BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF012P12

Length=796
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009764318.1|  PREDICTED: BTB/POZ domain-containing protein...    266   8e-81   Nicotiana sylvestris
ref|XP_009625190.1|  PREDICTED: BTB/POZ domain-containing protein...    265   2e-80   Nicotiana tomentosiformis
ref|XP_011088062.1|  PREDICTED: BTB/POZ domain-containing protein...    260   2e-78   Sesamum indicum [beniseed]
ref|XP_006346315.1|  PREDICTED: BTB/POZ domain-containing protein...    257   3e-77   Solanum tuberosum [potatoes]
emb|CDO97269.1|  unnamed protein product                                253   1e-75   Coffea canephora [robusta coffee]
ref|XP_004230705.1|  PREDICTED: BTB/POZ domain-containing protein...    253   1e-75   
ref|XP_002264153.1|  PREDICTED: BTB/POZ domain-containing protein...    244   4e-72   Vitis vinifera
emb|CAN66911.1|  hypothetical protein VITISV_035422                     241   3e-71   Vitis vinifera
ref|XP_010099608.1|  BTB/POZ domain-containing protein NPY2             239   2e-70   Morus notabilis
gb|KJB79441.1|  hypothetical protein B456_013G050000                    238   5e-70   Gossypium raimondii
gb|KHG02234.1|  BTB/POZ domain-containing NPY2 -like protein            238   6e-70   Gossypium arboreum [tree cotton]
gb|EYU37575.1|  hypothetical protein MIMGU_mgv1a002858mg                236   5e-69   Erythranthe guttata [common monkey flower]
ref|XP_007042621.1|  Phototropic-responsive NPH3 family protein i...    235   7e-69   
ref|XP_007042620.1|  Phototropic-responsive NPH3 family protein i...    235   1e-68   
ref|XP_008236444.1|  PREDICTED: BTB/POZ domain-containing protein...    231   2e-67   Prunus mume [ume]
emb|CBI22467.3|  unnamed protein product                                229   2e-67   Vitis vinifera
ref|XP_009335385.1|  PREDICTED: BTB/POZ domain-containing protein...    230   5e-67   Pyrus x bretschneideri [bai li]
ref|XP_009347119.1|  PREDICTED: BTB/POZ domain-containing protein...    229   9e-67   Pyrus x bretschneideri [bai li]
ref|XP_007201732.1|  hypothetical protein PRUPE_ppa002913mg             229   1e-66   Prunus persica
ref|XP_008346361.1|  PREDICTED: BTB/POZ domain-containing protein...    229   1e-66   
ref|XP_008366255.1|  PREDICTED: BTB/POZ domain-containing protein...    228   2e-66   
ref|XP_004289798.1|  PREDICTED: BTB/POZ domain-containing protein...    223   2e-64   Fragaria vesca subsp. vesca
ref|XP_009626485.1|  PREDICTED: BTB/POZ domain-containing protein...    221   9e-64   Nicotiana tomentosiformis
ref|XP_009776135.1|  PREDICTED: BTB/POZ domain-containing protein...    221   1e-63   Nicotiana sylvestris
ref|XP_011092512.1|  PREDICTED: BTB/POZ domain-containing protein...    219   8e-63   Sesamum indicum [beniseed]
ref|XP_011092513.1|  PREDICTED: BTB/POZ domain-containing protein...    219   9e-63   Sesamum indicum [beniseed]
gb|KHF97345.1|  BTB/POZ domain-containing NPY5 -like protein            216   4e-62   Gossypium arboreum [tree cotton]
gb|KJB32266.1|  hypothetical protein B456_005G232400                    216   1e-61   Gossypium raimondii
ref|XP_002300262.2|  hypothetical protein POPTR_0001s30270g             215   1e-61   
ref|XP_006486926.1|  PREDICTED: BTB/POZ domain-containing protein...    215   2e-61   Citrus sinensis [apfelsine]
gb|KDO57872.1|  hypothetical protein CISIN_1g007080mg                   215   2e-61   Citrus sinensis [apfelsine]
ref|XP_006422840.1|  hypothetical protein CICLE_v10028033mg             215   3e-61   Citrus clementina [clementine]
ref|XP_011030353.1|  PREDICTED: BTB/POZ domain-containing protein...    214   5e-61   Populus euphratica
gb|KJB32267.1|  hypothetical protein B456_005G232400                    215   5e-61   Gossypium raimondii
ref|XP_004248766.1|  PREDICTED: BTB/POZ domain-containing protein...    211   5e-60   Solanum lycopersicum
ref|XP_010065907.1|  PREDICTED: BTB/POZ domain-containing protein...    211   5e-60   
ref|XP_002284345.1|  PREDICTED: BTB/POZ domain-containing protein...    211   9e-60   Vitis vinifera
gb|EPS65621.1|  hypothetical protein M569_09155                         210   1e-59   Genlisea aurea
ref|XP_004156852.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    210   2e-59   
ref|XP_004152268.1|  PREDICTED: BTB/POZ domain-containing protein...    210   2e-59   Cucumis sativus [cucumbers]
ref|XP_007047503.1|  Phototropic-responsive NPH3 family protein i...    206   8e-59   
ref|XP_008454387.1|  PREDICTED: BTB/POZ domain-containing protein...    207   1e-58   Cucumis melo [Oriental melon]
ref|XP_007047500.1|  Phototropic-responsive NPH3 family protein i...    206   5e-58   
gb|KDP44480.1|  hypothetical protein JCGZ_16313                         204   2e-57   Jatropha curcas
ref|XP_004511848.1|  PREDICTED: BTB/POZ domain-containing protein...    204   3e-57   Cicer arietinum [garbanzo]
emb|CBI33702.3|  unnamed protein product                                202   8e-57   Vitis vinifera
ref|XP_011001843.1|  PREDICTED: BTB/POZ domain-containing protein...    202   1e-56   Populus euphratica
ref|XP_007143108.1|  hypothetical protein PHAVU_007G044300g             201   3e-56   Phaseolus vulgaris [French bean]
ref|XP_010272331.1|  PREDICTED: BTB/POZ domain-containing protein...    200   1e-55   
ref|XP_010086948.1|  BTB/POZ domain-containing protein NPY2             199   1e-55   Morus notabilis
gb|KHN42319.1|  BTB/POZ domain-containing protein NPY2                  199   2e-55   Glycine soja [wild soybean]
ref|XP_008238083.1|  PREDICTED: BTB/POZ domain-containing protein...    199   2e-55   Prunus mume [ume]
ref|XP_007204979.1|  hypothetical protein PRUPE_ppa002844mg             199   2e-55   Prunus persica
ref|XP_002313906.1|  phototropic-responsive NPH3 family protein         198   4e-55   
ref|XP_003536583.1|  PREDICTED: BTB/POZ domain-containing protein...    198   4e-55   Glycine max [soybeans]
ref|XP_003555987.1|  PREDICTED: BTB/POZ domain-containing protein...    198   4e-55   Glycine max [soybeans]
ref|XP_006353967.1|  PREDICTED: BTB/POZ domain-containing protein...    196   3e-54   Solanum tuberosum [potatoes]
ref|XP_002527501.1|  signal transducer, putative                        196   3e-54   
gb|KJB43897.1|  hypothetical protein B456_007G222400                    195   3e-54   Gossypium raimondii
gb|KJB43895.1|  hypothetical protein B456_007G222400                    195   5e-54   Gossypium raimondii
gb|KJB43899.1|  hypothetical protein B456_007G222400                    195   6e-54   Gossypium raimondii
gb|KHG12565.1|  BTB/POZ domain-containing NPY2 -like protein            194   1e-53   Gossypium arboreum [tree cotton]
ref|XP_003611607.1|  BTB/POZ domain-containing protein                  194   1e-53   Medicago truncatula
ref|XP_002525260.1|  signal transducer, putative                        191   2e-53   
ref|XP_009629742.1|  PREDICTED: BTB/POZ domain-containing protein...    193   2e-53   Nicotiana tomentosiformis
gb|KDP32062.1|  hypothetical protein JCGZ_12523                         193   2e-53   Jatropha curcas
ref|XP_009629746.1|  PREDICTED: BTB/POZ domain-containing protein...    193   3e-53   
ref|XP_009776107.1|  PREDICTED: BTB/POZ domain-containing protein...    193   4e-53   Nicotiana sylvestris
ref|XP_010687361.1|  PREDICTED: BTB/POZ domain-containing protein...    193   4e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009776109.1|  PREDICTED: BTB/POZ domain-containing protein...    192   5e-53   Nicotiana sylvestris
ref|XP_010687360.1|  PREDICTED: BTB/POZ domain-containing protein...    192   6e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010687359.1|  PREDICTED: BTB/POZ domain-containing protein...    192   1e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010277066.1|  PREDICTED: BTB/POZ domain-containing protein...    192   1e-52   Nelumbo nucifera [Indian lotus]
gb|KDO78947.1|  hypothetical protein CISIN_1g041399mg                   189   8e-52   Citrus sinensis [apfelsine]
ref|XP_006426078.1|  hypothetical protein CICLE_v10027450mg             189   9e-52   Citrus clementina [clementine]
ref|XP_006466475.1|  PREDICTED: BTB/POZ domain-containing protein...    189   9e-52   Citrus sinensis [apfelsine]
ref|XP_008440372.1|  PREDICTED: BTB/POZ domain-containing protein...    189   1e-51   
ref|XP_010316013.1|  PREDICTED: BTB/POZ domain-containing protein...    186   9e-51   Solanum lycopersicum
ref|XP_004231915.1|  PREDICTED: BTB/POZ domain-containing protein...    186   1e-50   Solanum lycopersicum
ref|XP_002306504.2|  hypothetical protein POPTR_0005s19010g             186   1e-50   
ref|XP_006339810.1|  PREDICTED: BTB/POZ domain-containing protein...    186   2e-50   
ref|XP_004141870.1|  PREDICTED: BTB/POZ domain-containing protein...    185   2e-50   Cucumis sativus [cucumbers]
gb|KJB18014.1|  hypothetical protein B456_003G029500                    184   4e-50   Gossypium raimondii
gb|KHN23238.1|  BTB/POZ domain-containing protein NPY2                  184   8e-50   Glycine soja [wild soybean]
ref|XP_003550011.1|  PREDICTED: BTB/POZ domain-containing protein...    184   9e-50   
ref|XP_011011590.1|  PREDICTED: BTB/POZ domain-containing protein...    182   3e-49   Populus euphratica
ref|XP_006339811.1|  PREDICTED: BTB/POZ domain-containing protein...    181   5e-49   
ref|XP_004496882.1|  PREDICTED: BTB/POZ domain-containing protein...    181   5e-49   
ref|XP_006339807.1|  PREDICTED: BTB/POZ domain-containing protein...    182   5e-49   
ref|XP_010679621.1|  PREDICTED: BTB/POZ domain-containing protein...    181   8e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009631542.1|  PREDICTED: BTB/POZ domain-containing protein...    180   1e-48   
ref|XP_004288238.1|  PREDICTED: BTB/POZ domain-containing protein...    180   2e-48   Fragaria vesca subsp. vesca
ref|XP_009631537.1|  PREDICTED: BTB/POZ domain-containing protein...    180   2e-48   Nicotiana tomentosiformis
gb|KHG04716.1|  BTB/POZ domain-containing NPY2 -like protein            179   2e-48   Gossypium arboreum [tree cotton]
ref|XP_010530706.1|  PREDICTED: BTB/POZ domain-containing protein...    180   3e-48   Tarenaya hassleriana [spider flower]
ref|XP_006579937.1|  PREDICTED: BTB/POZ domain-containing protein...    179   3e-48   Glycine max [soybeans]
ref|XP_009772494.1|  PREDICTED: BTB/POZ domain-containing protein...    179   4e-48   Nicotiana sylvestris
gb|KHN23237.1|  BTB/POZ domain-containing protein NPY2                  178   5e-48   Glycine soja [wild soybean]
ref|XP_006600919.1|  PREDICTED: BTB/POZ domain-containing protein...    178   7e-48   Glycine max [soybeans]
ref|XP_006600918.1|  PREDICTED: BTB/POZ domain-containing protein...    178   7e-48   Glycine max [soybeans]
ref|XP_003592479.1|  BTB/POZ domain-containing protein                  177   1e-47   Medicago truncatula
ref|XP_007155836.1|  hypothetical protein PHAVU_003G235700g             177   2e-47   Phaseolus vulgaris [French bean]
emb|CDP02592.1|  unnamed protein product                                177   2e-47   Coffea canephora [robusta coffee]
emb|CDY50369.1|  BnaA09g13180D                                          173   2e-46   Brassica napus [oilseed rape]
ref|XP_009123215.1|  PREDICTED: BTB/POZ domain-containing protein...    174   2e-46   Brassica rapa
emb|CDY37223.1|  BnaA09g08440D                                          174   2e-46   Brassica napus [oilseed rape]
emb|CDX81462.1|  BnaC09g08730D                                          172   1e-45   
ref|XP_008341028.1|  PREDICTED: BTB/POZ domain-containing protein...    169   2e-44   
ref|XP_010070650.1|  PREDICTED: BTB/POZ domain-containing protein...    168   2e-44   Eucalyptus grandis [rose gum]
ref|XP_006409633.1|  hypothetical protein EUTSA_v10023006mg             168   3e-44   Eutrema salsugineum [saltwater cress]
ref|NP_179089.1|  BTB/POZ domain-containing protein NPY2                167   8e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010467261.1|  PREDICTED: BTB/POZ domain-containing protein...    167   8e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010467259.1|  PREDICTED: BTB/POZ domain-containing protein...    167   9e-44   
ref|XP_006343206.1|  PREDICTED: BTB/POZ domain-containing protein...    167   1e-43   Solanum tuberosum [potatoes]
ref|XP_006579940.1|  PREDICTED: BTB/POZ domain-containing protein...    167   1e-43   Glycine max [soybeans]
ref|XP_009379321.1|  PREDICTED: BTB/POZ domain-containing protein...    167   1e-43   Pyrus x bretschneideri [bai li]
gb|ADL36611.1|  BZIP domain class transcription factor                  166   2e-43   Malus domestica [apple tree]
ref|XP_006297197.1|  hypothetical protein CARUB_v10013204mg             166   2e-43   Capsella rubella
gb|KHN06014.1|  BTB/POZ domain-containing protein NPY2                  166   2e-43   Glycine soja [wild soybean]
ref|XP_008352545.1|  PREDICTED: BTB/POZ domain-containing protein...    166   2e-43   
ref|XP_008338429.1|  PREDICTED: BTB/POZ domain-containing protein...    164   5e-43   
ref|XP_010488917.1|  PREDICTED: BTB/POZ domain-containing protein...    163   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_011073694.1|  PREDICTED: BTB/POZ domain-containing protein...    162   4e-42   Sesamum indicum [beniseed]
ref|XP_010517747.1|  PREDICTED: BTB/POZ domain-containing protein...    160   2e-41   
ref|XP_010317781.1|  PREDICTED: BTB/POZ domain-containing protein...    154   2e-39   
ref|XP_010317782.1|  PREDICTED: BTB/POZ domain-containing protein...    154   2e-39   
ref|XP_004234653.1|  PREDICTED: BTB/POZ domain-containing protein...    154   2e-39   Solanum lycopersicum
ref|XP_011099363.1|  PREDICTED: BTB/POZ domain-containing protein...    149   1e-37   
ref|XP_011099362.1|  PREDICTED: BTB/POZ domain-containing protein...    149   1e-37   Sesamum indicum [beniseed]
ref|XP_004982439.1|  PREDICTED: BTB/POZ domain-containing protein...    147   7e-37   Setaria italica
ref|XP_002464238.1|  hypothetical protein SORBIDRAFT_01g014760          145   3e-36   Sorghum bicolor [broomcorn]
ref|XP_006826702.1|  hypothetical protein AMTR_s00137p00096710          143   3e-35   
ref|XP_009388923.1|  PREDICTED: BTB/POZ domain-containing protein...    140   2e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010548457.1|  PREDICTED: BTB/POZ domain-containing protein...    137   3e-33   
ref|XP_010907394.1|  PREDICTED: BTB/POZ domain-containing protein...    137   3e-33   
ref|XP_009399110.1|  PREDICTED: BTB/POZ domain-containing protein...    137   3e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006650278.1|  PREDICTED: BTB/POZ domain-containing protein...    137   4e-33   Oryza brachyantha
ref|XP_010907392.1|  PREDICTED: BTB/POZ domain-containing protein...    136   5e-33   Elaeis guineensis
ref|XP_008777297.1|  PREDICTED: BTB/POZ domain-containing protein...    135   9e-33   Phoenix dactylifera
ref|XP_010526711.1|  PREDICTED: BTB/POZ domain-containing protein...    135   1e-32   Tarenaya hassleriana [spider flower]
ref|NP_001146578.1|  uncharacterized protein LOC100280174               135   2e-32   Zea mays [maize]
ref|XP_008787171.1|  PREDICTED: BTB/POZ domain-containing protein...    131   2e-31   
ref|XP_008792560.1|  PREDICTED: BTB/POZ domain-containing protein...    132   2e-31   Phoenix dactylifera
ref|XP_010942827.1|  PREDICTED: BTB/POZ domain-containing protein...    131   3e-31   Elaeis guineensis
ref|XP_010942829.1|  PREDICTED: BTB/POZ domain-containing protein...    131   4e-31   
ref|XP_008787168.1|  PREDICTED: BTB/POZ domain-containing protein...    131   4e-31   Phoenix dactylifera
ref|XP_010232704.1|  PREDICTED: BTB/POZ domain-containing protein...    131   4e-31   Brachypodium distachyon [annual false brome]
gb|EYU29635.1|  hypothetical protein MIMGU_mgv1a003178mg                130   5e-31   Erythranthe guttata [common monkey flower]
gb|AAK96859.1|  putative protein                                        124   1e-28   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF02155.1|  hypothetical protein                                   124   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568030.1|  protein NAKED PINS IN YUC MUTANTS 5                   124   1e-28   Arabidopsis thaliana [mouse-ear cress]
emb|CAB38298.1|  putative protein                                       123   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010939136.1|  PREDICTED: BTB/POZ domain-containing protein...    124   2e-28   Elaeis guineensis
ref|XP_010437207.1|  PREDICTED: BTB/POZ domain-containing protein...    123   2e-28   
ref|XP_010432046.1|  PREDICTED: BTB/POZ domain-containing protein...    123   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_006282580.1|  hypothetical protein CARUB_v10004449mg             122   5e-28   Capsella rubella
ref|XP_010446647.1|  PREDICTED: BTB/POZ domain-containing protein...    122   8e-28   Camelina sativa [gold-of-pleasure]
ref|XP_006411871.1|  hypothetical protein EUTSA_v10024767mg             119   4e-27   Eutrema salsugineum [saltwater cress]
emb|CDY22422.1|  BnaC03g61350D                                          119   4e-27   Brassica napus [oilseed rape]
ref|XP_010547549.1|  PREDICTED: BTB/POZ domain-containing protein...    119   7e-27   Tarenaya hassleriana [spider flower]
ref|XP_009109382.1|  PREDICTED: BTB/POZ domain-containing protein...    118   1e-26   Brassica rapa
emb|CDY44035.1|  BnaA08g15710D                                          118   2e-26   Brassica napus [oilseed rape]
emb|CDX72639.1|  BnaC07g46610D                                          116   6e-26   
gb|EAY90980.1|  hypothetical protein OsI_12589                          115   2e-25   Oryza sativa Indica Group [Indian rice]
ref|NP_001050649.1|  Os03g0609800                                       115   3e-25   
ref|NP_001278721.1|  putative phototropic-resoponsive NPH3 family...    112   2e-24   Zea mays [maize]
ref|XP_006664149.1|  PREDICTED: BTB/POZ domain-containing protein...    110   8e-24   Oryza brachyantha
ref|XP_009411058.1|  PREDICTED: BTB/POZ domain-containing protein...    110   1e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010232705.1|  PREDICTED: BTB/POZ domain-containing protein...    110   1e-23   
emb|CDY69095.1|  BnaAnng29310D                                          109   2e-23   Brassica napus [oilseed rape]
ref|XP_009103410.1|  PREDICTED: BTB/POZ domain-containing protein...    108   3e-23   Brassica rapa
ref|XP_007153783.1|  hypothetical protein PHAVU_003G064600g             108   4e-23   Phaseolus vulgaris [French bean]
emb|CDX81314.1|  BnaC09g07250D                                          107   4e-23   
gb|ACN31208.1|  unknown                                                 105   5e-23   Zea mays [maize]
ref|XP_004963018.1|  PREDICTED: BTB/POZ domain-containing protein...    107   8e-23   Setaria italica
ref|XP_004963017.1|  PREDICTED: BTB/POZ domain-containing protein...    108   8e-23   
ref|XP_003552044.1|  PREDICTED: BTB/POZ domain-containing protein...    107   9e-23   Glycine max [soybeans]
gb|KHN35451.1|  BTB/POZ domain-containing protein                       107   1e-22   Glycine soja [wild soybean]
gb|KHN22636.1|  BTB/POZ domain-containing protein                       107   1e-22   Glycine soja [wild soybean]
ref|XP_003531985.1|  PREDICTED: BTB/POZ domain-containing protein...    107   1e-22   Glycine max [soybeans]
gb|ACL54058.1|  unknown                                                 102   1e-22   Zea mays [maize]
ref|XP_006280223.1|  hypothetical protein CARUB_v10026140mg             106   2e-22   
gb|KHG04804.1|  hypothetical protein F383_28791                         107   2e-22   Gossypium arboreum [tree cotton]
ref|XP_010444645.1|  PREDICTED: BTB/POZ domain-containing protein...    106   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010100409.1|  BTB/POZ domain-containing protein                  106   2e-22   Morus notabilis
emb|CDY12846.1|  BnaC07g15870D                                          106   2e-22   Brassica napus [oilseed rape]
emb|CDY18660.1|  BnaA09g07350D                                          105   2e-22   Brassica napus [oilseed rape]
gb|KJB31122.1|  hypothetical protein B456_005G177600                    105   2e-22   Gossypium raimondii
ref|XP_009112216.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    105   3e-22   
ref|XP_003558549.1|  PREDICTED: BTB/POZ domain-containing protein...    106   3e-22   Brachypodium distachyon [annual false brome]
ref|XP_008446157.1|  PREDICTED: BTB/POZ domain-containing protein...    105   4e-22   
ref|XP_002468311.1|  hypothetical protein SORBIDRAFT_01g043540          105   5e-22   Sorghum bicolor [broomcorn]
gb|KJB31120.1|  hypothetical protein B456_005G177600                    105   5e-22   Gossypium raimondii
ref|XP_004985278.1|  PREDICTED: BTB/POZ domain-containing protein...    105   5e-22   
gb|KGN51751.1|  hypothetical protein Csa_5G598100                       105   6e-22   Cucumis sativus [cucumbers]
ref|XP_004172442.1|  PREDICTED: BTB/POZ domain-containing protein...    105   7e-22   
emb|CAN63893.1|  hypothetical protein VITISV_019664                     105   7e-22   Vitis vinifera
ref|XP_002282444.2|  PREDICTED: BTB/POZ domain-containing protein...    105   7e-22   
ref|XP_004135274.1|  PREDICTED: BTB/POZ domain-containing protein...    105   7e-22   Cucumis sativus [cucumbers]
ref|NP_001151545.1|  transposon protein Mutator sub-class               104   8e-22   
ref|XP_008679715.1|  PREDICTED: transposon protein Mutator sub-cl...    104   9e-22   Zea mays [maize]
ref|NP_001182914.1|  putative phototropic-resoponsive NPH3 family...    104   1e-21   Zea mays [maize]
gb|EEC74723.1|  hypothetical protein OsI_10448                          104   1e-21   Oryza sativa Indica Group [Indian rice]
gb|ACF83755.1|  unknown                                                 103   1e-21   Zea mays [maize]
ref|XP_009421103.1|  PREDICTED: BTB/POZ domain-containing protein...    104   1e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001067147.1|  Os12g0583500                                       103   2e-21   
gb|EAZ21022.1|  hypothetical protein OsJ_36671                          103   2e-21   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001146294.1|  uncharacterized protein LOC100279869               103   2e-21   Zea mays [maize]
tpg|DAA47265.1|  TPA: putative phototropic-responsive NPH3 family...    103   2e-21   
gb|EAY83679.1|  hypothetical protein OsI_38903                          103   2e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_002443443.1|  hypothetical protein SORBIDRAFT_08g019560          103   2e-21   
ref|XP_011086648.1|  PREDICTED: BTB/POZ domain-containing protein...    103   2e-21   
ref|NP_001049315.2|  Os03g0205700                                       103   2e-21   
ref|XP_011071147.1|  PREDICTED: BTB/POZ domain-containing protein...    103   3e-21   Sesamum indicum [beniseed]
ref|XP_006393947.1|  hypothetical protein EUTSA_v10003889mg             103   3e-21   Eutrema salsugineum [saltwater cress]
ref|XP_008389720.1|  PREDICTED: BTB/POZ domain-containing protein...    103   3e-21   Malus domestica [apple tree]
gb|EMT10822.1|  Root phototropism protein 3                             102   6e-21   
ref|XP_009770852.1|  PREDICTED: BTB/POZ domain-containing protein...    102   6e-21   Nicotiana sylvestris
emb|CDY29566.1|  BnaA03g54110D                                          102   6e-21   Brassica napus [oilseed rape]
gb|KHN14527.1|  BTB/POZ domain-containing protein                       102   6e-21   Glycine soja [wild soybean]
ref|XP_009138500.1|  PREDICTED: BTB/POZ domain-containing protein...    102   6e-21   Brassica rapa
gb|KHN00400.1|  BTB/POZ domain-containing protein                       102   9e-21   Glycine soja [wild soybean]
ref|XP_010464031.1|  PREDICTED: BTB/POZ domain-containing protein...    101   9e-21   Camelina sativa [gold-of-pleasure]
ref|NP_001146461.1|  putative phototropic-responsive NPH3 family ...    101   1e-20   Zea mays [maize]
ref|XP_002311763.1|  phototropic-responsive NPH3 family protein         101   1e-20   Populus trichocarpa [western balsam poplar]
ref|XP_010251055.1|  PREDICTED: BTB/POZ domain-containing protein...    101   1e-20   Nelumbo nucifera [Indian lotus]
ref|XP_003519715.1|  PREDICTED: BTB/POZ domain-containing protein...    101   1e-20   Glycine max [soybeans]
ref|XP_010248658.1|  PREDICTED: BTB/POZ domain-containing protein...    101   1e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010682456.1|  PREDICTED: BTB/POZ domain-containing protein...    101   1e-20   Beta vulgaris subsp. vulgaris [field beet]
gb|EMS51026.1|  Root phototropism protein 3                             101   2e-20   Triticum urartu
ref|XP_006649594.1|  PREDICTED: BTB/POZ domain-containing protein...    101   2e-20   Oryza brachyantha
ref|XP_010265570.1|  PREDICTED: BTB/POZ domain-containing protein...    100   2e-20   Nelumbo nucifera [Indian lotus]
ref|XP_009614413.1|  PREDICTED: BTB/POZ domain-containing protein...    100   2e-20   Nicotiana tomentosiformis
gb|KCW59745.1|  hypothetical protein EUGRSUZ_H02493                     100   2e-20   Eucalyptus grandis [rose gum]
ref|XP_011036689.1|  PREDICTED: BTB/POZ domain-containing protein...    100   3e-20   Populus euphratica
emb|CBI16786.3|  unnamed protein product                              99.4    3e-20   Vitis vinifera
ref|XP_006357600.1|  PREDICTED: BTB/POZ domain-containing protein...    100   3e-20   Solanum tuberosum [potatoes]
ref|XP_011034060.1|  PREDICTED: BTB/POZ domain-containing protein...    100   3e-20   Populus euphratica
ref|XP_007158393.1|  hypothetical protein PHAVU_002G149400g             100   4e-20   Phaseolus vulgaris [French bean]
ref|XP_006852352.1|  hypothetical protein AMTR_s00049p00216130        99.8    5e-20   
ref|XP_010023464.1|  PREDICTED: BTB/POZ domain-containing protein...  99.8    5e-20   
gb|KJB15638.1|  hypothetical protein B456_002G187700                  99.8    5e-20   Gossypium raimondii
ref|XP_007044812.1|  Phototropic-responsive NPH3 family protein       99.4    7e-20   
ref|XP_009786908.1|  PREDICTED: BTB/POZ domain-containing protein...  99.0    9e-20   Nicotiana sylvestris
gb|KHG03539.1|  hypothetical protein F383_27138                       99.0    9e-20   Gossypium arboreum [tree cotton]
ref|XP_006857240.1|  hypothetical protein AMTR_s00065p00211770        99.0    9e-20   Amborella trichopoda
ref|XP_007011711.1|  Phototropic-responsive NPH3 family protein i...  98.6    1e-19   
ref|XP_008803708.1|  PREDICTED: BTB/POZ domain-containing protein...  98.6    1e-19   Phoenix dactylifera
ref|XP_007011710.1|  Phototropic-responsive NPH3 family protein i...  98.6    1e-19   
ref|XP_008221906.1|  PREDICTED: BTB/POZ domain-containing protein...  98.6    1e-19   Prunus mume [ume]
ref|XP_007221979.1|  hypothetical protein PRUPE_ppa002809mg           98.6    1e-19   Prunus persica
emb|CDP13229.1|  unnamed protein product                              98.2    1e-19   Coffea canephora [robusta coffee]
gb|KJB50264.1|  hypothetical protein B456_008G161100                  97.4    2e-19   Gossypium raimondii
ref|XP_009630313.1|  PREDICTED: BTB/POZ domain-containing protein...  97.8    2e-19   
ref|XP_011045253.1|  PREDICTED: BTB/POZ domain-containing protein...  97.8    2e-19   Populus euphratica
gb|KDO67445.1|  hypothetical protein CISIN_1g007148mg                 97.4    3e-19   Citrus sinensis [apfelsine]
gb|KJB55086.1|  hypothetical protein B456_009G062900                  97.4    3e-19   Gossypium raimondii
tpg|DAA47264.1|  TPA: putative phototropic-responsive NPH3 family...  92.8    3e-19   
ref|XP_006450279.1|  hypothetical protein CICLE_v10007764mg           97.4    3e-19   Citrus clementina [clementine]
ref|XP_010484495.1|  PREDICTED: BTB/POZ domain-containing protein...  97.1    3e-19   Camelina sativa [gold-of-pleasure]
ref|XP_009396038.1|  PREDICTED: BTB/POZ domain-containing protein...  97.1    3e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006404771.1|  hypothetical protein EUTSA_v10000147mg           96.3    3e-19   Eutrema salsugineum [saltwater cress]
ref|XP_010929164.1|  PREDICTED: BTB/POZ domain-containing protein...  97.1    4e-19   Elaeis guineensis
ref|XP_011045254.1|  PREDICTED: BTB/POZ domain-containing protein...  97.1    4e-19   Populus euphratica
gb|KDP26695.1|  hypothetical protein JCGZ_17853                       96.7    5e-19   Jatropha curcas
gb|AFK38028.1|  unknown                                               92.0    5e-19   Lotus japonicus
ref|XP_010942083.1|  PREDICTED: BTB/POZ domain-containing protein...  96.3    7e-19   Elaeis guineensis
ref|XP_002530034.1|  signal transducer, putative                      96.3    7e-19   Ricinus communis
ref|NP_179887.1|  BTB/POZ domain-containing protein NPY4              95.1    8e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010556221.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  95.9    8e-19   
ref|XP_004509676.1|  PREDICTED: BTB/POZ domain-containing protein...  95.9    8e-19   Cicer arietinum [garbanzo]
ref|XP_002314596.2|  hypothetical protein POPTR_0010s05690g           95.9    1e-18   
ref|XP_006378242.1|  hypothetical protein POPTR_0010s05690g           95.9    1e-18   Populus trichocarpa [western balsam poplar]
ref|XP_006295878.1|  hypothetical protein CARUB_v10025008mg           94.7    1e-18   Capsella rubella
ref|XP_004299219.1|  PREDICTED: BTB/POZ domain-containing protein...  95.5    1e-18   Fragaria vesca subsp. vesca
ref|XP_010417060.1|  PREDICTED: BTB/POZ domain-containing protein...  94.7    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010429248.1|  PREDICTED: BTB/POZ domain-containing protein...  94.7    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010472303.1|  PREDICTED: BTB/POZ domain-containing protein...  94.4    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_003578395.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  95.1    2e-18   
ref|XP_006378241.1|  hypothetical protein POPTR_0010s05690g           95.1    2e-18   
ref|XP_009359209.1|  PREDICTED: BTB/POZ domain-containing protein...  95.1    2e-18   
gb|KHG05824.1|  hypothetical protein F383_32639                       94.7    2e-18   
ref|XP_010531578.1|  PREDICTED: BTB/POZ domain-containing protein...  94.4    3e-18   
ref|XP_004239131.1|  PREDICTED: BTB/POZ domain-containing protein...  94.4    3e-18   
ref|XP_006483950.1|  PREDICTED: BTB/POZ domain-containing protein...  94.4    3e-18   
gb|KHG00065.1|  BTB/POZ domain-containing protein NPY1                94.7    4e-18   
gb|KDO82220.1|  hypothetical protein CISIN_1g006846mg                 94.4    4e-18   
ref|XP_006438255.1|  hypothetical protein CICLE_v10030958mg           94.0    4e-18   
gb|KHG00066.1|  BTB/POZ domain-containing protein NPY1                94.7    4e-18   
ref|XP_008778389.1|  PREDICTED: BTB/POZ domain-containing protein...  94.0    4e-18   
ref|XP_003613103.1|  BTB/POZ domain-containing protein                93.6    5e-18   
ref|XP_004489774.1|  PREDICTED: BTB/POZ domain-containing protein...  93.6    6e-18   
emb|CDX89539.1|  BnaC04g35580D                                        92.8    6e-18   
emb|CDY38923.1|  BnaA04g13440D                                        92.4    7e-18   
gb|KFK32774.1|  hypothetical protein AALP_AA6G286900                  92.4    7e-18   
ref|XP_008340094.1|  PREDICTED: BTB/POZ domain-containing protein...  93.2    8e-18   
ref|XP_009140445.1|  PREDICTED: BTB/POZ domain-containing protein...  92.4    8e-18   
ref|NP_176957.1|  phototropic-responsive NPH3 family protein          93.2    8e-18   
ref|XP_003628937.1|  BTB/POZ domain-containing protein                92.4    1e-17   
gb|AET03413.2|  phototropic-responsive NPH3 family protein            92.4    1e-17   
ref|XP_011031448.1|  PREDICTED: BTB/POZ domain-containing protein...  92.4    1e-17   
ref|XP_011031451.1|  PREDICTED: BTB/POZ domain-containing protein...  92.4    1e-17   
ref|XP_002285522.2|  PREDICTED: BTB/POZ domain-containing protein...  92.4    1e-17   
gb|EPS63042.1|  hypothetical protein M569_11744                       92.0    2e-17   
ref|XP_010275834.1|  PREDICTED: BTB/POZ domain-containing protein...  92.0    2e-17   
ref|XP_010101025.1|  BTB/POZ domain-containing protein NPY1           92.0    2e-17   
ref|XP_009105081.1|  PREDICTED: BTB/POZ domain-containing protein...  91.7    2e-17   
emb|CAN82247.1|  hypothetical protein VITISV_036489                   91.7    3e-17   
gb|EMT18058.1|  Coleoptile phototropism protein 1                     91.7    3e-17   
ref|XP_009394935.1|  PREDICTED: BTB/POZ domain-containing protein...  91.3    3e-17   
ref|XP_004485603.1|  PREDICTED: root phototropism protein 3-like      91.3    3e-17   
ref|XP_006300867.1|  hypothetical protein CARUB_v10019960mg           90.9    5e-17   
ref|XP_010511760.1|  PREDICTED: BTB/POZ domain-containing protein...  90.5    5e-17   
ref|XP_010415392.1|  PREDICTED: BTB/POZ domain-containing protein...  90.5    6e-17   
gb|KDP33511.1|  hypothetical protein JCGZ_07082                       85.9    7e-17   
ref|XP_010929904.1|  PREDICTED: BTB/POZ domain-containing protein...  90.1    8e-17   
ref|XP_010048297.1|  PREDICTED: BTB/POZ domain-containing protein...  89.7    1e-16   
ref|XP_006351743.1|  PREDICTED: root phototropism protein 3-like      89.7    1e-16   
ref|XP_004248794.1|  PREDICTED: root phototropism protein 3-like      89.4    1e-16   
ref|XP_006359786.1|  PREDICTED: root phototropism protein 3-like      89.4    1e-16   
emb|CDY72257.1|  BnaCnng76750D                                        89.0    1e-16   
emb|CDY72267.1|  BnaAnng40470D                                        89.0    2e-16   
gb|KJB32105.1|  hypothetical protein B456_005G224200                  88.6    2e-16   
ref|XP_004230550.1|  PREDICTED: root phototropism protein 3-like      89.0    2e-16   
gb|KHN33549.1|  Root phototropism protein 3                           89.0    2e-16   
ref|XP_003545709.1|  PREDICTED: root phototropism protein 3-like      89.0    2e-16   
ref|XP_006594679.1|  PREDICTED: root phototropism protein 3-like      89.0    2e-16   
gb|KJB32106.1|  hypothetical protein B456_005G224200                  88.6    2e-16   
gb|KHN19000.1|  Root phototropism protein 3                           89.0    2e-16   
gb|KJB32104.1|  hypothetical protein B456_005G224200                  89.0    2e-16   
emb|CBI38224.3|  unnamed protein product                              88.6    2e-16   
ref|XP_008455135.1|  PREDICTED: root phototropism protein 3 isofo...  88.6    3e-16   
ref|XP_009631478.1|  PREDICTED: root phototropism protein 3-like      88.6    3e-16   
ref|XP_009803877.1|  PREDICTED: root phototropism protein 3-like      88.6    3e-16   
dbj|BAK05210.1|  predicted protein                                    88.6    3e-16   
ref|XP_010266412.1|  PREDICTED: root phototropism protein 3           88.6    3e-16   
ref|XP_008455134.1|  PREDICTED: root phototropism protein 3 isofo...  88.6    3e-16   
ref|XP_002269380.1|  PREDICTED: root phototropism protein 3           88.2    3e-16   
emb|CAN60915.1|  hypothetical protein VITISV_002200                   88.2    3e-16   
ref|XP_009766094.1|  PREDICTED: root phototropism protein 3-like ...  88.2    4e-16   
ref|XP_009608443.1|  PREDICTED: root phototropism protein 3 isofo...  88.2    4e-16   
ref|XP_009390549.1|  PREDICTED: BTB/POZ domain-containing protein...  87.8    4e-16   
ref|XP_010272952.1|  PREDICTED: root phototropism protein 3-like ...  87.8    4e-16   
ref|XP_007042875.1|  Phototropic-responsive NPH3 family protein i...  87.8    4e-16   
ref|XP_007148380.1|  hypothetical protein PHAVU_006G203600g           87.8    5e-16   
ref|XP_010520803.1|  PREDICTED: root phototropism protein 3           87.8    5e-16   
ref|XP_002515424.1|  protein binding protein, putative                87.8    5e-16   
ref|XP_010272951.1|  PREDICTED: root phototropism protein 3-like ...  87.8    5e-16   
ref|XP_007159131.1|  hypothetical protein PHAVU_002G211400g           87.8    5e-16   
ref|XP_009379958.1|  PREDICTED: BTB/POZ domain-containing protein...  87.4    6e-16   
ref|XP_009390548.1|  PREDICTED: BTB/POZ domain-containing protein...  87.4    6e-16   
ref|XP_004136895.1|  PREDICTED: root phototropism protein 3-like      87.4    6e-16   
ref|XP_002310495.1|  hypothetical protein POPTR_0007s03550g           87.4    6e-16   
ref|XP_011012727.1|  PREDICTED: root phototropism protein 3-like      87.4    6e-16   
ref|XP_011023032.1|  PREDICTED: root phototropism protein 3-like      87.4    6e-16   
ref|XP_010470729.1|  PREDICTED: BTB/POZ domain-containing protein...  87.4    7e-16   
ref|XP_007042874.1|  Phototropic-responsive NPH3 family protein i...  87.4    7e-16   
gb|KCW63332.1|  hypothetical protein EUGRSUZ_G00960                   87.0    8e-16   
ref|XP_004301628.1|  PREDICTED: root phototropism protein 3           87.0    8e-16   
emb|CDO97399.1|  unnamed protein product                              87.0    8e-16   
ref|XP_003593245.1|  Root phototropism protein                        87.0    9e-16   
ref|XP_009393648.1|  PREDICTED: root phototropism protein 3           87.0    9e-16   
gb|KDP40950.1|  hypothetical protein JCGZ_24949                       87.0    9e-16   
ref|XP_011014242.1|  PREDICTED: root phototropism protein 3-like ...  86.7    1e-15   
gb|KDO42273.1|  hypothetical protein CISIN_1g005842mg                 87.0    1e-15   
ref|XP_006494598.1|  PREDICTED: root phototropism protein 3-like ...  87.0    1e-15   
ref|XP_006420843.1|  hypothetical protein CICLE_v10004479mg           86.7    1e-15   
ref|XP_006420844.1|  hypothetical protein CICLE_v10004479mg           86.7    1e-15   
ref|XP_008237216.1|  PREDICTED: root phototropism protein 3           86.7    1e-15   
ref|XP_007200957.1|  hypothetical protein PRUPE_ppa002411mg           86.7    1e-15   
gb|EPS58028.1|  hypothetical protein M569_16791                       82.0    1e-15   
ref|XP_003608415.1|  Root phototropism protein                        86.7    1e-15   
ref|XP_010691413.1|  PREDICTED: root phototropism protein 3           86.7    1e-15   
ref|XP_008358392.1|  PREDICTED: root phototropism protein 3-like      86.7    1e-15   
ref|XP_010094827.1|  Root phototropism protein 3                      86.7    1e-15   
ref|XP_002522618.1|  hypothetical protein RCOM_0884570                86.3    1e-15   
ref|XP_009150508.1|  PREDICTED: root phototropism protein 3 isofo...  86.7    1e-15   
dbj|BAJ87350.1|  predicted protein                                    86.3    1e-15   
ref|XP_010065706.1|  PREDICTED: root phototropism protein 3           86.3    1e-15   
emb|CDX84515.1|  BnaC03g49850D                                        86.3    1e-15   
ref|XP_009348533.1|  PREDICTED: root phototropism protein 3-like      86.3    2e-15   
ref|XP_004169312.1|  PREDICTED: LOW QUALITY PROTEIN: root phototr...  86.3    2e-15   
ref|XP_009366303.1|  PREDICTED: root phototropism protein 3           86.3    2e-15   
ref|XP_008462886.1|  PREDICTED: root phototropism protein 3-like ...  86.3    2e-15   
gb|KFK28125.1|  hypothetical protein AALP_AA8G475700                  86.3    2e-15   
ref|XP_009150509.1|  PREDICTED: root phototropism protein 3 isofo...  86.3    2e-15   
ref|XP_004137156.1|  PREDICTED: root phototropism protein 3-like      86.3    2e-15   
ref|XP_006394165.1|  hypothetical protein EUTSA_v10003710mg           86.3    2e-15   
ref|NP_568989.1|  root phototropism protein 3                         86.3    2e-15   
ref|XP_002323955.2|  hypothetical protein POPTR_0017s07540g           86.3    2e-15   
ref|XP_009112128.1|  PREDICTED: root phototropism protein 3-like ...  86.3    2e-15   
gb|AAF05914.1|AF180390_1  non-phototropic hypocotyl 3                 86.3    2e-15   
ref|XP_010484212.1|  PREDICTED: root phototropism protein 3-like ...  86.3    2e-15   
gb|KHN09117.1|  Root phototropism protein 3                           85.9    2e-15   
emb|CDX81221.1|  BnaC09g06320D                                        86.3    2e-15   
dbj|BAB09864.1|  non-phototropic hypocotyl 3                          86.3    2e-15   
ref|XP_009112129.1|  PREDICTED: root phototropism protein 3-like ...  85.9    2e-15   
ref|XP_006280132.1|  hypothetical protein CARUB_v10026027mg           86.3    2e-15   
ref|XP_010461672.1|  PREDICTED: root phototropism protein 3 isofo...  86.3    2e-15   
ref|XP_010484214.1|  PREDICTED: root phototropism protein 3-like ...  85.9    2e-15   
ref|XP_003528390.2|  PREDICTED: root phototropism protein 3-like ...  86.3    2e-15   
emb|CDY18715.1|  BnaA09g06800D                                        86.3    2e-15   
ref|XP_010461680.1|  PREDICTED: root phototropism protein 3 isofo...  85.9    2e-15   
ref|XP_011043086.1|  PREDICTED: root phototropism protein 3-like      85.9    2e-15   
ref|XP_011014241.1|  PREDICTED: root phototropism protein 3-like ...  85.9    2e-15   
gb|EYU18437.1|  hypothetical protein MIMGU_mgv1a002339mg              85.9    2e-15   
ref|XP_010238175.1|  PREDICTED: BTB/POZ domain-containing protein...  85.5    2e-15   
ref|XP_006648764.1|  PREDICTED: coleoptile phototropism protein 1...  85.1    2e-15   
ref|XP_004952704.1|  PREDICTED: coleoptile phototropism protein 1...  85.9    2e-15   
gb|KHG03398.1|  BTB/POZ domain-containing NPY1 -like protein          85.5    2e-15   
gb|KHG29755.1|  Root phototropism 3 -like protein                     85.9    2e-15   
dbj|BAK02341.1|  predicted protein                                    84.7    2e-15   
ref|XP_003578134.1|  PREDICTED: BTB/POZ domain-containing protein...  85.5    2e-15   
ref|XP_002452387.1|  hypothetical protein SORBIDRAFT_04g024760        85.5    2e-15   
ref|XP_009368293.1|  PREDICTED: root phototropism protein 3-like      85.5    2e-15   
ref|XP_008373205.1|  PREDICTED: root phototropism protein 3           85.5    3e-15   
ref|NP_001119515.1|  MAB4/ENP/NPY1-LIKE 2                             85.1    3e-15   
ref|NP_201545.1|  MAB4/ENP/NPY1-LIKE 2                                85.1    3e-15   
gb|KHN46271.1|  Root phototropism protein 3                           85.1    3e-15   
ref|XP_006584970.1|  PREDICTED: root phototropism protein 3-like      85.1    3e-15   
dbj|BAK02443.1|  predicted protein                                    85.1    4e-15   
gb|AAK96885.1|  photoreceptor-interacting protein-like                85.1    4e-15   
ref|XP_010670801.1|  PREDICTED: BTB/POZ domain-containing protein...  85.1    4e-15   
ref|XP_010939734.1|  PREDICTED: root phototropism protein 3           85.1    4e-15   
ref|XP_007161085.1|  hypothetical protein PHAVU_001G041700g           85.1    4e-15   
ref|XP_011087936.1|  PREDICTED: root phototropism protein 3-like      85.1    4e-15   
ref|XP_002447182.1|  hypothetical protein SORBIDRAFT_06g030040        84.7    4e-15   
ref|XP_003575199.1|  PREDICTED: coleoptile phototropism protein 1     85.1    4e-15   
ref|XP_004984555.1|  PREDICTED: BTB/POZ domain-containing protein...  81.6    4e-15   
emb|CBI21142.3|  unnamed protein product                              84.7    4e-15   
dbj|BAD17765.1|  putative non-phototropic hypocotyl 3 (NPH3)          85.1    5e-15   
ref|XP_002454038.1|  hypothetical protein SORBIDRAFT_04g023550        85.1    5e-15   
gb|KJB07700.1|  hypothetical protein B456_001G038200                  84.7    5e-15   
gb|EMT11462.1|  BTB/POZ domain-containing protein                     84.3    5e-15   
ref|NP_001147552.1|  transposon protein Mutator sub-class             84.7    5e-15   
ref|NP_001047181.1|  Os02g0568200                                     84.7    5e-15   
gb|EAZ23501.1|  hypothetical protein OsJ_07198                        84.7    5e-15   
gb|AFW71924.1|  putative phototropic-responsive NPH3 family protein   84.7    5e-15   
gb|KJB07699.1|  hypothetical protein B456_001G038200                  84.3    5e-15   
gb|EYU39117.1|  hypothetical protein MIMGU_mgv1a002358mg              84.7    5e-15   
ref|XP_011092443.1|  PREDICTED: root phototropism protein 3           84.7    5e-15   
ref|XP_006841237.1|  hypothetical protein AMTR_s00135p00069650        84.7    5e-15   
ref|NP_001130370.1|  putative phototropic-resoponsive NPH3 family...  84.3    6e-15   
gb|EAY86354.1|  hypothetical protein OsI_07731                        84.7    6e-15   
ref|XP_009126615.1|  PREDICTED: BTB/POZ domain-containing protein...  84.3    6e-15   
ref|XP_010032181.1|  PREDICTED: BTB/POZ domain-containing protein...  84.3    6e-15   
ref|XP_002324913.2|  hypothetical protein POPTR_0018s02590g           84.0    7e-15   
dbj|BAK03079.1|  predicted protein                                    84.0    7e-15   
ref|XP_011081969.1|  PREDICTED: BTB/POZ domain-containing protein...  84.0    7e-15   
gb|KHN33978.1|  BTB/POZ domain-containing protein NPY1                84.0    8e-15   
gb|KJB79558.1|  hypothetical protein B456_013G057300                  84.0    8e-15   
ref|XP_004504830.1|  PREDICTED: root phototropism protein 3-like ...  84.0    8e-15   
ref|XP_004504832.1|  PREDICTED: root phototropism protein 3-like ...  84.0    8e-15   
ref|XP_003550246.1|  PREDICTED: BTB/POZ domain-containing protein...  84.0    9e-15   
gb|KHN37088.1|  BTB/POZ domain-containing protein NPY1                84.0    9e-15   
ref|XP_006846819.1|  hypothetical protein AMTR_s00148p00085230        84.0    9e-15   
ref|XP_004970185.1|  PREDICTED: BTB/POZ domain-containing protein...  84.0    9e-15   
dbj|BAK06168.1|  predicted protein                                    84.0    9e-15   
ref|XP_004504829.1|  PREDICTED: root phototropism protein 3-like ...  84.0    1e-14   
ref|XP_009399039.1|  PREDICTED: BTB/POZ domain-containing protein...  83.6    1e-14   
ref|XP_003564354.1|  PREDICTED: BTB/POZ domain-containing protein...  83.6    1e-14   
ref|XP_004291961.1|  PREDICTED: BTB/POZ domain-containing protein...  83.6    1e-14   
gb|EEC71596.1|  hypothetical protein OsI_03980                        83.6    1e-14   
dbj|BAD52854.1|  putative non-phototropic hypocotyl 3                 83.6    1e-14   
ref|XP_010905600.1|  PREDICTED: BTB/POZ domain-containing protein...  83.2    1e-14   
gb|EMS47904.1|  Coleoptile phototropism protein 1                     83.2    1e-14   
ref|XP_006653803.1|  PREDICTED: BTB/POZ domain-containing protein...  83.2    1e-14   
gb|EMT26515.1|  BTB/POZ domain-containing protein                     83.2    2e-14   
ref|XP_010252838.1|  PREDICTED: BTB/POZ domain-containing protein...  82.8    2e-14   
ref|XP_010252837.1|  PREDICTED: BTB/POZ domain-containing protein...  82.8    2e-14   
gb|EEE59569.1|  hypothetical protein OsJ_11863                        82.4    2e-14   
ref|XP_009347295.1|  PREDICTED: BTB/POZ domain-containing protein...  82.8    2e-14   
gb|EMS64627.1|  Coleoptile phototropism protein 1                     82.8    2e-14   
emb|CDX68790.1|  BnaC01g06630D                                        82.8    2e-14   
ref|XP_008794467.1|  PREDICTED: BTB/POZ domain-containing protein...  82.4    2e-14   
ref|XP_006836308.1|  hypothetical protein AMTR_s00092p00041800        82.8    2e-14   
ref|XP_008800153.1|  PREDICTED: BTB/POZ domain-containing protein...  82.4    2e-14   
ref|XP_010923665.1|  PREDICTED: BTB/POZ domain-containing protein...  82.4    2e-14   
ref|XP_004249834.1|  PREDICTED: BTB/POZ domain-containing protein...  82.4    2e-14   
ref|XP_003561994.1|  PREDICTED: BTB/POZ domain-containing protein...  82.4    2e-14   
ref|XP_006363693.1|  PREDICTED: BTB/POZ domain-containing protein...  82.4    3e-14   
ref|XP_006650337.1|  PREDICTED: BTB/POZ domain-containing protein...  82.4    3e-14   
gb|EMT08606.1|  Coleoptile phototropism protein 1                     82.4    3e-14   
gb|ABF97836.1|  transposon protein, putative, Mutator sub-class, ...  82.4    3e-14   
gb|ABF97835.1|  transposon protein, putative, Mutator sub-class, ...  82.4    3e-14   
gb|ABR25380.1|  transposon protein                                    80.1    3e-14   
gb|AAT85278.1|  NPH3 family protein                                   82.4    3e-14   
ref|XP_006391205.1|  hypothetical protein EUTSA_v10019709mg           82.4    3e-14   
emb|CDP07841.1|  unnamed protein product                              82.4    3e-14   
ref|XP_008794466.1|  PREDICTED: BTB/POZ domain-containing protein...  82.4    3e-14   
ref|XP_009605934.1|  PREDICTED: BTB/POZ domain-containing protein...  82.0    3e-14   
ref|XP_002458596.1|  hypothetical protein SORBIDRAFT_03g036420        82.4    3e-14   
ref|NP_001130814.1|  putative phototropic-resoponsive NPH3 family...  82.4    3e-14   
ref|XP_009781651.1|  PREDICTED: BTB/POZ domain-containing protein...  82.0    3e-14   
gb|AEP03595.1|  NPH3 family domain-like protein                       82.0    3e-14   
ref|XP_009363621.1|  PREDICTED: BTB/POZ domain-containing protein...  82.0    3e-14   
gb|ACG43447.1|  transposon protein Mutator sub-class                  82.0    3e-14   
ref|XP_003579359.1|  PREDICTED: BTB/POZ domain-containing protein...  82.0    3e-14   
ref|XP_010687037.1|  PREDICTED: BTB/POZ domain-containing protein...  82.0    3e-14   
ref|XP_008379044.1|  PREDICTED: BTB/POZ domain-containing protein...  82.0    3e-14   



