMPLEVISEFFSVGAKQAEIDEK  751



>ref|XP_006403910.1| hypothetical protein EUTSA_v10011113mg [Eutrema salsugineum]
 gb|ESQ45363.1| hypothetical protein EUTSA_v10011113mg [Eutrema salsugineum]
Length=739

 Score =   199 bits (507),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+L+LSTIP+ I SL+ LV+G+++ LG   +A++STI V++Y   FVMG+G IPNIL
Sbjct  585  TGRRSLMLSTIPILILSLLTLVIGSLVKLGGTTNALMSTISVMVYLSCFVMGFGAIPNIL  644

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPT VRG CI ICAL FWICD+IVTY+LPVML S+GLAGVFGIYA VC ++W+FV+
Sbjct  645  CSEIFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSLGLAGVFGIYAFVCAVAWVFVY  704

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMA  210
            L+VPETKGMPLEVI+EFF+VGA+Q ++A
Sbjct  705  LKVPETKGMPLEVISEFFSVGAKQQDLA  732



>ref|XP_010940242.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
Length=745

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 133/150 (89%), Gaps = 2/150 (1%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLL+TIPV I SL+VLV+ N++++G++ HAVLSTI VI+YFC FVMG+GPIPNIL
Sbjct  598  SGRRSLLLATIPVLIVSLIVLVVVNLVHMGTMVHAVLSTISVIVYFCCFVMGFGPIPNIL  657

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAE+FPTRVRG CIAIC+L FW  D+IVTY+LPVML ++GLAGVFGIYAVVCVI+ +F+F
Sbjct  658  CAELFPTRVRGMCIAICSLTFWFGDIIVTYTLPVMLKTVGLAGVFGIYAVVCVIALVFIF  717

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            L+VPETKGMPLEVI EFF VGA+ A  A+N
Sbjct  718  LKVPETKGMPLEVIIEFFNVGAKLA--ARN  745



>gb|EMT28528.1| Monosaccharide-sensing protein 3 [Aegilops tauschii]
Length=531

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRRTLLL+TIPV IFSLV+L++ NV+ + +  HA LST  VI+YFC FVMG+GPIPNI
Sbjct  381  LSGRRTLLLTTIPVLIFSLVILIVANVVPMATTVHAALSTGSVIIYFCCFVMGFGPIPNI  440

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LCAEIFPTRVRG CIA+C+L FWI D+IVTYSLPVML+S+GLAGVFGIYA VC ++ +FV
Sbjct  441  LCAEIFPTRVRGLCIALCSLTFWIGDIIVTYSLPVMLNSIGLAGVFGIYACVCCLALVFV  500

Query  296  FLRVPETKGMPLEVITEFFAVGAR  225
             L+VPETKG+PLEVI EFF VGA+
Sbjct  501  ALKVPETKGLPLEVIIEFFNVGAK  524



>ref|XP_009115837.1| PREDICTED: monosaccharide-sensing protein 3 [Brassica rapa]
Length=731

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+L+LSTIP+ I SL+ LV+G+++ LG  A+A++ST  V++Y   FVMG+G IPNIL
Sbjct  579  SGRRSLMLSTIPILILSLLTLVIGSLVKLGGTANALISTASVMVYLSCFVMGFGAIPNIL  638

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPT VRG CI ICAL FWICD+IVTY+LPVML S+GLAGVFGIYA VC ++W+FV+
Sbjct  639  CSEIFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSLGLAGVFGIYAFVCAVAWVFVY  698

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMA  210
            L+VPETKGMPLEVI+EFF+VGA+Q + A
Sbjct  699  LKVPETKGMPLEVISEFFSVGAKQQDAA  726



>ref|XP_010515555.1| PREDICTED: monosaccharide-sensing protein 3 [Camelina sativa]
Length=738

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLLSTIPV I SLV LV+G+++ LG   +A++ST  V +Y   FVMG+G IPNIL
Sbjct  584  AGRRSLLLSTIPVLILSLVTLVIGSLVKLGGTTNALISTASVTVYLSCFVMGFGAIPNIL  643

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPT VRG CI ICAL FWICD+IVTY+LPVML S+GLAGVFGIYAVVC ++W+FV+
Sbjct  644  CSEIFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSLGLAGVFGIYAVVCAVAWVFVY  703

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMA  210
            L+VPETKGMPLEVI+EFF+VGA+Q + A
Sbjct  704  LKVPETKGMPLEVISEFFSVGAKQQDAA  731



>gb|KCW55684.1| hypothetical protein EUGRSUZ_I01534 [Eucalyptus grandis]
Length=282

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 124/151 (82%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLL TIP+ I SL+++VL NV++ GS  HAV+ TI V+LY C FVMG+GP PN+L
Sbjct  132  SGRRSLLLGTIPMLIVSLIIMVLSNVVDAGSAIHAVICTIGVVLYICFFVMGFGPAPNVL  191

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG C+AIC L FW+ +VIVTYSLP+ML S GLA +FG++ VVC++SW FVF
Sbjct  192  CAEIFPTRVRGVCVAICGLAFWMGNVIVTYSLPLMLRSAGLASIFGMFTVVCLLSWAFVF  251

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFF +G +Q    K+E
Sbjct  252  LKVPETKGMPLEVITEFFCLGMKQTFAVKDE  282



>ref|XP_010426703.1| PREDICTED: monosaccharide-sensing protein 3-like [Camelina sativa]
Length=738

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLLSTIP+ I SLV LV+G+++ LG   +A+LST  V +Y   FVMG+G IPNIL
Sbjct  584  AGRRSLLLSTIPILILSLVTLVIGSLVKLGGTTNALLSTASVTVYLSCFVMGFGSIPNIL  643

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPT VRG CI ICAL FWICD+IVTY+LPVML S+GLAGVFGIYA VC ++W+FV+
Sbjct  644  CSEIFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSLGLAGVFGIYAFVCAVAWVFVY  703

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMA  210
            LRVPETKGMPLEVI+EFF+VGA+Q + A
Sbjct  704  LRVPETKGMPLEVISEFFSVGAKQQDAA  731



>gb|EYU30848.1| hypothetical protein MIMGU_mgv1a001984mg [Erythranthe guttata]
Length=730

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -2

Query  554  HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  375
            HAV+ST  VI+YFC+FVMG+GP+PNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLP
Sbjct  613  HAVISTGSVIVYFCTFVMGFGPVPNILCAEIFPTRVRGICIAICALTFWIGDIIVTYSLP  672

Query  374  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            V+L+S+GL GVFGIYA VC ++W FV+L+VPETKGMPLEVITEFFAVGA+Q+  A+N 
Sbjct  673  VLLNSIGLGGVFGIYAAVCTVAWFFVYLKVPETKGMPLEVITEFFAVGAKQSLAAENN  730



>ref|XP_007204446.1| hypothetical protein PRUPE_ppa026426mg [Prunus persica]
 gb|EMJ05645.1| hypothetical protein PRUPE_ppa026426mg [Prunus persica]
Length=742

 Score =   198 bits (503),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -2

Query  554  HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  375
            +A +STI V++YFC FVMG+GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  624  NATISTISVVVYFCCFVMGFGPIPNILCSEIFPTRVRGLCIAICALTFWIGDIIVTYTLP  683

Query  374  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            +ML+S+GLAGVF IYAVVC ISW+FVFL+VPETKGMPLEVI+EFF+VGA+QA++A++
Sbjct  684  IMLTSIGLAGVFAIYAVVCTISWVFVFLKVPETKGMPLEVISEFFSVGAKQADIAES  740



>ref|XP_006384856.1| transporter-related family protein [Populus trichocarpa]
 gb|ERP62653.1| transporter-related family protein [Populus trichocarpa]
Length=739

 Score =   198 bits (503),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLL+TIPV I SL++LVLG++++LGSV +A +ST+ V+LYFC FVMG+GPIPNIL
Sbjct  589  SGRRTLLLTTIPVLIVSLILLVLGSMVDLGSVVNASISTVSVVLYFCFFVMGFGPIPNIL  648