>ref|XP_009764318.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
sylvestris]
 ref|XP_009764381.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
sylvestris]
 ref|XP_009764456.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
sylvestris]
 ref|XP_009764516.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
sylvestris]
Length=624

 Score =   266 bits (681),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 168/187 (90%), Gaps = 4/187 (2%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRIC+LMDCKKLS DACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK
Sbjct  442  SKSERKRICKLMDCKKLSVDACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  501

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
            AI+DLN ASYGSSRSATT TEEDWD  ASA+ELRAL+GELAALR+GN G  D+ NGD   
Sbjct  502  AIRDLNSASYGSSRSATTNTEEDWDAAASAEELRALRGELAALRMGNGGTNDKVNGDAK-  560

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSR  255
              + +D+ AA+S+MKGLL+SKRIFSKIWS+KGG GENSGSDSSESLGS  +EEAKSTPSR
Sbjct  561  --SHADR-AAMSRMKGLLMSKRIFSKIWSNKGGQGENSGSDSSESLGSANLEEAKSTPSR  617

Query  254  KGRYSVS  234
            KGR+SVS
Sbjct  618  KGRHSVS  624



>ref|XP_009625190.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625197.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625203.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625209.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625213.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625220.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
tomentosiformis]
Length=624

 Score =   265 bits (678),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 168/187 (90%), Gaps = 4/187 (2%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRIC+LMDCKKLS DACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK
Sbjct  442  SKSERKRICKLMDCKKLSVDACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  501

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
            AI++LN ASYGSSRSATT TEEDWD  ASA+ELRAL+GELAALR+GN G  D+ANGD   
Sbjct  502  AIRELNSASYGSSRSATTNTEEDWDAAASAEELRALRGELAALRMGNGGTNDKANGDAK-  560

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSR  255
              + +D+ AA+S+MKGLL SKRIFSKIWS+KGG GENSGSDSSESLGS  +EEAKSTPSR
Sbjct  561  --SQADR-AAMSRMKGLLTSKRIFSKIWSNKGGQGENSGSDSSESLGSANLEEAKSTPSR  617

Query  254  KGRYSVS  234
            KGR+SVS
Sbjct  618  KGRHSVS  624



>ref|XP_011088062.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Sesamum indicum]
Length=624

 Score =   260 bits (665),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 161/187 (86%), Gaps = 4/187 (2%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRA ASSGSSTPDLPK
Sbjct  442  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRAAASSGSSTPDLPK  501

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
            AIKDLNCASYGSSRS TT  +EDWDGVASA+ELRAL+GELAALRLG+  + DR  G+   
Sbjct  502  AIKDLNCASYGSSRSTTTNNDEDWDGVASAEELRALRGELAALRLGHVAVHDRNGGEN--  559

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSR  255
             +++SD+ AAISKMKGL++SKRIFSKIW S  G    + SDSSESLGS   +E KSTP+R
Sbjct  560  RISNSDR-AAISKMKGLIMSKRIFSKIW-SSKGGQAENSSDSSESLGSINHDEVKSTPTR  617

Query  254  KGRYSVS  234
            +GR+SVS
Sbjct  618  RGRHSVS  624



>ref|XP_006346315.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006346316.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006346317.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X3 [Solanum tuberosum]
 ref|XP_006346318.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X4 [Solanum tuberosum]
 ref|XP_006346319.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X5 [Solanum tuberosum]
 ref|XP_006346320.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X6 [Solanum tuberosum]
Length=626

 Score =   257 bits (657),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 153/188 (81%), Gaps = 4/188 (2%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SK+ERKRIC+LMDCKKLS DACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK
Sbjct  442  SKNERKRICKLMDCKKLSVDACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  501

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
            AI+DLN ASYGSSRSATT TEEDWD  ASA+ELRAL+GELAALR+GN G  D+ N    K
Sbjct  502  AIRDLNSASYGSSRSATTNTEEDWDAAASAEELRALRGELAALRMGNGGTNDKVNVIDAK  561

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWssk-ggngensgsdsseslgSTTMEEAKSTPS  258
            + A     AA+SKMKGLL+SKR+FSKIWS+K G    +    S     +  +EEAKSTPS
Sbjct  562  SHADR---AAMSKMKGLLMSKRLFSKIWSNKGGQGENSGSDSSESLGSANNLEEAKSTPS  618

Query  257  RKGRYSVS  234
            RKGR+SVS
Sbjct  619  RKGRHSVS  626



>emb|CDO97269.1| unnamed protein product [Coffea canephora]
Length=622

 Score =   253 bits (646),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 155/188 (82%), Gaps = 4/188 (2%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRICRLMDCKKLS DACMHAVQNERLPLRVVVQVLFFEQVRA ASSGSSTPDLPK
Sbjct  438  SKSERKRICRLMDCKKLSVDACMHAVQNERLPLRVVVQVLFFEQVRAAASSGSSTPDLPK  497

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
             +KDLN AS+GSSR+ATT TEEDWD VASA+ELRALKGELAALRLGN  +++R  GD+  
Sbjct  498  VLKDLNSASHGSSRTATTNTEEDWDAVASAEELRALKGELAALRLGNGSISERNGGDSR-  556

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgST-TMEEAKSTPS  258
              + ++  AAISKM+ LL+SK+IFSKIWSSKGG    +    S     +  +EEAKSTPS
Sbjct  557  --SHNNDRAAISKMRSLLMSKKIFSKIWSSKGGGQGENSGSDSSESLGSANLEEAKSTPS  614

Query  257  RKGRYSVS  234
            R+GR+SVS
Sbjct  615  RRGRHSVS  622



>ref|XP_004230705.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Solanum lycopersicum]
 ref|XP_010315185.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Solanum lycopersicum]
 ref|XP_010315186.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Solanum lycopersicum]
 ref|XP_010315187.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Solanum lycopersicum]
 ref|XP_010315188.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Solanum lycopersicum]
 ref|XP_010315189.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Solanum lycopersicum]
Length=626

 Score =   253 bits (646),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 151/188 (80%), Gaps = 4/188 (2%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRIC+LMDCKKLS DACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK
Sbjct  442  SKSERKRICKLMDCKKLSVDACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  501

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
            AI+DLN  SYGSSRSATT TEEDWD  ASA+ELRAL+GELAALR+GN G  D+ N    K
Sbjct  502  AIRDLNSTSYGSSRSATTNTEEDWDAAASAEELRALRGELAALRMGNGGTNDKVNVIDAK  561

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWssk-ggngensgsdsseslgSTTMEEAKSTPS  258
            + A     AA+SKMKGLL+SKR+FSKIWS+K G    +    S     +  +EEAKSTPS
Sbjct  562  SHADR---AAMSKMKGLLMSKRLFSKIWSNKGGQGENSGSDSSESLGSANNLEEAKSTPS  618

Query  257  RKGRYSVS  234
            RK R+SVS
Sbjct  619  RKVRHSVS  626



>ref|XP_002264153.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Vitis vinifera]
 ref|XP_010647924.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Vitis vinifera]
 ref|XP_010647925.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Vitis vinifera]
Length=626

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 160/188 (85%), Gaps = 5/188 (3%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRICRLMDCKKLS DACMHAVQNERLPLRVVVQVLFFEQVRA A+SGSSTPDLPK
Sbjct  443  SKSERKRICRLMDCKKLSVDACMHAVQNERLPLRVVVQVLFFEQVRATATSGSSTPDLPK  502

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNA-GMADRANGDTT  438
             IKDLN AS+GSSRS TT TEEDWD VA+ +EL+ALKGELA+LRLGN  G ++R  GD+ 
Sbjct  503  GIKDLNSASHGSSRSVTTNTEEDWDAVATLEELKALKGELASLRLGNGVGASERNGGDSK  562

Query  437  KTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPS  258
             ++   DK AAI+KMKGLL+SK+IF+K+WSSK G GENSGSDSS S GS   EEAKSTPS
Sbjct  563  GSI---DK-AAINKMKGLLMSKKIFTKLWSSKSGQGENSGSDSSGSSGSANPEEAKSTPS  618

Query  257  RKGRYSVS  234
            R  R+SVS
Sbjct  619  RNRRHSVS  626



>emb|CAN66911.1| hypothetical protein VITISV_035422 [Vitis vinifera]
Length=621

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 159/188 (85%), Gaps = 5/188 (3%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRICRLMDCKKLS DACMHAVQNERLPLRVVVQVLFFEQVRA A+SGSSTPDLPK
Sbjct  438  SKSERKRICRLMDCKKLSVDACMHAVQNERLPLRVVVQVLFFEQVRATATSGSSTPDLPK  497

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNA-GMADRANGDTT  438
             IKDLN AS+GSSRS TT TEEDWD VA+ +EL+ALKGELA+LRLGN  G ++R  GD+ 
Sbjct  498  GIKDLNSASHGSSRSVTTNTEEDWDAVATLEELKALKGELASLRLGNGVGASERNGGDSK  557

Query  437  KTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPS  258
             ++   DK AAI+KMKGLL+SK+ F+K+WSSK G GENSGSDSS S GS   EEAKSTPS
Sbjct  558  GSI---DK-AAINKMKGLLMSKKXFTKLWSSKSGQGENSGSDSSGSSGSANPEEAKSTPS  613

Query  257  RKGRYSVS  234
            R  R+SVS
Sbjct  614  RNRRHSVS  621



>ref|XP_010099608.1| BTB/POZ domain-containing protein NPY2 [Morus notabilis]
 gb|EXB80039.1| BTB/POZ domain-containing protein NPY2 [Morus notabilis]
Length=627

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 163/188 (87%), Gaps = 4/188 (2%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRIC+LMDC+KLS DACMHAVQNERLPLRVVVQVLFFEQVRA A+SGSSTPDLPK
Sbjct  443  SKSERKRICKLMDCRKLSVDACMHAVQNERLPLRVVVQVLFFEQVRAAATSGSSTPDLPK  502

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNA-GMADRANGDTT  438
            +IKDLN AS+GSSRSATT TEEDWD VA+A+ELRAL+GELA+LRL N  G ++R  GD  
Sbjct  503  SIKDLNNASHGSSRSATTNTEEDWDAVATAEELRALRGELASLRLSNGVGGSERNGGDGA  562

Query  437  KTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPS  258
            K+    DK AAISKM+GLL SK+IF+K+WSSKGG GENSGSDSSESLGS   EEAKSTPS
Sbjct  563  KS--GVDK-AAISKMRGLLKSKKIFTKLWSSKGGQGENSGSDSSESLGSLNPEEAKSTPS  619

Query  257  RKGRYSVS  234
            R  R+SVS
Sbjct  620  RNRRHSVS  627



>gb|KJB79441.1| hypothetical protein B456_013G050000 [Gossypium raimondii]
 gb|KJB79442.1| hypothetical protein B456_013G050000 [Gossypium raimondii]
 gb|KJB79443.1| hypothetical protein B456_013G050000 [Gossypium raimondii]
Length=624

 Score =   238 bits (607),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 158/188 (84%), Gaps = 5/188 (3%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRIC+LMDCKKLS DACMHAVQNERLPLRVVVQVLFFEQVRA ASSGSSTPDLP+
Sbjct  441  SKSERKRICKLMDCKKLSVDACMHAVQNERLPLRVVVQVLFFEQVRATASSGSSTPDLPR  500

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNA-GMADRANGDTT  438
             +KDLN  S+GSSRSA T  EEDWD VA+A+EL+ALKGE+AALR+ N  G ++R  GD+ 
Sbjct  501  GLKDLNIGSHGSSRSAATHPEEDWDAVATAEELKALKGEIAALRMSNGIGGSERNGGDSR  560

Query  437  KTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPS  258
             +V   DK  AISKMKGLL SKRIFSKIWSSKG  GENSGSDSSESLGS   EEAKSTPS
Sbjct  561  NSV---DK-VAISKMKGLLKSKRIFSKIWSSKGAQGENSGSDSSESLGSANPEEAKSTPS  616

Query  257  RKGRYSVS  234
            R  R+SVS
Sbjct  617  RNRRHSVS  624



>gb|KHG02234.1| BTB/POZ domain-containing NPY2 -like protein [Gossypium arboreum]
Length=624

 Score =   238 bits (607),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 159/188 (85%), Gaps = 5/188 (3%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRIC+LMDCKKLS DACMHAVQNERLPLRVVVQVLFFEQVRA ASSGSSTPDLP+
Sbjct  441  SKSERKRICKLMDCKKLSVDACMHAVQNERLPLRVVVQVLFFEQVRATASSGSSTPDLPR  500

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNA-GMADRANGDTT  438
             +KDLN  S+GSSRSA T  EEDWD VA+A+EL+ALKGE+AALR+ N+ G ++R  GD+ 
Sbjct  501  GLKDLNIGSHGSSRSAATHPEEDWDAVATAEELKALKGEIAALRMSNSIGGSERNGGDSR  560

Query  437  KTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPS  258
             +V   DK  AISKMKGLL SKRIFSKIWSSKG  GENSGSDSSESLGS   EEAKSTPS
Sbjct  561  NSV---DK-VAISKMKGLLKSKRIFSKIWSSKGAQGENSGSDSSESLGSANPEEAKSTPS  616

Query  257  RKGRYSVS  234
            R  R+SVS
Sbjct  617  RNRRHSVS  624



>gb|EYU37575.1| hypothetical protein MIMGU_mgv1a002858mg [Erythranthe guttata]
Length=630

 Score =   236 bits (601),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 161/191 (84%), Gaps = 10/191 (5%)
 Frame = -3

Query  791  KSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPKA  612
            KS+RK+IC+LMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRA ASSGSSTPDLPKA
Sbjct  445  KSDRKKICKLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRAAASSGSSTPDLPKA  504

Query  611  IKDLNCASYGSSRSA-----TTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANG  447
            IKDLN  SYGSSRSA      T T+EDWD VASA+ELRAL+GELAALRLGN    +   G
Sbjct  505  IKDLNSGSYGSSRSATTTNTNTNTDEDWDAVASAEELRALRGELAALRLGN----EVVGG  560

Query  446  DTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKS  267
              +++  +S++ AA+SKMKGL++S+RIFSKIWS+K    ENSGSDSSESLGST  +EAK 
Sbjct  561  GESRS-GNSERGAAVSKMKGLIMSRRIFSKIWSNKAPAVENSGSDSSESLGSTNQDEAKC  619

Query  266  TPSRKGRYSVS  234
            TP+R+GR+SVS
Sbjct  620  TPTRRGRHSVS  630



>ref|XP_007042621.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
 ref|XP_007042622.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
 gb|EOX98452.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
 gb|EOX98453.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
Length=624

 Score =   235 bits (600),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 153/187 (82%), Gaps = 3/187 (2%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRIC+LMDCKKLS DACMHAVQNERLPLRVVVQVLFFEQVR  ASSGSSTPDLPK
Sbjct  441  SKSERKRICKLMDCKKLSVDACMHAVQNERLPLRVVVQVLFFEQVRVAASSGSSTPDLPK  500

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
             +KDLN  S+GSSRSA T  EEDWD VA+A+EL+ALKGELAALRL N       NG   +
Sbjct  501  GLKDLNSGSHGSSRSAATNPEEDWDAVATAEELKALKGELAALRLSNGVGGSERNGVDGR  560

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSR  255
               S DK AAISKMKGLL SKRIF+KIWSSKG  GENSGSDSSESLGS   EEAKSTPSR
Sbjct  561  N--SVDK-AAISKMKGLLKSKRIFTKIWSSKGAQGENSGSDSSESLGSANPEEAKSTPSR  617

Query  254  KGRYSVS  234
              R+SVS
Sbjct  618  NRRHSVS  624



>ref|XP_007042620.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX98451.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
Length=640

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 153/187 (82%), Gaps = 3/187 (2%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRIC+LMDCKKLS DACMHAVQNERLPLRVVVQVLFFEQVR  ASSGSSTPDLPK
Sbjct  457  SKSERKRICKLMDCKKLSVDACMHAVQNERLPLRVVVQVLFFEQVRVAASSGSSTPDLPK  516

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
             +KDLN  S+GSSRSA T  EEDWD VA+A+EL+ALKGELAALRL N       NG   +
Sbjct  517  GLKDLNSGSHGSSRSAATNPEEDWDAVATAEELKALKGELAALRLSNGVGGSERNGVDGR  576

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSR  255
               S DK AAISKMKGLL SKRIF+KIWSSKG  GENSGSDSSESLGS   EEAKSTPSR
Sbjct  577  N--SVDK-AAISKMKGLLKSKRIFTKIWSSKGAQGENSGSDSSESLGSANPEEAKSTPSR  633

Query  254  KGRYSVS  234
              R+SVS
Sbjct  634  NRRHSVS  640



>ref|XP_008236444.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Prunus 
mume]
Length=626

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 157/188 (84%), Gaps = 5/188 (3%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRIC+LMDCKKLS DACMHAVQNERLPLRVVVQVLFFEQVRA ASSGSSTPDLPK
Sbjct  443  SKSERKRICKLMDCKKLSVDACMHAVQNERLPLRVVVQVLFFEQVRAAASSGSSTPDLPK  502

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
             +KDLN  S+GSSRSATT TEEDWD VASA+EL+ALKGELA+LRL +       NGD   
Sbjct  503  GMKDLNNGSHGSSRSATTNTEEDWDAVASAEELKALKGELASLRLSSGVGGSEKNGDGKG  562

Query  434  TVASSDKAAAISKMKGLLVS-KRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPS  258
            +V   DK AA+SKM+GLL S K++F+K+WSSKG  GENSGSDSSESLGS   EEAKSTPS
Sbjct  563  SV---DK-AAVSKMRGLLKSKKKVFAKLWSSKGVQGENSGSDSSESLGSANPEEAKSTPS  618

Query  257  RKGRYSVS  234
            R  R+SVS
Sbjct  619  RNRRHSVS  626



>emb|CBI22467.3| unnamed protein product [Vitis vinifera]
Length=526

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 130/149 (87%), Gaps = 5/149 (3%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRICRLMDCKKLS DACMHAVQNERLPLRVVVQVLFFEQVRA A+SGSSTPDLPK
Sbjct  345  SKSERKRICRLMDCKKLSVDACMHAVQNERLPLRVVVQVLFFEQVRATATSGSSTPDLPK  404

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNA-GMADRANGDTT  438
             IKDLN AS+GSSRS TT TEEDWD VA+ +EL+ALKGELA+LRLGN  G ++R  GD+ 
Sbjct  405  GIKDLNSASHGSSRSVTTNTEEDWDAVATLEELKALKGELASLRLGNGVGASERNGGDSK  464

Query  437  KTVASSDKAAAISKMKGLLVSKRIFSKIW  351
             ++   DK AAI+KMKGLL+SK+IF+K+W
Sbjct  465  GSI---DK-AAINKMKGLLMSKKIFTKLW  489



>ref|XP_009335385.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Pyrus 
x bretschneideri]
 ref|XP_009335386.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Pyrus 
x bretschneideri]
Length=617

 Score =   230 bits (586),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 159/187 (85%), Gaps = 7/187 (4%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRIC+LMDCKKLS DACMHAVQNERLPLRVVVQVLFFEQVRA ASSGSSTPDLPK
Sbjct  438  SKSERKRICKLMDCKKLSVDACMHAVQNERLPLRVVVQVLFFEQVRAAASSGSSTPDLPK  497

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
             +KDLN  S+GSSRSATT TEEDWD VASA+ELRAL+GELA+LRL ++G+    +G +  
Sbjct  498  GMKDLNSGSHGSSRSATTNTEEDWDAVASAEELRALRGELASLRL-SSGVGACKDGKS--  554

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSR  255
               S DK AA++KM+GLL SK+IF+K+WSSKG  GENSGSDSSESLGS   EEAKSTPSR
Sbjct  555  ---SVDK-AAVNKMRGLLKSKKIFAKLWSSKGVQGENSGSDSSESLGSANPEEAKSTPSR  610