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWICD+IVTY+LPVML S+GLAGVFG+YAVVCVIS++FV+
Sbjct  649  CAEIFPTRVRGLCIAICALTFWICDIIVTYTLPVMLKSVGLAGVFGLYAVVCVISFVFVY  708

Query  293  LRVPETKGMPLEVITEFF  240
            L+VPETKGMPLEVI+EFF
Sbjct  709  LKVPETKGMPLEVISEFF  726



>ref|NP_001151936.1| LOC100285573 [Zea mays]
 ref|XP_008680244.1| PREDICTED: LOC100285573 isoform X1 [Zea mays]
 gb|ACG45075.1| hexose transporter [Zea mays]
 tpg|DAA46098.1| TPA: hexose transporter isoform 1 [Zea mays]
 tpg|DAA46099.1| TPA: hexose transporter isoform 2 [Zea mays]
Length=747

 Score =   198 bits (503),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRR LLL+TIPV I +L+VLV+ N++++G VAHA LST  VI+YFC FVMG+GP+PNI
Sbjct  591  MSGRRFLLLATIPVLIVALLVLVVSNIVDVGDVAHAALSTASVIVYFCFFVMGFGPVPNI  650

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LCAEIFPT VRG CIAICAL FW+ D+IVTY+LPVML+ +GLAGVFG+YAVVCV++  FV
Sbjct  651  LCAEIFPTTVRGVCIAICALAFWLGDIIVTYTLPVMLNVVGLAGVFGVYAVVCVLALAFV  710

Query  296  FLRVPETKGMPLEVITEFFAVGARQAE  216
            F++VPETKGMPLEVITEFF+VGA+QA+
Sbjct  711  FVKVPETKGMPLEVITEFFSVGAKQAK  737



>gb|ACG25339.1| hexose transporter [Zea mays]
Length=763

 Score =   197 bits (502),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLL TIPV I SL VLVL NV+ + +  HA+LST CV++YFC FVMG+GPIPNIL
Sbjct  607  AGRRSLLLRTIPVLIVSLAVLVLANVVPMAAKVHALLSTACVVVYFCCFVMGFGPIPNIL  666

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIA+C+L FWICD+IVT SLPVML ++GLAGVFG YA VC +S +FV+
Sbjct  667  CAEIFPTRVRGICIAVCSLTFWICDIIVTNSLPVMLRTIGLAGVFGSYAFVCCLSLVFVY  726

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            LRVPETKG PLEVI EFF VGA+  +  ++E
Sbjct  727  LRVPETKGFPLEVIIEFFNVGAKAQKPEQHE  757



>ref|NP_001147067.1| hexose transporter [Zea mays]
 gb|ACN33422.1| unknown [Zea mays]
 gb|AFW69612.1| hexose transporter [Zea mays]
Length=763

 Score =   197 bits (502),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLL TIPV I SL VLVL NV+ + +  HA+LST CV++YFC FVMG+GPIPNIL
Sbjct  607  AGRRSLLLRTIPVLIVSLAVLVLANVVPMAAKVHALLSTACVVVYFCCFVMGFGPIPNIL  666

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIA+C+L FWICD+IVT SLPVML ++GLAGVFG YA VC +S +FV+
Sbjct  667  CAEIFPTRVRGICIAVCSLTFWICDIIVTNSLPVMLRTIGLAGVFGSYAFVCCLSLVFVY  726

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            LRVPETKG PLEVI EFF VGA+  +  ++E
Sbjct  727  LRVPETKGFPLEVIIEFFNVGAKAQKPEQHE  757



>ref|XP_004978456.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Setaria 
italica]
 ref|XP_004978457.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Setaria 
italica]
 ref|XP_004978458.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X3 [Setaria 
italica]
Length=710

 Score =   197 bits (501),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -2

Query  656  FSGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
             SGRR LLL+TIP+ I +LVVLV+ N++++G+  HA LSTI +ILYFC FVMG+GPIPNI
Sbjct  562  MSGRRFLLLATIPILIVALVVLVMVNIVDVGTTVHAALSTISLILYFCFFVMGFGPIPNI  621

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LCAEIFPT VRG CIAICA   WI D+IVTY+LPVML+S+GLAGVFGIYAV C+I+ +FV
Sbjct  622  LCAEIFPTTVRGICIAICAFTSWIGDIIVTYTLPVMLNSIGLAGVFGIYAVFCIIALVFV  681

Query  296  FLRVPETKGMPLEVITEFFAVGARQAE  216
            +++VPETKGMPLEVI EFF+VGA+QA+
Sbjct  682  YMKVPETKGMPLEVIIEFFSVGAKQAK  708



>gb|KFK34392.1| hypothetical protein AALP_AA5G139300 [Arabis alpina]
Length=739

 Score =   197 bits (501),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+L+LSTIP+ I SL+ LV+G+++ LG  A+A+LST  V++Y   FVMG+G IPNIL
Sbjct  585  AGRRSLMLSTIPILILSLITLVIGSLVKLGGTANALLSTASVMVYLSCFVMGFGAIPNIL  644

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPT VRG CI ICAL FWICD+IVTY+LPVML S+GLAGVFGIYA VC ++W+FV+
Sbjct  645  CSEIFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSLGLAGVFGIYAFVCAVAWVFVY  704

Query  293  LRVPETKGMPLEVITEFFAVGARQAE  216
            L+VPETKGMPLEVI+EFF+VGA+Q +
Sbjct  705  LKVPETKGMPLEVISEFFSVGAKQQD  730



>ref|XP_008242106.1| PREDICTED: monosaccharide-sensing protein 2-like [Prunus mume]
Length=742

 Score =   197 bits (501),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -2

Query  554  HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  375
            +A +STI V++YFC FVMG+GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  624  NATISTISVVVYFCCFVMGFGPIPNILCSEIFPTRVRGLCIAICALTFWIGDIIVTYTLP  683

Query  374  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            +ML+++GLAGVF IYAVVC ISW+FVFL+VPETKGMPLEVI+EFF+VGA+QA++A++
Sbjct  684  IMLTTIGLAGVFAIYAVVCTISWVFVFLKVPETKGMPLEVISEFFSVGAKQADIAES  740



>ref|XP_002893133.1| hypothetical protein ARALYDRAFT_472320 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69392.1| hypothetical protein ARALYDRAFT_472320 [Arabidopsis lyrata subsp. 
lyrata]
Length=735

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLL TIPV I SLVVLV+  ++++  V +A LST CV+LYFC FVMGYGPIPNIL
Sbjct  581  SGRRSLLLWTIPVLIVSLVVLVISELVHISKVVNAALSTGCVVLYFCFFVMGYGPIPNIL  640

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICA+VFWI D+IVTYSLPV+LSS+GL GVF IYA VCVISWIFV+
Sbjct  641  CSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLPVLLSSIGLVGVFSIYAAVCVISWIFVY  700

Query  293  LRVPETKGMPLEVITEFFAVG  231
            ++VPETKGMPLEVIT++FA G
Sbjct  701  MKVPETKGMPLEVITDYFAFG  721



>ref|XP_009589978.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009589979.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
Length=721

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -2

Query  554  HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  375
            HAV+STI V++YFC+FVMG+GPIPNILC+EIFPT VRG CIAICAL FW  D+IVTYSLP
Sbjct  607  HAVISTISVVVYFCTFVMGFGPIPNILCSEIFPTSVRGICIAICALTFWFGDIIVTYSLP  666

Query  374  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA  219
            VML+S+GL GVFGIYAVVC ++W+FV+L+VPETKGMPLEVITEFFAVGA+QA
Sbjct  667  VMLTSIGLGGVFGIYAVVCALAWVFVYLKVPETKGMPLEVITEFFAVGAKQA  718



>ref|XP_008392888.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=471

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 108/125 (86%), Gaps = 7/125 (6%)
 Frame = -2

Query  554  HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  375
            +A +STI V++YFC+FV+G+GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  353  NATISTISVVVYFCTFVLGFGPIPNILCSEIFPTRVRGLCIAICALTFWIGDIIVTYTLP  412

Query  374  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE*M  195
            +ML+S+GLAGVF IYAVVC ISW+FVFL+VPETKGMPLEVI+EFF+VGA+  E       
Sbjct  413  IMLTSIGLAGVFAIYAVVCTISWVFVFLKVPETKGMPLEVISEFFSVGAKHTE-------  465

Query  194  NERKL  180
            N+ KL
Sbjct  466  NDEKL  470



>ref|XP_009775817.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009775879.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009775941.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=721

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -2

Query  554  HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  375
            HAV+ST+ V++YFC+FVMG+GPIPNILC+EIFPT VRG CIAICAL FW  D+IVTYSLP
Sbjct  607  HAVISTVSVVVYFCTFVMGFGPIPNILCSEIFPTSVRGICIAICALTFWFGDIIVTYSLP  666

Query  374  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA  219
            VML+S+GL GVFGIYAVVC ++W+FV+L+VPETKGMPLEVITEFFAVGA+QA
Sbjct  667  VMLTSIGLGGVFGIYAVVCALAWVFVYLKVPETKGMPLEVITEFFAVGAKQA  718



>ref|XP_011099908.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011099909.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=709

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = -2

Query  554  HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  375
            HAV+ST  VI+YFC FVMG+GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  594  HAVISTASVIVYFCCFVMGFGPIPNILCAEIFPTRVRGICIAICALTFWIGDIIVTYTLP  653

Query  374  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQ  222
            VML+ +GLAGVFGIYAVVC ++W+FVF++VPETKGMPLEVITEFFAVGA+Q
Sbjct  654  VMLNQIGLAGVFGIYAVVCAVAWVFVFVKVPETKGMPLEVITEFFAVGAKQ  704



>ref|XP_006343319.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006343320.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Solanum 
tuberosum]
Length=722

 Score =   195 bits (495),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -2

Query  554  HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  375
            HAV+ST+ V++YFC+FVMG+GPIPNILC+EIFPT VRG CIAICAL FWI D+IVTYSLP
Sbjct  608  HAVISTVSVVVYFCTFVMGFGPIPNILCSEIFPTSVRGICIAICALTFWIGDIIVTYSLP  667

Query  374  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA  219
            +ML+S+GL GVF IYAVVC ++W+FVFL+VPETKGMPLEVITEFFAVGA++A
Sbjct  668  IMLNSIGLGGVFAIYAVVCAVAWVFVFLKVPETKGMPLEVITEFFAVGAKRA  719



>ref|NP_001190054.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
 gb|AEE78799.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
Length=737

 Score =   195 bits (495),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+L+LSTIP+ I SLV LV+G+++NLG   +A++ST  V +Y   FVMG+G IPNIL
Sbjct  583  TGRRSLMLSTIPILILSLVTLVIGSLVNLGGSINALISTASVTVYLSCFVMGFGAIPNIL  642

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPT VRG CI ICAL FWICD+IVTY+LPVML S+G+AGVFGIYA+VC ++W+FV+
Sbjct  643  CSEIFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSIGIAGVFGIYAIVCAVAWVFVY  702

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMA  210
            L+VPETKGMPLEVI+EFF+VGA+Q + A
Sbjct  703  LKVPETKGMPLEVISEFFSVGAKQQDAA  730



>dbj|BAI94493.1| sugar transporter [Dianthus caryophyllus]
Length=733

 Score =   194 bits (494),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRRTLLL+TIP  + SL+VL++ NVI   S+ HAVLST+ ++LY C F+MG+ P+PNIL
Sbjct  587  AGRRTLLLTTIPPLVLSLLVLIIVNVIETSSIVHAVLSTLSLVLYICFFMMGFAPVPNIL  646

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWI D+IVT +LP++L+S+GLAGVFGIYAV  VI+W+F+F
Sbjct  647  CAEIFPTRVRGVCIAICALTFWISDIIVTDTLPLLLNSVGLAGVFGIYAVFSVIAWVFIF  706

Query  293  LRVPETKGMPLEVITEFFAVGARQ  222
            L+VPETKGMPLEVITEFFA+GAR+
Sbjct  707  LKVPETKGMPLEVITEFFALGARK  730



>ref|XP_008812559.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008812567.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008812574.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008812580.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
Length=745

 Score =   194 bits (494),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 131/150 (87%), Gaps = 2/150 (1%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLL+TIPV I SL+VLV+ N++++G++ HAVLST  VI+YFC FVMG+GPIPNIL
Sbjct  598  SGRRSLLLATIPVLIVSLIVLVVVNLVHMGTMVHAVLSTFSVIIYFCCFVMGFGPIPNIL  657

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAE+FPTRVRG CIAIC+L FW  D+IVTY+LPVML++ GLAG FGIYAVVCVI+ +FVF
Sbjct  658  CAELFPTRVRGVCIAICSLAFWFGDIIVTYTLPVMLNTTGLAGAFGIYAVVCVIALVFVF  717

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            L+VPETKGMPLEVI EFF+VG + A  A+N
Sbjct  718  LKVPETKGMPLEVIIEFFSVGTKLA--ARN  745



>ref|XP_009148978.1| PREDICTED: monosaccharide-sensing protein 3 [Brassica rapa]
Length=741

 Score =   194 bits (494),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+L+LSTIP+ I SL+ LV+G+++ LG  A+A++ST  V++Y   FVMG G IPNIL
Sbjct  586  SGRRSLMLSTIPILILSLITLVIGSLVKLGGTANALISTASVMVYLSCFVMGLGAIPNIL  645

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPT VRG CI ICAL FWICD+IVTY+LPVML S+GLAGVFGIYA VC ++W+FV+
Sbjct  646  CSEIFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSLGLAGVFGIYAFVCAVAWVFVY  705

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMA  210
            L+VPETKGMPLEVI+EFF+VGA+  + +
Sbjct  706  LKVPETKGMPLEVISEFFSVGAKHQDAS  733



>ref|NP_001280690.1| monosaccharide-sensing protein 2-like [Solanum lycopersicum]
 dbj|BAO96236.1| tonoplast monosaccharide transporter 1 [Solanum lycopersicum]
Length=725

 Score =   194 bits (493),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -2

Query  554  HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  375
            HAV+ST  V++YFC+FVMG+GPIPNILC+EIFPT VRG CIAICAL FWI D+IVTYSLP
Sbjct  611  HAVISTASVVVYFCTFVMGFGPIPNILCSEIFPTSVRGICIAICALTFWIGDIIVTYSLP  670

Query  374  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA  219
            VML+S+GL GVF IYAVVC ++W+FVFL+VPETKGMPLEVITEFFAVGA++A
Sbjct  671  VMLNSIGLGGVFAIYAVVCAVAWVFVFLKVPETKGMPLEVITEFFAVGAKKA  722



>ref|XP_009776539.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009776540.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=722

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -2

Query  554  HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  375
            HAV+STI V++YFC FV G+GPIPNILC+EIFPT VRG CIAICAL FW  D+IVTYSLP
Sbjct  608  HAVISTISVVVYFCCFVTGFGPIPNILCSEIFPTSVRGLCIAICALTFWFGDIIVTYSLP  667

Query  374  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA  219
            VML+S+GLAGVFGIYA+VC I+W+FVFL+VPETKGMPLEVITEFFAVGA+Q+
Sbjct  668  VMLTSIGLAGVFGIYAIVCAIAWVFVFLKVPETKGMPLEVITEFFAVGAKQS  719



>ref|XP_009622210.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009622211.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009622212.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
Length=722