Query  254  KGRYSVS  234
              R+SVS
Sbjct  611  NRRHSVS  617



>ref|XP_009347119.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Pyrus 
x bretschneideri]
Length=626

 Score =   229 bits (585),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 161/189 (85%), Gaps = 7/189 (4%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERK+IC+LMDCKKLSADAC+HAVQNERLPLRVVVQVLFFEQVRA ASSGSSTPDLPK
Sbjct  443  SKSERKKICKLMDCKKLSADACVHAVQNERLPLRVVVQVLFFEQVRAAASSGSSTPDLPK  502

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNA-GMADRANGDTT  438
             +KDLN  S+GSS SATT TEEDWD VASA+ELRALKGELA+LRL +  G+ DR NGD  
Sbjct  503  GMKDLNSGSHGSSISATTNTEEDWDAVASAEELRALKGELASLRLSSGVGLCDR-NGDGK  561

Query  437  KTVASSDKAAAISKMKGLLVS-KRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
             +V   DK AA+SKM+GLL S K+IF+K+WSSKG  GENSGSDSSESLGS   EEAKSTP
Sbjct  562  GSV---DK-AAVSKMRGLLKSKKKIFAKLWSSKGVQGENSGSDSSESLGSGNPEEAKSTP  617

Query  260  SRKGRYSVS  234
            SR  R+SVS
Sbjct  618  SRNRRHSVS  626



>ref|XP_007201732.1| hypothetical protein PRUPE_ppa002913mg [Prunus persica]
 gb|EMJ02931.1| hypothetical protein PRUPE_ppa002913mg [Prunus persica]
Length=622

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 156/188 (83%), Gaps = 5/188 (3%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRIC+LMDCKKLS DACMHAVQNERLPLRVVVQVLFFEQVRA ASSGSSTPDLPK
Sbjct  439  SKSERKRICKLMDCKKLSVDACMHAVQNERLPLRVVVQVLFFEQVRAAASSGSSTPDLPK  498

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
             +KDLN  S+GSSRS TT TEEDWD VASA+EL+ALKGELA+LRL +       NGD   
Sbjct  499  GMKDLNNGSHGSSRSVTTNTEEDWDAVASAEELKALKGELASLRLSSGVGGGEKNGDGKG  558

Query  434  TVASSDKAAAISKMKGLLVS-KRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPS  258
            +V   DK AA+SKM+GLL S K++F+K+WSSKG  GENSGSDSSESLGS   EEAKSTPS
Sbjct  559  SV---DK-AAVSKMRGLLKSKKKVFAKLWSSKGVQGENSGSDSSESLGSANPEEAKSTPS  614

Query  257  RKGRYSVS  234
            R  R+SVS
Sbjct  615  RNRRHSVS  622



>ref|XP_008346361.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Malus 
domestica]
 ref|XP_008346362.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Malus 
domestica]
Length=626

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 158/188 (84%), Gaps = 5/188 (3%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRIC+LMDCKKLS DACMHAVQNERLPLRVVVQVLFFEQVRA ASSG+STPDLPK
Sbjct  443  SKSERKRICKLMDCKKLSVDACMHAVQNERLPLRVVVQVLFFEQVRAAASSGNSTPDLPK  502

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
             +KDLN  S+GSSRSATT TEEDWD VASA+ELRALKGELA+LRL ++  A   NGD   
Sbjct  503  GMKDLNSGSHGSSRSATTNTEEDWDAVASAEELRALKGELASLRLSSSVGACNRNGDXKS  562

Query  434  TVASSDKAAAISKMKGLLVS-KRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPS  258
            +V   DK AA+SKM+GLL S K+IF+K+WSSKG  GENSGSDSSESLGS   EEAKST S
Sbjct  563  SV---DK-AAVSKMRGLLKSKKKIFAKLWSSKGVQGENSGSDSSESLGSANPEEAKSTHS  618

Query  257  RKGRYSVS  234
            R  R+SVS
Sbjct  619  RNRRHSVS  626



>ref|XP_008366255.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Malus domestica]
Length=626

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 160/189 (85%), Gaps = 7/189 (4%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERK+IC+LMDCKKLS DAC+HAVQNERLPLRVVVQVLFFEQVRA ASSGSSTPDLPK
Sbjct  443  SKSERKKICKLMDCKKLSVDACVHAVQNERLPLRVVVQVLFFEQVRAAASSGSSTPDLPK  502

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNA-GMADRANGDTT  438
             +KDLN  S+GSSR+ATT TEEDWD VASA+ELRALKGELA+LRL +  G  DR NGD  
Sbjct  503  GMKDLNSGSHGSSRTATTNTEEDWDAVASAEELRALKGELASLRLSSGVGSCDR-NGDGK  561

Query  437  KTVASSDKAAAISKMKGLLVS-KRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
             +V   DK AA+SKM+GLL S K+IF+K+WSSKG  GENSGSDSSESLGS   EEAKSTP
Sbjct  562  GSV---DK-AAVSKMRGLLKSKKKIFAKLWSSKGVQGENSGSDSSESLGSGNPEEAKSTP  617

Query  260  SRKGRYSVS  234
            SR  R+SVS
Sbjct  618  SRNRRHSVS  626



>ref|XP_004289798.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011457862.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Fragaria vesca 
subsp. vesca]
Length=621

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 157/188 (84%), Gaps = 9/188 (5%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRIC+LMDCKKLS +ACMHAVQNERLPLRVVVQVLFFEQVRA ASSG+STPDLPK
Sbjct  442  SKSERKRICKLMDCKKLSVEACMHAVQNERLPLRVVVQVLFFEQVRAAASSGTSTPDLPK  501

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
             +KDLN  S+GSSRSATT TEEDWD VASA+ELRALKGELA+LRL ++      NGD   
Sbjct  502  GMKDLNSGSHGSSRSATTNTEEDWDAVASAEELRALKGELASLRLASS----ERNGDGKS  557

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEE-AKSTPS  258
             V   DK AA+SKM+GLL SK++F+K++SSKGG GENSGSDSS SLGS   EE AKSTPS
Sbjct  558  NV---DK-AAVSKMRGLLNSKKVFAKLFSSKGGQGENSGSDSSGSLGSANPEEAAKSTPS  613

Query  257  RKGRYSVS  234
            R  R+SVS
Sbjct  614  RNRRHSVS  621



>ref|XP_009626485.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
tomentosiformis]
Length=614

 Score =   221 bits (564),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 153/188 (81%), Gaps = 10/188 (5%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SK +RKRIC LMDCKKLS DAC HAVQNERLP RVVVQVLFFEQVRANASSG STPDLPK
Sbjct  436  SKIDRKRICGLMDCKKLSVDACTHAVQNERLPSRVVVQVLFFEQVRANASSGCSTPDLPK  495

Query  614  AIKDLNCA-SYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTT  438
            AI+DL    SY SSRSATT T ED +  ASA+ELRALK ELAAL+L N G+ D+ NGDT 
Sbjct  496  AIRDLTAGVSYASSRSATTNT-EDSEVTASAEELRALKEELAALKLQNGGLIDKVNGDT-  553

Query  437  KTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPS  258
                   K AA S+MKGLL SKRIFS+IWSSKGG GENSGSDSSESLGS ++EEAK TPS
Sbjct  554  -------KRAATSRMKGLLSSKRIFSRIWSSKGGQGENSGSDSSESLGSASLEEAKYTPS  606

Query  257  RKGRYSVS  234
            RKGR+SVS
Sbjct  607  RKGRHSVS  614



>ref|XP_009776135.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
sylvestris]
Length=614

 Score =   221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 154/188 (82%), Gaps = 10/188 (5%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKS+RKRIC LMDCKKLS +AC HAVQNERLP RVVVQVLFFEQVRANASSG STPDLPK
Sbjct  436  SKSDRKRICGLMDCKKLSVNACTHAVQNERLPSRVVVQVLFFEQVRANASSGCSTPDLPK  495

Query  614  AIKDLNCA-SYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTT  438
            AI+DL    SY SSRSATT T ED +  ASA+ELRALK ELAAL+L N G+ D+ NGDT 
Sbjct  496  AIRDLTAGVSYESSRSATTNT-EDSEVTASAEELRALKEELAALKLQNGGLIDKVNGDT-  553

Query  437  KTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPS  258
                   K AA S+MKGLL SKRIFS+IWSSKGG GENSGSDSSESLGS ++EEAK TPS
Sbjct  554  -------KRAATSRMKGLLSSKRIFSRIWSSKGGQGENSGSDSSESLGSASLEEAKYTPS  606

Query  257  RKGRYSVS  234
            RKGR+SVS
Sbjct  607  RKGRHSVS  614



>ref|XP_011092512.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Sesamum indicum]
Length=624

 Score =   219 bits (558),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 153/187 (82%), Gaps = 6/187 (3%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSE+KRIC+LMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQ RA  SSG STPDL K
Sbjct  444  NKSEKKRICKLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQARAATSSGCSTPDLAK  503

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
            A+KDLNC SY SSRSAT   +EDW+ +ASA+ELR L+GELAA RLGN   +DR++ +   
Sbjct  504  AVKDLNCGSYRSSRSATANADEDWEAIASAEELRTLRGELAAFRLGN---SDRSSAEN--  558

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSR  255
             ++++DK  AI KMKGL++SK++ SKIWS+K G  ENSGSDSS+SLGST  ++ K TP R
Sbjct  559  RMSNADK-TAIGKMKGLIMSKKMLSKIWSNKVGQAENSGSDSSDSLGSTNQDDVKCTPPR  617

Query  254  KGRYSVS  234
            KGR SVS
Sbjct  618  KGRNSVS  624



>ref|XP_011092513.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Sesamum indicum]
Length=623

 Score =   219 bits (557),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 153/187 (82%), Gaps = 6/187 (3%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSE+KRIC+LMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQ RA  SSG STPDL K
Sbjct  443  NKSEKKRICKLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQARAATSSGCSTPDLAK  502

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
            A+KDLNC SY SSRSAT   +EDW+ +ASA+ELR L+GELAA RLGN   +DR++ +   
Sbjct  503  AVKDLNCGSYRSSRSATANADEDWEAIASAEELRTLRGELAAFRLGN---SDRSSAEN--  557

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSR  255
             ++++DK  AI KMKGL++SK++ SKIWS+K G  ENSGSDSS+SLGST  ++ K TP R
Sbjct  558  RMSNADK-TAIGKMKGLIMSKKMLSKIWSNKVGQAENSGSDSSDSLGSTNQDDVKCTPPR  616

Query  254  KGRYSVS  234
            KGR SVS
Sbjct  617  KGRNSVS  623



>gb|KHF97345.1| BTB/POZ domain-containing NPY5 -like protein [Gossypium arboreum]
Length=549

 Score =   216 bits (549),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 150/189 (79%), Gaps = 12/189 (6%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANA--SSGSSTPDL  621
            SKSERKRIC+LMDCKKLSADACMHAVQNERLPLRVV+QVLFF+Q+R  A  SSG+STPDL
Sbjct  371  SKSERKRICKLMDCKKLSADACMHAVQNERLPLRVVIQVLFFKQLRGAAATSSGTSTPDL  430

Query  620  PKAIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
            PK++K+ N  S+GSSRSA T  EEDWD V++ +EL+ALK ELAALRL       R  GD 
Sbjct  431  PKSLKNANGGSHGSSRSAPTNPEEDWDSVSATEELKALKTELAALRL-------RNRGDI  483

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
               V   D AAAISKMKGL+ SKRIF+KIWSSK   GENSGSDSSESLGS   EEAKSTP
Sbjct  484  RNNV---DNAAAISKMKGLMKSKRIFTKIWSSKAAIGENSGSDSSESLGSANPEEAKSTP  540

Query  260  SRKGRYSVS  234
            SR  R+SVS
Sbjct  541  SRNRRHSVS  549



>gb|KJB32266.1| hypothetical protein B456_005G232400 [Gossypium raimondii]
Length=619

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 150/189 (79%), Gaps = 12/189 (6%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANA--SSGSSTPDL  621
            SKSE+KRIC+LMDCKKLSADACMHAVQNERLPLRVV+QVLFFEQ+R  A  SSG+STPDL
Sbjct  441  SKSEQKRICKLMDCKKLSADACMHAVQNERLPLRVVIQVLFFEQLRGAAATSSGTSTPDL  500

Query  620  PKAIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
            PK++K+ N  S+GSSRSA T  EEDWD V++ +EL+ALK ELAALRL       R  GD 
Sbjct  501  PKSLKNPNGGSHGSSRSAPTNPEEDWDSVSATEELKALKPELAALRL-------RNRGDN  553

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
               V   D AAAISKMKGL+ SKRIF+KIWSSK   GENSGSDSSESLGS   EEAKSTP
Sbjct  554  RNNV---DNAAAISKMKGLMKSKRIFTKIWSSKAAIGENSGSDSSESLGSANPEEAKSTP  610

Query  260  SRKGRYSVS  234
            SR  R+SVS
Sbjct  611  SRNRRHSVS  619



>ref|XP_002300262.2| hypothetical protein POPTR_0001s30270g [Populus trichocarpa]
 gb|EEE85067.2| hypothetical protein POPTR_0001s30270g [Populus trichocarpa]
Length=599

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 148/187 (79%), Gaps = 14/187 (7%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRIC LMDCKKLS DACMHA+QN+RLPLRVVVQVLFFEQVR  ASSGSSTPDLPK
Sbjct  427  SKSERKRICNLMDCKKLSVDACMHAMQNDRLPLRVVVQVLFFEQVRVAASSGSSTPDLPK  486

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
            +I+DLN  S  SSRS TT TEEDWD VA+ADEL+ALK E+A+LRL N       NG    
Sbjct  487  SIRDLNNGSQRSSRSTTTNTEEDWDAVATADELKALKEEVASLRLANG-----RNG----  537

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSR  255
                 DKAA+ +K+KG+L SK+IF+K+WS+KG  GE SGSDSSES GS  MEEAKSTPSR
Sbjct  538  ----VDKAAS-NKLKGMLKSKKIFTKLWSNKGEKGEKSGSDSSESTGSANMEEAKSTPSR  592

Query  254  KGRYSVS  234
              R+SVS
Sbjct  593  NRRHSVS  599



>ref|XP_006486926.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006486927.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Citrus sinensis]
 ref|XP_006486928.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X3 [Citrus sinensis]
Length=619

 Score =   215 bits (548),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 150/187 (80%), Gaps = 9/187 (5%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERK+IC+LMDC+KLS DACMHAVQNERLPLRVVVQVLFFEQVR  A+SGSSTPDLP+
Sbjct  442  SKSERKKICKLMDCRKLSVDACMHAVQNERLPLRVVVQVLFFEQVRVAAASGSSTPDLPR  501

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
             +KDLN  S  SSRSA T  EEDWD VA+A+EL+ALKGELAALRL N       NG    
Sbjct  502  GLKDLNNGSRRSSRSAATNPEEDWDAVATAEELKALKGELAALRLSNGVGGSERNG----  557

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSR  255
                SDK AAI+KMKGLL SK+IF+K+++SKGG GENSGSDSSES+GS  +EE KSTPSR
Sbjct  558  ----SDK-AAITKMKGLLKSKKIFAKLFTSKGGQGENSGSDSSESVGSAVLEETKSTPSR  612

Query  254  KGRYSVS  234
              R SVS
Sbjct  613  NRRNSVS  619



>gb|KDO57872.1| hypothetical protein CISIN_1g007080mg [Citrus sinensis]
Length=619

 Score =   215 bits (548),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 150/187 (80%), Gaps = 9/187 (5%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERK+IC+LMDC+KLS DACMHAVQNERLPLRVVVQVLFFEQVR  A+SGSSTPDLP+
Sbjct  442  SKSERKKICKLMDCRKLSVDACMHAVQNERLPLRVVVQVLFFEQVRVAAASGSSTPDLPR  501

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
             +KDLN  S  SSRSA T  EEDWD VA+A+EL+ALKGELAALRL N       NG    
Sbjct  502  GLKDLNNGSRRSSRSAATNPEEDWDAVATAEELKALKGELAALRLSNGVGGSERNG----  557

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSR  255
                SDK AAI+KMKGLL SK+IF+K+++SKGG GENSGSDSSES+GS  +EE KSTPSR
Sbjct  558  ----SDK-AAITKMKGLLKSKKIFAKLFTSKGGQGENSGSDSSESVGSAVLEETKSTPSR  612

Query  254  KGRYSVS  234
              R SVS
Sbjct  613  NRRNSVS  619



>ref|XP_006422840.1| hypothetical protein CICLE_v10028033mg [Citrus clementina]
 gb|ESR36080.1| hypothetical protein CICLE_v10028033mg [Citrus clementina]
Length=619

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 150/187 (80%), Gaps = 9/187 (5%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERK+IC+LMDC+KLS DACMHAVQNERLPLRVVVQVLFFEQVR  A+SGSSTPDLP+
Sbjct  442  SKSERKKICKLMDCRKLSVDACMHAVQNERLPLRVVVQVLFFEQVRVAAASGSSTPDLPR  501

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
             +KDLN  S  SSRSA T  EEDWD VA+A+EL+ALKGELAALRL N       NG    
Sbjct  502  GLKDLNNGSRRSSRSAATNPEEDWDAVATAEELKALKGELAALRLSNGVGGSERNG----  557

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSR  255
                SDK AAI+KMKGLL SK+IF+K+++SKGG GENSGSDSSESLGS  +EE KSTPSR
Sbjct  558  ----SDK-AAITKMKGLLKSKKIFAKLFTSKGGQGENSGSDSSESLGSAILEETKSTPSR  612

Query  254  KGRYSVS  234
              R SVS
Sbjct  613  NRRNSVS  619



>ref|XP_011030353.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Populus 
euphratica]
 ref|XP_011030354.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Populus 
euphratica]
 ref|XP_011030355.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Populus 
euphratica]
 ref|XP_011030356.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Populus 
euphratica]
Length=614

 Score =   214 bits (545),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 149/187 (80%), Gaps = 14/187 (7%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRIC+LMDCKKLS DACMHA+QN+RLPLRVVVQVLFFEQVR  ASSGSSTPDLPK
Sbjct  442  SKSERKRICKLMDCKKLSVDACMHAMQNDRLPLRVVVQVLFFEQVRVAASSGSSTPDLPK  501

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
            +I+DLN  S  SSRS TT TEEDWD VA+A+EL+ALK E+A+LRL N       NG    
Sbjct  502  SIRDLNNGSQRSSRSTTTNTEEDWDAVATAEELKALKEEVASLRLANG-----RNG----  552

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSR  255
                 DKAA+ +K+KG+L SK+IF+K+WSS+G  GE SGSDSSES GS  MEEAKSTPSR
Sbjct  553  ----VDKAAS-NKLKGMLKSKKIFTKLWSSRGEKGEKSGSDSSESTGSANMEEAKSTPSR  607

Query  254  KGRYSVS  234
              R+SVS
Sbjct  608  NRRHSVS  614



>gb|KJB32267.1| hypothetical protein B456_005G232400 [Gossypium raimondii]
Length=680

 Score =   215 bits (547),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 150/189 (79%), Gaps = 12/189 (6%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANA--SSGSSTPDL  621
            SKSE+KRIC+LMDCKKLSADACMHAVQNERLPLRVV+QVLFFEQ+R  A  SSG+STPDL
Sbjct  502  SKSEQKRICKLMDCKKLSADACMHAVQNERLPLRVVIQVLFFEQLRGAAATSSGTSTPDL  561

Query  620  PKAIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
            PK++K+ N  S+GSSRSA T  EEDWD V++ +EL+ALK ELAALRL       R  GD 
Sbjct  562  PKSLKNPNGGSHGSSRSAPTNPEEDWDSVSATEELKALKPELAALRL-------RNRGDN  614

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
               V   D AAAISKMKGL+ SKRIF+KIWSSK   GENSGSDSSESLGS   EEAKSTP
Sbjct  615  RNNV---DNAAAISKMKGLMKSKRIFTKIWSSKAAIGENSGSDSSESLGSANPEEAKSTP  671

Query  260  SRKGRYSVS  234
            SR  R+SVS
Sbjct  672  SRNRRHSVS  680



>ref|XP_004248766.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Solanum 
lycopersicum]
Length=611

 Score =   211 bits (538),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 139/187 (74%), Gaps = 12/187 (6%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SK++RKRIC LMDCKKLS DAC HAVQN+RLP RVVVQVLFFEQVRANASSGSSTPDLPK
Sbjct  437  SKNDRKRICCLMDCKKLSVDACTHAVQNDRLPSRVVVQVLFFEQVRANASSGSSTPDLPK  496

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
            AI+DL  ASYGSSRSA T TE   +  ASA+ELRALK ELAALRL N G+    NGDT +
Sbjct  497  AIRDLTSASYGSSRSAITNTENS-EVTASAEELRALKEELAALRLANGGL----NGDTKR  551

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSR  255
             V   DKA    +MK +L SK+IF+KIW      G     ++S S    ++EEAK TPSR
Sbjct  552  HV---DKATN-GRMKSILSSKKIFTKIW---SSKGRRKQGENSGSDSPDSLEEAKYTPSR  604

Query  254  KGRYSVS  234
            KGRYSVS
Sbjct  605  KGRYSVS  611



>ref|XP_010065907.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Eucalyptus 
grandis]
 ref|XP_010065908.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Eucalyptus 
grandis]
 ref|XP_010065909.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Eucalyptus 
grandis]
 ref|XP_010065910.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Eucalyptus 
grandis]
 ref|XP_010065911.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Eucalyptus 
grandis]
 ref|XP_010065912.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Eucalyptus 
grandis]
 gb|KCW63621.1| hypothetical protein EUGRSUZ_G01249 [Eucalyptus grandis]
Length=625

 Score =   211 bits (538),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 153/191 (80%), Gaps = 9/191 (5%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSERKRIC+LMDCKKLS DACMHAVQNERLPLRVVVQVLFFEQVR  ASSGSSTPDLPK
Sbjct  440  TKSERKRICKLMDCKKLSVDACMHAVQNERLPLRVVVQVLFFEQVRVAASSGSSTPDLPK  499

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRL--GNAGMADRANGDT  441
            ++++LN  S+GSSRSA T TEEDWD VA+A+EL+ALK ELA+LRL  G  G  +R NG+ 
Sbjct  500  SLRELNNGSHGSSRSANTNTEEDWDAVATAEELKALKTELASLRLSIGARGGPER-NGEG  558

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsses--lgSTTMEEAKS  267
               V   DK AAI+KMKGLL SK++F K++SSK  +  NSGSDSSES   G+  ++E KS
Sbjct  559  KPNV---DK-AAITKMKGLLRSKKVFMKMFSSKSQSENNSGSDSSESLGSGNGNVDEVKS  614

Query  266  TPSRKGRYSVS  234
            TPS+  RYSVS
Sbjct  615  TPSQNRRYSVS  625



>ref|XP_002284345.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Vitis vinifera]
 ref|XP_010652712.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Vitis vinifera]
 ref|XP_010652713.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Vitis vinifera]
 ref|XP_010652714.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Vitis vinifera]
 ref|XP_010652715.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Vitis vinifera]
 ref|XP_010652716.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Vitis vinifera]
Length=629

 Score =   211 bits (537),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 149/191 (78%), Gaps = 4/191 (2%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            SKSERKRICRLMDCKKLS DACMHAVQNERLPLRVVVQVLFFEQVRA  SS GSSTPDLP
Sbjct  439  SKSERKRICRLMDCKKLSTDACMHAVQNERLPLRVVVQVLFFEQVRAATSSAGSSTPDLP  498

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGN--AGMADRANG  447
             +++  L   S+GSSRSATT TEE+WD V +A+EL+ALKGELA LRLG    G +DR+  
Sbjct  499  GSVRALLPGGSHGSSRSATTNTEEEWDAVPTAEELKALKGELATLRLGAGVGGGSDRSGN  558

Query  446  DTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKS  267
            +      S+ +  A SK+KGLL+SK+IFS++WSSK   GENS SD+SES GS   EE KS
Sbjct  559  ELNDGPKSNAENVAASKVKGLLMSKKIFSRLWSSKEKLGENSSSDTSESPGSANAEETKS  618

Query  266  TPSRKGRYSVS  234
            TPSR  R+SVS
Sbjct  619  TPSRSRRHSVS  629



>gb|EPS65621.1| hypothetical protein M569_09155 [Genlisea aurea]
Length=591

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 139/187 (74%), Gaps = 17/187 (9%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKS+RK+ICRLM+CKKLSA+A +HAVQNERLPLRVVVQV+FFEQVRA ASSGS+TP+LPK
Sbjct  422  SKSDRKKICRLMECKKLSAEASLHAVQNERLPLRVVVQVIFFEQVRAAASSGSTTPELPK  481

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
            AIKDLN  S GSSRSA T  +EDWD VASA+ELRAL+GELAALRL N G+AD+A      
Sbjct  482  AIKDLNYGSCGSSRSA-TNADEDWDAVASAEELRALRGELAALRLSNNGVADKATA----  536

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSR  255
                        K KGL++SKRI SKIW S    G+    ++      +  E+AK+TP+R
Sbjct  537  -----------GKAKGLVLSKRILSKIW-SSSKGGQQQNENTGSDSSGSVGEDAKTTPAR  584

Query  254  KGRYSVS  234
            +GR+SVS
Sbjct  585  RGRHSVS  591



>ref|XP_004156852.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
NPY2-like [Cucumis sativus]
Length=626

 Score =   210 bits (534),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 145/187 (78%), Gaps = 5/187 (3%)
 Frame = -3

Query  791  KSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPKA  612
            KS++KRIC+L+DCKKLSADAC+HAVQNERLPLR+VVQVLFFEQVRA+ASSGSSTPDLPKA
Sbjct  444  KSDKKRICKLIDCKKLSADACIHAVQNERLPLRMVVQVLFFEQVRASASSGSSTPDLPKA  503

Query  611  IKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTKT  432
            IKDL   S+ SSRSATT  EEDWD VA A+EL+ALKGELA+LRL N   +   NGD    
Sbjct  504  IKDLTSGSHSSSRSATTNPEEDWDAVAMAEELKALKGELASLRLANGRGSSERNGDGKNG  563

Query  431  VASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgST-TMEEAKSTPSR  255
            +   DK AA+SKMKGLL SK++F+K+WSSKGG    +    S     +   EEAKSTPSR
Sbjct  564  I---DK-AALSKMKGLLKSKKLFTKLWSSKGGGYGENSGSDSSESLGSANQEEAKSTPSR  619

Query  254  KGRYSVS  234
              R+SVS
Sbjct  620  NRRHSVS  626



>ref|XP_004152268.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Cucumis 
sativus]
 gb|KGN52773.1| hypothetical protein Csa_4G000910 [Cucumis sativus]
Length=626

 Score =   210 bits (534),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 145/187 (78%), Gaps = 5/187 (3%)
 Frame = -3

Query  791  KSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPKA  612
            KS++KRIC+L+DCKKLSADAC+HAVQNERLPLR+VVQVLFFEQVRA+ASSGSSTPDLPKA
Sbjct  444  KSDKKRICKLIDCKKLSADACIHAVQNERLPLRMVVQVLFFEQVRASASSGSSTPDLPKA  503

Query  611  IKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTKT  432
            IKDL   S+ SSRSATT  EEDWD VA A+EL+ALKGELA+LRL N   +   NGD    
Sbjct  504  IKDLTSGSHSSSRSATTNPEEDWDAVAMAEELKALKGELASLRLANGRGSSERNGDGKNG  563

Query  431  VASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgST-TMEEAKSTPSR  255
            +   DK AA+SKMKGLL SK++F+K+WSSKGG    +    S     +   EEAKSTPSR
Sbjct  564  I---DK-AALSKMKGLLKSKKLFTKLWSSKGGGYGENSGSDSSESLGSANQEEAKSTPSR  619

Query  254  KGRYSVS  234
              R+SVS
Sbjct  620  NRRHSVS  626



>ref|XP_007047503.1| Phototropic-responsive NPH3 family protein isoform 4 [Theobroma 
cacao]
 ref|XP_007047504.1| Phototropic-responsive NPH3 family protein isoform 4 [Theobroma 
cacao]
 gb|EOX91660.1| Phototropic-responsive NPH3 family protein isoform 4 [Theobroma 
cacao]
 gb|EOX91661.1| Phototropic-responsive NPH3 family protein isoform 4 [Theobroma 
cacao]
Length=532

 Score =   206 bits (525),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 151/188 (80%), Gaps = 6/188 (3%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRICRLMDC+KLSA+ACMHAVQNERLPLRVVVQVLFFEQVRA AS+G+STPDLP 
Sbjct  350  SKSERKRICRLMDCRKLSAEACMHAVQNERLPLRVVVQVLFFEQVRATASAGNSTPDLPG  409

Query  614  AIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTT  438
            +I+  L   S+GSSRS TT TEEDWD V +A++++ALKGEL  LRLG++G  DR   D  
Sbjct  410  SIRALLPGGSHGSSRSTTTNTEEDWDSVPTAEDIKALKGELVTLRLGSSG-TDRNGNDAA  468

Query  437  KTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPS  258
            K+ A  +K AA ++MKGL++SK IFSK+WSSK  +GE S SD+SES GS   EE KSTPS
Sbjct  469  KSDA--EKIAA-NRMKGLVMSK-IFSKLWSSKERHGEISSSDTSESPGSVNAEETKSTPS  524

Query  257  RKGRYSVS  234
            R  R+S+S
Sbjct  525  RSRRHSLS  532



>ref|XP_008454387.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Cucumis melo]
 ref|XP_008454388.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Cucumis melo]
Length=623

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 144/187 (77%), Gaps = 5/187 (3%)
 Frame = -3

Query  791  KSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPKA  612
            KS++KRIC+L+DCKKLSADAC+HAVQNERLPLR+VVQVLFFEQVRA+ASSG STPDLPKA
Sbjct  441  KSDKKRICKLIDCKKLSADACIHAVQNERLPLRMVVQVLFFEQVRASASSGCSTPDLPKA  500

Query  611  IKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTKT  432
            IKDL   S+ SSRSATT  EEDWD VA A+EL+ALKGELA+LRL N   +   NGD    
Sbjct  501  IKDLTSGSHSSSRSATTNPEEDWDAVAMAEELKALKGELASLRLANGRGSSERNGDGKNG  560

Query  431  VASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgST-TMEEAKSTPSR  255
            +   DK AA+SKMKGLL SK++F+K+WSSKGG    +    S     +   EEAKSTPSR
Sbjct  561  I---DK-AALSKMKGLLKSKKLFTKLWSSKGGGYGENSGSDSSESLGSANQEEAKSTPSR  616

Query  254  KGRYSVS  234
              R+SVS
Sbjct  617  NRRHSVS  623



>ref|XP_007047500.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007047501.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007047502.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91657.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91658.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91659.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
Length=622

 Score =   206 bits (524),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 151/188 (80%), Gaps = 6/188 (3%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRICRLMDC+KLSA+ACMHAVQNERLPLRVVVQVLFFEQVRA AS+G+STPDLP 
Sbjct  440  SKSERKRICRLMDCRKLSAEACMHAVQNERLPLRVVVQVLFFEQVRATASAGNSTPDLPG  499

Query  614  AIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTT  438
            +I+  L   S+GSSRS TT TEEDWD V +A++++ALKGEL  LRLG++G  DR   D  
Sbjct  500  SIRALLPGGSHGSSRSTTTNTEEDWDSVPTAEDIKALKGELVTLRLGSSG-TDRNGNDAA  558

Query  437  KTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPS  258
            K+ A  +K AA ++MKGL++SK IFSK+WSSK  +GE S SD+SES GS   EE KSTPS
Sbjct  559  KSDA--EKIAA-NRMKGLVMSK-IFSKLWSSKERHGEISSSDTSESPGSVNAEETKSTPS  614

Query  257  RKGRYSVS  234
            R  R+S+S
Sbjct  615  RSRRHSLS  622



>gb|KDP44480.1| hypothetical protein JCGZ_16313 [Jatropha curcas]
Length=623

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 152/186 (82%), Gaps = 7/186 (4%)
 Frame = -3

Query  791  KSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPKA  612
            KSERK+IC+LMDCKKLS DACMHAVQNERLPLRVVVQVLFFEQVRA A+SGSSTPDLPK 
Sbjct  445  KSERKKICKLMDCKKLSVDACMHAVQNERLPLRVVVQVLFFEQVRAAATSGSSTPDLPKG  504

Query  611  IKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTKT  432
            ++DLN  S+GSSRSA T  EEDWD VA+A+EL+ALK E+A+LRLGN   A+R  GD    
Sbjct  505  LRDLNNGSHGSSRSAVTNPEEDWDAVATAEELKALKAEIASLRLGN---AERNGGDGKNC  561

Query  431  VASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSRK  252
               +DKA   +K+KGLL SK+IF+K+WSSKG   ENSGSDSS+SLGS   EEAKSTPSR 
Sbjct  562  ---TDKATT-NKLKGLLKSKKIFTKLWSSKGEKSENSGSDSSDSLGSANPEEAKSTPSRN  617

Query  251  GRYSVS  234
             R+SVS
Sbjct  618  RRHSVS  623



>ref|XP_004511848.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Cicer 
arietinum]
Length=627

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 155/191 (81%), Gaps = 5/191 (3%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRA---NASSGSSTPD  624
            SKSERKRICRLMDC+KLSA+ACMHAVQNERLPLRVVVQVLFFEQ+RA   ++S G+STPD
Sbjct  438  SKSERKRICRLMDCRKLSAEACMHAVQNERLPLRVVVQVLFFEQLRATTTSSSGGTSTPD  497

Query  623  LPKAIKDLNC-ASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANG  447
            LP++I+ L+   S+GSSRS TT TEE+WD VA+A++++ LKGELAAL+L + G +DR + 
Sbjct  498  LPESIRALHPGGSHGSSRSTTTNTEEEWDTVATAEDIKVLKGELAALKLSSGGSSDRNSN  557

Query  446  DTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKS  267
                +  +++K AA +KMKG L+SK+IFSKIWS+K  NGE + SD+SES  ST +EE KS
Sbjct  558  SNDGSKGNAEKVAA-NKMKGFLMSKKIFSKIWSNKEKNGEITSSDTSESPASTVVEETKS  616

Query  266  TPSRKGRYSVS  234
            TPSR  R+SVS
Sbjct  617  TPSRSRRHSVS  627



>emb|CBI33702.3| unnamed protein product [Vitis vinifera]
Length=586

 Score =   202 bits (514),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 142/189 (75%), Gaps = 17/189 (9%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            SKSERKRICRLMDCKKLS DACMHAVQNERLPLRVVVQVLFFEQVRA  SS GSSTPDLP
Sbjct  413  SKSERKRICRLMDCKKLSTDACMHAVQNERLPLRVVVQVLFFEQVRAATSSAGSSTPDLP  472

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
             +++  L   S+GSSRSATT TEE+WD V +A+EL+ALKGELA LRLG    A+      
Sbjct  473  GSVRALLPGGSHGSSRSATTNTEEEWDAVPTAEELKALKGELATLRLGAGSNAEN-----  527

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
                       A SK+KGLL+SK+IFS++WSSK   GENS SD+SES GS   EE KSTP
Sbjct  528  ----------VAASKVKGLLMSKKIFSRLWSSKEKLGENSSSDTSESPGSANAEETKSTP  577

Query  260  SRKGRYSVS  234
            SR  R+SVS
Sbjct  578  SRSRRHSVS  586



>ref|XP_011001843.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Populus 
euphratica]
 ref|XP_011001851.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Populus 
euphratica]
 ref|XP_011001854.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Populus 
euphratica]
Length=613

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 148/187 (79%), Gaps = 15/187 (8%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRIC+LMDCKKLS DACMHAVQN+RLPLRVVVQVLFFEQVR  ASSGSSTPDLPK
Sbjct  442  SKSERKRICKLMDCKKLSVDACMHAVQNDRLPLRVVVQVLFFEQVRVAASSGSSTPDLPK  501

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
            +I+DLN  S  SSRSA T TE DWD VA+A+EL+ALK E+A+LRL N+      NG    
Sbjct  502  SIRDLNNGSQRSSRSANTNTEGDWDVVATAEELKALKEEVASLRLANS-----RNG----  552

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSR  255
                 DKA + SKM+G+L SK I +K+WSSKG  GENSGSDSSESLGS  MEEAKSTPSR
Sbjct  553  ----VDKAVS-SKMRGMLKSK-ILTKLWSSKGEKGENSGSDSSESLGSANMEEAKSTPSR  606

Query  254  KGRYSVS  234
              R+SVS
Sbjct  607  NIRHSVS  613



>ref|XP_007143108.1| hypothetical protein PHAVU_007G044300g [Phaseolus vulgaris]
 gb|ESW15102.1| hypothetical protein PHAVU_007G044300g [Phaseolus vulgaris]
Length=624

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 146/187 (78%), Gaps = 4/187 (2%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SK E+KRIC+LMDC+KLS DAC+HAVQNERLPLRVVVQVL+FEQ+R  ASSG+STPD+P+
Sbjct  442  SKGEKKRICKLMDCRKLSVDACLHAVQNERLPLRVVVQVLYFEQLRTAASSGTSTPDIPR  501