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -2

Query  554  HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  375
            HAV+STI V++YFC FV G+GPIPNILC+EIFPT VRG CIAICAL FW  D+IVTYSLP
Sbjct  608  HAVISTISVVVYFCCFVTGFGPIPNILCSEIFPTSVRGLCIAICALTFWFGDIIVTYSLP  667

Query  374  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA  219
            VML+S+GLAGVFGIYA+VC I+W+FVFL+VPETKGMPLEVITEFFAVGA+Q+
Sbjct  668  VMLTSIGLAGVFGIYAIVCAIAWVFVFLKVPETKGMPLEVITEFFAVGAKQS  719



>ref|XP_006292750.1| hypothetical protein CARUB_v10018997mg [Capsella rubella]
 gb|EOA25648.1| hypothetical protein CARUB_v10018997mg [Capsella rubella]
Length=729

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = -2

Query  644  RTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNILCAE  465
            R+LLLSTIP+ I SLV LV+G+++ LG   +A++ST  V +Y   FVMG+G IPNILC+E
Sbjct  578  RSLLLSTIPILILSLVTLVVGSLVKLGGTTNALISTASVTVYLSCFVMGFGAIPNILCSE  637

Query  464  IFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVFLRV  285
            IFPT VRG CI ICAL FWICD+IVTY+LPVML S+GLAGVFGIYA+VC ++W+FV+L+V
Sbjct  638  IFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSLGLAGVFGIYAIVCAVAWVFVYLKV  697

Query  284  PETKGMPLEVITEFFAVGARQAEMA  210
            PETKGMPLEVI+EFF+VGA+Q + A
Sbjct  698  PETKGMPLEVISEFFSVGAKQQDAA  722



>emb|CDX78009.1| BnaA09g32040D [Brassica napus]
Length=669

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = -2

Query  644  RTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNILCAE  465
            R+L+LSTIP+ I SL+ LV+G+++ LG  A+A++ST  V++Y   FVMG+G IPNILC+E
Sbjct  520  RSLMLSTIPILILSLLTLVIGSLVKLGGTANALISTASVMVYLSCFVMGFGAIPNILCSE  579

Query  464  IFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVFLRV  285
            IFPT VRG CI ICAL FWICD+IVTY+LPVML S+GLAGVFGIYA VC ++W+FV+L+V
Sbjct  580  IFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSLGLAGVFGIYAFVCAVAWVFVYLKV  639

Query  284  PETKGMPLEVITEFFAVGARQAEMA  210
            PETKGMPLEVI+EFF+VGA+Q + A
Sbjct  640  PETKGMPLEVISEFFSVGAKQQDAA  664



>ref|XP_004144248.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
 ref|XP_004171132.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
 gb|KGN47521.1| hypothetical protein Csa_6G355400 [Cucumis sativus]
Length=729

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL+TIPV I SL++L++  ++ + ++ +A +STICV++YFC FVM YGPIPNIL
Sbjct  579  SGRRWLLLATIPVLIVSLLILIVFKLVTVSTIVNAAISTICVVVYFCVFVMAYGPIPNIL  638

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAIC++VFW  D+IVTYSLPVMLS++GLAGVFGIYA VC+ISWIFV+
Sbjct  639  CSEIFPTRVRGLCIAICSMVFWTGDIIVTYSLPVMLSAIGLAGVFGIYAFVCIISWIFVY  698

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVI EFF+VGARQA    N 
Sbjct  699  LKVPETKGMPLEVIAEFFSVGARQAAKGSNN  729



>ref|XP_006855646.1| hypothetical protein AMTR_s00044p00110510 [Amborella trichopoda]
 gb|ERN17113.1| hypothetical protein AMTR_s00044p00110510 [Amborella trichopoda]
Length=743

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLL+TIPV + SL+VLV+ +      VA A +S + V++YFC FVMG+GPIPNIL
Sbjct  594  SGRRTLLLTTIPVLVVSLLVLVVSDSFLDEGVAQAAISCLGVVVYFCFFVMGFGPIPNIL  653

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICAL FWI D+IVTY+LP +L+++GL+GVFGIYAVVCVISWIFVF
Sbjct  654  CSEIFPTRVRGLCIAICALTFWIGDIIVTYTLPSLLTAIGLSGVFGIYAVVCVISWIFVF  713

Query  293  LRVPETKGMPLEVITEFF  240
            L+VPETKGMPLEVITEFF
Sbjct  714  LKVPETKGMPLEVITEFF  731



>emb|CDX73717.1| BnaC08g22860D [Brassica napus]
Length=681

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = -2

Query  644  RTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNILCAE  465
            R+L+LSTIP+ I SL+ LV+G+++ LG  A+A++ST  V++Y   FVMG+G IPNILC+E
Sbjct  532  RSLMLSTIPILILSLLTLVIGSLVKLGGTANALISTASVMVYLSCFVMGFGAIPNILCSE  591

Query  464  IFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVFLRV  285
            IFPT VRG CI ICAL FWICD+IVTY+LPVML S+GLAGVFGIYA VC ++W+FV+L+V
Sbjct  592  IFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSLGLAGVFGIYAFVCAVAWVFVYLKV  651

Query  284  PETKGMPLEVITEFFAVGARQAEMA  210
            PETKGMPLEVI+EFF+VGA+Q + A
Sbjct  652  PETKGMPLEVISEFFSVGAKQQDAA  676



>ref|XP_002312798.1| transporter-related family protein [Populus trichocarpa]
 gb|EEE86753.1| transporter-related family protein [Populus trichocarpa]
Length=740

 Score =   192 bits (488),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLL+TIPV I SL++LVLG+++++GSV +A +ST+ V+LYFC FVMG+GPIPNIL
Sbjct  590  SGRRTLLLTTIPVLIISLILLVLGSLVDMGSVVNASISTVSVVLYFCFFVMGFGPIPNIL  649

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWICD+IVTY+LPVML S+GLAGVFG+YA+VCVIS++FV+
Sbjct  650  CAEIFPTRVRGLCIAICALTFWICDIIVTYTLPVMLKSIGLAGVFGLYAIVCVISFVFVY  709

Query  293  LRVPETKGMPLEVITEFF  240
            L+VPETKGMPLEVI+EFF
Sbjct  710  LKVPETKGMPLEVISEFF  727



>ref|XP_004964709.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=748

 Score =   192 bits (487),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLLSTIPV I SL+VL++ NV+ + +  HA LST  VI+YFC FVMG+GPIPNIL
Sbjct  592  SGRRSLLLSTIPVLIASLLVLIVANVLPMATTLHAALSTGSVIVYFCCFVMGFGPIPNIL  651

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAIC+L FW+ D+ VTYSLPVMLSS+GLAGVFG YAVVC ++ IFV+
Sbjct  652  CAEIFPTRVRGLCIAICSLTFWLGDIAVTYSLPVMLSSVGLAGVFGFYAVVCCLALIFVY  711

Query  293  LRVPETKGMPLEVITEFFAVGAR  225
            ++VPETKG PLEVI EFF +GA+
Sbjct  712  IKVPETKGFPLEVIIEFFNIGAK  734



>ref|XP_011000869.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011000870.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011000871.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=740

 Score =   192 bits (487),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLL+TIPV I SL++LVLG+++++GSV +A +ST+ V+LYFC FVMG+GPIPNIL
Sbjct  590  SGRRTLLLTTIPVLIISLILLVLGSLVDMGSVVNASISTVSVVLYFCFFVMGFGPIPNIL  649

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL FWICD+IVTY+LPVML S+GLAGVFG+YA+VC+IS++FV+
Sbjct  650  CAEIFPTRVRGLCIAICALTFWICDIIVTYTLPVMLKSIGLAGVFGLYAIVCIISFVFVY  709

Query  293  LRVPETKGMPLEVITEFF  240
            L+VPETKGMPLEVI+EFF
Sbjct  710  LKVPETKGMPLEVISEFF  727



>ref|XP_008786687.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008786688.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008786689.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008786690.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
Length=744

 Score =   191 bits (485),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL+TIPV I SLV+ V+ N++++G+V HAVLST  V+ Y C FVMG+GPIPNIL
Sbjct  597  SGRRFLLLATIPVLIASLVLSVVVNLVDMGTVVHAVLSTGSVVAYLCCFVMGFGPIPNIL  656

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICA+ +W  ++I+TY+LPVML ++GL GVFGIYA VC++S +FV+
Sbjct  657  CAEIFPTRVRGVCIAICAITYWFGNIIITYTLPVMLDAIGLTGVFGIYAAVCILSLVFVY  716

Query  293  LRVPETKGMPLEVITEFFAVGARQA  219
            L+VPETKGMPLEVI+EFFA+G++QA
Sbjct  717  LKVPETKGMPLEVISEFFALGSKQA  741



>ref|XP_002877807.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54066.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=730

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  644  RTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNILCAE  465
            R+L+LSTIP+ I SLV LV+G+++ LG   +A++ST  V +Y   FVMG+G IPNILC+E
Sbjct  579  RSLMLSTIPILILSLVTLVIGSLVKLGGTTNALISTASVTVYLSCFVMGFGAIPNILCSE  638

Query  464  IFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVFLRV  285
            IFPT VRG CI ICAL FWICD+IVTY+LPVML S+G+AGVFGIYA+VC ++W+FV+LRV
Sbjct  639  IFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSIGIAGVFGIYAIVCAVAWVFVYLRV  698

Query  284  PETKGMPLEVITEFFAVGARQAE  216
            PETKGMPLEVI+EFF+VGA+Q +
Sbjct  699  PETKGMPLEVISEFFSVGAKQQD  721



>emb|CDY16303.1| BnaC01g23380D [Brassica napus]
Length=670

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = -2

Query  644  RTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNILCAE  465
            R+L+LSTIP+ I SL+ LV+G+++ L   A+A++ST  V++Y   FVMG+G IPNILC+E
Sbjct  518  RSLMLSTIPILILSLITLVIGSLVKLEGTANALISTASVMVYLSCFVMGFGAIPNILCSE  577

Query  464  IFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVFLRV  285
            IFPT VRG CI ICAL FWICD+IVTY+LPVML S+GLAGVFGIYA VC ++W+FV+L+V
Sbjct  578  IFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSLGLAGVFGIYAFVCAVAWVFVYLKV  637

Query  284  PETKGMPLEVITEFFAVGARQAEMA  210
            PETKGMPLEVI+EFF+VGA+  + +
Sbjct  638  PETKGMPLEVISEFFSVGAKHQDAS  662



>ref|XP_004977696.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=198

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 118/136 (87%), Gaps = 0/136 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL+TIP+ I +LVVLV+ N++++G+  HA LSTI +ILYFC FVMG+GPIPNIL
Sbjct  62   SGRRFLLLATIPILIVALVVLVMVNIVDVGTTVHAALSTISLILYFCFFVMGFGPIPNIL  121

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPT VRG CIAICA   WI D+IVTY+LPVML+S+GLAGVFGIYAV C+I+ +FV+
Sbjct  122  CAEIFPTTVRGICIAICAFTSWIGDIIVTYTLPVMLNSIGLAGVFGIYAVFCIIALVFVY  181

Query  293  LRVPETKGMPLEVITE  246
            ++VPETKGMPLEV+ +
Sbjct  182  MKVPETKGMPLEVLVK  197



>ref|XP_002300629.1| hypothetical protein POPTR_0002s00760g [Populus trichocarpa]
 gb|EEE79902.1| hypothetical protein POPTR_0002s00760g [Populus trichocarpa]
Length=738

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLL+TIPV I SLVVL++  ++ + ++  A + T CVI++ C FV  YGPIPNIL
Sbjct  589  SGRRTLLLTTIPVLILSLVVLIIFELVTVSAIVSAAILTACVIIFICCFVSAYGPIPNIL  648

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICA+V+WI D+IVTY+LPVML+S+GL G+F IYA VCVISWIFVF
Sbjct  649  CSEIFPTRVRGLCIAICAMVYWIGDIIVTYTLPVMLTSIGLVGIFSIYAAVCVISWIFVF  708

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            L+VPETKGMPLEVITEFFAVGARQA  AKN
Sbjct  709  LKVPETKGMPLEVITEFFAVGARQAAAAKN  738



>ref|XP_010028861.1| PREDICTED: LOW QUALITY PROTEIN: monosaccharide-sensing protein 
2 [Eucalyptus grandis]
Length=730

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 124/151 (82%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLL TIP+ I SL+++VL NV++ GS  HAV+ TI V+LY C FVMG+GP PN+L
Sbjct  580  SGRRSLLLGTIPMLIVSLIIMVLSNVVDAGSAIHAVICTIGVVLYICFFVMGFGPAPNVL  639

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG C+AIC L FW+ +VIVTYSLP+ML S GLA +FG++ VVC++SW FVF
Sbjct  640  CAEIFPTRVRGVCVAICGLAFWMGNVIVTYSLPLMLRSAGLASIFGMFTVVCLLSWAFVF  699

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKGMPLEVITEFF +G +Q    K+E
Sbjct  700  LKVPETKGMPLEVITEFFCLGMKQTFAVKDE  730



>emb|CDY33276.1| BnaA01g19430D [Brassica napus]
Length=668

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = -2

Query  644  RTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNILCAE  465
            R+L+LSTIP+ I SL+ LV+G+++ LG  A+A++ST  V++Y   FVMG+G IPNILC+E
Sbjct  516  RSLMLSTIPILILSLITLVIGSLVKLGGTANALISTASVMVYLSCFVMGFGAIPNILCSE  575

Query  464  IFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVFLRV  285
            IFPT VRG CI ICAL FWICD+IVTY+LPVML S+GLAGVFGIYA VC ++W+FV+L+V
Sbjct  576  IFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSLGLAGVFGIYAFVCAVAWVFVYLKV  635

Query  284  PETKGMPLEVITEFFAVGARQAEMA  210
            PETKGMPLEVI+EFF+VGA+  + +
Sbjct  636  PETKGMPLEVISEFFSVGAKHQDAS  660



>ref|NP_190717.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
 sp|Q9SD00.1|MSSP3_ARATH RecName: Full=Monosaccharide-sensing protein 3; AltName: Full=Sugar 
transporter MSSP3 [Arabidopsis thaliana]
 emb|CAB63013.1| sugar transporter-like protein [Arabidopsis thaliana]
 emb|CAD58693.1| monosaccharide sensing protein 3 [Arabidopsis thaliana]
 gb|AEE78798.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
Length=729

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = -2

Query  644  RTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNILCAE  465
            R+L+LSTIP+ I SLV LV+G+++NLG   +A++ST  V +Y   FVMG+G IPNILC+E
Sbjct  578  RSLMLSTIPILILSLVTLVIGSLVNLGGSINALISTASVTVYLSCFVMGFGAIPNILCSE  637

Query  464  IFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVFLRV  285
            IFPT VRG CI ICAL FWICD+IVTY+LPVML S+G+AGVFGIYA+VC ++W+FV+L+V
Sbjct  638  IFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSIGIAGVFGIYAIVCAVAWVFVYLKV  697

Query  284  PETKGMPLEVITEFFAVGARQAEMA  210
            PETKGMPLEVI+EFF+VGA+Q + A
Sbjct  698  PETKGMPLEVISEFFSVGAKQQDAA  722



>ref|XP_006662557.1| PREDICTED: monosaccharide-sensing protein 2-like [Oryza brachyantha]
Length=717

 Score =   189 bits (480),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL+TIP+ I +L +L+L NV+ +G++ HA LST+ VILYFC FVMG+GPIPNI 
Sbjct  566  SGRRFLLLATIPILIVALAILILVNVVEVGTMVHASLSTVSVILYFCFFVMGFGPIPNIF  625