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
             IKDLN  S GSSRS TT  E++ D VA+A+EL+AL+ ELA+LRL N    +  +GD   
Sbjct  502  GIKDLNNESNGSSRSGTTNPEDELDAVATAEELKALRKELASLRLSNGVGNNDKDGDIK-  560

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSR  255
               S DK A I KMKGLL SKR F K+W+SKGG GENSGSDSSES+ S   EEAKSTPSR
Sbjct  561  --PSMDK-AVIGKMKGLLKSKRSFIKLWASKGGQGENSGSDSSESISSANPEEAKSTPSR  617

Query  254  KGRYSVS  234
              R+SVS
Sbjct  618  NRRHSVS  624



>ref|XP_010272331.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nelumbo 
nucifera]
 ref|XP_010272334.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nelumbo 
nucifera]
Length=629

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 149/192 (78%), Gaps = 10/192 (5%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKS+RK+ICRLMDCKKLS DACMHAVQNERLPLRVVVQVLFFEQVRA  S+G ST +L  
Sbjct  443  SKSDRKKICRLMDCKKLSVDACMHAVQNERLPLRVVVQVLFFEQVRAATSAGGSTSELSG  502

Query  614  AIK----DLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANG  447
            +++      N  S+GSSRSATT TEEDWD V +A+EL+ALKGELA+LRLG  G A   N 
Sbjct  503  SVRTSLPQENDGSHGSSRSATTNTEEDWDAVPTAEELKALKGELASLRLGGRGSARNGND  562

Query  446  DTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgST-TMEEAK  270
            D +    + DKAAA SK+KGLL+SK+IF+K+ SSKGG  ENS SD+S+S  ST  ME+ K
Sbjct  563  DKS----TIDKAAA-SKVKGLLMSKKIFTKLLSSKGGQSENSSSDTSDSPNSTNNMEDTK  617

Query  269  STPSRKGRYSVS  234
            STPSR  R+SVS
Sbjct  618  STPSRNRRHSVS  629



>ref|XP_010086948.1| BTB/POZ domain-containing protein NPY2 [Morus notabilis]
 gb|EXB25084.1| BTB/POZ domain-containing protein NPY2 [Morus notabilis]
Length=630

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 148/189 (78%), Gaps = 3/189 (2%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRICRLMDC+KLSA+ACMHAVQNERLPLRV VQVLFFEQVRA  S+G+STPDLP 
Sbjct  443  SKSERKRICRLMDCRKLSAEACMHAVQNERLPLRVAVQVLFFEQVRATTSAGNSTPDLPG  502

Query  614  AIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTT  438
            +I+  L   S+GSSRS TT TE+DWD V +A++++ALKG+LA LRLG   +   +N    
Sbjct  503  SIRALLPGGSHGSSRSTTTNTEDDWDSVPTAEDIKALKGKLATLRLGGGDVGVGSNRSGI  562

Query  437  KTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPS  258
                S+ + AA +K KGL++SKR+FSK+WSSK  +GENS S++SES GST  EE KSTPS
Sbjct  563  DGAKSNAERAAANK-KGLIMSKRLFSKLWSSKERSGENSSSETSESPGSTNAEETKSTPS  621

Query  257  -RKGRYSVS  234
             R GR+SVS
Sbjct  622  ARSGRHSVS  630



>gb|KHN42319.1| BTB/POZ domain-containing protein NPY2 [Glycine soja]
Length=623

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 147/187 (79%), Gaps = 4/187 (2%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +K E+KRIC+LMDC+KLS DAC+HAVQNERLPLRVVVQVL+FEQ+R  ASSG+STPDLP+
Sbjct  441  NKGEKKRICKLMDCRKLSVDACLHAVQNERLPLRVVVQVLYFEQLRTAASSGTSTPDLPR  500

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
             IKDLN  S GSSRS TT  E++ D VA+A+EL+AL+ ELA+LRL N    +  +GD   
Sbjct  501  GIKDLNNESNGSSRSGTTNPEDELDAVATAEELKALRKELASLRLSNGVGNNDKDGDNK-  559

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSR  255
               S DK A +SK+KGLL SK+ F KIW+SKGG GENSGSDSSES+ S   EEAKSTPSR
Sbjct  560  --PSMDK-AVMSKVKGLLKSKKSFIKIWASKGGQGENSGSDSSESMSSANPEEAKSTPSR  616

Query  254  KGRYSVS  234
              R+SVS
Sbjct  617  NRRHSVS  623



>ref|XP_008238083.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Prunus 
mume]
Length=628

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 124/151 (82%), Gaps = 5/151 (3%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRIC+LMDC+KLS DACMHAVQNERLPLRVVVQVLFFEQ+RA+AS G+STPDL  
Sbjct  439  SKSERKRICKLMDCRKLSTDACMHAVQNERLPLRVVVQVLFFEQIRASASGGNSTPDLQG  498

Query  614  AIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNA--GMADRANGD  444
            +I+  L   S+GSSRS TT TEEDWD V +A+E++ALKGELA LRLG+A  G+ +  N +
Sbjct  499  SIRALLPGGSHGSSRSTTTNTEEDWDAVPTAEEIKALKGELATLRLGDANRGVGNDRNAN  558

Query  443  TTKTVASSDKAAAISKMKGLLVSKRIFSKIW  351
               T  +S+K AA SKMKGLL+SK+IFSK+W
Sbjct  559  HGAT-NNSEKVAA-SKMKGLLMSKKIFSKLW  587



>ref|XP_007204979.1| hypothetical protein PRUPE_ppa002844mg [Prunus persica]
 gb|EMJ06178.1| hypothetical protein PRUPE_ppa002844mg [Prunus persica]
Length=628

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 124/151 (82%), Gaps = 5/151 (3%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRIC+LMDC+KLS DACMHAVQNERLPLRVVVQVLFFEQ+RA+AS G+STPDL  
Sbjct  439  SKSERKRICKLMDCRKLSTDACMHAVQNERLPLRVVVQVLFFEQIRASASGGNSTPDLQG  498

Query  614  AIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNA--GMADRANGD  444
            +I+  L   S+GSSRS TT TEEDWD V +A+E++ALKGELA LRLG+A  G+ +  N +
Sbjct  499  SIRALLPGGSHGSSRSTTTNTEEDWDAVPTAEEIKALKGELATLRLGDANRGVGNDRNAN  558

Query  443  TTKTVASSDKAAAISKMKGLLVSKRIFSKIW  351
               T  +S+K AA SKMKGLL+SK+IFSK+W
Sbjct  559  HGAT-NNSEKVAA-SKMKGLLMSKKIFSKLW  587



>ref|XP_002313906.1| phototropic-responsive NPH3 family protein [Populus trichocarpa]
 gb|EEE87861.1| phototropic-responsive NPH3 family protein [Populus trichocarpa]
Length=613

 Score =   198 bits (503),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 147/189 (78%), Gaps = 19/189 (10%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRIC+LMDCKKLS DACMHAVQN+RLPLRVVVQVLFFEQVR  ASSGSSTPDLPK
Sbjct  442  SKSERKRICKLMDCKKLSVDACMHAVQNDRLPLRVVVQVLFFEQVRVAASSGSSTPDLPK  501

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRL--GNAGMADRANGDT  441
            +I+DLN  S  SSRSA T TE DWD VA+A+EL+ALK E+A+LRL  G +G+        
Sbjct  502  SIRDLNNGSQRSSRSANTNTEGDWDVVATAEELKALKEEVASLRLATGRSGV--------  553

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
                   DKA   +KM+G+L SK I +K+WSSKG  GENSGSDSSESLGS  MEEAKSTP
Sbjct  554  -------DKAVN-NKMRGMLKSK-ILTKLWSSKGEKGENSGSDSSESLGSANMEEAKSTP  604

Query  260  SRKGRYSVS  234
            SR  R+SVS
Sbjct  605  SRNIRHSVS  613



>ref|XP_003536583.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Glycine max]
 ref|XP_006589617.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Glycine max]
 ref|XP_006589618.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X3 [Glycine max]
 ref|XP_006589619.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X4 [Glycine max]
 gb|KHN06801.1| BTB/POZ domain-containing protein NPY2 [Glycine soja]
Length=624

 Score =   198 bits (504),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 147/187 (79%), Gaps = 4/187 (2%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SK E+KRIC+LMDC+KLS DAC+HAVQNERLPLRVVVQVL+FEQ+R  ASSG+STPD+P+
Sbjct  442  SKGEKKRICKLMDCRKLSVDACLHAVQNERLPLRVVVQVLYFEQLRTAASSGTSTPDIPR  501

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
             IKDLN  S GSSRS TT  E++ D VA+A+EL+AL+ ELA+LRL N    +  +GDT  
Sbjct  502  GIKDLNNESNGSSRSGTTNPEDELDAVATAEELKALRKELASLRLSNGVGNNDKDGDTK-  560

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSR  255
               S DK A + K+KGLL SK+ F K+W+SKGG GENSGSDSSES+ S   EEAKSTPSR
Sbjct  561  --PSMDK-AVMGKVKGLLKSKKSFIKLWASKGGQGENSGSDSSESMSSANPEEAKSTPSR  617

Query  254  KGRYSVS  234
              R+SVS
Sbjct  618  NRRHSVS  624



>ref|XP_003555987.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Glycine max]
 ref|XP_006605997.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Glycine max]
Length=623

 Score =   198 bits (504),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 147/187 (79%), Gaps = 4/187 (2%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +K E+KRIC+LMDC+KLS DAC+HAVQNERLPLRVVVQVL+FEQ+R  ASSG+STPD+P+
Sbjct  441  NKGEKKRICKLMDCRKLSVDACLHAVQNERLPLRVVVQVLYFEQLRTAASSGTSTPDIPR  500

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
             IKDLN  S GSSRS TT  E++ D VA+A+EL+AL+ ELA+LRL N    +  +GD   
Sbjct  501  GIKDLNNESNGSSRSGTTNPEDELDAVATAEELKALRKELASLRLSNGVGNNDKDGDNK-  559

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSR  255
               S DK A +SK+KGLL SK+ F KIW+SKGG GENSGSDSSES+ S   EEAKSTPSR
Sbjct  560  --PSMDK-AVMSKVKGLLKSKKSFIKIWASKGGQGENSGSDSSESMSSANPEEAKSTPSR  616

Query  254  KGRYSVS  234
              R+SVS
Sbjct  617  NRRHSVS  623



>ref|XP_006353967.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Solanum 
tuberosum]
Length=610

 Score =   196 bits (498),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 141/187 (75%), Gaps = 13/187 (7%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SK++RKRIC LMDCKKLS DAC HAVQNERLP RVVVQVLFFEQVRANASSGSSTPDLPK
Sbjct  437  SKNDRKRICCLMDCKKLSVDACTHAVQNERLPSRVVVQVLFFEQVRANASSGSSTPDLPK  496

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
            AI++L  ASY SSRSATT TE   +  ASA+ELRALK ELAALRL N G+    NGDT +
Sbjct  497  AIRNLTSASYASSRSATTNTENS-EVTASAEELRALKEELAALRLANGGL----NGDTKR  551

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSR  255
             V   DKAA   +MK +L SK+IF+KIW     +      ++S S  S ++EEAK TPSR
Sbjct  552  HV---DKAAN-GRMKSILSSKKIFTKIW----SSKGRKQGENSGSDSSDSLEEAKYTPSR  603

Query  254  KGRYSVS  234
            KGRYSVS
Sbjct  604  KGRYSVS  610



>ref|XP_002527501.1| signal transducer, putative [Ricinus communis]
 gb|EEF34899.1| signal transducer, putative [Ricinus communis]
Length=621

 Score =   196 bits (498),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 145/189 (77%), Gaps = 12/189 (6%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SK ERKRIC+LMDCKKLS DACMHAVQNERLPLRVVVQVLFFEQVR  A+SGSSTPDLP+
Sbjct  443  SKGERKRICKLMDCKKLSVDACMHAVQNERLPLRVVVQVLFFEQVRVAATSGSSTPDLPR  502

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
            +++DLN    GSSRSA T  EEDWD VA+ +EL+AL+ E+A+LR  N       NG   K
Sbjct  503  SLRDLN---NGSSRSAVTNLEEDWDAVATVEELKALRAEIASLRTSNG----ERNGGYGK  555

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWssk--ggngensgsdsseslgSTTMEEAKSTP  261
               S DK  +  KMKGLL SK+IF+K+WSSK  G  GENSGSDSS+SLGS   EEAKSTP
Sbjct  556  H--SIDKVTSY-KMKGLLKSKKIFAKLWSSKGGGEKGENSGSDSSDSLGSANPEEAKSTP  612

Query  260  SRKGRYSVS  234
            SR  R+SVS
Sbjct  613  SRNRRHSVS  621



>gb|KJB43897.1| hypothetical protein B456_007G222400 [Gossypium raimondii]
 gb|KJB43898.1| hypothetical protein B456_007G222400 [Gossypium raimondii]
Length=589

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 145/189 (77%), Gaps = 11/189 (6%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRIC+LMDC+KLSA+ACMHAVQNERLPLRVVVQVLFFEQVRA AS+ +ST DLP 
Sbjct  410  SKSERKRICKLMDCRKLSAEACMHAVQNERLPLRVVVQVLFFEQVRATASAENSTSDLPG  469

Query  614  AIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTT  438
            +I+  L   S+GSSRS TT TEEDWD V +AD+++ALKGELA LRLG        + D+ 
Sbjct  470  SIRALLPGGSHGSSRSTTTNTEEDWDSVPTADDIKALKGELATLRLG--------SNDSG  521

Query  437  KTVASSD-KAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
               A SD +  A S+MKGL++SK IFSK+WSSK  +GE S SD+S+S GS   EE KSTP
Sbjct  522  NEAAKSDVEKVAASRMKGLVMSK-IFSKLWSSKERHGEISSSDTSDSHGSVNAEETKSTP  580

Query  260  SRKGRYSVS  234
            SR  R+S+S
Sbjct  581  SRSRRHSLS  589



>gb|KJB43895.1| hypothetical protein B456_007G222400 [Gossypium raimondii]
 gb|KJB43896.1| hypothetical protein B456_007G222400 [Gossypium raimondii]
 gb|KJB43900.1| hypothetical protein B456_007G222400 [Gossypium raimondii]
Length=619

 Score =   195 bits (496),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 145/189 (77%), Gaps = 11/189 (6%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRIC+LMDC+KLSA+ACMHAVQNERLPLRVVVQVLFFEQVRA AS+ +ST DLP 
Sbjct  440  SKSERKRICKLMDCRKLSAEACMHAVQNERLPLRVVVQVLFFEQVRATASAENSTSDLPG  499

Query  614  AIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTT  438
            +I+  L   S+GSSRS TT TEEDWD V +AD+++ALKGELA LRLG        + D+ 
Sbjct  500  SIRALLPGGSHGSSRSTTTNTEEDWDSVPTADDIKALKGELATLRLG--------SNDSG  551

Query  437  KTVASSD-KAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
               A SD +  A S+MKGL++SK IFSK+WSSK  +GE S SD+S+S GS   EE KSTP
Sbjct  552  NEAAKSDVEKVAASRMKGLVMSK-IFSKLWSSKERHGEISSSDTSDSHGSVNAEETKSTP  610

Query  260  SRKGRYSVS  234
            SR  R+S+S
Sbjct  611  SRSRRHSLS  619



>gb|KJB43899.1| hypothetical protein B456_007G222400 [Gossypium raimondii]
Length=623

 Score =   195 bits (496),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 145/189 (77%), Gaps = 11/189 (6%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRIC+LMDC+KLSA+ACMHAVQNERLPLRVVVQVLFFEQVRA AS+ +ST DLP 
Sbjct  444  SKSERKRICKLMDCRKLSAEACMHAVQNERLPLRVVVQVLFFEQVRATASAENSTSDLPG  503

Query  614  AIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTT  438
            +I+  L   S+GSSRS TT TEEDWD V +AD+++ALKGELA LRLG        + D+ 
Sbjct  504  SIRALLPGGSHGSSRSTTTNTEEDWDSVPTADDIKALKGELATLRLG--------SNDSG  555

Query  437  KTVASSD-KAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
               A SD +  A S+MKGL++SK IFSK+WSSK  +GE S SD+S+S GS   EE KSTP
Sbjct  556  NEAAKSDVEKVAASRMKGLVMSK-IFSKLWSSKERHGEISSSDTSDSHGSVNAEETKSTP  614

Query  260  SRKGRYSVS  234
            SR  R+S+S
Sbjct  615  SRSRRHSLS  623



>gb|KHG12565.1| BTB/POZ domain-containing NPY2 -like protein [Gossypium arboreum]
Length=619

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 144/188 (77%), Gaps = 9/188 (5%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRIC+LMDC+KLSA+ACMHAVQNERLPLRVVVQVLFFEQVRA AS+ +ST DLP 
Sbjct  440  SKSERKRICKLMDCRKLSAEACMHAVQNERLPLRVVVQVLFFEQVRATASAENSTSDLPG  499

Query  614  AIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTT  438
            +I+  L   S+GSSRS TT TEEDWD V +AD+++ALKGELA LRLG+    + A     
Sbjct  500  SIRALLPGGSHGSSRSTTTNTEEDWDSVPTADDIKALKGELATLRLGSNDSGNEAAKSEV  559

Query  437  KTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPS  258
            + VA+       S+MKGL++SK IFSK+WSSK  +GE S SD+S+S GS   EE KSTPS
Sbjct  560  EKVAA-------SRMKGLVMSK-IFSKLWSSKERHGEISSSDTSDSHGSVNAEETKSTPS  611

Query  257  RKGRYSVS  234
            R  R+S+S
Sbjct  612  RSRRHSLS  619



>ref|XP_003611607.1| BTB/POZ domain-containing protein [Medicago truncatula]
 gb|AES94565.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=630

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 151/193 (78%), Gaps = 6/193 (3%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRA---NASSGSSTPD  624
            SKSERKRICRLMDC+KLSA+ACMHAVQNERLPLRVVVQVLFFEQ+RA   ++S G+STPD
Sbjct  438  SKSERKRICRLMDCRKLSAEACMHAVQNERLPLRVVVQVLFFEQMRASTTSSSGGTSTPD  497

Query  623  LPKAIKDLNC-ASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAG--MADRA  453
            LP +I+ L+   S+GSSRS TT TEE+WD VA+A++++ LKGELAAL+L + G   +DR 
Sbjct  498  LPGSIRALHPGGSHGSSRSTTTNTEEEWDAVATAEDIKVLKGELAALKLSSGGSQSSDRN  557

Query  452  NGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEA  273
            + +       + +  A +KMKG L+SK++FSK+WSSK  NGE + SD+SES  ST +EE 
Sbjct  558  SNNNDGGGIGNAEKVAANKMKGFLMSKKLFSKLWSSKEKNGEITSSDTSESPASTVVEET  617

Query  272  KSTPSRKGRYSVS  234
            KSTPSR  R+SVS
Sbjct  618  KSTPSRSRRHSVS  630



>ref|XP_002525260.1| signal transducer, putative [Ricinus communis]
 gb|EEF37088.1| signal transducer, putative [Ricinus communis]
Length=488

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 145/191 (76%), Gaps = 13/191 (7%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVR-ANASSGSSTPDLP  618
            SKSERKRICRLMDC+KLSA+ACMHAVQNERLPLRVVVQVLFFEQVR A +S+G+STP+LP
Sbjct  307  SKSERKRICRLMDCRKLSAEACMHAVQNERLPLRVVVQVLFFEQVRQATSSAGNSTPELP  366

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLG--NAGMADRANG  447
              I+  L   S+GSSRS TT TEEDWD V +A++++ALKGEL  LRLG  +    D A  
Sbjct  367  GPIRALLPGGSHGSSRSTTTNTEEDWDAVPTAEDIKALKGELTTLRLGRSDTNANDGAKN  426

Query  446  DTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKS  267
            D  K        AA +KM+GL++SK IFSK+WS+K  NGE S +D+SES GS + E+ KS
Sbjct  427  DAEK--------AAANKMRGLVMSK-IFSKLWSNKERNGEISSTDTSESPGSASAEDTKS  477

Query  266  TPSRKGRYSVS  234
            TPSR  R+SVS
Sbjct  478  TPSRSRRHSVS  488



>ref|XP_009629742.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009629743.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009629744.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=627

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 143/189 (76%), Gaps = 5/189 (3%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            +KSERKRIC+LMDC+KLSA+ACMHAVQNERLPLRVVVQVLFFEQVRA  SS G STPDL 
Sbjct  442  TKSERKRICKLMDCRKLSAEACMHAVQNERLPLRVVVQVLFFEQVRATTSSGGGSTPDLH  501

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
              IK  L   S+GSSRSATT TEEDWD V +A+EL+ALKGELA LRL +    + +N   
Sbjct  502  GTIKALLPVESHGSSRSATTNTEEDWDAVPTAEELKALKGELATLRLRD---KEGSNDSN  558

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
             K +  S +  A  K KGL++SK+IFSK+WS+K    ENS SD+SES GS+   E+KSTP
Sbjct  559  LKDMKLSAEKVAGGKAKGLIMSKKIFSKLWSNKDRLSENSSSDTSESPGSSNAGESKSTP  618

Query  260  SRKGRYSVS  234
            SR  R+S+S
Sbjct  619  SRSRRHSLS  627



>gb|KDP32062.1| hypothetical protein JCGZ_12523 [Jatropha curcas]
Length=623

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 145/188 (77%), Gaps = 8/188 (4%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRICRLMDC+KLS +ACMH VQNERLPLRVVVQVLFFEQVR   S+G+STP+LP 
Sbjct  443  SKSERKRICRLMDCRKLSVEACMHVVQNERLPLRVVVQVLFFEQVRQATSAGNSTPELPG  502

Query  614  AIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTT  438
            +I+  L   S+GSSRS TT TEEDWD V +A++++ALKGELA L+LG    +DR   D  
Sbjct  503  SIRALLPGGSHGSSRSTTTNTEEDWDAVPTAEDIKALKGELATLQLGG---SDRNLNDNA  559

Query  437  KTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPS  258
            KT    +KAAA +K KG+++SK IFSK+WSSK  NGE S SD+SES GS   EE KSTPS
Sbjct  560  KT--DPEKAAA-NKTKGVVMSK-IFSKLWSSKERNGEISSSDTSESPGSAAAEETKSTPS  615

Query  257  RKGRYSVS  234
            R  R+SVS
Sbjct  616  RSMRHSVS  623



>ref|XP_009629746.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X2 [Nicotiana tomentosiformis]
Length=620

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 143/189 (76%), Gaps = 5/189 (3%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            +KSERKRIC+LMDC+KLSA+ACMHAVQNERLPLRVVVQVLFFEQVRA  SS G STPDL 
Sbjct  435  TKSERKRICKLMDCRKLSAEACMHAVQNERLPLRVVVQVLFFEQVRATTSSGGGSTPDLH  494

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
              IK  L   S+GSSRSATT TEEDWD V +A+EL+ALKGELA LRL +    + +N   
Sbjct  495  GTIKALLPVESHGSSRSATTNTEEDWDAVPTAEELKALKGELATLRLRD---KEGSNDSN  551

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
             K +  S +  A  K KGL++SK+IFSK+WS+K    ENS SD+SES GS+   E+KSTP
Sbjct  552  LKDMKLSAEKVAGGKAKGLIMSKKIFSKLWSNKDRLSENSSSDTSESPGSSNAGESKSTP  611

Query  260  SRKGRYSVS  234
            SR  R+S+S
Sbjct  612  SRSRRHSLS  620



>ref|XP_009776107.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009776108.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Nicotiana sylvestris]
Length=627

 Score =   193 bits (490),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 143/189 (76%), Gaps = 5/189 (3%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            +KSERKRIC+LMDC+KLSA+ACMHAVQNERLPLRVVVQVLFFEQVRA  SS G STPDL 
Sbjct  442  TKSERKRICKLMDCRKLSAEACMHAVQNERLPLRVVVQVLFFEQVRATTSSGGGSTPDLH  501

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
              IK  L   S+GSSRSATT TEEDWD V +A+EL+ALKGELA LRL +    + +N   
Sbjct  502  GTIKALLPGESHGSSRSATTNTEEDWDAVPTAEELKALKGELATLRLRD---KEGSNDSN  558

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
             K +  S +  A  K KGL++SK+IFSK+WS+K    ENS SD+SES GS+   E+KSTP
Sbjct  559  LKDMKLSAEKVAGGKTKGLIMSKKIFSKLWSNKDRVSENSSSDTSESPGSSNAGESKSTP  618

Query  260  SRKGRYSVS  234
            SR  R+S+S
Sbjct  619  SRSRRHSLS  627



>ref|XP_010687361.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X3 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010687362.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X3 
[Beta vulgaris subsp. vulgaris]
Length=621

 Score =   193 bits (490),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 144/187 (77%), Gaps = 8/187 (4%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSERK+IC+LMDCKKLS DACMHAVQNERLPLRV+VQVLFFEQVRA A+SG+STPDLPK
Sbjct  443  TKSERKKICKLMDCKKLSVDACMHAVQNERLPLRVIVQVLFFEQVRAAATSGTSTPDLPK  502

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
            +I+DLN  S  SSRS T   +EDWD VA+A+EL+ LKGELAAL+L      +R N +  +
Sbjct  503  SIRDLNYGSQRSSRS-TPNADEDWDAVATAEELKVLKGELAALKL------ERKNSEKIE  555

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSR  255
               S DK AA  KMKG+L++K+IF+K+ SSK GNG+ SGSDSSES  S   EEAKS  S 
Sbjct  556  GRRSVDK-AAFHKMKGVLMTKKIFAKLLSSKHGNGDTSGSDSSESPSSANPEEAKSMSST  614

Query  254  KGRYSVS  234
              R SVS
Sbjct  615  HRRISVS  621



>ref|XP_009776109.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X2 [Nicotiana sylvestris]
Length=620

 Score =   192 bits (489),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 143/189 (76%), Gaps = 5/189 (3%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            +KSERKRIC+LMDC+KLSA+ACMHAVQNERLPLRVVVQVLFFEQVRA  SS G STPDL 
Sbjct  435  TKSERKRICKLMDCRKLSAEACMHAVQNERLPLRVVVQVLFFEQVRATTSSGGGSTPDLH  494

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
              IK  L   S+GSSRSATT TEEDWD V +A+EL+ALKGELA LRL +    + +N   
Sbjct  495  GTIKALLPGESHGSSRSATTNTEEDWDAVPTAEELKALKGELATLRLRD---KEGSNDSN  551

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
             K +  S +  A  K KGL++SK+IFSK+WS+K    ENS SD+SES GS+   E+KSTP
Sbjct  552  LKDMKLSAEKVAGGKTKGLIMSKKIFSKLWSNKDRVSENSSSDTSESPGSSNAGESKSTP  611

Query  260  SRKGRYSVS  234
            SR  R+S+S
Sbjct  612  SRSRRHSLS  620



>ref|XP_010687360.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=651

 Score =   192 bits (489),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 144/187 (77%), Gaps = 8/187 (4%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSERK+IC+LMDCKKLS DACMHAVQNERLPLRV+VQVLFFEQVRA A+SG+STPDLPK
Sbjct  473  TKSERKKICKLMDCKKLSVDACMHAVQNERLPLRVIVQVLFFEQVRAAATSGTSTPDLPK  532

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
            +I+DLN  S  SSRS T   +EDWD VA+A+EL+ LKGELAAL+L      +R N +  +
Sbjct  533  SIRDLNYGSQRSSRS-TPNADEDWDAVATAEELKVLKGELAALKL------ERKNSEKIE  585

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSR  255
               S DK AA  KMKG+L++K+IF+K+ SSK GNG+ SGSDSSES  S   EEAKS  S 
Sbjct  586  GRRSVDK-AAFHKMKGVLMTKKIFAKLLSSKHGNGDTSGSDSSESPSSANPEEAKSMSST  644

Query  254  KGRYSVS  234
              R SVS
Sbjct  645  HRRISVS  651



>ref|XP_010687359.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=672

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 144/187 (77%), Gaps = 8/187 (4%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSERK+IC+LMDCKKLS DACMHAVQNERLPLRV+VQVLFFEQVRA A+SG+STPDLPK
Sbjct  494  TKSERKKICKLMDCKKLSVDACMHAVQNERLPLRVIVQVLFFEQVRAAATSGTSTPDLPK  553

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
            +I+DLN  S  SSRS T   +EDWD VA+A+EL+ LKGELAAL+L      +R N +  +
Sbjct  554  SIRDLNYGSQRSSRS-TPNADEDWDAVATAEELKVLKGELAALKL------ERKNSEKIE  606

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSR  255
               S DK AA  KMKG+L++K+IF+K+ SSK GNG+ SGSDSSES  S   EEAKS  S 
Sbjct  607  GRRSVDK-AAFHKMKGVLMTKKIFAKLLSSKHGNGDTSGSDSSESPSSANPEEAKSMSST  665

Query  254  KGRYSVS  234
              R SVS
Sbjct  666  HRRISVS  672



>ref|XP_010277066.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Nelumbo nucifera]
 ref|XP_010277067.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Nelumbo nucifera]
Length=630

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 149/192 (78%), Gaps = 9/192 (5%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERK+ICRLMDCKKLS DACMHAVQNERLPLRVVVQVLFFEQVRA  S+G  T +L  
Sbjct  443  SKSERKKICRLMDCKKLSVDACMHAVQNERLPLRVVVQVLFFEQVRAATSAGGRTAELSG  502

Query  614  AIKDL----NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANG  447
             ++ L    N  S+GSSRSATT T EDWD V +A+EL+ALKGELA+LRL   G     +G
Sbjct  503  NVRTLLPQENGGSHGSSRSATTNT-EDWDAVPTAEELKALKGELASLRLEGGGRGSNRHG  561

Query  446  DTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgST-TMEEAK  270
            +  K+  + DKAAA +K++GLL+SK+IF+K+WSSKGG  ENS SD+S+SLGST   E+ K
Sbjct  562  NDDKS--TIDKAAA-NKIRGLLMSKKIFTKLWSSKGGQSENSSSDTSDSLGSTNNPEDTK  618

Query  269  STPSRKGRYSVS  234
            STPSR  R+SVS
Sbjct  619  STPSRSRRHSVS  630



>gb|KDO78947.1| hypothetical protein CISIN_1g041399mg [Citrus sinensis]
Length=617

 Score =   189 bits (480),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 143/191 (75%), Gaps = 9/191 (5%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANAS-SGSSTPDLP  618
            SKSERKRICRLMDC+KLS +ACMHAVQNERLPLRVVVQVLFFEQ+RA AS +G+STPDLP
Sbjct  432  SKSERKRICRLMDCRKLSVEACMHAVQNERLPLRVVVQVLFFEQIRATASAAGNSTPDLP  491

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
             +I+  L   S+GSSRS TT TEEDWD + +AD+++ALKGE+A LRL   G +D+   D 
Sbjct  492  GSIRSLLPGGSHGSSRSTTTNTEEDWDSIPTADDIQALKGEIATLRLA-GGNSDKNGNDG  550

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslg--STTMEEAKS  267
             K  A    A    KMKG+L+SK IFSK+ SSK   GE S SD+SES    STT EE KS
Sbjct  551  CKIDAEKVTAG---KMKGILMSK-IFSKLRSSKDKYGEISSSDTSESPSPGSTTAEETKS  606

Query  266  TPSRKGRYSVS  234
            TPSR  R+SVS
Sbjct  607  TPSRSRRHSVS  617



>ref|XP_006426078.1| hypothetical protein CICLE_v10027450mg [Citrus clementina]
 gb|ESR39318.1| hypothetical protein CICLE_v10027450mg [Citrus clementina]
Length=628

 Score =   189 bits (480),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 143/191 (75%), Gaps = 9/191 (5%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANAS-SGSSTPDLP  618
            SKSERKRICRLMDC+KLS +ACMHAVQNERLPLRVVVQVLFFEQ+RA AS +G+STPDLP
Sbjct  443  SKSERKRICRLMDCRKLSVEACMHAVQNERLPLRVVVQVLFFEQIRATASAAGNSTPDLP  502

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
             +I+  L   S+GSSRS TT TEEDWD + +AD+++ALKGE+A LRL   G +D+   D 
Sbjct  503  GSIRSLLPGGSHGSSRSTTTNTEEDWDSIPTADDIQALKGEIATLRLA-GGNSDKNGNDG  561

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslg--STTMEEAKS  267
             K  A    A    KMKG+L+SK IFSK+ SSK   GE S SD+SES    STT EE KS
Sbjct  562  CKIDAEKVTAG---KMKGILMSK-IFSKLRSSKDKYGEISSSDTSESPSPGSTTAEETKS  617

Query  266  TPSRKGRYSVS  234
            TPSR  R+SVS
Sbjct  618  TPSRSRRHSVS  628



>ref|XP_006466475.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006466476.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Citrus sinensis]
Length=628

 Score =   189 bits (480),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 143/191 (75%), Gaps = 9/191 (5%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANAS-SGSSTPDLP  618
            SKSERKRICRLMDC+KLS +ACMHAVQNERLPLRVVVQVLFFEQ+RA AS +G+STPDLP
Sbjct  443  SKSERKRICRLMDCRKLSVEACMHAVQNERLPLRVVVQVLFFEQIRATASAAGNSTPDLP  502

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
             +I+  L   S+GSSRS TT TEEDWD + +AD+++ALKGE+A LRL   G +D+   D 
Sbjct  503  GSIRSLLPGGSHGSSRSTTTNTEEDWDSIPTADDIQALKGEIATLRLA-GGNSDKNGNDG  561

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslg--STTMEEAKS  267
             K  A    A    KMKG+L+SK IFSK+ SSK   GE S SD+SES    STT EE KS
Sbjct  562  CKIDAEKVTAG---KMKGILMSK-IFSKLRSSKDKYGEISSSDTSESPSPGSTTAEETKS  617

Query  266  TPSRKGRYSVS  234
            TPSR  R+SVS
Sbjct  618  TPSRSRRHSVS  628



>ref|XP_008440372.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Cucumis melo]
 ref|XP_008440373.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Cucumis melo]
 ref|XP_008440374.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Cucumis melo]
 ref|XP_008440375.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Cucumis melo]
 ref|XP_008440376.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Cucumis melo]
 ref|XP_008440377.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Cucumis melo]
 ref|XP_008440378.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Cucumis melo]
 ref|XP_008440379.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Cucumis melo]
 ref|XP_008440380.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Cucumis melo]
Length=626

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 149/190 (78%), Gaps = 9/190 (5%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRAN-ASSGSSTPDLP  618
            SKSERK+ICRLMDC+KLS DAC+HAVQNERLPLRVVVQVLFFEQ+RA+ AS+G STPDLP
Sbjct  443  SKSERKKICRLMDCRKLSPDACLHAVQNERLPLRVVVQVLFFEQMRASAASAGDSTPDLP  502

Query  617  KAIKDL--NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGD  444
              I+ L     S+GSSRS TT TE+DWD + + +E+RALKGELAAL+LGN    DR   D
Sbjct  503  STIRALLPGSGSHGSSRSTTTNTEDDWDAIPTIEEIRALKGELAALKLGN---GDRNGSD  559

Query  443  TTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKST  264
              K   +++K +  +KMKG+L+SK+IFSK+WS+K  NGE S S++SES GS+  EE KST
Sbjct  560  IAKN--NAEKVSG-NKMKGMLISKKIFSKLWSNKDRNGEISSSETSESPGSSNAEETKST  616

Query  263  PSRKGRYSVS  234
            PSR  R+S+S
Sbjct  617  PSRSLRHSIS  626



>ref|XP_010316013.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X2 [Solanum lycopersicum]
Length=611

 Score =   186 bits (472),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 143/191 (75%), Gaps = 8/191 (4%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            +KSERKRIC+LMDC+KLSA+ACMHAVQNERLPLRVVVQVLFFEQ RA  SS G STPDL 
Sbjct  425  TKSERKRICKLMDCRKLSAEACMHAVQNERLPLRVVVQVLFFEQARATTSSGGGSTPDLA  484

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGN--AGMADRANG  447
              IK  L   S+GSSRSATT T+EDWD V +A+EL+ALKGELA LRL +  AG  D  + 
Sbjct  485  GTIKSLLPGESHGSSRSATTNTDEDWDAVPTAEELKALKGELATLRLRDKEAGCNDTNSI  544

Query  446  DTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKS  267
            D   +V   +K     K KGL++SK++FSK+WS+K    ENS SD+SES GS+   E+KS
Sbjct  545  DIKMSV---EKVIG-GKAKGLIMSKKLFSKLWSNKDRLSENSSSDTSESPGSSNAGESKS  600

Query  266  TPSRKGRYSVS  234
            TPSR  R+S+S
Sbjct  601  TPSRSRRHSLS  611



>ref|XP_004231915.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Solanum lycopersicum]
 ref|XP_010316010.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Solanum lycopersicum]
 ref|XP_010316011.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Solanum lycopersicum]
 ref|XP_010316012.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Solanum lycopersicum]
Length=628

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 142/191 (74%), Gaps = 8/191 (4%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            +KSERKRIC+LMDC+KLSA+ACMHAVQNERLPLRVVVQVLFFEQ RA  SS G STPDL 
Sbjct  442  TKSERKRICKLMDCRKLSAEACMHAVQNERLPLRVVVQVLFFEQARATTSSGGGSTPDLA  501