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPT VRG CIAIC++ FWI D+IVTY+LPVML+S+GLAGVFGIYAVVC+++ +FV+
Sbjct  626  CAEIFPTTVRGICIAICSMTFWIGDIIVTYTLPVMLNSIGLAGVFGIYAVVCILALLFVY  685

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
             +VPETKGMPLEVITE F++G +     ++
Sbjct  686  TKVPETKGMPLEVITEVFSLGTQPKHDKED  715



>ref|XP_007203009.1| hypothetical protein PRUPE_ppa017631mg [Prunus persica]
 gb|EMJ04208.1| hypothetical protein PRUPE_ppa017631mg [Prunus persica]
Length=738

 Score =   189 bits (479),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR LLLSTIP+ I SL +LV  N++NLGS+ +A +ST  V++Y C FVM +G IPNIL
Sbjct  589  AGRRPLLLSTIPILILSLALLVFVNIVNLGSILNATISTASVVVYLCCFVMAFGVIPNIL  648

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTR+RG CIAICAL FWI D+++TYS PVMLSS+G AGVFGIY   C+I+W FV+
Sbjct  649  CAEIFPTRIRGLCIAICALTFWIGDIVITYSFPVMLSSIGFAGVFGIYVAGCIIAWFFVY  708

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            L+VPETKGMPLEVI++FFA G +QA  A N
Sbjct  709  LKVPETKGMPLEVISDFFAAGVKQAADASN  738



>ref|NP_001067890.1| Os11g0475600 [Oryza sativa Japonica Group]
 gb|ABA93553.1| hexose transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28253.1| Os11g0475600 [Oryza sativa Japonica Group]
 gb|EAZ18344.1| hypothetical protein OsJ_33873 [Oryza sativa Japonica Group]
 dbj|BAH00841.1| unnamed protein product [Oryza sativa Japonica Group]
Length=757

 Score =   189 bits (479),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL T+PV + SL VLV+ NV+ + + AHA LST  VI+YFC FVMG+GPIPNIL
Sbjct  605  SGRRALLLWTLPVLVASLAVLVVANVVPMAATAHAALSTGSVIVYFCCFVMGFGPIPNIL  664

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAIC+L FW+ D+ VTYSLPVMLSS+GLAGVF  YA VC ++ +FV 
Sbjct  665  CAEIFPTRVRGLCIAICSLTFWLGDIAVTYSLPVMLSSVGLAGVFSFYAAVCCVALVFVA  724

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKG+PLEVI EFF VGA+   +   E
Sbjct  725  LKVPETKGLPLEVIIEFFNVGAKAGTLPDEE  755



>gb|EAY80902.1| hypothetical protein OsI_36080 [Oryza sativa Indica Group]
Length=763

 Score =   189 bits (479),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR LLL T+PV + SL VLV+ NV+ + + AHA LST  VI+YFC FVMG+GPIPNIL
Sbjct  611  SGRRALLLWTLPVLVASLAVLVVANVVPMAATAHAALSTGSVIVYFCCFVMGFGPIPNIL  670

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAIC+L FW+ D+ VTYSLPVMLSS+GLAGVF  YA VC ++ +FV 
Sbjct  671  CAEIFPTRVRGLCIAICSLTFWLGDIAVTYSLPVMLSSVGLAGVFSFYAAVCCVALVFVA  730

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            L+VPETKG+PLEVI EFF VGA+   +   E
Sbjct  731  LKVPETKGLPLEVIIEFFNVGAKAGTLPDEE  761



>ref|XP_008242155.1| PREDICTED: monosaccharide-sensing protein 2-like [Prunus mume]
Length=738

 Score =   188 bits (478),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLLSTIP+ I SL +LV  N++NLGS+ +A +ST  V++Y C FVM +G IPNIL
Sbjct  589  AGRRSLLLSTIPILILSLALLVFVNIVNLGSILNAAISTDSVVVYLCCFVMAFGVIPNIL  648

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVR  CIAICAL FWI D+I+TYS PVMLSS+G AGVFGIY   C+I+W FV+
Sbjct  649  CAEIFPTRVRSLCIAICALTFWIGDIIITYSFPVMLSSIGFAGVFGIYVAGCIIAWFFVY  708

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            L+VPETKGMPLEVI++FFA G +QA  A N
Sbjct  709  LKVPETKGMPLEVISDFFAAGVKQAADASN  738



>ref|XP_011034826.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011034827.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011034828.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011034829.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=738

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRRTLLL+TIPV I SL+VL++  ++ + ++  A + T CVI++ C FV  YGPIPNIL
Sbjct  589  SGRRTLLLTTIPVLILSLIVLIIFELVTVSAMVSAAILTACVIIFICCFVSAYGPIPNIL  648

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICA+V+WI D+IVTY+LPVML+S+GL G+FGIYA VC+ISWIFVF
Sbjct  649  CSEIFPTRVRGLCIAICAMVYWIGDIIVTYTLPVMLTSIGLVGIFGIYAAVCIISWIFVF  708

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            L+VPETKGMPLEVITEFFAVGARQA  AKN
Sbjct  709  LKVPETKGMPLEVITEFFAVGARQAAAAKN  738



>ref|XP_011041174.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=740

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRRTLLL+TIPV I SL+VL++  ++ + SV +A + T CVI++ C FV  YGPIPNIL
Sbjct  589  AGRRTLLLTTIPVLILSLIVLIIFELVTVSSVVNAAILTACVIIFICCFVSAYGPIPNIL  648

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAICA+V+WI D+IVTY+LPVMLSS+GL G+FGIYAVVC ISWIFVF
Sbjct  649  CSEIFPTRVRGLCIAICAMVYWIGDIIVTYTLPVMLSSIGLVGIFGIYAVVCAISWIFVF  708

Query  293  LRVPETKGMPLEVITEFF  240
            L+VPETKGMPLEVITEFF
Sbjct  709  LKVPETKGMPLEVITEFF  726



>ref|XP_003560303.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=770

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLL TIPV I +L+VL++ NV+ + +  HA LST  VI+YFC FVMG+GPIPNIL
Sbjct  621  SGRRSLLLWTIPVLICALLVLIVANVVPMATTLHAALSTGSVIVYFCCFVMGFGPIPNIL  680

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAIC+L FWI D++VTYSLPVMLSS+GLAGVFG YA VC ++ +FV 
Sbjct  681  CAEIFPTRVRGLCIAICSLTFWIGDIVVTYSLPVMLSSVGLAGVFGFYAFVCCLALVFVA  740

Query  293  LRVPETKGMPLEVITEFFAVGAR  225
            L+VPETKG+PLEVI EFF VGA+
Sbjct  741  LKVPETKGLPLEVIIEFFNVGAK  763



>ref|XP_002439068.1| hypothetical protein SORBIDRAFT_10g031000 [Sorghum bicolor]
 gb|EER90435.1| hypothetical protein SORBIDRAFT_10g031000 [Sorghum bicolor]
Length=767

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLL TIPV + SLVVL++ N++ + +  HAVLST  VI+YFC FVMG+GPIPNIL
Sbjct  612  AGRRSLLLWTIPVLVASLVVLIVANLVPMATTVHAVLSTASVIVYFCCFVMGFGPIPNIL  671

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAIC+L FW+ D+ VTYSLPVML ++GLAGVFG YA VC ++ IFV+
Sbjct  672  CAEIFPTRVRGLCIAICSLTFWLGDIAVTYSLPVMLKAIGLAGVFGFYAFVCCLALIFVY  731

Query  293  LRVPETKGMPLEVITEFFAVGAR  225
            L+VPETKG PLEVI EFF +GA+
Sbjct  732  LKVPETKGFPLEVIIEFFNIGAK  754



>dbj|BAK02857.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=729

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLL TIPV I SLV LV  +V+ L +  HA +ST  VI+Y C+FVMG+GPIP IL
Sbjct  578  AGRRSLLLWTIPVLIVSLVSLVTADVLPLAATVHAAVSTTSVIVYICTFVMGFGPIPGIL  637

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAIC+L FW+ D+ VTYS+PVML S+GLAGVF IYA VC ++  FV 
Sbjct  638  CSEIFPTRVRGMCIAICSLAFWLSDIAVTYSMPVMLDSLGLAGVFSIYAAVCCVALAFVA  697

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            LRVPETKG+PLEVI EFF VGA+      +E
Sbjct  698  LRVPETKGLPLEVIAEFFNVGAKGMPKLDHE  728



>gb|KJB12351.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
 gb|KJB12353.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
Length=734

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLL+T+P+ I SL+VLV+G ++ +G+V +A LSTI V+L F  FVMG+GPIPNIL
Sbjct  589  AGRRSLLLTTVPLLIISLLVLVIGTIVKMGNVTNAALSTISVVLCFFFFVMGFGPIPNIL  648

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C EIFPTRVRG CIA+C L+ WIC++IVTYSLPV+L S+GLAG+FG+YAVVC ISW+FVF
Sbjct  649  CTEIFPTRVRGICIAVCFLISWICNIIVTYSLPVLLKSIGLAGLFGMYAVVCAISWVFVF  708

Query  293  LRVPETKGMPLEVITEFFAVGARQ  222
            L+VPETKGMPLEVI + F+VGA++
Sbjct  709  LKVPETKGMPLEVIMDVFSVGAKR  732



>gb|KJB12354.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
Length=758

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLL+T+P+ I SL+VLV+G ++ +G+V +A LSTI V+L F  FVMG+GPIPNIL
Sbjct  613  AGRRSLLLTTVPLLIISLLVLVIGTIVKMGNVTNAALSTISVVLCFFFFVMGFGPIPNIL  672

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C EIFPTRVRG CIA+C L+ WIC++IVTYSLPV+L S+GLAG+FG+YAVVC ISW+FVF
Sbjct  673  CTEIFPTRVRGICIAVCFLISWICNIIVTYSLPVLLKSIGLAGLFGMYAVVCAISWVFVF  732

Query  293  LRVPETKGMPLEVITEFFAVGARQ  222
            L+VPETKGMPLEVI + F+VGA++
Sbjct  733  LKVPETKGMPLEVIMDVFSVGAKR  756



>ref|XP_004289030.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
Length=714

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLLST+P+ I +L +LVL +++NLG+   A +ST  V++Y C FVMG+G IPNIL
Sbjct  567  AGRRSLLLSTLPILIVALALLVLSSIVNLGTTLTATISTASVVIYLCCFVMGFGVIPNIL  626

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPT VRG CIAICAL +WI D+I+TYS PVMLSS+G AGVFG+Y + C+ISWIFV+
Sbjct  627  CAEIFPTPVRGLCIAICALTYWIGDIIITYSFPVMLSSIGFAGVFGVYVLGCIISWIFVY  686

Query  293  LRVPETKGMPLEVITEFFAVGARQA  219
            L+VPETKGMPLEVI+EFFA G + A
Sbjct  687  LKVPETKGMPLEVISEFFAAGVKPA  711



>ref|XP_009359632.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLLST+P+ I SL +LVL N++NLG+V +A +ST  V++Y C FVM +G IPNIL
Sbjct  581  AGRRSLLLSTLPILILSLTLLVLVNIVNLGTVVNATISTASVVVYLCCFVMAFGVIPNIL  640

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAICAL  WI D+I+TYS PV+LSS+G AGVFGIY V C++SW+FV+
Sbjct  641  CAEIFPTRVRGLCIAICALALWIGDIIITYSFPVLLSSVGFAGVFGIYVVGCIVSWVFVY  700

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE*MNER  186
            L+VPETKGMPLEVI+EFFA G + A    +   N++
Sbjct  701  LKVPETKGMPLEVISEFFAAGVKPATADTSADSNDK  736



>gb|EYU40481.1| hypothetical protein MIMGU_mgv1a001997mg [Erythranthe guttata]
Length=728

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = -2

Query  653  SGRRTLLLSTIPV-XIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNI  477
            SGRR+LLL+T PV  +  +++++   +    ++  A +ST+ VI Y C F MG+GPIPNI
Sbjct  577  SGRRSLLLNTNPVLTVSLVILVMTRYIEVGSNIGKAAVSTVSVITYSCFFAMGFGPIPNI  636

Query  476  LCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFV  297
            LCAEIFPTRVRG CI IC + FWIC++++TYSLP+MLS +GL GVF I+AV  ++SW FV
Sbjct  637  LCAEIFPTRVRGVCIGICGITFWICNIMITYSLPMMLSWIGLGGVFSIFAVASLVSWGFV  696

Query  296  FLRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            +L+VPETKGMPLEVITEFF++GA+ A    N
Sbjct  697  YLKVPETKGMPLEVITEFFSLGAKPAAAPPN  727



>gb|EMS60524.1| Monosaccharide-sensing protein 3 [Triticum urartu]
Length=407

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLL TIPV I SLV LV  +V+ L +  HA +ST  +I+Y C+FVMG+GPIP IL
Sbjct  256  AGRRSLLLWTIPVLIVSLVSLVTADVLPLATTMHAAVSTTSIIVYICTFVMGFGPIPGIL  315

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAIC+L FW+ ++ VTYS+PVML  +GL GVF IYA VC ++ +FV 
Sbjct  316  CSEIFPTRVRGMCIAICSLAFWLSNIAVTYSMPVMLDYLGLTGVFSIYAAVCCVALVFVA  375

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKNE  201
            LRVPETKG+PLEVI EFF V ++      ++
Sbjct  376  LRVPETKGLPLEVIAEFFNVASKGMPKLDHD  406



>gb|KJB31963.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31964.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31965.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31966.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31967.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
Length=737

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR LLL T+P+    L +LV+G+ + +GSV  + +ST+ V+L  C +VMG+GPIP+IL
Sbjct  582  AGRRRLLLITVPLLALCLFILVIGSFVKMGSVVRSAISTVSVVLSCCVYVMGFGPIPSIL  641

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAI +LV+WI ++IV YSLPV+L ++GLAGVFG++  VC+ S++FVF
Sbjct  642  CAEIFPTRVRGTCIAIVSLVYWISNIIVAYSLPVLLKTIGLAGVFGMFGTVCLASFVFVF  701

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            L+VPETKGMPLEVITEFF+VG++QA  AKN
Sbjct  702  LKVPETKGMPLEVITEFFSVGSKQAITAKN  731



>ref|XP_006649210.1| PREDICTED: monosaccharide-sensing protein 2-like [Oryza brachyantha]
Length=668

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLL TIPV I SL  LV+ +V  + + AHA L T  V++Y C FVMG+GPIPNIL
Sbjct  512  SGRRSLLLWTIPVLIASLAALVVASVAPMAAAAHAALCTGSVVVYLCCFVMGFGPIPNIL  571

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAIC+L FW+ D+ VTYSLPVMLSS+GLAGVF IYA VC ++  FV 
Sbjct  572  CAEIFPTRVRGLCIAICSLAFWLADIAVTYSLPVMLSSLGLAGVFAIYAAVCCVALAFVA  631

Query  293  LRVPETKGMPLEVITEFFAVGAR  225
            LRVPETKG+PLEVI +FF VGA+
Sbjct  632  LRVPETKGLPLEVIIDFFNVGAK  654



>gb|EMT02609.1| Monosaccharide-sensing protein 3 [Aegilops tauschii]
Length=760

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR +LL TIP+ + SL+VLV  N++NL +  HA+LST+ V +YFC FVMG+GPIPNI 
Sbjct  553  SGRRRILLVTIPILVVSLIVLVTVNIVNLSAELHALLSTMSVGIYFCIFVMGFGPIPNIF  612