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGN--AGMADRANG  447
              IK  L   S+GSSRSATT T+EDWD V +A+EL+ALKGELA LRL +  AG  D  + 
Sbjct  502  GTIKSLLPGESHGSSRSATTNTDEDWDAVPTAEELKALKGELATLRLRDKEAGCNDTNSI  561

Query  446  DTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKS  267
            D   +V    +     K KGL++SK++FSK+WS+K    ENS SD+SES GS+   E+KS
Sbjct  562  DIKMSV----EKVIGGKAKGLIMSKKLFSKLWSNKDRLSENSSSDTSESPGSSNAGESKS  617

Query  266  TPSRKGRYSVS  234
            TPSR  R+S+S
Sbjct  618  TPSRSRRHSLS  628



>ref|XP_002306504.2| hypothetical protein POPTR_0005s19010g [Populus trichocarpa]
 gb|EEE93500.2| hypothetical protein POPTR_0005s19010g [Populus trichocarpa]
Length=626

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 140/189 (74%), Gaps = 11/189 (6%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVR-ANASSGSSTPDLP  618
            SKSERKRICRLMDC+KLSADACMHAVQNERLPLRVVVQVLFFEQ+R A  S  +ST +LP
Sbjct  442  SKSERKRICRLMDCRKLSADACMHAVQNERLPLRVVVQVLFFEQIRQATLSVDNSTQELP  501

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
             +I+  L   S+GSSRS TT TEEDWD V +A++++ALKGELAALRLG +G +DR   D 
Sbjct  502  GSIRALLPGGSHGSSRS-TTNTEEDWDAVPTAEDVKALKGELAALRLGGSG-SDRNLNDG  559

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
             K  A  +K AA  K+KGL++SK IFSK+W        N    SS++ GS T EE KSTP
Sbjct  560  AKNDA--EKVAA-GKLKGLVMSK-IFSKLW---SNKERNGEISSSDTSGSATAEETKSTP  612

Query  260  SRKGRYSVS  234
            SR  R+SVS
Sbjct  613  SRSRRHSVS  621



>ref|XP_006339810.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X4 [Solanum tuberosum]
Length=628

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 140/189 (74%), Gaps = 4/189 (2%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            +KSERKRIC+LMDC+KLSA+ACMHAVQNERLPLRVVVQVLFFEQ RA  SS G STPDL 
Sbjct  442  TKSERKRICKLMDCRKLSAEACMHAVQNERLPLRVVVQVLFFEQARATTSSGGGSTPDLA  501

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
              IK  L   S+GSSRSATT T+EDWD V +A+EL+ALKGELA LRL +  +    N   
Sbjct  502  GTIKSLLPGESHGSSRSATTNTDEDWDAVPTAEELKALKGELATLRLTDKEVG--CNDTN  559

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
            +  +  S +     K KGL++SK++FSK+WS+K    ENS SD+SES GS+   E+KSTP
Sbjct  560  SIDIKMSVEKVIGGKAKGLIMSKKLFSKLWSNKDRLSENSSSDTSESPGSSNAGESKSTP  619

Query  260  SRKGRYSVS  234
            SR  R+S+S
Sbjct  620  SRSRRHSLS  628



>ref|XP_004141870.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Cucumis 
sativus]
 ref|XP_004166812.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Cucumis 
sativus]
 gb|KGN48602.1| hypothetical protein Csa_6G495070 [Cucumis sativus]
Length=626

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 149/190 (78%), Gaps = 9/190 (5%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRA-NASSGSSTPDLP  618
            SKSERK+ICRLMDC+KLS DAC+HAVQNERLPLRVVVQVLFFEQ+RA +AS+G STPDLP
Sbjct  443  SKSERKKICRLMDCRKLSPDACLHAVQNERLPLRVVVQVLFFEQMRASSASAGDSTPDLP  502

Query  617  KAIKDL--NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGD  444
              I+ L     S+GSSRS TT TE+DWD + + +E+RALKGELAAL+LG+    DR   D
Sbjct  503  STIRALLPGSGSHGSSRSTTTNTEDDWDAIPTIEEIRALKGELAALKLGS---GDRNGSD  559

Query  443  TTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKST  264
              +   +++K +  +KMKG+L+SK+IFSK+WS+K  NGE S S++SES GS+  EE KST
Sbjct  560  IARN--NAEKVSG-NKMKGMLISKKIFSKLWSNKDRNGEISSSETSESPGSSNAEETKST  616

Query  263  PSRKGRYSVS  234
            PSR  R+S+S
Sbjct  617  PSRSQRHSIS  626



>gb|KJB18014.1| hypothetical protein B456_003G029500 [Gossypium raimondii]
 gb|KJB18015.1| hypothetical protein B456_003G029500 [Gossypium raimondii]
 gb|KJB18016.1| hypothetical protein B456_003G029500 [Gossypium raimondii]
Length=615

 Score =   184 bits (468),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 135/188 (72%), Gaps = 14/188 (7%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRICRLMDCKKLSA+ACMHAVQNERLPLRVVVQVLFFEQ RA  SSGSSTPDLP 
Sbjct  441  SKSERKRICRLMDCKKLSAEACMHAVQNERLPLRVVVQVLFFEQARATTSSGSSTPDLPG  500

Query  614  AIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTT  438
            +I+  L   S+GSSRS TT TEEDWD V +A++++ALKGEL  LRL  +G  +R NG   
Sbjct  501  SIRALLPGGSHGSSRSTTTNTEEDWDSVPTAEDIKALKGELTTLRL--SGETNR-NG---  554

Query  437  KTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPS  258
             T  +  +  A+S+MKGL +SK IFSK+      + +    + S S  S + EE KSTPS
Sbjct  555  -TAKTDIERVAVSRMKGLAMSK-IFSKL-----KSSKERNGEISSSDTSESPEETKSTPS  607

Query  257  RKGRYSVS  234
               ++S+S
Sbjct  608  VSRKHSLS  615



>gb|KHN23238.1| BTB/POZ domain-containing protein NPY2 [Glycine soja]
Length=629

 Score =   184 bits (466),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 148/192 (77%), Gaps = 9/192 (5%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            SKSE+KRICRLM+C+KLSA+ACMHAVQNERLP+RVVVQVLFFEQ+RA  SS G+ TPD P
Sbjct  442  SKSEKKRICRLMNCRKLSAEACMHAVQNERLPMRVVVQVLFFEQLRATTSSGGNGTPDHP  501

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRL--GNAGMADRA-N  450
             +I+  L   S+GSSRS  T TEE+WD V + +++++LKGEL AL+L  G +G + R+ N
Sbjct  502  GSIRALLPGGSHGSSRSTITNTEEEWDAVGTMEDIKSLKGELDALKLSGGTSGASSRSDN  561

Query  449  GDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAK  270
             D  K   +++K AA SKMKGL+ SK+I SKIWSSK  +GE S SD+SES  ST +EE K
Sbjct  562  NDGGKD--NAEKVAA-SKMKGLM-SKKIISKIWSSKERSGELSSSDTSESPASTVVEETK  617

Query  269  STPSRKGRYSVS  234
            STPSR  R+S+S
Sbjct  618  STPSRSRRHSLS  629



>ref|XP_003550011.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Glycine max]
 ref|XP_006600917.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Glycine max]
Length=629

 Score =   184 bits (466),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 148/192 (77%), Gaps = 9/192 (5%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            SKSE+KRICRLM+C+KLSA+ACMHAVQNERLP+RVVVQVLFFEQ+RA  SS G+ TPD P
Sbjct  442  SKSEKKRICRLMNCRKLSAEACMHAVQNERLPMRVVVQVLFFEQLRATTSSGGNGTPDHP  501

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRL--GNAGMADRA-N  450
             +I+  L   S+GSSRS  T TEE+WD V + +++++LKGEL AL+L  G +G + R+ N
Sbjct  502  GSIRALLPGGSHGSSRSTITNTEEEWDAVGTMEDIKSLKGELDALKLSGGTSGASSRSDN  561

Query  449  GDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAK  270
             D  K   +++K AA SKMKGL+ SK+I SKIWSSK  +GE S SD+SES  ST +EE K
Sbjct  562  NDGGKD--NAEKVAA-SKMKGLM-SKKIISKIWSSKERSGELSSSDTSESPASTVVEETK  617

Query  269  STPSRKGRYSVS  234
            STPSR  R+S+S
Sbjct  618  STPSRSRRHSLS  629



>ref|XP_011011590.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Populus 
euphratica]
Length=623

 Score =   182 bits (462),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 139/189 (74%), Gaps = 14/189 (7%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVR-ANASSGSSTPDLP  618
            SKSERKRICRLMDC+KLSADACMHAVQNERLPLRVVVQVLFFEQ+R A  +  +ST +LP
Sbjct  442  SKSERKRICRLMDCRKLSADACMHAVQNERLPLRVVVQVLFFEQIRQATLAVDNSTQELP  501

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
             +I+  L   S+GSSRS TT TEEDWD V +A++++ALKGELAALRLG +G +DR   D 
Sbjct  502  GSIRALLPGGSHGSSRS-TTNTEEDWDAVPTAEDVKALKGELAALRLGGSG-SDRNLNDG  559

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
             K    +D AA   K+KGL++SK IFSK+W        N    SS+S GS T EE KSTP
Sbjct  560  AK----NDVAAG--KLKGLVMSK-IFSKLW---SNKERNGEISSSDSSGSATAEETKSTP  609

Query  260  SRKGRYSVS  234
            SR  R+SVS
Sbjct  610  SRSRRHSVS  618



>ref|XP_006339811.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X5 [Solanum tuberosum]
Length=604

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 136/183 (74%), Gaps = 4/183 (2%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            +KSERKRIC+LMDC+KLSA+ACMHAVQNERLPLRVVVQVLFFEQ RA  SS G STPDL 
Sbjct  412  TKSERKRICKLMDCRKLSAEACMHAVQNERLPLRVVVQVLFFEQARATTSSGGGSTPDLA  471

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
              IK  L   S+GSSRSATT T+EDWD V +A+EL+ALKGELA LRL +  +    N   
Sbjct  472  GTIKSLLPGESHGSSRSATTNTDEDWDAVPTAEELKALKGELATLRLTDKEVG--CNDTN  529

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
            +  +  S +     K KGL++SK++FSK+WS+K    ENS SD+SES GS+   E+KSTP
Sbjct  530  SIDIKMSVEKVIGGKAKGLIMSKKLFSKLWSNKDRLSENSSSDTSESPGSSNAGESKSTP  589

Query  260  SRK  252
            SR+
Sbjct  590  SRR  592



>ref|XP_004496882.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Cicer arietinum]
 ref|XP_004496883.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Cicer arietinum]
 ref|XP_004496884.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X3 [Cicer arietinum]
Length=611

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 141/187 (75%), Gaps = 12/187 (6%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SK E+KRIC+LMDC+KLS DAC+HAVQNERLPLRVVVQVL+FEQVR  ASSG+STPD+ K
Sbjct  437  SKGEKKRICKLMDCRKLSVDACLHAVQNERLPLRVVVQVLYFEQVRTAASSGTSTPDIAK  496

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
             IKD++  S GSSRS TT  EED DGVA+A+EL+AL+ ELA LRL N            +
Sbjct  497  GIKDMSNGSNGSSRSGTTNPEEDADGVATAEELKALRKELATLRLSNG-----------E  545

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSR  255
               S DK A I KMKGLL SK+ F K+W+SKGG GENSGSDSSES+ S   EE KSTPSR
Sbjct  546  AKPSMDK-AVIGKMKGLLRSKKSFIKLWASKGGQGENSGSDSSESVVSANPEEVKSTPSR  604

Query  254  KGRYSVS  234
              R+SVS
Sbjct  605  NRRHSVS  611



>ref|XP_006339807.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006339808.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006339809.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X3 [Solanum tuberosum]
Length=634

 Score =   182 bits (461),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 136/183 (74%), Gaps = 4/183 (2%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            +KSERKRIC+LMDC+KLSA+ACMHAVQNERLPLRVVVQVLFFEQ RA  SS G STPDL 
Sbjct  442  TKSERKRICKLMDCRKLSAEACMHAVQNERLPLRVVVQVLFFEQARATTSSGGGSTPDLA  501

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
              IK  L   S+GSSRSATT T+EDWD V +A+EL+ALKGELA LRL +  +    N   
Sbjct  502  GTIKSLLPGESHGSSRSATTNTDEDWDAVPTAEELKALKGELATLRLTDKEVG--CNDTN  559

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
            +  +  S +     K KGL++SK++FSK+WS+K    ENS SD+SES GS+   E+KSTP
Sbjct  560  SIDIKMSVEKVIGGKAKGLIMSKKLFSKLWSNKDRLSENSSSDTSESPGSSNAGESKSTP  619

Query  260  SRK  252
            SR+
Sbjct  620  SRR  622



>ref|XP_010679621.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010679622.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Beta vulgaris 
subsp. vulgaris]
Length=625

 Score =   181 bits (459),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 141/189 (75%), Gaps = 11/189 (6%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS---GSSTPD  624
            SKSE+K+IC+LMDC+KLS +AC HAVQNERLPLRVVVQVLFFEQ RA A+S   GS TPD
Sbjct  443  SKSEKKKICKLMDCRKLSVEACAHAVQNERLPLRVVVQVLFFEQARATATSSSPGSRTPD  502

Query  623  LPKAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANG  447
            L +  +  L   S+GSSRSATT TE+DWDGV + +EL+ALKGE+A LR+G         G
Sbjct  503  LQRPTRALLPGGSHGSSRSATTNTEDDWDGVPTIEELKALKGEIANLRVGG------GEG  556

Query  446  DTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgST-TMEEAK  270
             +     S  + AA++K++GLL+SKR+FSK+WSSK  +GENS SD+SES  ST   EE++
Sbjct  557  SSVDVPKSDAEKAAVNKVRGLLMSKRLFSKLWSSKEKDGENSSSDTSESPASTNNAEESR  616

Query  269  STPSRKGRY  243
            STPSR  ++
Sbjct  617  STPSRNRKH  625



>ref|XP_009631542.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like isoform 
X2 [Nicotiana tomentosiformis]
Length=597

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 137/189 (72%), Gaps = 5/189 (3%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            +KSERKRICRLMDC+KLSA+ACMHAVQNERLPLR+VVQVLFFEQVRA  SS G STPDL 
Sbjct  412  TKSERKRICRLMDCRKLSAEACMHAVQNERLPLRIVVQVLFFEQVRATTSSGGGSTPDLT  471

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
            +++K  L   SYGSS S T+ TEEDWD V +A EL+ALKG LA LRL +    +  NG  
Sbjct  472  RSVKALLPVGSYGSSTSVTSNTEEDWDAVPTAKELKALKGGLATLRLRD---REGNNGSD  528

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
               + ++ +    SK+KG ++SK++FSK+WS+K    ENS SD+SES  S+   E KSTP
Sbjct  529  LNDMKTNAEKVDTSKVKGSIISKKMFSKLWSNKDRLSENSSSDTSESPSSSNAGETKSTP  588

Query  260  SRKGRYSVS  234
             R  R S+S
Sbjct  589  CRSRRQSMS  597



>ref|XP_004288238.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011465947.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011465950.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Fragaria 
vesca subsp. vesca]
Length=625

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 118/151 (78%), Gaps = 6/151 (4%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSE+KR+C+LMDC+KLSA+AC HAVQNERLPLRVVVQVLFFEQ RA+   G+STPDL  
Sbjct  441  TKSEKKRVCKLMDCRKLSAEACTHAVQNERLPLRVVVQVLFFEQARASV-GGNSTPDLHG  499

Query  614  AIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRL--GNAGMADRANGD  444
            +I+  L   S+GSSRS TT TEEDWD V +A+E++ALKGE++ LRL  GN G+ +  N D
Sbjct  500  SIRALLPGGSHGSSRSTTTNTEEDWDAVPTAEEIKALKGEISTLRLGDGNEGVGNDRN-D  558

Query  443  TTKTVASSDKAAAISKMKGLLVSKRIFSKIW  351
                   S+K AA SKMKGLL+SK+IFSK+W
Sbjct  559  HHGAKNQSEKVAA-SKMKGLLMSKKIFSKLW  588



>ref|XP_009631537.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009631538.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009631539.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009631540.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009631541.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like isoform 
X1 [Nicotiana tomentosiformis]
Length=627

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 137/193 (71%), Gaps = 13/193 (7%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            +KSERKRICRLMDC+KLSA+ACMHAVQNERLPLR+VVQVLFFEQVRA  SS G STPDL 
Sbjct  442  TKSERKRICRLMDCRKLSAEACMHAVQNERLPLRIVVQVLFFEQVRATTSSGGGSTPDLT  501

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRL----GNAGMADRA  453
            +++K  L   SYGSS S T+ TEEDWD V +A EL+ALKG LA LRL    GN       
Sbjct  502  RSVKALLPVGSYGSSTSVTSNTEEDWDAVPTAKELKALKGGLATLRLRDREGN-------  554

Query  452  NGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEA  273
            NG     + ++ +    SK+KG ++SK++FSK+WS+K    ENS SD+SES  S+   E 
Sbjct  555  NGSDLNDMKTNAEKVDTSKVKGSIISKKMFSKLWSNKDRLSENSSSDTSESPSSSNAGET  614

Query  272  KSTPSRKGRYSVS  234
            KSTP R  R S+S
Sbjct  615  KSTPCRSRRQSMS  627



>gb|KHG04716.1| BTB/POZ domain-containing NPY2 -like protein [Gossypium arboreum]
Length=615

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 136/189 (72%), Gaps = 16/189 (8%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKRICRLMDCKKLSA+ACMHAVQNERLPLRVVVQVLFFEQ RA  SSGSSTPDLP 
Sbjct  441  SKSERKRICRLMDCKKLSAEACMHAVQNERLPLRVVVQVLFFEQARATTSSGSSTPDLPG  500

Query  614  AIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTT  438
            +++  L   S+GSSRS TT TEEDWD V +A++++ALKGEL  LRL  +G  +R NG   
Sbjct  501  SVRALLPGGSHGSSRSTTTNTEEDWDSVPTAEDIKALKGELTTLRL--SGETNR-NG---  554

Query  437  KTVASSD-KAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
              +A +D +  + S+MKGL +SK IFSK+      + +    + S S  S + EE KSTP
Sbjct  555  --MAKTDIERVSASRMKGLAMSK-IFSKL-----KSSKERNGEISSSDTSESPEETKSTP  606

Query  260  SRKGRYSVS  234
            S   ++S+S
Sbjct  607  SVSRKHSLS  615



>ref|XP_010530706.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Tarenaya hassleriana]
 ref|XP_010530707.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Tarenaya hassleriana]
 ref|XP_010530708.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Tarenaya hassleriana]
Length=642

 Score =   180 bits (456),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 117/150 (78%), Gaps = 13/150 (9%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPD-LP  618
            +K E+KR+C+LMDC+KLS +ACMHAVQNERLPLRVVVQVLFFEQVRA ASSGSSTPD +P
Sbjct  448  TKGEKKRVCKLMDCRKLSVEACMHAVQNERLPLRVVVQVLFFEQVRAAASSGSSTPDVIP  507

Query  617  KAIKDL-NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
            K +K+L NC  YGSSRS  T  E++WDG+ASA+ELRALK E+AAL+L          G+ 
Sbjct  508  KGVKELRNCTVYGSSRSVPTIMEDEWDGIASAEELRALKSEIAALKL---------QGNI  558

Query  440  TKTVASSDKAAA--ISKMKGLLVSKRIFSK  357
            ++   S D+AA+  I+++K L+ SK+IF K
Sbjct  559  SEGRRSIDRAASQVINRVKSLIKSKKIFGK  588



>ref|XP_006579937.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Glycine max]
 ref|XP_006579938.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Glycine max]
 ref|XP_006579939.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X3 [Glycine max]
 gb|KHN06013.1| BTB/POZ domain-containing protein NPY2 [Glycine soja]
Length=628

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 143/191 (75%), Gaps = 8/191 (4%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSG-SSTPDLP  618
            SKSERK+ICRLM+C+ LSA+ACMHAVQNERLP+RVVVQVLFFEQ+RA  SSG +STPD P
Sbjct  442  SKSERKKICRLMNCRNLSAEACMHAVQNERLPMRVVVQVLFFEQLRATTSSGDNSTPDHP  501

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANG--  447
             +++  L   S+GSS S  T TEE+WD V + +++++LKGE+ AL+L  +G   RA+G  
Sbjct  502  GSLRAFLPGGSHGSSMSTITNTEEEWDAVGTMEDIKSLKGEVDALKL--SGGTGRASGRK  559

Query  446  DTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKS  267
            D      ++D  AA SKMKG  +SK+I SKIWSSK  +G+ S SD+SES  ST +EE KS
Sbjct  560  DNNGDKGNADNVAA-SKMKG-FISKKILSKIWSSKEKSGDLSSSDTSESPASTVVEETKS  617

Query  266  TPSRKGRYSVS  234
            TPSR  R+SVS
Sbjct  618  TPSRSRRHSVS  628



>ref|XP_009772494.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Nicotiana 
sylvestris]
Length=626

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 138/193 (72%), Gaps = 13/193 (7%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            +KSERKRICRLMDC+KLSA+ACMHAVQNERLPLRVVVQVLFFEQVRA  SS G STPDL 
Sbjct  441  TKSERKRICRLMDCRKLSAEACMHAVQNERLPLRVVVQVLFFEQVRATTSSGGGSTPDLT  500

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRL----GNAGMADRA  453
            +++K  L   S+GSS S T+ T+EDWD V +A EL+ALKGE A+LRL    GN       
Sbjct  501  RSVKALLPVGSHGSSTSVTSNTDEDWDAVPTAKELKALKGEFASLRLRDREGN-------  553

Query  452  NGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEA  273
            NG     + ++ +    SK+KG ++SK++FSK+WS+K    ENS SD+SES  S+   E 
Sbjct  554  NGSDLNNMKTNAEKVDSSKVKGSMISKKMFSKLWSNKDRLSENSSSDTSESPSSSNAGET  613

Query  272  KSTPSRKGRYSVS  234
            KSTP R  R S+S
Sbjct  614  KSTPYRSRRQSLS  626



>gb|KHN23237.1| BTB/POZ domain-containing protein NPY2 [Glycine soja]
Length=587

 Score =   178 bits (452),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 140/190 (74%), Gaps = 6/190 (3%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            SKSERKRICRLM+C+ LSA+ACMHAVQNERLP+RVVVQVLFFEQ+R   SS G+STPD P
Sbjct  401  SKSERKRICRLMNCRSLSAEACMHAVQNERLPMRVVVQVLFFEQLRTTTSSGGNSTPDHP  460

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRL-GNAGMADRANGD  444
             +++  L   S+GSSRS  T TEE+WD V + +++++LKGE+ AL+L G  G A  +  D
Sbjct  461  GSLRSFLPGGSHGSSRSTITNTEEEWDAVGTMEDIKSLKGEVDALKLSGGTGRAS-SGKD  519

Query  443  TTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKST  264
                  ++D  AA SKMKG + SK+I SKIWSSK  + + S SD+SES  ST +EE KST
Sbjct  520  NNSGKGNADNIAA-SKMKGFM-SKKILSKIWSSKEKSVDISSSDTSESPASTVVEETKST  577

Query  263  PSRKGRYSVS  234
            P+R  R+SVS
Sbjct  578  PARSRRHSVS  587



>ref|XP_006600919.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X2 
[Glycine max]
Length=614

 Score =   178 bits (452),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 140/190 (74%), Gaps = 6/190 (3%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            SKSERKRICRLM+C+ LSA+ACMHAVQNERLP+RVVVQVLFFEQ+R   SS G+STPD P
Sbjct  428  SKSERKRICRLMNCRSLSAEACMHAVQNERLPMRVVVQVLFFEQLRTTTSSGGNSTPDHP  487

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRL-GNAGMADRANGD  444
             +++  L   S+GSSRS  T TEE+WD V + +++++LKGE+ AL+L G  G A  +  D
Sbjct  488  GSLRSFLPGGSHGSSRSTITNTEEEWDAVGTMEDIKSLKGEVDALKLSGGTGRAS-SGKD  546

Query  443  TTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKST  264
                  ++D  AA SKMKG + SK+I SKIWSSK  + + S SD+SES  ST +EE KST
Sbjct  547  NNSGKGNADNIAA-SKMKGFM-SKKILSKIWSSKEKSVDISSSDTSESPASTVVEETKST  604

Query  263  PSRKGRYSVS  234
            P+R  R+SVS
Sbjct  605  PARSRRHSVS  614



>ref|XP_006600918.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X1 
[Glycine max]
Length=630

 Score =   178 bits (452),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 140/190 (74%), Gaps = 6/190 (3%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            SKSERKRICRLM+C+ LSA+ACMHAVQNERLP+RVVVQVLFFEQ+R   SS G+STPD P
Sbjct  444  SKSERKRICRLMNCRSLSAEACMHAVQNERLPMRVVVQVLFFEQLRTTTSSGGNSTPDHP  503

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRL-GNAGMADRANGD  444
             +++  L   S+GSSRS  T TEE+WD V + +++++LKGE+ AL+L G  G A  +  D
Sbjct  504  GSLRSFLPGGSHGSSRSTITNTEEEWDAVGTMEDIKSLKGEVDALKLSGGTGRAS-SGKD  562

Query  443  TTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKST  264
                  ++D  AA SKMKG + SK+I SKIWSSK  + + S SD+SES  ST +EE KST
Sbjct  563  NNSGKGNADNIAA-SKMKGFM-SKKILSKIWSSKEKSVDISSSDTSESPASTVVEETKST  620

Query  263  PSRKGRYSVS  234
            P+R  R+SVS
Sbjct  621  PARSRRHSVS  630



>ref|XP_003592479.1| BTB/POZ domain-containing protein [Medicago truncatula]
 gb|AES62730.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=625

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 137/187 (73%), Gaps = 4/187 (2%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SK E+K IC+LMDC+KLS DA +HAVQNERLP RV+VQVL FEQVR  ASSG+STPD+ K
Sbjct  443  SKGEKKSICQLMDCRKLSVDASLHAVQNERLPTRVIVQVLHFEQVRTAASSGTSTPDIAK  502

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
             IKDL+  S GSSRS TT  E D DG  +A+EL+AL+ ELA+LR  N       +GD   
Sbjct  503  GIKDLSIGSNGSSRSGTTNPEYDTDGAGTAEELKALRKELASLRQSNGVGNSFKDGDAKP  562

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSR  255
             +   DK A I KMKGLL SK+ F K+W+SKGG+GENSGSDSSES+GS   EE KSTPSR
Sbjct  563  NM---DK-AVIGKMKGLLKSKKSFIKLWASKGGHGENSGSDSSESIGSVNPEEVKSTPSR  618

Query  254  KGRYSVS  234
              R SVS
Sbjct  619  NRRNSVS  625



>ref|XP_007155836.1| hypothetical protein PHAVU_003G235700g [Phaseolus vulgaris]
 ref|XP_007155837.1| hypothetical protein PHAVU_003G235700g [Phaseolus vulgaris]
 gb|ESW27830.1| hypothetical protein PHAVU_003G235700g [Phaseolus vulgaris]
 gb|ESW27831.1| hypothetical protein PHAVU_003G235700g [Phaseolus vulgaris]
Length=628

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 138/189 (73%), Gaps = 4/189 (2%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            SKSE+KRICRLM+C+KLS +ACMHAVQNERLP+RVVVQVLFFEQ+RA  SS G+STPD  
Sbjct  442  SKSEKKRICRLMNCRKLSPEACMHAVQNERLPMRVVVQVLFFEQLRATTSSGGNSTPDHS  501

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
             +I+  L   S+GSSRS  T TEE+WD V + ++L++LKGEL AL+L           + 
Sbjct  502  GSIRAFLPGGSHGSSRSTITNTEEEWDAVGTIEDLKSLKGELDALKLSGGINGASGGNNN  561

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
                 +++  AA SKMKGL+ SK+I SKIWSSK  +GE + SD+SES  ST +EE KSTP
Sbjct  562  NCGKGNAENVAA-SKMKGLM-SKKIMSKIWSSKEKSGELTSSDTSESPASTVVEETKSTP  619

Query  260  SRKGRYSVS  234
            SR  R+SVS
Sbjct  620  SRSRRHSVS  628



>emb|CDP02592.1| unnamed protein product [Coffea canephora]
Length=623

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 138/186 (74%), Gaps = 6/186 (3%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            +KSERKRICRLMDC+KLS DA  HAVQNERLPLRVVVQVLFFEQVR+  SS G S P+L 
Sbjct  442  TKSERKRICRLMDCRKLSVDASAHAVQNERLPLRVVVQVLFFEQVRSTTSSAGDSIPELA  501

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
             +IK  L   S+ SSRSATT TE+DWD V +A++L+ALKG LA +RL      +  +G+ 
Sbjct  502  GSIKALLPGGSHASSRSATTNTEDDWDAVPTAEDLKALKGGLANIRLKE----ETEHGND  557

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
            +     + +  A++K+KGL++SK+IFSK+WS+K  + ENS SD+SES  S+T EE KSTP
Sbjct  558  SNLAKINSEKVAMTKVKGLIMSKKIFSKLWSNKERDSENSSSDTSESPASSTAEETKSTP  617

Query  260  SRKGRY  243
            SR  R+
Sbjct  618  SRSRRH  623



>emb|CDY50369.1| BnaA09g13180D [Brassica napus]
Length=513

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 115/147 (78%), Gaps = 14/147 (10%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +K E+KR+C+LMDC+KLS +ACMHAVQN+RLPLRVVVQVLFFEQVRA+ASSGSSTPD PK
Sbjct  328  TKGEKKRMCKLMDCRKLSVEACMHAVQNDRLPLRVVVQVLFFEQVRASASSGSSTPDFPK  387

Query  614  AIKDL-NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTT  438
             I++L +C +YGSSRS  T  E++WD VA+ +E+RALK E+AAL+L         +G   
Sbjct  388  GIRELRSCGTYGSSRSVPTVMEDEWDTVATEEEMRALKSEIAALKL------QEESGR--  439

Query  437  KTVASSDKAA--AISKMKGLLVSKRIF  363
                S+DKAA  AIS++K L++S+++F
Sbjct  440  ---KSTDKAAVTAISRVKSLIMSRKMF  463



>ref|XP_009123215.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Brassica rapa]
Length=627

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 116/147 (79%), Gaps = 14/147 (10%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +K E+KR+C+LMDC+KLS +ACMHAVQN+RLPLRVVVQVLFFEQVRA+ASSGSSTPDLPK
Sbjct  441  TKGEKKRMCKLMDCRKLSVEACMHAVQNDRLPLRVVVQVLFFEQVRASASSGSSTPDLPK  500

Query  614  AIKDL-NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTT  438
             I++L +C +YGSSRS  T  E++WD VA+ +E+RALK E+AAL+L         +G   
Sbjct  501  GIRELRSCGTYGSSRSVPTVMEDEWDAVATEEEMRALKSEIAALKL------QEESGR--  552

Query  437  KTVASSDKAA--AISKMKGLLVSKRIF  363
                S+DKAA  AIS++K L++S+++F
Sbjct  553  ---KSTDKAAVTAISRVKSLIMSRKMF  576



>emb|CDY37223.1| BnaA09g08440D [Brassica napus]
Length=603

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 116/147 (79%), Gaps = 14/147 (10%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +K E+KR+C+LMDC+KLS +ACMHAVQN+RLPLRVVVQVLFFEQVRA+ASSGSSTPDLPK
Sbjct  418  TKGEKKRMCKLMDCRKLSVEACMHAVQNDRLPLRVVVQVLFFEQVRASASSGSSTPDLPK  477

Query  614  AIKDL-NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTT  438
             I++L +C +YGSSRS  T  E++WD VA+ +E+RALK E+AAL+L         +G   
Sbjct  478  GIRELRSCGTYGSSRSVPTVMEDEWDTVATEEEMRALKSEIAALKL------QEESGR--  529

Query  437  KTVASSDKAA--AISKMKGLLVSKRIF  363
                S+DKAA  AIS++K L++S+++F
Sbjct  530  ---KSTDKAAVTAISRVKSLIMSRKMF  553



>emb|CDX81462.1| BnaC09g08730D [Brassica napus]
Length=603

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 114/147 (78%), Gaps = 14/147 (10%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +K E+KR+C+LMDC+KLS +ACMHAVQN+RLPLRVVVQVLFFEQVRA+ASSGSSTPD PK
Sbjct  418  TKGEKKRMCKLMDCRKLSVEACMHAVQNDRLPLRVVVQVLFFEQVRASASSGSSTPDFPK  477

Query  614  AIKDL-NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTT  438
             I++L +C +YGSSRS  T  E++WD VA+ +E+RALK E+AAL+L         +G   
Sbjct  478  GIRELRSCGTYGSSRSVPTVMEDEWDAVATEEEMRALKSEIAALKL------QEESGR--  529

Query  437  KTVASSDKAA--AISKMKGLLVSKRIF  363
                S+DKAA  AIS++K L++S+ +F
Sbjct  530  ---KSTDKAAVTAISRVKSLIMSRTMF  553



>ref|XP_008341028.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Malus 
domestica]
 ref|XP_008341035.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Malus 
domestica]
Length=627

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 130/191 (68%), Gaps = 5/191 (3%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SK ERKR+C+LMDC+KLS DACMHAVQNERLPLRVVVQVLFFEQ+RA+AS G+STPDL  
Sbjct  438  SKGERKRMCKLMDCRKLSVDACMHAVQNERLPLRVVVQVLFFEQIRASASGGNSTPDLQG  497

Query  614  AIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTT  438
            +I+  L   S+GSSRS TT T +DWD V +A+E++ LK E++ LRLG          D  
Sbjct  498  SIRALLPGGSHGSSRS-TTNTADDWDAVPTAEEIKGLKCEISTLRLGEVNGGVGVGSDRN  556

Query  437  KTVASSDKAAAI--SKMKGLLVSKRIFSKIWsskggn-gensgsdsseslgSTTMEEAKS  267
                ++     +  SK+KG+ +SK+IFSK+WSSK  +   +S + S     S+  EE KS
Sbjct  557  GNPGATKNLEKVPSSKVKGMFMSKKIFSKLWSSKERSGEISSSNTSESPGSSSNAEETKS  616

Query  266  TPSRKGRYSVS  234
            T SR  R SVS
Sbjct  617  TCSRSRRNSVS  627



>ref|XP_010070650.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Eucalyptus 
grandis]
 ref|XP_010070651.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Eucalyptus 
grandis]
 gb|KCW59544.1| hypothetical protein EUGRSUZ_H02298 [Eucalyptus grandis]
Length=626

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 140/192 (73%), Gaps = 13/192 (7%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVR--ANASSGSSTPDL  621
            SKSE+K+IC++MDC KLSADACMHAVQNERLPLRVVVQVLFFEQ+R     SSG++TP L
Sbjct  443  SKSEKKKICKMMDCSKLSADACMHAVQNERLPLRVVVQVLFFEQMRTTTTTSSGNTTPTL  502

Query  620  PKAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGD  444
            P  I   L   S+GSSRSATT TEEDWDGV +A+E++ALKGELA+LRLG        N D
Sbjct  503  PGPIAALLPGGSHGSSRSATTNTEEDWDGVPTAEEMKALKGELASLRLGEKN----GNHD  558

Query  443  TTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTME--EAK  270
              K   +S  AA  +KMKG LVSK IFSK+WSSK   GE S SD+SES   ++    + K
Sbjct  559  GLK---NSSNAAEKAKMKGQLVSK-IFSKLWSSKERQGELSSSDTSESPSPSSGNAGDTK  614

Query  269  STPSRKGRYSVS  234
            STPSR  R+SVS
Sbjct  615  STPSRSRRHSVS  626



>ref|XP_006409633.1| hypothetical protein EUTSA_v10023006mg [Eutrema salsugineum]
 gb|ESQ51086.1| hypothetical protein EUTSA_v10023006mg [Eutrema salsugineum]
Length=633

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 112/152 (74%), Gaps = 19/152 (13%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +K E+K++C+LMDC+KLS +ACMHAVQN+RLPLRVVVQVLFFEQVRA ASSGSSTPDLPK
Sbjct  443  TKGEKKKMCKLMDCRKLSVEACMHAVQNDRLPLRVVVQVLFFEQVRAAASSGSSTPDLPK  502

Query  614  A-IKDL-NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRL----GNAGMADRA  453
              I++L +C +YGSSRS  T  E++WD VA+ +E+RALK E+AAL+L    G   M DRA
Sbjct  503  GMIRELRSCGTYGSSRSVPTVMEDEWDAVATEEEMRALKSEIAALKLQEESGRKSM-DRA  561

Query  452  NGDTTKTVASSDKAAAISKMKGLLVSKRIFSK  357
                           A+SK+K L+ SK+IF K
Sbjct  562  T------------VTALSKVKSLIKSKKIFGK  581



>ref|NP_179089.1| BTB/POZ domain-containing protein NPY2 [Arabidopsis thaliana]
 sp|O80970.1|NPY2_ARATH RecName: Full=BTB/POZ domain-containing protein NPY2; AltName: 
Full=Protein NAKED PINS IN YUC MUTANTS 2 [Arabidopsis thaliana]
 gb|AAC24177.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC06336.1| BTB/POZ domain-containing protein NPY2 [Arabidopsis thaliana]
Length=634

 Score =   167 bits (423),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 113/152 (74%), Gaps = 19/152 (13%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +K E+KR+C+LMDC+KLS +ACMHAVQN+RLPLRVVVQVLFFEQVRA ASSGSSTPDLP+
Sbjct  443  TKGEKKRMCKLMDCRKLSVEACMHAVQNDRLPLRVVVQVLFFEQVRAAASSGSSTPDLPR  502

Query  614  AI-KDL-NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRL----GNAGMADRA  453
             + ++L +C +YGSSRS  T  E++W+ VA+ +E+RALK E+AAL+L    G   M DRA
Sbjct  503  GMGRELRSCGTYGSSRSVPTVMEDEWEAVATEEEMRALKSEIAALKLQEESGRKSM-DRA  561

Query  452  NGDTTKTVASSDKAAAISKMKGLLVSKRIFSK  357
                           AISK++ L++SK+IF K
Sbjct  562  G------------VTAISKIRSLIMSKKIFGK  581



>ref|XP_010467261.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Camelina sativa]
 ref|XP_010467262.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Camelina sativa]
 ref|XP_010467263.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Camelina sativa]
Length=637

 Score =   167 bits (422),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 113/152 (74%), Gaps = 19/152 (13%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +K E+KR+C+LMDC+KLS +ACMHAVQN+RLPLRVVVQVLFFEQVRA ASSGSSTPDLP+
Sbjct  443  TKGEKKRMCKLMDCRKLSVEACMHAVQNDRLPLRVVVQVLFFEQVRAAASSGSSTPDLPR  502

Query  614  AI-KDL-NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRL----GNAGMADRA  453
             + ++L +C +YGSSRS  T  E++W+ VA+ +E+RALK E+AAL+L    G   M D+A
Sbjct  503  GMARELRSCGTYGSSRSVPTVMEDEWEAVATEEEMRALKSEIAALKLQEESGRKSM-DKA  561

Query  452  NGDTTKTVASSDKAAAISKMKGLLVSKRIFSK  357
                         A AISKM+ L+ SK+IF K
Sbjct  562  G------------ATAISKMRSLIKSKKIFGK  581



>ref|XP_010467259.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Camelina sativa]
Length=713

 Score =   167 bits (423),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 113/152 (74%), Gaps = 19/152 (13%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +K E+KR+C+LMDC+KLS +ACMHAVQN+RLPLRVVVQVLFFEQVRA ASSGSSTPDLP+
Sbjct  519  TKGEKKRMCKLMDCRKLSVEACMHAVQNDRLPLRVVVQVLFFEQVRAAASSGSSTPDLPR  578

Query  614  AI-KDL-NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRL----GNAGMADRA  453
             + ++L +C +YGSSRS  T  E++W+ VA+ +E+RALK E+AAL+L    G   M D+A
Sbjct  579  GMARELRSCGTYGSSRSVPTVMEDEWEAVATEEEMRALKSEIAALKLQEESGRKSM-DKA  637

Query  452  NGDTTKTVASSDKAAAISKMKGLLVSKRIFSK  357
                         A AISKM+ L+ SK+IF K
Sbjct  638  G------------ATAISKMRSLIKSKKIFGK  657



>ref|XP_006343206.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006343207.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Solanum tuberosum]
Length=627

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 140/191 (73%), Gaps = 9/191 (5%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            +KSERKRICRLMDC+KLSA+ACMHAVQNERLPLRVVVQVLFFEQ+RA ASS G STPDL 
Sbjct  442  TKSERKRICRLMDCRKLSAEACMHAVQNERLPLRVVVQVLFFEQLRATASSGGGSTPDLT  501

Query  617  KAIKDLNCASYGSSR---SATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANG  447
            +++K L     GS R   SAT+  E++ D V +A EL+ALKGELAALRL + G  + +N 
Sbjct  502  RSVKSL--LPVGSQRCSTSATSNIEDNPDAVLTAKELKALKGELAALRLRDRGDNNCSNL  559

Query  446  DTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKS  267
            + TKT A++      SK++  ++SK++ SK+WS+K    ENS SD+SES  S+   E KS
Sbjct  560  NDTKTNAAT---VDDSKVRSSIMSKKMLSKLWSNKERQSENSSSDTSESPSSSNAGETKS  616

Query  266  TPSRKGRYSVS  234
            T  R GR+S+S
Sbjct  617  TSCRSGRHSLS  627



>ref|XP_006579940.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Glycine max]
 ref|XP_006579941.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Glycine max]
Length=624

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 137/189 (72%), Gaps = 8/189 (4%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            SKSE+KRICRLM+C+KLSA+ACMHAVQNERLP+RVVVQVLFFEQ+RA  SS G+ TPD  
Sbjct  442  SKSEKKRICRLMNCRKLSAEACMHAVQNERLPMRVVVQVLFFEQLRATTSSGGNGTPDHS  501

Query  617  KAIK-DLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
             +I+  L   S+GSSRS     EE+W+ V + +++++LKGEL AL+L        +  + 
Sbjct  502  GSIRASLPGGSHGSSRS-----EEEWEAVGTMEDIKSLKGELIALKLSGGTRGASSRSNN  556

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
              +   + ++ A SKMKG LVSK+I SKIWSSK  +GE S SD+SES  ST +EE KSTP
Sbjct  557  NDSSKGNSESVAASKMKG-LVSKKIISKIWSSKERSGELSSSDTSESPASTVVEETKSTP  615

Query  260  SRKGRYSVS  234
            SR  R+S+S
Sbjct  616  SRSRRHSLS  624



>ref|XP_009379321.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Pyrus 
x bretschneideri]
 ref|XP_009379322.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Pyrus 
x bretschneideri]
 ref|XP_009379324.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Pyrus 
x bretschneideri]
Length=626

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 114/152 (75%), Gaps = 6/152 (4%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGS-STPDLP  618
            +K E+KR+C+LMDC+KLS DACMHAVQNERLPLRVVVQVLFFEQ+RA+AS GS STPDL 
Sbjct  437  NKGEKKRMCKLMDCRKLSIDACMHAVQNERLPLRVVVQVLFFEQIRASASGGSNSTPDLQ  496

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLG--NAGMADRANG  447
             +I+  L   S+GSSRS TT TE  WD V +A+E++ALK E+   RLG  N G+    NG
Sbjct  497  GSIRALLPGGSHGSSRSTTTNTENGWDDVPTAEEIKALKCEIFTPRLGEVNGGVGSDRNG  556

Query  446  DTTKTVASSDKAAAISKMKGLLVSKRIFSKIW  351
            +   T  + +K  +  K+KG+++SK+IFSK+W
Sbjct  557  NPGAT-KNLEKVPS-GKVKGMIMSKKIFSKLW  586



>gb|ADL36611.1| BZIP domain class transcription factor [Malus domestica]
Length=626

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 113/152 (74%), Gaps = 6/152 (4%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGS-STPDLP  618
            SK E+KR+C+LMDC+KLS DACMHAVQNERLPLRVV QVLFFEQ+RA+AS GS S PDL 
Sbjct  437  SKGEKKRMCKLMDCRKLSVDACMHAVQNERLPLRVVAQVLFFEQIRASASGGSTSIPDLQ  496

Query  617  KAI-KDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLG--NAGMADRANG  447
             +I   L   S+GSSRS TT TE+DWD V +A+E++ALK E+   RLG  N G+    NG
Sbjct  497  GSIWALLPGGSHGSSRSTTTNTEDDWDDVPTAEEIKALKCEIFTPRLGEVNGGVGSDRNG  556

Query  446  DTTKTVASSDKAAAISKMKGLLVSKRIFSKIW  351
            +   T  + +K  +  K+KG+++SK+IFSK+W
Sbjct  557  NPGAT-KNLEKVPS-GKVKGMIMSKKIFSKLW  586



>ref|XP_006297197.1| hypothetical protein CARUB_v10013204mg [Capsella rubella]
 gb|EOA30095.1| hypothetical protein CARUB_v10013204mg [Capsella rubella]
Length=631

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 113/150 (75%), Gaps = 15/150 (10%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +K E+KR+C+LMDC+KLS +ACMHAVQN+RLPLRVVVQVLFFEQVRA ASSGSSTPDLP+
Sbjct  443  TKGEKKRMCKLMDCRKLSVEACMHAVQNDRLPLRVVVQVLFFEQVRAAASSGSSTPDLPR  502

Query  614  AI-KDL-NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
             + ++L +C +YGSSRS  T  E++W+ VA+ +E+RALK E+AAL+L         +G  
Sbjct  503  GMGRELRSCGTYGSSRSVPTVMEDEWEAVATEEEMRALKSEIAALKL------QEESGR-  555

Query  440  TKTVASSDKAA--AISKMKGLLVSKRIFSK  357
                 S DKA   AISKM+ L+ SK+IF K
Sbjct  556  ----KSMDKAGVTAISKMRSLIKSKKIFGK  581



>gb|KHN06014.1| BTB/POZ domain-containing protein NPY2 [Glycine soja]
Length=625

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 137/189 (72%), Gaps = 8/189 (4%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            SKSE+KRICRLM+C+KLSA+ACMHAVQNERLP+RVVVQVLFFEQ+RA  SS G+ TPD  
Sbjct  443  SKSEKKRICRLMNCRKLSAEACMHAVQNERLPMRVVVQVLFFEQLRATTSSGGNGTPDHS  502

Query  617  KAIK-DLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
             +I+  L   S+GSSRS     EE+W+ V + +++++LKGEL AL+L        +  + 
Sbjct  503  GSIRASLPGGSHGSSRS-----EEEWEAVGTMEDIKSLKGELIALKLSGGTRGASSRSNN  557

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
              +   + ++ A SKMKG LVSK+I SKIWSSK  +GE S SD+SES  ST +EE KSTP
Sbjct  558  NDSSKGNAESVAASKMKG-LVSKKIISKIWSSKERSGELSSSDTSESPASTVVEETKSTP  616

Query  260  SRKGRYSVS  234
            SR  R+S+S
Sbjct  617  SRSRRHSLS  625



>ref|XP_008352545.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Malus 
domestica]
 ref|XP_008352546.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Malus 
domestica]
 ref|XP_008352547.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Malus 
domestica]
 ref|XP_008352548.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Malus 
domestica]
 ref|XP_008352549.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Malus 
domestica]
 ref|XP_008352550.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Malus 
domestica]
 ref|XP_008352551.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Malus 
domestica]
Length=626

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 112/152 (74%), Gaps = 6/152 (4%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGS-STPDLP  618
            SK E+KR+C+LMDC+KLS DACMHAVQNERLP RVV QVLFFEQ+RA+AS GS S PDL 
Sbjct  437  SKGEKKRMCKLMDCRKLSVDACMHAVQNERLPFRVVAQVLFFEQIRASASGGSTSIPDLQ  496

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLG--NAGMADRANG  447
             +I   L   S+GSSRS TT TE+DWD V +A+E++ALK E+   RLG  N G+    NG
Sbjct  497  GSIXALLPGGSHGSSRSTTTNTEDDWDDVPTAEEIKALKCEIFTPRLGEVNGGVGSDRNG  556

Query  446  DTTKTVASSDKAAAISKMKGLLVSKRIFSKIW  351
            +   T  + +K  +  K+KG+++SK+IFSK+W
Sbjct  557  NPGAT-KNLEKVPS-GKVKGMIMSKKIFSKLW  586



>ref|XP_008338429.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Malus 
domestica]
 ref|XP_008338430.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Malus 
domestica]
 ref|XP_008338431.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Malus 
domestica]
 ref|XP_008338432.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Malus 
domestica]
Length=626

 Score =   164 bits (416),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 112/152 (74%), Gaps = 6/152 (4%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGS-STPDLP  618
            SK E+KR+C+LMDC+KLS DACMHAVQNERLP RVV QVLFFEQ+RA+AS GS S PDL 
Sbjct  437  SKGEKKRMCKLMDCRKLSVDACMHAVQNERLPXRVVAQVLFFEQIRASASGGSTSIPDLQ  496

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLG--NAGMADRANG  447
             +I   L   S+GSSRS TT TE+DWD V +A+E++ALK E+   RLG  N G+    NG
Sbjct  497  GSIXALLPGGSHGSSRSTTTNTEDDWDDVPTAEEIKALKCEIFTPRLGEVNGGVGSDRNG  556

Query  446  DTTKTVASSDKAAAISKMKGLLVSKRIFSKIW  351
            +   T  + +K  +  K+KG+++SK+IFSK+W
Sbjct  557  NPGAT-KNLEKVPS-GKVKGMIMSKKIFSKLW  586



>ref|XP_010488917.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X1 
[Camelina sativa]
 ref|XP_010488918.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X2 
[Camelina sativa]
 ref|XP_010488919.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X1 
[Camelina sativa]
 ref|XP_010488920.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X1 
[Camelina sativa]
 ref|XP_010488921.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X1 
[Camelina sativa]
 ref|XP_010488922.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X1 
[Camelina sativa]
 ref|XP_010488923.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X1 
[Camelina sativa]
Length=634

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 112/150 (75%), Gaps = 15/150 (10%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +K E+KR+C++MDC+KLS +ACMHAVQN+RLPLRVVVQVLFFEQVRA ASSGSSTPDLP+
Sbjct  443  TKGEKKRMCKMMDCRKLSVEACMHAVQNDRLPLRVVVQVLFFEQVRAAASSGSSTPDLPR  502

Query  614  AI-KDL-NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
             + ++L +C +YGSSRS  T  E++W+ VA+ +E+RALK E+AAL+L         +G  
Sbjct  503  GMARELRSCGTYGSSRSVPTVMEDEWEAVATEEEMRALKSEIAALKL------QEESGRK  556

Query  440  TKTVASSDKAAAI--SKMKGLLVSKRIFSK  357
                 S DKA A   SKM+ L+ SK+IF K
Sbjct  557  -----SMDKAGATARSKMRSLIKSKKIFGK  581



>ref|XP_011073694.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Sesamum 
indicum]
 ref|XP_011073695.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Sesamum 
indicum]
Length=634

 Score =   162 bits (410),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 129/179 (72%), Gaps = 8/179 (4%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQ-VRANASSGSSTPDLP  618
            SKSE+KRICRLMDC+KLSADAC HAVQNERLPLRVVVQ+LFFEQ   A A++G  +PDLP
Sbjct  440  SKSEKKRICRLMDCRKLSADACAHAVQNERLPLRVVVQLLFFEQARAAAAATGGKSPDLP  499

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
              ++  L   SYGSSRSATT ++EDW+G  +++EL+ LKGELA+LRL N G +D  +  T
Sbjct  500  GTVRALLPRGSYGSSRSATTNSDEDWEGDQTSEELKDLKGELASLRLRNKGRSDSESAGT  559

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKST  264
                 S+ +     K+      K+IFSK+W+SK   GENS SD+SES  ST+ EEAK T
Sbjct  560  ANDTKSNTEKGTPKKV------KKIFSKLWTSKDRQGENSSSDTSESPASTSAEEAKET  612



>ref|XP_010517747.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Camelina 
sativa]
 ref|XP_010517752.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Camelina 
sativa]
 ref|XP_010517760.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Camelina 
sativa]
 ref|XP_010517769.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Camelina 
sativa]
 ref|XP_010517777.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Camelina 
sativa]
 ref|XP_010517783.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Camelina 
sativa]
 ref|XP_010517790.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Camelina 
sativa]
Length=626

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 112/150 (75%), Gaps = 16/150 (11%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +K E+KRIC+LMDC+KLS +ACMHAVQN+RLPLRVVVQVLFFEQVRA ASSGSSTPDLP+
Sbjct  438  TKGEKKRICKLMDCRKLSVEACMHAVQNDRLPLRVVVQVLFFEQVRAAASSGSSTPDLPR  497

Query  614  AI-KDL-NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
             + ++L +C +Y SSRS  T  E++W+ VA+ +E+RALK E+AAL+L           D+
Sbjct  498  GMARELRSCGTYVSSRSVPTVMEDEWEAVATEEEMRALKSEIAALKLQE---------DS  548

Query  440  TKTVASSDKAA--AISKMKGLLVSKRIFSK  357
             +   S DKA   AISKM+ L+ SK IF K
Sbjct  549  GR--KSMDKAGVTAISKMRSLIKSK-IFGK  575



>ref|XP_010317781.1| PREDICTED: BTB/POZ domain-containing protein NPY4 isoform X2 
[Solanum lycopersicum]
Length=615

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 111/153 (73%), Gaps = 11/153 (7%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            +KSERKRICRLMDC+KLSA+ACMHAVQNERLP+R+VVQVLFFEQ+RA ASS G STPDL 
Sbjct  427  TKSERKRICRLMDCRKLSAEACMHAVQNERLPVRIVVQVLFFEQLRATASSGGGSTPDLT  486

Query  617  KAIKDLNCASYGSSR---SATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRAN-  450
            + +K L     GS R   SAT+  E++ D V +A EL+ LKGELA LRL + G  + +N 
Sbjct  487  RPVKSL--LPVGSQRCSTSATSNIEDNSDAVLTAKELKDLKGELATLRLRDRGDNNCSNL  544

Query  449  GDTTKTVASSDKAAAISKMKGLLVSKRIFSKIW  351
             D  K  A+ D     SK++  ++SK++FSK+W
Sbjct  545  NDMIKNAATVDD----SKVRSSVMSKKMFSKLW  573



>ref|XP_010317782.1| PREDICTED: BTB/POZ domain-containing protein NPY4 isoform X3 
[Solanum lycopersicum]
 ref|XP_010317783.1| PREDICTED: BTB/POZ domain-containing protein NPY4 isoform X3 
[Solanum lycopersicum]
Length=600

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 111/153 (73%), Gaps = 11/153 (7%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            +KSERKRICRLMDC+KLSA+ACMHAVQNERLP+R+VVQVLFFEQ+RA ASS G STPDL 
Sbjct  412  TKSERKRICRLMDCRKLSAEACMHAVQNERLPVRIVVQVLFFEQLRATASSGGGSTPDLT  471

Query  617  KAIKDLNCASYGSSR---SATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRAN-  450
            + +K L     GS R   SAT+  E++ D V +A EL+ LKGELA LRL + G  + +N 
Sbjct  472  RPVKSL--LPVGSQRCSTSATSNIEDNSDAVLTAKELKDLKGELATLRLRDRGDNNCSNL  529

Query  449  GDTTKTVASSDKAAAISKMKGLLVSKRIFSKIW  351
             D  K  A+ D     SK++  ++SK++FSK+W
Sbjct  530  NDMIKNAATVDD----SKVRSSVMSKKMFSKLW  558



>ref|XP_004234653.1| PREDICTED: BTB/POZ domain-containing protein NPY4 isoform X1 
[Solanum lycopersicum]
 ref|XP_010317780.1| PREDICTED: BTB/POZ domain-containing protein NPY4 isoform X1 
[Solanum lycopersicum]
Length=630

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 111/153 (73%), Gaps = 11/153 (7%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            +KSERKRICRLMDC+KLSA+ACMHAVQNERLP+R+VVQVLFFEQ+RA ASS G STPDL 
Sbjct  442  TKSERKRICRLMDCRKLSAEACMHAVQNERLPVRIVVQVLFFEQLRATASSGGGSTPDLT  501

Query  617  KAIKDLNCASYGSSR---SATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRAN-  450
            + +K L     GS R   SAT+  E++ D V +A EL+ LKGELA LRL + G  + +N 
Sbjct  502  RPVKSL--LPVGSQRCSTSATSNIEDNSDAVLTAKELKDLKGELATLRLRDRGDNNCSNL  559

Query  449  GDTTKTVASSDKAAAISKMKGLLVSKRIFSKIW  351
             D  K  A+ D     SK++  ++SK++FSK+W
Sbjct  560  NDMIKNAATVDD----SKVRSSVMSKKMFSKLW  588



>ref|XP_011099363.1| PREDICTED: BTB/POZ domain-containing protein NPY3 isoform X2 
[Sesamum indicum]
Length=583

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 116/186 (62%), Gaps = 17/186 (9%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGS-STPDLP  618
            +KSE+KRICRLMDC+KLS +AC HAVQNERLPLRVVVQVLFFEQ RA A+  S S PDLP
Sbjct  410  TKSEKKRICRLMDCRKLSGEACAHAVQNERLPLRVVVQVLFFEQARAAATVDSGSIPDLP  469

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
             +++  L   SYGSSRSATT T+ED D    ++EL+ LKGELA+L+L N G    +  DT
Sbjct  470  GSVRALLPGGSYGSSRSATTNTDEDLDRDQISEELKTLKGELASLKLTNKG----STNDT  525

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
              T    D              K IFS++W      G  + S  +    ++T EE +STP
Sbjct  526  KLTTEKIDANKV----------KTIFSRLW-LSKDRGGENSSSDTSESPTSTAEETRSTP  574

Query  260  SRKGRY  243
            S   R+
Sbjct  575  SGSRRH  580



>ref|XP_011099362.1| PREDICTED: BTB/POZ domain-containing protein NPY5 isoform X1 
[Sesamum indicum]
Length=613

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 116/186 (62%), Gaps = 17/186 (9%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGS-STPDLP  618
            +KSE+KRICRLMDC+KLS +AC HAVQNERLPLRVVVQVLFFEQ RA A+  S S PDLP
Sbjct  440  TKSEKKRICRLMDCRKLSGEACAHAVQNERLPLRVVVQVLFFEQARAAATVDSGSIPDLP  499

Query  617  KAIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
             +++  L   SYGSSRSATT T+ED D    ++EL+ LKGELA+L+L N G    +  DT
Sbjct  500  GSVRALLPGGSYGSSRSATTNTDEDLDRDQISEELKTLKGELASLKLTNKG----STNDT  555

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
              T    D              K IFS++W      G  + S  +    ++T EE +STP
Sbjct  556  KLTTEKIDANKV----------KTIFSRLW-LSKDRGGENSSSDTSESPTSTAEETRSTP  604

Query  260  SRKGRY  243
            S   R+
Sbjct  605  SGSRRH  610



>ref|XP_004982439.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Setaria 
italica]
Length=635

 Score =   147 bits (371),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 129/193 (67%), Gaps = 10/193 (5%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTP--DL  621
            SKSE+K++C LMDCK+LS DACMHAVQNERLPLRVVVQVLFFEQVRA+ +S  S P  +L
Sbjct  447  SKSEKKKLCGLMDCKQLSQDACMHAVQNERLPLRVVVQVLFFEQVRASVASARSDPSVEL  506

Query  620  PKAIKDL----NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRA  453
            P  ++ L    N  S GSSRSA TTT E+  GV ++ ++ +L+    ++RL N       
Sbjct  507  PSVVRSLLPRENGNSIGSSRSAATTTTEEECGVPTSSDINSLR----SMRLANNSGGSER  562

Query  452  NGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEA  273
            +  ++    + D  +A  K KG+L+ K+I SK+WS K   GENS SD+SES GS   EE 
Sbjct  563  SSGSSDMNKNGDDKSASGKAKGMLMPKKILSKLWSGKTNAGENSSSDTSESPGSVNPEEV  622

Query  272  KSTPSRKGRYSVS  234
            KST SR  R+SVS
Sbjct  623  KSTQSRITRHSVS  635



>ref|XP_002464238.1| hypothetical protein SORBIDRAFT_01g014760 [Sorghum bicolor]
 gb|EER91236.1| hypothetical protein SORBIDRAFT_01g014760 [Sorghum bicolor]
Length=633

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 128/193 (66%), Gaps = 10/193 (5%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTP--DL  621
            SKSE+K++C LMDCK+LS DACMHAVQNERLPLRVVVQVLFFEQVRA+ +S  S P  +L
Sbjct  445  SKSEKKKLCGLMDCKQLSQDACMHAVQNERLPLRVVVQVLFFEQVRASVASARSDPSSEL  504

Query  620  PKAIKDL----NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRA  453
            P  ++ L    N  S GSSRSA TTT E+  GV ++ ++ +L+    ++RL N       
Sbjct  505  PSVVRSLLPRENGNSIGSSRSAATTTTEEECGVPTSSDINSLR----SMRLANNSGGSER  560

Query  452  NGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEA  273
            +  ++    +SD  +   K KG+L+ K+I SK+WS K   GENS SD+SES GS   EE 
Sbjct  561  SSGSSDINKNSDDKSTAGKAKGMLMPKKILSKLWSGKTNAGENSSSDTSESPGSVNPEEV  620

Query  272  KSTPSRKGRYSVS  234
            KST SR  R SVS
Sbjct  621  KSTQSRITRRSVS  633



>ref|XP_006826702.1| hypothetical protein AMTR_s00137p00096710 [Amborella trichopoda]
 gb|ERM93939.1| hypothetical protein AMTR_s00137p00096710 [Amborella trichopoda]
Length=670

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 128/213 (60%), Gaps = 42/213 (20%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSST----P  627
            SK E+KRIC LMDC+KLS DACMHA QNERLPLRVVVQVLFFEQVR+  SS +      P
Sbjct  474  SKGEKKRICGLMDCRKLSMDACMHAAQNERLPLRVVVQVLFFEQVRSATSSSTVQADMLP  533

Query  626  DLPKAIKDL--------NCASYGSSRSATTTTEEDWD----------GVASADELRALKG  501
            +LP +I+ L        NC S+GSSR  TT TE++W+          G  +A+E+RALK 
Sbjct  534  ELPGSIRALLPAARGSHNCGSHGSSR--TTNTEDEWECSGGGGPAYSGGPTAEEIRALKS  591

Query  500  ELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngens  321
            ELAALR+G        N +  K           S++KG+L +++IFSKIW +    G++ 
Sbjct  592  ELAALRVG----GKSGNCNMEKE----------SRLKGILRTRKIFSKIWGANAKGGKDG  637

Query  320  gsdsseslgSTTME----EAKSTPSRKGRYSVS  234
            G ++S     +       +AKST SR  R+S+S
Sbjct  638  GENTSSDTSESPGSGNPGDAKSTLSRNRRHSIS  670



>ref|XP_009388923.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388924.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Musa 
acuminata subsp. malaccensis]
Length=631

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 127/193 (66%), Gaps = 11/193 (6%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSE+K+IC LMDCKKLSADAC+HAVQNERLPLRVVVQVLFFEQ+RA  +      +LP 
Sbjct  444  TKSEKKKICALMDCKKLSADACIHAVQNERLPLRVVVQVLFFEQMRAAGAMAGGATELPG  503

Query  614  AIKDL----NCASYGSSRSA-TTTTEEDWDGVA-SADELRALKGELAALRLGNAGMADRA  453
             I+      N  SYGSSRSA TT TE++WDGV  +A  L +LK  +     G        
Sbjct  504  NIRAAFLRENGGSYGSSRSAITTNTEDEWDGVPTTAGNLNSLKS-VNLSSRGGGSQRSSG  562

Query  452  NGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEA  273
            +GD  K     DKA    K+KG+ +SK+I +K+WSSKG   ENS SD SES  S+  EEA
Sbjct  563  SGDVNK--HGDDKAN--DKVKGIPMSKKILNKLWSSKGQGSENSSSDMSESPDSSNQEEA  618

Query  272  KSTPSRKGRYSVS  234
            KST SR  R+SVS
Sbjct  619  KSTHSRNTRHSVS  631



>ref|XP_010548457.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Tarenaya 
hassleriana]
 ref|XP_010548458.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Tarenaya 
hassleriana]
 ref|XP_010548459.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Tarenaya 
hassleriana]
 ref|XP_010548461.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Tarenaya 
hassleriana]
 ref|XP_010548462.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Tarenaya 
hassleriana]
Length=575

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 104/149 (70%), Gaps = 30/149 (20%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            +KSE+KRICRLMDC+KLSA+AC HAVQNERLPLRVVVQVLFFEQVRAN SS G+STPDLP
Sbjct  422  TKSEKKRICRLMDCRKLSAEACAHAVQNERLPLRVVVQVLFFEQVRANGSSTGNSTPDLP  481

Query  617  KAIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTT  438
             +           S + TT TE++WD     +E++AL+GELA+LR        + N +T 
Sbjct  482  AS----------RSTTTTTKTEDEWD----PEEIKALRGELASLRQA------KNNQETD  521

Query  437  KTVASSDKAAAISKMKGLLVSKRIFSKIW  351
            K      KAAA   M+G+ VS R+FSK+W
Sbjct  522  K-----GKAAA---MRGMAVS-RVFSKMW  541



>ref|XP_010907394.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Elaeis guineensis]
Length=577

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 129/199 (65%), Gaps = 25/199 (13%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTP----  627
            +KSE+K+IC LMDCKKLS DACMHAVQN+RLPLRVVVQVLFFEQ+RA+A   ++TP    
Sbjct  392  TKSEKKKICGLMDCKKLSVDACMHAVQNDRLPLRVVVQVLFFEQLRASA---AATPGNGA  448

Query  626  DLPKAIKDL----NCASYGSSRS-ATTTTEEDWDG-VASADELRALKGELAALRLGNAGM  465
            D+P++ + L    N  SY SSRS A T  E+DWDG V     L+++           +  
Sbjct  449  DIPQSARLLLPRENDTSYASSRSAAMTNAEDDWDGAVGDVSSLKSMSLVGRGGGSERSSG  508

Query  464  ADRA--NGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgS  291
            ++    NGD               K+KG+L+ KRI +K+WSSKG  GENS SD+S+S GS
Sbjct  509  SNEVNKNGDEKGN----------GKVKGMLMPKRILNKLWSSKGQGGENSNSDTSDSPGS  558

Query  290  TTMEEAKSTPSRKGRYSVS  234
            T +EE+KSTPSR  R SVS
Sbjct  559  TNVEESKSTPSRNTRRSVS  577



>ref|XP_009399110.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009399111.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like [Musa 
acuminata subsp. malaccensis]
Length=631

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 127/196 (65%), Gaps = 17/196 (9%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVR-ANASSGSSTPDLP  618
            SKSE++RIC +MDC+KLS DAC+HAVQNERLPLRVVVQ+LFF Q+R A A +      LP
Sbjct  444  SKSEKRRICSMMDCRKLSTDACVHAVQNERLPLRVVVQILFFVQMRAAAAPAAGGVSQLP  503

Query  617  KAIKDL---NCASYGSSRSATTT-TEEDWDGVASADELRALKGELAALRLGNAGMADRAN  450
              +K L   N  SYGSSRSA TT TE+DWDGV +A       G++ +L+  +AG   R  
Sbjct  504  GNVKALLRENGGSYGSSRSAVTTNTEDDWDGVPTAG------GDINSLK--SAGPVGRGG  555

Query  449  GDTTKT----VASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTM  282
            G    +    V+         K+KG+L+ KRI SK+WS KG  GENS SD SES GS   
Sbjct  556  GSQRSSGGSDVSKHGDEKGNGKVKGILLPKRILSKLWSGKGQGGENSSSDMSESPGSVAQ  615

Query  281  EEAKSTPSRKGRYSVS  234
            EEAKST SR  R+SVS
Sbjct  616  EEAKSTHSRNTRHSVS  631



>ref|XP_006650278.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Oryza 
brachyantha]
Length=634

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 126/194 (65%), Gaps = 11/194 (6%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSG--SSTPDL  621
            SKSE+K++C LMDCKKLS DACMHAVQNERLPLRVVVQVLFFEQ+RA+ +SG   +  +L
Sbjct  445  SKSEKKQLCGLMDCKKLSQDACMHAVQNERLPLRVVVQVLFFEQIRASVASGRADAAMEL  504

Query  620  PKAIKDL----NCASYGSSRS-ATTTTEEDWDGVASADELRALKGELAALRLGNAGMADR  456
              A+  L    N  SYGSSRS ATTTTEED  GV ++ ++ +L+    +LRL N      
Sbjct  505  TSAVHSLLPRENGNSYGSSRSAATTTTEEDCTGVPTSSDVNSLR----SLRLANNSGGSE  560

Query  455  ANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEE  276
             +  ++     S    + SK KG L+ K+I SK+WS K    ENS SD+SE  GS   EE
Sbjct  561  RSSGSSDVNNKSSDDKSSSKSKGSLMPKKILSKLWSGKTNASENSSSDTSERPGSLNPEE  620

Query  275  AKSTPSRKGRYSVS  234
             KST SR  R SV+
Sbjct  621  GKSTTSRNTRRSVT  634



>ref|XP_010907392.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010907393.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like isoform 
X1 [Elaeis guineensis]
Length=630

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 129/199 (65%), Gaps = 25/199 (13%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTP----  627
            +KSE+K+IC LMDCKKLS DACMHAVQN+RLPLRVVVQVLFFEQ+RA+A   ++TP    
Sbjct  445  TKSEKKKICGLMDCKKLSVDACMHAVQNDRLPLRVVVQVLFFEQLRASA---AATPGNGA  501

Query  626  DLPKAIKDL----NCASYGSSRS-ATTTTEEDWDG-VASADELRALKGELAALRLGNAGM  465
            D+P++ + L    N  SY SSRS A T  E+DWDG V     L+++           +  
Sbjct  502  DIPQSARLLLPRENDTSYASSRSAAMTNAEDDWDGAVGDVSSLKSMSLVGRGGGSERSSG  561

Query  464  ADRA--NGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgS  291
            ++    NGD               K+KG+L+ KRI +K+WSSKG  GENS SD+S+S GS
Sbjct  562  SNEVNKNGDEKGN----------GKVKGMLMPKRILNKLWSSKGQGGENSNSDTSDSPGS  611

Query  290  TTMEEAKSTPSRKGRYSVS  234
            T +EE+KSTPSR  R SVS
Sbjct  612  TNVEESKSTPSRNTRRSVS  630



>ref|XP_008777297.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Phoenix 
dactylifera]
 ref|XP_008777298.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Phoenix 
dactylifera]
 ref|XP_008777299.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Phoenix 
dactylifera]
Length=620

 Score =   135 bits (341),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 123/187 (66%), Gaps = 11/187 (6%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERK++CRLMDCKKLS +AC HAVQNERLPLRVVVQVLFFEQVRA A++   T     
Sbjct  445  SKSERKKLCRLMDCKKLSVNACTHAVQNERLPLRVVVQVLFFEQVRAAAATAGQT-----  499

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
               +   +   S    TT TE+DWDGV + ++L++LK    +++L +   ++R +G    
Sbjct  500  --VNSGGSYGSSRSGVTTNTEDDWDGVPTVEDLKSLK----SMKLMDGKESERTSGSNNA  553

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPSR  255
            +  + +  A   ++KG+++ K+I  K+ SSKG  GENS SD+S S GS   +E KSTPSR
Sbjct  554  SKNNGNDRAGSVEVKGMVMPKKILGKLLSSKGQGGENSSSDTSGSPGSANRDEPKSTPSR  613

Query  254  KGRYSVS  234
              R+ VS
Sbjct  614  NTRHHVS  620



>ref|XP_010526711.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Tarenaya 
hassleriana]
 ref|XP_010526712.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Tarenaya 
hassleriana]
 ref|XP_010526713.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Tarenaya 
hassleriana]
Length=572

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 96/149 (64%), Gaps = 32/149 (21%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDLP  618
            +K E+KRICRLMDC+KLSA+AC HAVQNERLPLRV+VQVLFFE  RAN SS G+STPDL 
Sbjct  420  TKKEKKRICRLMDCRKLSAEACEHAVQNERLPLRVIVQVLFFELARANGSSTGNSTPDLQ  479

Query  617  KAIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTT  438
             +           S + TT TEEDWD     +E++AL+GELA LR+G  G   R +G   
Sbjct  480  AS----------RSTTITTNTEEDWD----QEEIKALRGELANLRMGKKG---RESGKG-  521

Query  437  KTVASSDKAAAISKMKGLLVSKRIFSKIW  351
                          MKG+ VS R+FSK+W
Sbjct  522  ------------KVMKGMAVS-RVFSKMW  537



>ref|NP_001146578.1| uncharacterized protein LOC100280174 [Zea mays]
 gb|ACL54319.1| unknown [Zea mays]
Length=635

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 121/196 (62%), Gaps = 17/196 (9%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTP---D  624
            SKSE+K++C LMDCK+LS DACMHAVQNERLPLRVVVQVLFFEQVRA+ +S  S P   +
Sbjct  448  SKSEKKKLCGLMDCKQLSHDACMHAVQNERLPLRVVVQVLFFEQVRASVASARSDPSSAE  507

Query  623  LPKAIKDL----NCASYGSSRS-ATTTTEEDWDGVASADELRALKGELAALRLGNAGMAD  459
            LP A++ L    N  S GSSRS ATTTTEED  GV ++ ++ +L+    + RL N    +
Sbjct  508  LPSAVRSLLPRENGNSVGSSRSAATTTTEEDGCGVPTSSDVNSLR----STRLAN----N  559

Query  458  RANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWs-skggngensgsdsseslgSTTM  282
                + +   +  +++AA    +G+L+ K++ SK+WS        +S   S         
Sbjct  560  SGGSERSSGSSDINRSAAGRGARGILMPKKMLSKLWSGKTNAGENSSSDTSQSPGSVNNP  619