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFP +VR  C+AIC+L+FWICD+IVTY+LPV+L  +GLAGVFG+YA+VCV++++FV 
Sbjct  613  CSEIFPNKVRAICLAICSLIFWICDIIVTYTLPVLLRYIGLAGVFGVYAIVCVLAFVFVC  672

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAK  207
            L+VPETK +P+EVI EF+A+G      AK
Sbjct  673  LKVPETKNIPIEVIAEFYALGGSDYVKAK  701



>ref|XP_011022133.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011022134.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=719

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR++LL TIP+ + +LV  VLG+++N+ S   AV+ST  V++Y   FVMG+G IPNIL
Sbjct  575  SGRRSILLYTIPILVATLVAFVLGSIVNMDSSLKAVISTGSVMMYLSCFVMGFGVIPNIL  634

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CI IC+L +WI ++ +TYSLPVML+  GL+GVF IYA+ C +SWIFVF
Sbjct  635  CAEIFPTRVRGICITICSLTYWIGNITITYSLPVMLNFFGLSGVFTIYAIGCAVSWIFVF  694

Query  293  LRVPETKGMPLEVITEFFAVGARQ  222
            L+VPETKGMPLEVITEFFAVG++ 
Sbjct  695  LKVPETKGMPLEVITEFFAVGSKN  718



>ref|XP_002306419.1| hypothetical protein POPTR_0005s10180g [Populus trichocarpa]
 gb|EEE93415.1| hypothetical protein POPTR_0005s10180g [Populus trichocarpa]
Length=719

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR++LL TIP+ + SLV  VLG+++N+ S   AV+ST  V++Y   FVMG+G IPNIL
Sbjct  575  SGRRSILLYTIPILVASLVAFVLGSIVNMDSSLKAVISTGSVMIYLSCFVMGFGVIPNIL  634

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CI IC+L +WI ++ +TYSLPVML+  GL+GVF IYA+ C +SWIFVF
Sbjct  635  CAEIFPTRVRGICITICSLTYWIGNITITYSLPVMLNFFGLSGVFTIYAIGCAVSWIFVF  694

Query  293  LRVPETKGMPLEVITEFFAVGARQ  222
            L+VPETKGMPLEVITEFFAVG++ 
Sbjct  695  LKVPETKGMPLEVITEFFAVGSKN  718



>ref|XP_010097645.1| Monosaccharide-sensing protein 3 [Morus notabilis]
 gb|EXB70345.1| Monosaccharide-sensing protein 3 [Morus notabilis]
Length=737

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLLSTIP+ I SL +LVLG+++N GS  +A++ST  VI+Y C FVM +G IPNIL
Sbjct  595  SGRRSLLLSTIPILIVSLFLLVLGSIVNFGSTMNALISTSSVIVYECCFVMAFGVIPNIL  654

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG+CIA+C+L +WI ++++TYS P M   +GLAGV GIYA+ C++SWIFVF
Sbjct  655  CAEIFPTRVRGRCIALCSLTYWIGNILITYSFPTMFKLIGLAGVIGIYAIGCIVSWIFVF  714

Query  293  LRVPETKGMPLEVITEFFAVGAR  225
            L+VPETKGMPLEVI+EFFA+  +
Sbjct  715  LKVPETKGMPLEVISEFFALETK  737



>gb|EMS63099.1| Monosaccharide-sensing protein 3 [Triticum urartu]
Length=714

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 127/159 (80%), Gaps = 1/159 (1%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR +LL TIP+ + SL+VLV  N++NL +  HA+LST+ V +YFC FVMG+GPIPNI 
Sbjct  554  SGRRRILLVTIPILVVSLIVLVTVNIVNLSAELHALLSTMSVGIYFCIFVMGFGPIPNIF  613

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFP +VR  C+AIC+L+FWICD+IVTY+LPV+L  +GLAGVFG+YA+VCV++++FV 
Sbjct  614  CSEIFPNKVRAICLAICSLIFWICDIIVTYTLPVLLRYIGLAGVFGVYAIVCVLAFVFVC  673

Query  293  LRVPETKGMPLEVITEFFAVGARQAE-MAKNE*MNERKL  180
            L+VPETK +P+EVI EF+A+G    + + + +  N  KL
Sbjct  674  LKVPETKNIPIEVIAEFYALGGSGTQIIQERQKENSEKL  712



>gb|KHG14026.1| Monosaccharide-sensing 2 -like protein [Gossypium arboreum]
Length=737

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR LLL T+P+    L +LV+G+++ +GSV  + +ST+ V+L  C + MG+GPIP+IL
Sbjct  582  AGRRRLLLITVPLLALCLFILVIGSIVKMGSVVRSAISTVSVVLSCCVYAMGFGPIPSIL  641

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAI +LV+WI ++IV YSLPV+L ++GLAGVFG++  VC+ S++FVF
Sbjct  642  CAEIFPTRVRGTCIAIVSLVYWISNIIVAYSLPVLLKTVGLAGVFGMFGTVCLASFVFVF  701

Query  293  LRVPETKGMPLEVITEFFAVGARQAEMAKN  204
            L+VPETKGMPLEVITEFF+VG++QA  AKN
Sbjct  702  LKVPETKGMPLEVITEFFSVGSKQAITAKN  731



>gb|EMT01868.1| Monosaccharide-sensing protein 2 [Aegilops tauschii]
Length=532

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            +GRR+LLL TIPV I SLV LV  +V+ L +  HA +ST  +I+Y C+FVMG+GPIP IL
Sbjct  381  AGRRSLLLWTIPVLIVSLVSLVTADVLPLATTLHAAVSTTSIIIYICTFVMGFGPIPGIL  440

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            C+EIFPTRVRG CIAIC+L FW+ ++ VTYS+PVML  +GL GVF IYA VC ++  FV 
Sbjct  441  CSEIFPTRVRGMCIAICSLAFWLSNIAVTYSMPVMLDYLGLTGVFSIYAAVCCVALAFVA  500

Query  293  LRVPETKGMPLEVITEFFAVGAR  225
            LRVPETKG+PLEVI EFF V ++
Sbjct  501  LRVPETKGLPLEVIAEFFNVASK  523



>ref|XP_004954530.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=707

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLL TIPV I SLVVLV+ +V+ + +  HA ++T  V+ Y C FVMG+GPIPNIL
Sbjct  541  SGRRSLLLWTIPVLIVSLVVLVVASVVPMAAAVHAAVATGSVMTYLCCFVMGFGPIPNIL  600

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAIC+L FW+ D+ VTYSLPVML+ +GLAGVFG YAVVC ++  FV 
Sbjct  601  CAEIFPTRVRGLCIAICSLAFWLADIAVTYSLPVMLNCVGLAGVFGFYAVVCCLALAFVA  660

Query  293  LRVPETKGMPLEVITEFFAVGAR  225
            LRVPETKG+PLEVITEFF VGAR
Sbjct  661  LRVPETKGLPLEVITEFFNVGAR  683



>gb|EAY88138.1| hypothetical protein OsI_09573 [Oryza sativa Indica Group]
Length=643

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = -2

Query  653  SGRRTLLLSTIPVXIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNIL  474
            SGRR+LLL TIP+ + SL VLV  +V  + + AHA + T  V++Y C FVMG+GPIPNIL
Sbjct  488  SGRRSLLLWTIPLLVASLAVLVAASVAPMAAAAHAAVCTGSVVVYLCCFVMGFGPIPNIL  547

Query  473  CAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVF  294
            CAEIFPTRVRG CIAIC+L FW+ D+ VTY+LPVML+S+GLAG+F IYA VC ++ +FV 
Sbjct  548  CAEIFPTRVRGLCIAICSLAFWLADIAVTYTLPVMLASLGLAGLFAIYAAVCCVALVFVA  607

Query  293  LRVPETKGMPLEVITEFFAVGAR  225
            LRVPETKG+PLEVI +FF VGA+
Sbjct  608  LRVPETKGLPLEVIIDFFNVGAK  630



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1050626367960