Query  281  EEAKSTPSRKGRYSVS  234
            EE KST SR  R SVS
Sbjct  620  EEVKSTQSRITRRSVS  635



>ref|XP_008787171.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X2 
[Phoenix dactylifera]
Length=530

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 121/189 (64%), Gaps = 15/189 (8%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERK+IC LMDCKKLSADAC HAVQNERLPLR VVQVLFFEQVRA A++   T     
Sbjct  355  SKSERKKICGLMDCKKLSADACSHAVQNERLPLRAVVQVLFFEQVRAAATAAGRTE----  410

Query  614  AIKDLNC--ASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
                 NC  +   SS   TT TE+DWDG+ + ++ + LK    +++L   G ++R++   
Sbjct  411  -----NCGGSYGSSSSGVTTNTEDDWDGLPTVEDFKLLK----SMKLVGGGESERSSDSN  461

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
              +    +  A   K+KG+++ K+I  K+ SSKG  GEN+ SD+S S GS   +E KSTP
Sbjct  462  AASKNQGNDRAGNGKVKGIMMPKKILGKLLSSKGQGGENTSSDTSGSPGSANPDEPKSTP  521

Query  260  SRKGRYSVS  234
             R  RYSVS
Sbjct  522  LRNTRYSVS  530



>ref|XP_008792560.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Phoenix 
dactylifera]
 ref|XP_008792561.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Phoenix 
dactylifera]
 ref|XP_008792562.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Phoenix 
dactylifera]
Length=630

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 125/196 (64%), Gaps = 19/196 (10%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSST-PDLP  618
            +KSE+K+IC LMDCKKLS DA MHAVQN+RLPLRVVVQVLFFEQ+RA A++ +    D+P
Sbjct  445  AKSEKKKICGLMDCKKLSVDASMHAVQNDRLPLRVVVQVLFFEQLRATAAAPAGNGADIP  504

Query  617  KAIKDL----NCASYGSSRS-ATTTTEEDWDG-VASADELRALKGELAALRLGNAGMADR  456
            ++ + L    N  SY SSRS A T TE+DWDG V     L+++           +  ++ 
Sbjct  505  RSARLLLPPENGTSYASSRSAAMTNTEDDWDGAVGDVSSLKSMSLVRRGGGSERSSGSNE  564

Query  455  A--NGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTM  282
               NGD               K+KG+L+ K+I  K+WSSKG  GE+S SD+S+S GS  +
Sbjct  565  VNKNGDEKGN----------GKVKGILMPKKILGKLWSSKGQGGESSNSDTSDSPGSINL  614

Query  281  EEAKSTPSRKGRYSVS  234
            EE+KSTPSR  R SVS
Sbjct  615  EESKSTPSRNTRRSVS  630



>ref|XP_010942827.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010942828.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like isoform 
X1 [Elaeis guineensis]
Length=621

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 120/188 (64%), Gaps = 12/188 (6%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERK+IC LMDCKKLSADAC HAVQNERLPLRVVVQVLFFEQVRA A++   T     
Sbjct  445  SKSERKKICGLMDCKKLSADACTHAVQNERLPLRVVVQVLFFEQVRAAAAAAGRT-----  499

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
               +   +   SS   TT TE+DWDGV + ++LR+LK     ++L   G ++R++     
Sbjct  500  --GNHGGSYGSSSSGVTTNTEDDWDGVPTVEDLRSLK----CMKLVGGGESERSSDSIAA  553

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEA-KSTPS  258
                 +  A   K+KG+++ K+I  K+ SSKG  GENS SD+S S  S   +E  K TPS
Sbjct  554  GRNHGNDKAGNGKVKGIMMPKKILGKLLSSKGQGGENSSSDTSGSPDSANQDETKKGTPS  613

Query  257  RKGRYSVS  234
            R  RYSVS
Sbjct  614  RNTRYSVS  621



>ref|XP_010942829.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like isoform 
X2 [Elaeis guineensis]
Length=612

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 120/188 (64%), Gaps = 12/188 (6%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERK+IC LMDCKKLSADAC HAVQNERLPLRVVVQVLFFEQVRA A++   T     
Sbjct  436  SKSERKKICGLMDCKKLSADACTHAVQNERLPLRVVVQVLFFEQVRAAAAAAGRT-----  490

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
               +   +   SS   TT TE+DWDGV + ++LR+LK     ++L   G ++R++     
Sbjct  491  --GNHGGSYGSSSSGVTTNTEDDWDGVPTVEDLRSLK----CMKLVGGGESERSSDSIAA  544

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEA-KSTPS  258
                 +  A   K+KG+++ K+I  K+ SSKG  GENS SD+S S  S   +E  K TPS
Sbjct  545  GRNHGNDKAGNGKVKGIMMPKKILGKLLSSKGQGGENSSSDTSGSPDSANQDETKKGTPS  604

Query  257  RKGRYSVS  234
            R  RYSVS
Sbjct  605  RNTRYSVS  612



>ref|XP_008787168.1| PREDICTED: BTB/POZ domain-containing protein NPY4 isoform X1 
[Phoenix dactylifera]
 ref|XP_008787170.1| PREDICTED: BTB/POZ domain-containing protein NPY4 isoform X1 
[Phoenix dactylifera]
Length=620

 Score =   131 bits (330),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 121/189 (64%), Gaps = 15/189 (8%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERK+IC LMDCKKLSADAC HAVQNERLPLR VVQVLFFEQVRA A++   T     
Sbjct  445  SKSERKKICGLMDCKKLSADACSHAVQNERLPLRAVVQVLFFEQVRAAATAAGRTE----  500

Query  614  AIKDLNC--ASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
                 NC  +   SS   TT TE+DWDG+ + ++ + LK    +++L   G ++R++   
Sbjct  501  -----NCGGSYGSSSSGVTTNTEDDWDGLPTVEDFKLLK----SMKLVGGGESERSSDSN  551

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
              +    +  A   K+KG+++ K+I  K+ SSKG  GEN+ SD+S S GS   +E KSTP
Sbjct  552  AASKNQGNDRAGNGKVKGIMMPKKILGKLLSSKGQGGENTSSDTSGSPGSANPDEPKSTP  611

Query  260  SRKGRYSVS  234
             R  RYSVS
Sbjct  612  LRNTRYSVS  620



>ref|XP_010232704.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like isoform 
X1 [Brachypodium distachyon]
Length=634

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 127/193 (66%), Gaps = 12/193 (6%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQV--RANASSGSSTPDL  621
            SKSE+KR+C LMDCKKLS DACMHAVQNERLPLRVVVQVLFFEQV   A ++ G S  +L
Sbjct  446  SKSEKKRLCGLMDCKKLSQDACMHAVQNERLPLRVVVQVLFFEQVRASAASARGGSAAEL  505

Query  620  PKAIKDL----NCASYGSSRS-ATTTTEEDWDGVASADELRALKGELAALRLGNAGMADR  456
              A++ L    N  SYGSSRS ATTTT+E+  G+ ++ ++ + +    ++RL N      
Sbjct  506  SSAVQSLLPRENGNSYGSSRSAATTTTDEEGSGIPTSSDINSFR----SMRLANNCGGSD  561

Query  455  ANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEE  276
            ++  +       DK+ A  K K +L+ K+I SK+WS K   GENS SD+SES GS   EE
Sbjct  562  SSLSSDINKNGEDKSTA-GKAKAMLMPKKILSKLWSGKTNVGENSSSDTSESPGSANPEE  620

Query  275  AKSTPSRKGRYSV  237
             KSTPSR  R S+
Sbjct  621  LKSTPSRNMRRSM  633



>gb|EYU29635.1| hypothetical protein MIMGU_mgv1a003178mg [Erythranthe guttata]
Length=602

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 81/106 (76%), Gaps = 8/106 (8%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKS++KRICRLMDC+KLS +AC HAVQNERLPLRVVVQVLFFEQ R          DLP 
Sbjct  425  SKSDKKRICRLMDCRKLSPEACSHAVQNERLPLRVVVQVLFFEQSRG-------AHDLPG  477

Query  614  AIKD-LNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRL  480
             ++  L   SYGSSRS TT +++DW+G  +++EL+ LKGELA+LRL
Sbjct  478  PVRALLPRGSYGSSRSTTTNSDDDWEGNQTSEELKDLKGELASLRL  523



>gb|AAK96859.1| putative protein [Arabidopsis thaliana]
 gb|AAM10059.1| putative protein [Arabidopsis thaliana]
Length=580

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 97/155 (63%), Gaps = 36/155 (23%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRAN----ASSGSSTP  627
            +KSE+KRICRLMDC+KLSA+AC HAVQNERLP+RVVVQVLFFEQVRAN    +S+G+STP
Sbjct  420  NKSEKKRICRLMDCRKLSAEACAHAVQNERLPMRVVVQVLFFEQVRANNNGSSSTGNSTP  479

Query  626  DLPKAIKDLNCASYGSSRSATTTTEED---WDGVASADELRALKGELAALRLGNAGMADR  456
            ++  A           SRS  TT +ED   WD     ++++AL+GELA LRL        
Sbjct  480  EVIPA-----------SRSTNTTDQEDTECWD----TEDIKALRGELANLRLA-------  517

Query  455  ANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIW  351
                  K    S     + K  GL VS R+FSK+W
Sbjct  518  ------KNQQESHNQGKLMKGGGLGVS-RVFSKLW  545



>dbj|BAF02155.1| hypothetical protein [Arabidopsis thaliana]
Length=580

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 97/155 (63%), Gaps = 36/155 (23%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRAN----ASSGSSTP  627
            +KSE+KRICRLMDC+KLSA+AC HAVQNERLP+RVVVQVLFFEQVRAN    +S+G+STP
Sbjct  420  NKSEKKRICRLMDCRKLSAEACAHAVQNERLPMRVVVQVLFFEQVRANNNGSSSTGNSTP  479

Query  626  DLPKAIKDLNCASYGSSRSATTTTEED---WDGVASADELRALKGELAALRLGNAGMADR  456
            ++  A           SRS  TT +ED   WD     ++++AL+GELA LRL        
Sbjct  480  EVIPA-----------SRSTNTTDQEDTECWD----TEDIKALRGELANLRLA-------  517

Query  455  ANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIW  351
                  K    S     + K  GL VS R+FSK+W
Sbjct  518  ------KNQQESHNQGKLMKGGGLGVS-RVFSKLW  545



>ref|NP_568030.1| protein NAKED PINS IN YUC MUTANTS 5 [Arabidopsis thaliana]
 sp|Q0WL52.2|NPY5_ARATH RecName: Full=BTB/POZ domain-containing protein NPY5; AltName: 
Full=Protein NAKED PINS IN YUC MUTANTS 5 [Arabidopsis thaliana]
 gb|AEE86814.1| phototropic-responsive NPH3 family protein [Arabidopsis thaliana]
Length=580

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 97/155 (63%), Gaps = 36/155 (23%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRAN----ASSGSSTP  627
            +KSE+KRICRLMDC+KLSA+AC HAVQNERLP+RVVVQVLFFEQVRAN    +S+G+STP
Sbjct  420  NKSEKKRICRLMDCRKLSAEACAHAVQNERLPMRVVVQVLFFEQVRANNNGSSSTGNSTP  479

Query  626  DLPKAIKDLNCASYGSSRSATTTTEED---WDGVASADELRALKGELAALRLGNAGMADR  456
            ++  A           SRS  TT +ED   WD     ++++AL+GELA LRL        
Sbjct  480  EVIPA-----------SRSTNTTDQEDTECWD----TEDIKALRGELANLRLA-------  517

Query  455  ANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIW  351
                  K    S     + K  GL VS R+FSK+W
Sbjct  518  ------KNQQESHNQGKLMKGGGLGVS-RVFSKLW  545



>emb|CAB38298.1| putative protein [Arabidopsis thaliana]
 emb|CAB80424.1| putative protein [Arabidopsis thaliana]
Length=586

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 97/155 (63%), Gaps = 36/155 (23%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRAN----ASSGSSTP  627
            +KSE+KRICRLMDC+KLSA+AC HAVQNERLP+RVVVQVLFFEQVRAN    +S+G+STP
Sbjct  426  NKSEKKRICRLMDCRKLSAEACAHAVQNERLPMRVVVQVLFFEQVRANNNGSSSTGNSTP  485

Query  626  DLPKAIKDLNCASYGSSRSATTTTEED---WDGVASADELRALKGELAALRLGNAGMADR  456
            ++  A           SRS  TT +ED   WD     ++++AL+GELA LRL        
Sbjct  486  EVIPA-----------SRSTNTTDQEDTECWD----TEDIKALRGELANLRLA-------  523

Query  455  ANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIW  351
                  K    S     + K  GL VS R+FSK+W
Sbjct  524  ------KNQQESHNQGKLMKGGGLGVS-RVFSKLW  551



>ref|XP_010939136.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Elaeis 
guineensis]
Length=620

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 123/188 (65%), Gaps = 13/188 (7%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSERK+IC LMDCKKLS +AC HAVQNERLPLRVVVQVLFFEQVRA A++   T     
Sbjct  445  NKSERKKICSLMDCKKLSVNACTHAVQNERLPLRVVVQVLFFEQVRAAAATAGRT-----  499

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADR-ANGDTT  438
              ++   +   S    TT TEEDWDGV + ++L+ LK    +++L +   + R ++ +  
Sbjct  500  --ENTGGSYGSSRSGVTTNTEEDWDGVPTVEDLKTLK----SMKLMDCMESQRSSSSNNA  553

Query  437  KTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPS  258
            +    +DK  +I ++KG+++ ++I  K+ SSKG  GENS SD+S S GS   +E KSTPS
Sbjct  554  RKNNGNDKIGSI-EVKGMMMPRKILGKLLSSKGQGGENSSSDTSGSPGSANQDEPKSTPS  612

Query  257  RKGRYSVS  234
            R  R  VS
Sbjct  613  RNTRPYVS  620



>ref|XP_010437207.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Camelina 
sativa]
Length=582

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 83/113 (73%), Gaps = 22/113 (19%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRAN----ASSGSSTP  627
            +KSE+KRICRLMDC+KLSA+AC HAVQNERLP+RVVVQVLFFEQVRAN    +S+G+STP
Sbjct  421  NKSEKKRICRLMDCRKLSAEACAHAVQNERLPMRVVVQVLFFEQVRANNNGSSSTGNSTP  480

Query  626  DLPKAIKDLNCASYGSSRSATTTTEED---WDGVASADELRALKGELAALRLG  477
            ++  A           SRS  TT +ED   WD     ++++AL+GELA+LRL 
Sbjct  481  EIIPA-----------SRSTNTTDQEDTECWD----TEDIKALRGELASLRLA  518



>ref|XP_010432046.1| PREDICTED: BTB/POZ domain-containing protein NPY5 [Camelina sativa]
Length=582

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 83/113 (73%), Gaps = 22/113 (19%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRAN----ASSGSSTP  627
            +KSE+KRICRLMDC+KLSA+AC HAVQNERLP+RVVVQVLFFEQVRAN    +S+G+STP
Sbjct  420  NKSEKKRICRLMDCRKLSAEACAHAVQNERLPMRVVVQVLFFEQVRANNNGSSSTGNSTP  479

Query  626  DLPKAIKDLNCASYGSSRSATTTTEED---WDGVASADELRALKGELAALRLG  477
            ++  A           SRS  TT +ED   WD     ++++AL+GELA+LRL 
Sbjct  480  EIIPA-----------SRSTNTTDQEDTECWD----TEDIKALRGELASLRLA  517



>ref|XP_006282580.1| hypothetical protein CARUB_v10004449mg [Capsella rubella]
 gb|EOA15478.1| hypothetical protein CARUB_v10004449mg [Capsella rubella]
Length=581

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 82/113 (73%), Gaps = 22/113 (19%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRAN----ASSGSSTP  627
            +KSE+KRICRLMDC+KLSA+AC HAVQNERLP+RVVVQVLFFEQVRAN    +S+G+STP
Sbjct  419  NKSEKKRICRLMDCRKLSAEACAHAVQNERLPMRVVVQVLFFEQVRANNNGSSSTGNSTP  478

Query  626  DLPKAIKDLNCASYGSSRSATTTTEED---WDGVASADELRALKGELAALRLG  477
            ++  A           SRS  TT +ED   WD     ++++AL+GELA LRL 
Sbjct  479  EIIPA-----------SRSTNTTDQEDTECWD----TEDIKALRGELANLRLA  516



>ref|XP_010446647.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Camelina 
sativa]
 ref|XP_010446648.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Camelina 
sativa]
Length=583

 Score =   122 bits (305),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 83/113 (73%), Gaps = 21/113 (19%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRAN----ASSGSSTP  627
            +KSE+KRICRLMDC+KLSA+AC HAVQNERLP+RVVVQVLFFEQVRAN    +S+G+STP
Sbjct  420  NKSEKKRICRLMDCRKLSAEACAHAVQNERLPMRVVVQVLFFEQVRANNNGSSSTGNSTP  479

Query  626  DLPKAIKDLNCASYGSSRSATTTTEED---WDGVASADELRALKGELAALRLG  477
            ++             +SRS  TT +ED   WD     ++++AL+GELA+LRL 
Sbjct  480  EI----------IIPASRSTNTTDQEDTECWD----TEDIKALRGELASLRLA  518



>ref|XP_006411871.1| hypothetical protein EUTSA_v10024767mg [Eutrema salsugineum]
 ref|XP_006411872.1| hypothetical protein EUTSA_v10024767mg [Eutrema salsugineum]
 gb|ESQ53324.1| hypothetical protein EUTSA_v10024767mg [Eutrema salsugineum]
 gb|ESQ53325.1| hypothetical protein EUTSA_v10024767mg [Eutrema salsugineum]
Length=579

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 93/155 (60%), Gaps = 38/155 (25%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRAN----ASSGSSTP  627
            +KSE+KRICRLMDC+KLS +AC HAVQNERLP+RVVVQVLFFEQVRAN    +S+G+STP
Sbjct  421  NKSEKKRICRLMDCRKLSVEACAHAVQNERLPMRVVVQVLFFEQVRANNNGSSSTGNSTP  480

Query  626  DLPKAIKDLNCASYGSSRSATTTTEED---WDGVASADELRALKGELAALRLGNAGMADR  456
            ++  A             S +T TEED   WD     ++++AL+GELA LRL     A  
Sbjct  481  EIIPA-------------SRSTNTEEDTECWD----TEDIKALRGELANLRL-----AKN  518

Query  455  ANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIW  351
               + +K          +S         R+FSK+W
Sbjct  519  QQQENSKGKLMKGGGLGVS---------RVFSKLW  544



>emb|CDY22422.1| BnaC03g61350D [Brassica napus]
Length=575

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 81/112 (72%), Gaps = 24/112 (21%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRAN----ASSGSSTP  627
            SKSE+KR+CRLMDC+KLSA+AC HAVQNERLP+RVVVQVLFFEQVRAN    +S+G STP
Sbjct  417  SKSEKKRLCRLMDCRKLSAEACAHAVQNERLPMRVVVQVLFFEQVRANSNGSSSTGDSTP  476

Query  626  DLPKAIKDLNCASYGSSRSATTTTEED---WDGVASADELRALKGELAALRL  480
            ++  A             S +T TE+D   WD     ++++AL+GELA+LRL
Sbjct  477  EITPA-------------SRSTNTEDDRESWD----TEDIKALRGELASLRL  511



>ref|XP_010547549.1| PREDICTED: BTB/POZ domain-containing protein NPY3 [Tarenaya hassleriana]
Length=590

 Score =   119 bits (298),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 110/188 (59%), Gaps = 36/188 (19%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSST-PDLP  618
            +KSE+K ICRLMDC+KLS +AC HA+QNERLPLRVVVQ+LFFEQVRA     S   P LP
Sbjct  438  TKSEKKMICRLMDCRKLSQEACAHAIQNERLPLRVVVQILFFEQVRATTDVSSPVKPSLP  497

Query  617  KAIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTT  438
             +       S GSSR+ TT TE+DWD                     +  +A+    +  
Sbjct  498  PS------GSRGSSRTTTTNTEDDWD--------------------SSVPVAEETCNNKN  531

Query  437  KTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTPS  258
            KT  S DKA      KG+    +IFSK+W+ K  +G+ S S++SES GS T EE KSTPS
Sbjct  532  KT--SYDKA------KGVAAMPKIFSKLWTVKDRDGDVSSSEASESPGSATAEE-KSTPS  582

Query  257  RKGRYSVS  234
             + R S S
Sbjct  583  TRRRRSTS  590



>ref|XP_009109382.1| PREDICTED: BTB/POZ domain-containing protein NPY5 [Brassica rapa]
 ref|XP_009109383.1| PREDICTED: BTB/POZ domain-containing protein NPY5 [Brassica rapa]
Length=575

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 81/113 (72%), Gaps = 24/113 (21%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRAN----ASSGSSTP  627
            SKSE+KR+C+LMDC+KLSA+AC HAVQNERLP+RVVVQVLFFEQVRAN    +S+G STP
Sbjct  417  SKSEKKRLCKLMDCRKLSAEACAHAVQNERLPMRVVVQVLFFEQVRANSNGSSSTGDSTP  476

Query  626  DLPKAIKDLNCASYGSSRSATTTTEED---WDGVASADELRALKGELAALRLG  477
            ++  A             S +T TE+D   WD     ++++AL+GELA+LRL 
Sbjct  477  EITPA-------------SRSTNTEDDRESWD----TEDIKALRGELASLRLA  512



>emb|CDY44035.1| BnaA08g15710D [Brassica napus]
Length=575

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 81/113 (72%), Gaps = 24/113 (21%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRAN----ASSGSSTP  627
            SKSE+KR+C+LMDC+KLSA+AC HAVQNERLP+RVVVQVLFFEQVRAN    +S+G STP
Sbjct  417  SKSEKKRLCKLMDCRKLSAEACAHAVQNERLPMRVVVQVLFFEQVRANSNGSSSTGDSTP  476

Query  626  DLPKAIKDLNCASYGSSRSATTTTEED---WDGVASADELRALKGELAALRLG  477
            ++  A             S +T TE+D   WD     ++++AL+GELA+LRL 
Sbjct  477  EITPA-------------SRSTNTEDDRESWD----TEDIKALRGELASLRLA  512



>emb|CDX72639.1| BnaC07g46610D [Brassica napus]
Length=578

 Score =   116 bits (291),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 78/112 (70%), Gaps = 21/112 (19%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRAN-----ASSGSST  630
            SKSE+KRICRLMDC+KLS +AC HAVQNERLP+RVVVQVLFFEQ RAN     +S+G+ST
Sbjct  419  SKSEKKRICRLMDCRKLSVEACAHAVQNERLPMRVVVQVLFFEQARANNNNGSSSTGNST  478

Query  629  PDLPKAIKDLNCASYGSSRSATTTTE-EDWDGVASADELRALKGELAALRLG  477
            P++  A           SRS  T  E E WD     ++++ L+GELA+LRL 
Sbjct  479  PEIIPA-----------SRSTNTEDETESWD----TEDIKTLRGELASLRLA  515



>gb|EAY90980.1| hypothetical protein OsI_12589 [Oryza sativa Indica Group]
Length=634

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 126/194 (65%), Gaps = 11/194 (6%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSG--SSTPDL  621
            SKSE+K +CRLMDCKKLS DAC+HAVQNERLPLRVVVQVLFFEQ+RA+A+SG   +  +L
Sbjct  445  SKSEKKALCRLMDCKKLSQDACLHAVQNERLPLRVVVQVLFFEQIRASAASGRTDAAAEL  504

Query  620  PKAIKDL----NCASYGSSRS-ATTTTEEDWDGVASADELRALKGELAALRLGNAGMADR  456
              A+  L    N  SYGSSRS ATTTTEED  GV ++ ++ + +    +LRL N      
Sbjct  505  TSAVHSLLPRENGNSYGSSRSAATTTTEEDGTGVPTSSDINSFR----SLRLANNSGGSE  560

Query  455  ANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEE  276
             +  ++     S    + SK KG L+ K+I SK+WS K    ENS SD+SES GS   EE
Sbjct  561  RSSGSSDINNKSCDDKSSSKSKGSLMPKKILSKLWSGKTNASENSSSDTSESPGSLNPEE  620

Query  275  AKSTPSRKGRYSVS  234
             KST SR  R  V+
Sbjct  621  VKSTTSRNTRRLVT  634



>ref|NP_001050649.1| Os03g0609800 [Oryza sativa Japonica Group]
 gb|AAR00589.1| putative NPH3 family protein [Oryza sativa Japonica Group]
 gb|AAR87349.1| transposon protein, putative, mutator sub-class [Oryza sativa 
Japonica Group]
 gb|AAX95837.1| transposon protein, putative, mutator sub-class [Oryza sativa 
Japonica Group]
 gb|ABF97571.1| transposon protein, putative, Mutator sub-class, expressed [Oryza 
sativa Japonica Group]
 gb|ABF97572.1| transposon protein, putative, Mutator sub-class, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12563.1| Os03g0609800 [Oryza sativa Japonica Group]
 gb|EAZ27761.1| hypothetical protein OsJ_11706 [Oryza sativa Japonica Group]
 dbj|BAG89762.1| unnamed protein product [Oryza sativa Japonica Group]
Length=634

 Score =   115 bits (287),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 126/194 (65%), Gaps = 11/194 (6%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSG--SSTPDL  621
            SKSE+K +CRLMDCKKLS DAC+HAVQNERLPLRVVVQVLFFEQ+RA+A+SG   +  +L
Sbjct  445  SKSEKKALCRLMDCKKLSQDACLHAVQNERLPLRVVVQVLFFEQIRASAASGRTDAAAEL  504

Query  620  PKAIKDL----NCASYGSSRS-ATTTTEEDWDGVASADELRALKGELAALRLGNAGMADR  456
              A+  L    N  SYGSSRS ATTTTEED  GV ++ ++ +     ++LRL N      
Sbjct  505  TSAVHSLLPRENGNSYGSSRSAATTTTEEDGTGVPTSSDINS----FSSLRLANNSGGSE  560

Query  455  ANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEE  276
             +  ++     S    + SK KG L+ K+I SK+WS K    ENS SD+SES GS   EE
Sbjct  561  RSSGSSDINNKSCDDKSSSKSKGSLMPKKILSKLWSGKTNASENSSSDTSESPGSLNPEE  620

Query  275  AKSTPSRKGRYSVS  234
             KST SR  R  V+
Sbjct  621  VKSTTSRNTRRLVT  634



>ref|NP_001278721.1| putative phototropic-resoponsive NPH3 family protein [Zea mays]
 ref|XP_008643409.1| PREDICTED: putative phototropic-resoponsive NPH3 family protein 
isoform X1 [Zea mays]
 ref|XP_008643410.1| PREDICTED: putative phototropic-resoponsive NPH3 family protein 
isoform X1 [Zea mays]
 gb|ACN27618.1| unknown [Zea mays]
 gb|AFW68230.1| putative phototropic-responsive NPH3 family protein [Zea mays]
Length=643

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 129/203 (64%), Gaps = 20/203 (10%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS------GSS  633
            SKSE+K++C LMDCK+LS DACMHAVQNERLPLRVVVQVLFFEQVRA++S        +S
Sbjct  445  SKSEKKKLCGLMDCKQLSQDACMHAVQNERLPLRVVVQVLFFEQVRASSSVASARSDANS  504

Query  632  TPDLPKAIKDL----NCASYGSSRSA--TTTTEEDWDGVASADELRALKGELAALRLGN-  474
            T  LP A++ L    N  S GSSRSA  T TTEE+  GV ++ ++ +L+    ++RL N 
Sbjct  505  TSGLPSAVRSLLPRENGNSIGSSRSAATTMTTEEEESGVPTSSDINSLR----SMRLANN  560

Query  473  --AGMADRANGDTTKTVASSDKAAAISKMKG-LLVSKRIFSKIWsskggngensgsdsse  303
                     + D     +    AAA  K KG +L+ K++ SK+WS K   GE+S SD+S+
Sbjct  561  SGGSERSSGSSDVNNKSSDDRSAAATGKAKGTMLMPKKMLSKLWSGKTNAGESSSSDTSD  620

Query  302  slgSTTMEEAKSTPSRKGRYSVS  234
            S GS   EEAKST SR    SVS
Sbjct  621  SPGSANPEEAKSTQSRITWRSVS  643



>ref|XP_006664149.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Oryza 
brachyantha]
Length=659

 Score =   110 bits (276),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 124/215 (58%), Gaps = 36/215 (17%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPD---  624
            SK E+KR+C LMDCKKLS +A MHAVQNERLPLRVVVQVLFFEQVRA A++ ++  D   
Sbjct  453  SKGEKKRLCGLMDCKKLSPEASMHAVQNERLPLRVVVQVLFFEQVRAAAAAAAAGGDGDG  512

Query  623  ------LPKAIKDLNCASYGSSRSATTTTEED--WD-GVASADELRALKGELAALRLGNA  471
                  LP+  +D N  SYGSSRSA TT  ED  W  GV ++ ++ + +    ++ L N 
Sbjct  513  LPARSLLPR--EDGN--SYGSSRSAATTATEDDQWACGVPTSSDVNSFR----SMSLANK  564

Query  470  GMADRA----------------NGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskg  339
                                  NG           ++A     G L+ K+I SK+WS K 
Sbjct  565  NGGGGGCSGRSTGGGGDTGSNKNGGGGGEACKKPPSSAKGSTGGGLMPKKILSKLWSGKA  624

Query  338  gngensgsdsseslgSTTMEEAKSTPSRKGRYSVS  234
             +GENS SD+SES GS  +EE +STPSR  R+SVS
Sbjct  625  SSGENSSSDTSESPGSANLEETRSTPSRNTRHSVS  659



>ref|XP_009411058.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009411059.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Musa 
acuminata subsp. malaccensis]
Length=617

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 113/188 (60%), Gaps = 15/188 (8%)
 Frame = -3

Query  791  KSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPKA  612
            KSE+K++C LM+CKKLS D C HA+QNERLPLR+VVQ+L+FEQ+RA+A++ S        
Sbjct  441  KSEKKKLCGLMNCKKLSGDVCAHAMQNERLPLRLVVQILYFEQMRASAATTSRAE-----  495

Query  611  IKDLNCASYGSSRSA-TTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
                +  SYGSSRSA TT TE++ DGV +A++ +A K     L  G  G  + ++G   +
Sbjct  496  ----SGNSYGSSRSAITTNTEDECDGVPNAEDGKARK--FTKLSEGGKG-CEWSSGGNNE  548

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTME--EAKSTP  261
              ++    +  S++KG+++ K++  K   S  G    S S S  S    + +  E K TP
Sbjct  549  NRSNGQGKSGNSQVKGVVMPKKMLGKFLLSSKGQAGGSSSSSDTSGSPNSAKQGEPKLTP  608

Query  260  SRKGRYSV  237
            SR  RY+V
Sbjct  609  SRNIRYTV  616



>ref|XP_010232705.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Brachypodium distachyon]
Length=610

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 111/192 (58%), Gaps = 34/192 (18%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTP--DL  621
            SKSE+KR+C LMDCKKLS DACMHAVQNERLPLRVVVQVLFFEQVRA+A+S       +L
Sbjct  446  SKSEKKRLCGLMDCKKLSQDACMHAVQNERLPLRVVVQVLFFEQVRASAASARGGSAAEL  505

Query  620  PKAIKDL----NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRA  453
              A++ L    N  SYGSSRS                           +RL N      +
Sbjct  506  SSAVQSLLPRENGNSYGSSRS---------------------------MRLANNCGGSDS  538

Query  452  NGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEA  273
            +  +       DK+ A  K K +L+ K+I SK+WS K   GENS SD+SES GS   EE 
Sbjct  539  SLSSDINKNGEDKSTA-GKAKAMLMPKKILSKLWSGKTNVGENSSSDTSESPGSANPEEL  597

Query  272  KSTPSRKGRYSV  237
            KSTPSR  R S+
Sbjct  598  KSTPSRNMRRSM  609



>emb|CDY69095.1| BnaAnng29310D [Brassica napus]
Length=561

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 87/148 (59%), Gaps = 42/148 (28%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSE+K ICRLMDC+KLS +AC HAV+NERLPLRVVVQ+LFFEQVRA A      P LP 
Sbjct  414  SKSEKKSICRLMDCRKLSPEACAHAVKNERLPLRVVVQILFFEQVRATAK-----PSLPA  468

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
            +       S+GSSR  TTT EE+ D V + +E                         T  
Sbjct  469  S------GSHGSSR--TTTEEEECDSVTATEET------------------------TRD  496

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIW  351
              +SS+K    +K KG+++S RIFSK+W
Sbjct  497  KTSSSEK----TKAKGVVMS-RIFSKLW  519



>ref|XP_009103410.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like [Brassica 
rapa]
 ref|XP_009103411.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like [Brassica 
rapa]
 ref|XP_009103412.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like [Brassica 
rapa]
 ref|XP_009103413.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like [Brassica 
rapa]
 ref|XP_009103414.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like [Brassica 
rapa]
 ref|XP_009103415.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like [Brassica 
rapa]
 ref|XP_009103416.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like [Brassica 
rapa]
 ref|XP_009103417.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like [Brassica 
rapa]
 ref|XP_009103418.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like [Brassica 
rapa]
Length=563

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 87/148 (59%), Gaps = 42/148 (28%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSE+K ICRLMDC+KLS +AC HAV+NERLPLRVVVQ+LFFEQVRA A      P LP 
Sbjct  416  SKSEKKSICRLMDCRKLSPEACAHAVKNERLPLRVVVQILFFEQVRATAK-----PSLPA  470

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
            +       S+GSSR  TTT EE+ D V + +E                         T  
Sbjct  471  S------GSHGSSR--TTTEEEECDSVTATEET------------------------TRD  498

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIW  351
              +SS+K    +K KG+++S RIFSK+W
Sbjct  499  KTSSSEK----TKAKGVVMS-RIFSKLW  521



>ref|XP_007153783.1| hypothetical protein PHAVU_003G064600g [Phaseolus vulgaris]
 gb|ESW25777.1| hypothetical protein PHAVU_003G064600g [Phaseolus vulgaris]
Length=632

 Score =   108 bits (271),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 90/160 (56%), Gaps = 22/160 (14%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +K+ERKR+CR++DCKKLS +ACMHA QNE LPLRVVVQVLFFEQ RA A+ G  T D+P 
Sbjct  473  NKNERKRLCRILDCKKLSVEACMHAAQNELLPLRVVVQVLFFEQARAAAAGGKVT-DMPS  531

Query  614  AIKDLNCAS------YGSSRSATTTTEED--WDGVASADELRALKGELAALRLGNAGMAD  459
             IK L  A       + +  S TT+   D  W  V+     ++ +     ++L       
Sbjct  532  NIKALLTAHGIDPSKHTAPLSTTTSIHADDNW-SVSGFKSPKSTRNPTLRMKL-------  583

Query  458  RANGDTTKTVASSDKAAAISKMKGLLV----SKRIFSKIW  351
             A  D  + V   D+    S+ KGLL      KR+FSK+W
Sbjct  584  -AEDDLDENVVPRDEIGRTSRFKGLLALPTQPKRMFSKLW  622



>emb|CDX81314.1| BnaC09g07250D [Brassica napus]
Length=526

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 86/148 (58%), Gaps = 41/148 (28%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSE+K ICRLMDC+KLS +AC HAVQNERLPLRVVVQ+LFFEQVRA A      P LP 
Sbjct  379  TKSEKKSICRLMDCRKLSPEACAHAVQNERLPLRVVVQILFFEQVRATAK-----PSLPP  433

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
            +       S+GSSR   TTTEE+ D V +                      D+ NG    
Sbjct  434  S------GSHGSSR---TTTEEECDSVTAT--------------EETRTTRDKTNG----  466

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIW  351
                S+K    +K KG+++S RIFSK+W
Sbjct  467  ----SEK----TKAKGVVMS-RIFSKLW  485



>gb|ACN31208.1| unknown [Zea mays]
Length=307

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 67/93 (72%), Gaps = 8/93 (9%)
 Frame = -3

Query  791  KSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPKA  612
            KS++KR+C LMDC+KLS DAC HAVQNERLPLRVVVQVL+ EQ RA+A++          
Sbjct  132  KSDKKRLCALMDCRKLSPDACAHAVQNERLPLRVVVQVLYHEQTRASAAATVRA------  185

Query  611  IKDLNCASYGSSRS-ATTTTEEDWDGVASADEL  516
               +   SY SSRS ATT TE++WDGV + ++L
Sbjct  186  -DSIGIGSYESSRSGATTNTEDEWDGVMAVEDL  217



>ref|XP_004963018.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Setaria italica]
Length=634

 Score =   107 bits (268),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 119/198 (60%), Gaps = 23/198 (12%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPD---  624
            SKSE+KR+C LMDCKKLSADA  HAVQNERLPLRVVVQVLFFEQVR +++S ++ P    
Sbjct  449  SKSEKKRLCALMDCKKLSADASAHAVQNERLPLRVVVQVLFFEQVRQSSASAAAVPSADA  508

Query  623  ----LPKAIKDLNCASYGSSRSATTTTEED--WDGVASADELRALKGELAALRLGNAGMA  462
                LP+     +  S GSSRSATTT  ED  W GV  A    +  G+ ++LR  +  +A
Sbjct  509  RSFLLPRE----DGTSCGSSRSATTTATEDEQWAGVVGAPTSTS-GGDASSLR--SVSLA  561

Query  461  DRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgs--dsseslgST  288
                GD +     S   A +        +KR+  K+WS K  +GENSGS   S    GS 
Sbjct  562  ASKRGDGSGGKKKSKGGAVVPAP-----AKRVLGKLWSGKASSGENSGSDDTSESPAGSV  616

Query  287  TMEEAKSTPSRKGRYSVS  234
             +EE KSTPSR  R+SVS
Sbjct  617  NLEETKSTPSRITRHSVS  634



>ref|XP_004963017.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Setaria italica]
Length=667

 Score =   108 bits (269),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 119/198 (60%), Gaps = 23/198 (12%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPD---  624
            SKSE+KR+C LMDCKKLSADA  HAVQNERLPLRVVVQVLFFEQVR +++S ++ P    
Sbjct  482  SKSEKKRLCALMDCKKLSADASAHAVQNERLPLRVVVQVLFFEQVRQSSASAAAVPSADA  541

Query  623  ----LPKAIKDLNCASYGSSRSATTTTEED--WDGVASADELRALKGELAALRLGNAGMA  462
                LP+     +  S GSSRSATTT  ED  W GV  A    +  G+ ++LR  +  +A
Sbjct  542  RSFLLPRE----DGTSCGSSRSATTTATEDEQWAGVVGAPTSTS-GGDASSLR--SVSLA  594

Query  461  DRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgs--dsseslgST  288
                GD +     S   A +        +KR+  K+WS K  +GENSGS   S    GS 
Sbjct  595  ASKRGDGSGGKKKSKGGAVVPA-----PAKRVLGKLWSGKASSGENSGSDDTSESPAGSV  649

Query  287  TMEEAKSTPSRKGRYSVS  234
             +EE KSTPSR  R+SVS
Sbjct  650  NLEETKSTPSRITRHSVS  667



>ref|XP_003552044.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Glycine 
max]
Length=632

 Score =   107 bits (268),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 87/157 (55%), Gaps = 16/157 (10%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKR+CR++DCKKLS +ACMHA QNE LPLRVVVQVLFFEQ RA A++G    D+P 
Sbjct  473  SKSERKRLCRILDCKKLSMEACMHAAQNELLPLRVVVQVLFFEQARA-AAAGGKVSDMPS  531

Query  614  AIKDLNCAS------YGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRA  453
             IK L  A       + +  S TT+   D +   S       K   +  R     M   A
Sbjct  532  NIKALLTAHGIDPSKHTAPLSTTTSIHADDNWSVS-----GFKSPKSTTRNPTLRM-KLA  585

Query  452  NGDTTKTVASSDKAAAISKMKGLLV---SKRIFSKIW  351
              D  + V   D+    SK KGL +    KR+FSK+W
Sbjct  586  EDDLDENVVPRDEIGRTSKFKGLGLPTQPKRMFSKLW  622



>gb|KHN35451.1| BTB/POZ domain-containing protein [Glycine soja]
Length=631

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 89/158 (56%), Gaps = 17/158 (11%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKR+CR++DCKKLS +ACMHA QNE LPLRVVVQVLFFEQVRA A++G    D+P 
Sbjct  471  SKSERKRLCRILDCKKLSMEACMHAAQNELLPLRVVVQVLFFEQVRA-AAAGGKVSDMPS  529

Query  614  AIKDLNCAS------YGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRA  453
             IK L  A+      + +  S TT+   D +   S       K   +  R     M   A
Sbjct  530  NIKALLTANGIDPSKHTAPLSTTTSIHVDDNWSVS-----GFKSSKSTTRNPTLRM-KLA  583

Query  452  NGDTTKTVASSDKAAAISKMKGLL----VSKRIFSKIW  351
              D  + V   D+    S+ KG+L      K++FSK+W
Sbjct  584  EDDLDENVVPRDEIGRTSRFKGILGLPTQPKKMFSKLW  621



>gb|KHN22636.1| BTB/POZ domain-containing protein [Glycine soja]
Length=629

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 87/157 (55%), Gaps = 16/157 (10%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKR+CR++DCKKLS +ACMHA QNE LPLRVVVQVLFFEQ RA A++G    D+P 
Sbjct  470  SKSERKRLCRILDCKKLSMEACMHAAQNELLPLRVVVQVLFFEQARA-AAAGGKVSDMPS  528

Query  614  AIKDLNCAS------YGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRA  453
             IK L  A       + +  S TT+   D +   S       K   +  R     M   A
Sbjct  529  NIKALLTAHGIDPSKHTAPLSTTTSIHADDNWSVS-----GFKSPKSTTRNPTLRM-KLA  582

Query  452  NGDTTKTVASSDKAAAISKMKGLLV---SKRIFSKIW  351
              D  + V   D+    SK KGL +    KR+FSK+W
Sbjct  583  EDDLDENVVPRDEIGRTSKFKGLGLPTQPKRMFSKLW  619



>ref|XP_003531985.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Glycine 
max]
Length=634

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 89/158 (56%), Gaps = 17/158 (11%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKR+CR++DCKKLS +ACMHA QNE LPLRVVVQVLFFEQVRA A++G    D+P 
Sbjct  474  SKSERKRLCRILDCKKLSMEACMHAAQNELLPLRVVVQVLFFEQVRA-AAAGGKVSDMPS  532

Query  614  AIKDLNCAS------YGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRA  453
             IK L  A+      + +  S TT+   D +   S       K   +  R     M   A
Sbjct  533  NIKALLTANGIDPSKHTAPLSTTTSIHVDDNWSVS-----GFKSSKSTTRNPTLRM-KLA  586

Query  452  NGDTTKTVASSDKAAAISKMKGLL----VSKRIFSKIW  351
              D  + V   D+    S+ KG+L      K++FSK+W
Sbjct  587  EDDLDENVVPRDEIGRTSRFKGILGLPTQPKKMFSKLW  624



>gb|ACL54058.1| unknown [Zea mays]
Length=197

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 68/93 (73%), Gaps = 7/93 (8%)
 Frame = -3

Query  791  KSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPKA  612
            KS++KR+C LMDCKKLS DAC HAVQNERLPLR+VVQVL+ EQ RA A++ +   D    
Sbjct  11   KSDKKRLCALMDCKKLSPDACAHAVQNERLPLRIVVQVLYHEQTRACAAATAIRAD----  66

Query  611  IKDLNCASYGSSRS-ATTTTEEDWDGVASADEL  516
               +   SY SSRS ATT TE++WDGV + ++L
Sbjct  67   --SIGIGSYESSRSGATTNTEDEWDGVMAVEDL  97



>ref|XP_006280223.1| hypothetical protein CARUB_v10026140mg [Capsella rubella]
 gb|EOA13121.1| hypothetical protein CARUB_v10026140mg [Capsella rubella]
Length=585

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 89/148 (60%), Gaps = 38/148 (26%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSE+K ICRLMDC+KLS +AC HAVQNERLPLRVVVQ+LFFEQVRA     ++ P LP 
Sbjct  435  TKSEKKSICRLMDCRKLSPEACAHAVQNERLPLRVVVQILFFEQVRATCP--TAKPSLPP  492

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
            +       S+GSSR   TTTEE+ D V + +E    + +                     
Sbjct  493  S------GSHGSSR---TTTEEECDSVTATEETTTTRDK---------------------  522

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIW  351
              +SS+K    +K KG+++S RIFSK+W
Sbjct  523  -TSSSEK----TKAKGVVIS-RIFSKLW  544



>gb|KHG04804.1| hypothetical protein F383_28791 [Gossypium arboreum]
Length=631

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 91/159 (57%), Gaps = 21/159 (13%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSERK++CR++DCKKLS +ACMHA QNE+LPLRVVVQVLFFEQ RA A++G    DLP 
Sbjct  471  NKSERKKLCRVLDCKKLSVEACMHAAQNEKLPLRVVVQVLFFEQTRA-ATTGHKVTDLPS  529

Query  614  AIKDL----NCASYGSSRSATTTT----EEDWDGVASADELRALKGELAALRLGNAGMAD  459
             IK L    N       R+ +TTT    ++ W  V+    LR+ K  ++ LR+  A   D
Sbjct  530  NIKALLASHNIDPSKPPRALSTTTSIPGDDQWSTVSG---LRSPKSRISTLRMKLAEDDD  586

Query  458  RANGDTTKTVASSDKAAAISKMKGLLV----SKRIFSKI  354
                D      + D     SK KG        K++FS++
Sbjct  587  LDENDM-----NPDGMGRPSKFKGFCALPTGPKKMFSRL  620



>ref|XP_010444645.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like [Camelina 
sativa]
 ref|XP_010444646.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like [Camelina 
sativa]
Length=583

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 86/148 (58%), Gaps = 41/148 (28%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSE+K + RLMDC+KLS +AC HAVQNERLPLRVVVQ+LFFEQVRA   +    P LP 
Sbjct  436  TKSEKKSLSRLMDCRKLSPEACAHAVQNERLPLRVVVQILFFEQVRATCPTAK--PSLPP  493

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
            +       S+GSSR   TTTEE+ D V + +E R   G                      
Sbjct  494  S------GSHGSSR---TTTEEECDSVTATEETRDKTG----------------------  522

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIW  351
               SS+K    +K KG+++S RIFSK+W
Sbjct  523  ---SSEK----TKAKGVVMS-RIFSKLW  542



>ref|XP_010100409.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB82543.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=645

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 94/164 (57%), Gaps = 21/164 (13%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSERKR+CR++DCKKLS +ACMHA QNE LPLRVVVQVLFFEQ RA   +G    +LP 
Sbjct  477  NKSERKRLCRILDCKKLSMEACMHAAQNELLPLRVVVQVLFFEQARATMGNGGKVTELPS  536

Query  614  AIKDLNCASYG-------SSRSATTTT--EEDWDGVASADELRALKGELAALRLGNA---  471
             I+ L  AS+G          S+TTT   E+ W    S   L++ K +++ LR+  A   
Sbjct  537  NIRAL-LASHGIDPSKARGPLSSTTTIPAEDQW----SVSGLKSPKSKISTLRMKLAEDD  591

Query  470  GMAD---RANGDTTKTVASSDKAAAISKMKGLLV-SKRIFSKIW  351
            G+ +   + N D         K + +  +  L    KR+FSK+W
Sbjct  592  GLDENDMQLNPDGIGIGIGIGKNSRLKALCALPTRPKRMFSKLW  635



>emb|CDY12846.1| BnaC07g15870D [Brassica napus]
Length=565

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 85/148 (57%), Gaps = 42/148 (28%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSE+K ICRLMDC+KLS +AC HAVQNERLPLRVVVQ+LFFEQVR  A      P LP 
Sbjct  418  SKSEKKSICRLMDCRKLSQEACAHAVQNERLPLRVVVQILFFEQVRPTAK-----PLLPP  472

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
            +       S+GSSR   TT EE+ D V + +E                         T  
Sbjct  473  S------TSHGSSRK--TTEEEECDSVTATEET------------------------TRD  500

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIW  351
              +SS+K    +K KG+++S RIFSK+W
Sbjct  501  KTSSSEK----TKAKGVVMS-RIFSKLW  523



>emb|CDY18660.1| BnaA09g07350D [Brassica napus]
Length=528

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 89/148 (60%), Gaps = 41/148 (28%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSE+K ICRLMDC+KLS +AC HAVQNERLPLRVVVQ+LFFEQVRA A      P LP 
Sbjct  381  TKSEKKSICRLMDCRKLSPEACAHAVQNERLPLRVVVQILFFEQVRATAK-----PSLPP  435

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
            +       S+GSSR   TTTEE+ D V + +E    +              D+ +G    
Sbjct  436  S------GSHGSSR---TTTEEECDSVTATEETTTTR--------------DKTSG----  468

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIW  351
                S+K    +K KG+++S RIFSK+W
Sbjct  469  ----SEK----TKAKGVVMS-RIFSKLW  487



>gb|KJB31122.1| hypothetical protein B456_005G177600 [Gossypium raimondii]
Length=521

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 89/159 (56%), Gaps = 21/159 (13%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSERK++CR++DCKKLS +ACMHA QNE+LPLRVVVQVLFFEQ RA  + G  T DLP 
Sbjct  361  NKSERKKLCRVLDCKKLSVEACMHAAQNEKLPLRVVVQVLFFEQARAATTGGKGT-DLPS  419

Query  614  AIKDL----NCASYGSSRSATTTT----EEDWDGVASADELRALKGELAALRLGNAGMAD  459
             IK L    N       R+ +TTT     + W  V+    LR+ K  ++ LR+  A   D
Sbjct  420  NIKALLASHNIDPSKPPRALSTTTSIPGHDQWSTVSG---LRSPKSRISTLRMKLAEDDD  476

Query  458  RANGDTTKTVASSDKAAAISKMKGLLV----SKRIFSKI  354
                D      + D     SK KG        K++FS++
Sbjct  477  LDENDM-----NPDGMGRPSKFKGFCALPTGPKKMFSRL  510



>ref|XP_009112216.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
NPY3-like [Brassica rapa]
Length=552

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 89/148 (60%), Gaps = 41/148 (28%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSE+K ICRLMDC+KLS +AC HAVQNERLPLRVVVQ+LFFEQVRA A      P LP 
Sbjct  405  TKSEKKSICRLMDCRKLSPEACAHAVQNERLPLRVVVQILFFEQVRATAK-----PSLPP  459

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
            +       S+GSSR   TTTEE+ D V + +E    +              D+ +G    
Sbjct  460  S------GSHGSSR---TTTEEECDSVTATEETTTTR--------------DKTSG----  492

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIW  351
                S+K    +K KG+++S RIFSK+W
Sbjct  493  ----SEK----TKAKGVVMS-RIFSKLW  511



>ref|XP_003558549.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Brachypodium 
distachyon]
 ref|XP_010229003.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Brachypodium 
distachyon]
Length=605

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 89/144 (62%), Gaps = 13/144 (9%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKS++K++C LMDCKKLS DAC HAVQNERLPLR VVQVL+ EQ RA+A++         
Sbjct  437  SKSDKKKLCSLMDCKKLSPDACAHAVQNERLPLRTVVQVLYHEQTRASAAATIRA-----  491

Query  614  AIKDLNCASYGSSRS-ATTTTEEDWDGVASADELRALKGELAALRLGNAGM-ADRANGDT  441
              + +   SY SSRS ATT TE++WDGV + ++L   K      ++  AG  A++++G  
Sbjct  492  --ESICIGSYESSRSGATTNTEDEWDGVMAVEDLSLSK----TTKVHTAGTNAEKSHGSN  545

Query  440  TKTVASSDKAAAISKMKGLLVSKR  369
              T +    AA   K  G ++S +
Sbjct  546  RSTSSKVKGAATPKKALGKMLSSK  569



>ref|XP_008446157.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Cucumis 
melo]
 ref|XP_008446158.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Cucumis 
melo]
Length=628

 Score =   105 bits (263),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 87/155 (56%), Gaps = 14/155 (9%)
 Frame = -3

Query  791  KSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPKA  612
            KSERKR+CR++DCKKLS +ACMHA QNE LPLRVVVQVLFFEQ RA    GS   +LP  
Sbjct  470  KSERKRLCRILDCKKLSVEACMHAAQNELLPLRVVVQVLFFEQARATM-GGSKVAELPSN  528

Query  611  IKDL----NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGD  444
            IK L    N        S +TTT    +   S   L++ K +++ L++  A      + D
Sbjct  529  IKALLAAHNIDPSKPPASLSTTTSVQAEDQLSISGLKSPKSKISTLQMKLA-----EDDD  583

Query  443  TTKTVASSDKAAAISKMKGLLV----SKRIFSKIW  351
              +    S+  +  SK K L       KRIFSK+W
Sbjct  584  LNENSMHSNGLSRSSKFKALCSLPSRPKRIFSKLW  618



>ref|XP_002468311.1| hypothetical protein SORBIDRAFT_01g043540 [Sorghum bicolor]
 gb|EER95309.1| hypothetical protein SORBIDRAFT_01g043540 [Sorghum bicolor]
Length=609

 Score =   105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 67/93 (72%), Gaps = 8/93 (9%)
 Frame = -3

Query  791  KSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPKA  612
            KS++KR+C LMDCKKLS DAC HAVQNERLPLR+VVQVL+ EQ RA+A++          
Sbjct  438  KSDKKRLCALMDCKKLSPDACAHAVQNERLPLRIVVQVLYHEQTRASAAATIRA------  491

Query  611  IKDLNCASYGSSRS-ATTTTEEDWDGVASADEL  516
               +   SY SSRS ATT TE++WDGV + ++L
Sbjct  492  -DSIGIGSYESSRSGATTNTEDEWDGVMAVEDL  523



>gb|KJB31120.1| hypothetical protein B456_005G177600 [Gossypium raimondii]
 gb|KJB31121.1| hypothetical protein B456_005G177600 [Gossypium raimondii]
Length=632

 Score =   105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 89/159 (56%), Gaps = 21/159 (13%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSERK++CR++DCKKLS +ACMHA QNE+LPLRVVVQVLFFEQ RA  + G  T DLP 
Sbjct  472  NKSERKKLCRVLDCKKLSVEACMHAAQNEKLPLRVVVQVLFFEQARAATTGGKGT-DLPS  530

Query  614  AIKDL----NCASYGSSRSATTTT----EEDWDGVASADELRALKGELAALRLGNAGMAD  459
             IK L    N       R+ +TTT     + W  V+    LR+ K  ++ LR+  A   D
Sbjct  531  NIKALLASHNIDPSKPPRALSTTTSIPGHDQWSTVSG---LRSPKSRISTLRMKLAEDDD  587

Query  458  RANGDTTKTVASSDKAAAISKMKGLLV----SKRIFSKI  354
                D      + D     SK KG        K++FS++
Sbjct  588  LDENDM-----NPDGMGRPSKFKGFCALPTGPKKMFSRL  621



>ref|XP_004985278.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Setaria italica]
 ref|XP_004985279.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Setaria italica]
 ref|XP_004985280.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X3 [Setaria italica]
 ref|XP_004985281.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X4 [Setaria italica]
Length=609

 Score =   105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 67/93 (72%), Gaps = 8/93 (9%)
 Frame = -3

Query  791  KSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPKA  612
            KS++KR+C LMDCKKLS DAC HAVQNERLPLR+VVQVL+ EQ RA+A++          
Sbjct  438  KSDKKRLCALMDCKKLSPDACAHAVQNERLPLRIVVQVLYHEQTRASAAATIRA------  491

Query  611  IKDLNCASYGSSRS-ATTTTEEDWDGVASADEL  516
               +   SY SSRS ATT TE++WDGV + ++L
Sbjct  492  -DSIGIGSYESSRSGATTNTEDEWDGVMAVEDL  523



>gb|KGN51751.1| hypothetical protein Csa_5G598100 [Cucumis sativus]
Length=599

 Score =   105 bits (261),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 86/152 (57%), Gaps = 8/152 (5%)
 Frame = -3

Query  791  KSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPKA  612
            K ERKR+CR++DCKKLS +ACMHA QNE LPLRVVVQVLFFEQ RA    GS   +LP  
Sbjct  441  KGERKRLCRILDCKKLSVEACMHAAQNELLPLRVVVQVLFFEQARATM-GGSKVAELPSN  499

Query  611  IKDL----NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMAD-RANG  447
            IK L    N        S +TTT    +   S   L++ K +++ L++  A   D   N 
Sbjct  500  IKALLAAHNIDPSKPPASLSTTTSVQAEDQLSISGLKSPKSKISTLQMKLAEDEDLNENS  559

Query  446  DTTKTVASSDKAAAISKMKGLLVSKRIFSKIW  351
              +  ++ S K  A+  +      KRIFSK+W
Sbjct  560  IHSNGISRSSKFKALCSLPSR--PKRIFSKLW  589



>ref|XP_004172442.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Cucumis 
sativus]
Length=627

 Score =   105 bits (261),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 86/152 (57%), Gaps = 8/152 (5%)
 Frame = -3

Query  791  KSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPKA  612
            K ERKR+CR++DCKKLS +ACMHA QNE LPLRVVVQVLFFEQ RA    GS   +LP  
Sbjct  469  KGERKRLCRILDCKKLSVEACMHAAQNELLPLRVVVQVLFFEQARATM-GGSKVAELPSN  527

Query  611  IKDL----NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMAD-RANG  447
            IK L    N        S +TTT    +   S   L++ K +++ L++  A   D   N 
Sbjct  528  IKALLAAHNIDPSKPPASLSTTTSVQAEDQLSISGLKSPKSKISTLQMKLAEDEDLNENS  587

Query  446  DTTKTVASSDKAAAISKMKGLLVSKRIFSKIW  351
              +  ++ S K  A+  +      KRIFSK+W
Sbjct  588  IHSNGISRSSKFKALCSLPSR--PKRIFSKLW  617



>emb|CAN63893.1| hypothetical protein VITISV_019664 [Vitis vinifera]
Length=619

 Score =   105 bits (261),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 90/161 (56%), Gaps = 24/161 (15%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKR+CR++DCKKLS +ACMHA QNE LPLRVVVQVLFFEQ RA A +G    +LP 
Sbjct  460  SKSERKRLCRILDCKKLSVEACMHAAQNELLPLRVVVQVLFFEQARA-AMAGGQVTELPN  518

Query  614  AIKDLNCASYGSSRS------ATTTT---EEDWDGVASADELRALKGELAALRLGNAGMA  462
             IK L  A++    S      +TTTT   E+ W    S   L++ K  L+ LR+  A   
Sbjct  519  NIKAL-LATHNVDPSRPPAPLSTTTTVAAEDQW----SISGLKSPKSSLSTLRMKLAEDD  573

Query  461  DRANGDTTKTVASSDKAAAISKMKGLLV----SKRIFSKIW  351
            D    D        D     SK+K L       KR+ SK+W
Sbjct  574  DLEENDI-----HPDGIGRSSKLKALCSIPTRPKRMLSKLW  609



>ref|XP_002282444.2| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Vitis 
vinifera]
 ref|XP_010650462.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Vitis 
vinifera]
 ref|XP_010650467.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Vitis 
vinifera]
 ref|XP_010650472.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Vitis 
vinifera]
Length=630

 Score =   105 bits (261),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 90/161 (56%), Gaps = 24/161 (15%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKR+CR++DCKKLS +ACMHA QNE LPLRVVVQVLFFEQ RA  + G  T +LP 
Sbjct  471  SKSERKRLCRILDCKKLSVEACMHAAQNELLPLRVVVQVLFFEQARAAMAGGQVT-ELPN  529

Query  614  AIKDLNCASYGSSRS------ATTTT---EEDWDGVASADELRALKGELAALRLGNAGMA  462
             IK L  A++    S      +TTTT   E+ W    S   L++ K  L+ LR+  A   
Sbjct  530  NIKAL-LATHNVDPSRPPAPLSTTTTVAAEDQW----SISGLKSPKSSLSTLRMKLAEDD  584

Query  461  DRANGDTTKTVASSDKAAAISKMKGLLV----SKRIFSKIW  351
            D    D        D     SK+K L       KR+ SK+W
Sbjct  585  DLEENDI-----HPDGIGRSSKLKALCSIPTRPKRMLSKLW  620



>ref|XP_004135274.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Cucumis 
sativus]
Length=627

 Score =   105 bits (261),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 86/152 (57%), Gaps = 8/152 (5%)
 Frame = -3

Query  791  KSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPKA  612
            K ERKR+CR++DCKKLS +ACMHA QNE LPLRVVVQVLFFEQ RA    GS   +LP  
Sbjct  469  KGERKRLCRILDCKKLSVEACMHAAQNELLPLRVVVQVLFFEQARATM-GGSKVAELPSN  527

Query  611  IKDL----NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMAD-RANG  447
            IK L    N        S +TTT    +   S   L++ K +++ L++  A   D   N 
Sbjct  528  IKALLAAHNIDPSKPPASLSTTTSVQAEDQLSISGLKSPKSKISTLQMKLAEDEDLNENS  587

Query  446  DTTKTVASSDKAAAISKMKGLLVSKRIFSKIW  351
              +  ++ S K  A+  +      KRIFSK+W
Sbjct  588  IHSNGISRSSKFKALCSLPSR--PKRIFSKLW  617



>ref|NP_001151545.1| transposon protein Mutator sub-class [Zea mays]
 gb|ACG43260.1| transposon protein Mutator sub-class [Zea mays]
Length=608

 Score =   104 bits (260),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 67/93 (72%), Gaps = 8/93 (9%)
 Frame = -3

Query  791  KSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPKA  612
            KS++KR+C LMDC+KLS DAC HAVQNERLPLRVVVQVL+ EQ RA+A++          
Sbjct  439  KSDKKRLCALMDCRKLSPDACAHAVQNERLPLRVVVQVLYHEQTRASAAATVRA------  492

Query  611  IKDLNCASYGSSRS-ATTTTEEDWDGVASADEL  516
               +   SY SSRS ATT TE++WDGV + ++L
Sbjct  493  -DSIGIGSYESSRSGATTNTEDEWDGVMAVEDL  524



>ref|XP_008679715.1| PREDICTED: transposon protein Mutator sub-class isoform X1 [Zea 
mays]
 ref|XP_008679722.1| PREDICTED: transposon protein Mutator sub-class isoform X1 [Zea 
mays]
 ref|XP_008679727.1| PREDICTED: transposon protein Mutator sub-class isoform X1 [Zea 
mays]
 ref|XP_008679737.1| PREDICTED: transposon protein Mutator sub-class isoform X1 [Zea 
mays]
 ref|XP_008679743.1| PREDICTED: transposon protein Mutator sub-class isoform X1 [Zea 
mays]
 ref|XP_008679747.1| PREDICTED: transposon protein Mutator sub-class isoform X1 [Zea 
mays]
 tpg|DAA43905.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
Length=613

 Score =   104 bits (260),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 67/93 (72%), Gaps = 8/93 (9%)
 Frame = -3

Query  791  KSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPKA  612
            KS++KR+C LMDC+KLS DAC HAVQNERLPLRVVVQVL+ EQ RA+A++          
Sbjct  438  KSDKKRLCALMDCRKLSPDACAHAVQNERLPLRVVVQVLYHEQTRASAAATVRA------  491

Query  611  IKDLNCASYGSSRS-ATTTTEEDWDGVASADEL  516
               +   SY SSRS ATT TE++WDGV + ++L
Sbjct  492  -DSIGIGSYESSRSGATTNTEDEWDGVMAVEDL  523



>ref|NP_001182914.1| putative phototropic-resoponsive NPH3 family protein [Zea mays]
 ref|XP_008679713.1| PREDICTED: transposon protein Mutator sub-class isoform X2 [Zea 
mays]
 gb|ACR35115.1| unknown [Zea mays]
 tpg|DAA43904.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
Length=619

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 67/93 (72%), Gaps = 8/93 (9%)
 Frame = -3

Query  791  KSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPKA  612
            KS++KR+C LMDC+KLS DAC HAVQNERLPLRVVVQVL+ EQ RA+A++          
Sbjct  444  KSDKKRLCALMDCRKLSPDACAHAVQNERLPLRVVVQVLYHEQTRASAAATVRA------  497

Query  611  IKDLNCASYGSSRS-ATTTTEEDWDGVASADEL  516
               +   SY SSRS ATT TE++WDGV + ++L
Sbjct  498  -DSIGIGSYESSRSGATTNTEDEWDGVMAVEDL  529



>gb|EEC74723.1| hypothetical protein OsI_10448 [Oryza sativa Indica Group]
Length=605

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 80/130 (62%), Gaps = 10/130 (8%)
 Frame = -3

Query  791  KSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPKA  612
            K+E+K++C LMDCKKLS DAC HAVQNERLPLR VVQVL+ EQ RA+A+       +   
Sbjct  438  KNEKKKLCSLMDCKKLSPDACAHAVQNERLPLRTVVQVLYHEQTRASAA-------VTIR  490

Query  611  IKDLNCASYGSSRS-ATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
               +   SY SSRS ATT TE++WDGV + ++L          +L  A  +  +NG   K
Sbjct  491  ADSICVGSYESSRSGATTNTEDEWDGVMAVEDLSL--STKTTTKLDGAANSHCSNGKAMK  548

Query  434  TVASSDKAAA  405
              AS+ K AA
Sbjct  549  GGASTPKKAA  558



>gb|ACF83755.1| unknown [Zea mays]
Length=551

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 115/207 (56%), Gaps = 36/207 (17%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SK E+KR+C LMDC+KL+ADA  HAVQNERLPLRVVVQVLFFEQVR +A++ +++    +
Sbjct  361  SKGEKKRLCALMDCRKLTADASEHAVQNERLPLRVVVQVLFFEQVRQSAAAAAASAAPAR  420

Query  614  AI---KDLNCASYGSSRSATTTTEED--W---------------DGVASADELRALKGEL  495
            ++   +D + ASYGSSRSATTT  ED  W                G   A  LR++  +L
Sbjct  421  SLILPRD-DGASYGSSRSATTTATEDEQWGSGAVVGAPVTTSTSGGAGDAGSLRSMS-QL  478

Query  494  AALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgs  315
            +A   G +G      GD  K    +   A +         KR+  K+W S   +   S  
Sbjct  479  SANENGRSG----GGGDRKKAKGGAVAPAPV---------KRVLGKLW-SGKASSGGSDD  524

Query  314  dsseslgSTTMEEAKSTPSRKGRYSVS  234
             S+  +GS  +EE KS  S+  R+SVS
Sbjct  525  TSASPVGSLNLEETKSMSSQITRHSVS  551



>ref|XP_009421103.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009421104.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Musa acuminata 
subsp. malaccensis]
Length=603

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 92/148 (62%), Gaps = 13/148 (9%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRA-NASSGSSTPDLP  618
            SKSE+K++C L+DCKKLSA+ C+HAVQNERLPLR+VVQ+LFFEQ+RA +A SG +     
Sbjct  444  SKSEKKKLCGLLDCKKLSAEICIHAVQNERLPLRLVVQILFFEQMRASSACSGRA-----  498

Query  617  KAIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTT  438
                +   +   S    TT  E++WDG+ +A+ L + K     L  GNAG + R +G + 
Sbjct  499  ----ESGGSYGSSRSGITTNAEDEWDGMPTAEVLGSFKS--TKLTHGNAG-SQRNSGSSD  551

Query  437  KTVASSDKAAAISKMKGLLVSKRIFSKI  354
             T +     +  +K KG+ + +++  ++
Sbjct  552  TTKSDGHDKSGNAKAKGIKMPRKMLGEL  579



>ref|NP_001067147.1| Os12g0583500 [Oryza sativa Japonica Group]
 gb|ABA99702.1| transposon protein, putative, Mutator sub-class, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF30166.1| Os12g0583500 [Oryza sativa Japonica Group]
Length=638

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 83/203 (41%), Positives = 114/203 (56%), Gaps = 30/203 (15%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVR-ANASSGSSTPDLP  618
            +K E+KR+C LMDCKKLS +A MHAVQNERLPLRVVVQVLFFEQVR A+++S ++  D+P
Sbjct  450  TKGEKKRLCGLMDCKKLSPEASMHAVQNERLPLRVVVQVLFFEQVRAASSASAAAAADMP  509

Query  617  KAIKDL-----NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRA  453
             A + L     +  SYGSSRS T T ++ W    +   +     ++ + R     M+   
Sbjct  510  PAARSLLPREQDGNSYGSSRS-TATEDDQWAPPPTTTSV-----DVTSFR----SMSLAN  559

Query  452  NGDTTKTVASSDKAA----------AISKMKGLLVSKRIFSKIWsskggngensgsdsse  303
            N +   +    D+AA          A     G L+ K+I SK+W        +SG +SS 
Sbjct  560  NKNGGVSGGGGDQAACKKPPPSSASAKGSGGGGLMPKKILSKLW----SGKASSGENSSS  615

Query  302  slgSTTMEEAKSTPSRKGRYSVS  234
                +  EE +STPSR  R+SVS
Sbjct  616  DTSESPGEETRSTPSRNTRHSVS  638



>gb|EAZ21022.1| hypothetical protein OsJ_36671 [Oryza sativa Japonica Group]
Length=638

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 83/203 (41%), Positives = 114/203 (56%), Gaps = 30/203 (15%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVR-ANASSGSSTPDLP  618
            +K E+KR+C LMDCKKLS +A MHAVQNERLPLRVVVQVLFFEQVR A+++S ++  D+P
Sbjct  450  TKGEKKRLCGLMDCKKLSPEASMHAVQNERLPLRVVVQVLFFEQVRAASSASAAAAADMP  509

Query  617  KAIKDL-----NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRA  453
             A + L     +  SYGSSRS T T ++ W    +   +     ++ + R     M+   
Sbjct  510  PAARSLLPREQDGNSYGSSRS-TATEDDQWAPPPTTTSV-----DVTSFR----SMSLAN  559

Query  452  NGDTTKTVASSDKAA----------AISKMKGLLVSKRIFSKIWsskggngensgsdsse  303
            N +   +    D+AA          A     G L+ K+I SK+W        +SG +SS 
Sbjct  560  NKNGGVSGGGGDQAACKKPQPSSASAKGSGGGGLMPKKILSKLW----SGKASSGENSSS  615

Query  302  slgSTTMEEAKSTPSRKGRYSVS  234
                +  EE +STPSR  R+SVS
Sbjct  616  DTSESPGEETRSTPSRNTRHSVS  638



>ref|NP_001146294.1| uncharacterized protein LOC100279869 [Zea mays]
 ref|XP_008672921.1| PREDICTED: uncharacterized protein LOC100279869 isoform X1 [Zea 
mays]
 ref|XP_008672927.1| PREDICTED: uncharacterized protein LOC100279869 isoform X1 [Zea 
mays]
 gb|ACL53641.1| unknown [Zea mays]
 tpg|DAA47266.1| TPA: putative phototropic-responsive NPH3 family protein isoform 
1 [Zea mays]
 tpg|DAA47267.1| TPA: putative phototropic-responsive NPH3 family protein isoform 
2 [Zea mays]
Length=641

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 115/207 (56%), Gaps = 36/207 (17%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SK E+KR+C LMDC+KL+ADA  HAVQNERLPLRVVVQVLFFEQVR +A++ +++    +
Sbjct  451  SKGEKKRLCALMDCRKLTADASEHAVQNERLPLRVVVQVLFFEQVRQSAAAAAASAAPAR  510

Query  614  AI---KDLNCASYGSSRSATTTTEED--W---------------DGVASADELRALKGEL  495
            ++   +D + ASYGSSRSATTT  ED  W                G   A  LR++  +L
Sbjct  511  SLILPRD-DGASYGSSRSATTTATEDEQWGSGAVVGAPVTTSTSGGAGDAGSLRSMS-QL  568

Query  494  AALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgs  315
            +A   G +G      GD  K    +   A +         KR+  K+W S   +   S  
Sbjct  569  SANENGRSG----GGGDRKKAKGGAVAPAPV---------KRVLGKLW-SGKASSGGSDD  614

Query  314  dsseslgSTTMEEAKSTPSRKGRYSVS  234
             S+  +GS  +EE KS  S+  R+SVS
Sbjct  615  TSASPVGSLNLEETKSMSSQITRHSVS  641



>tpg|DAA47265.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
Length=639

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 115/207 (56%), Gaps = 36/207 (17%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SK E+KR+C LMDC+KL+ADA  HAVQNERLPLRVVVQVLFFEQVR +A++ +++    +
Sbjct  449  SKGEKKRLCALMDCRKLTADASEHAVQNERLPLRVVVQVLFFEQVRQSAAAAAASAAPAR  508

Query  614  AI---KDLNCASYGSSRSATTTTEED--W---------------DGVASADELRALKGEL  495
            ++   +D + ASYGSSRSATTT  ED  W                G   A  LR++  +L
Sbjct  509  SLILPRD-DGASYGSSRSATTTATEDEQWGSGAVVGAPVTTSTSGGAGDAGSLRSMS-QL  566

Query  494  AALRLGNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgs  315
            +A   G +G      GD  K    +   A +         KR+  K+W S   +   S  
Sbjct  567  SANENGRSG----GGGDRKKAKGGAVAPAPV---------KRVLGKLW-SGKASSGGSDD  612

Query  314  dsseslgSTTMEEAKSTPSRKGRYSVS  234
             S+  +GS  +EE KS  S+  R+SVS
Sbjct  613  TSASPVGSLNLEETKSMSSQITRHSVS  639



>gb|EAY83679.1| hypothetical protein OsI_38903 [Oryza sativa Indica Group]
Length=638

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 83/203 (41%), Positives = 113/203 (56%), Gaps = 30/203 (15%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTP-DLP  618
            +K E+KR+C LMDCKKLS +A MHAVQNERLPLRVVVQVLFFEQVRA +S+ ++   D+P
Sbjct  450  TKGEKKRLCGLMDCKKLSPEASMHAVQNERLPLRVVVQVLFFEQVRAASSASAAAAVDMP  509

Query  617  KAIKDL-----NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRA  453
             A + L     +  SYGSSRS T T ++ W    +   +     ++ + R     M+   
Sbjct  510  PAARSLLPREQDGNSYGSSRS-TATEDDQWAPPPTTTSV-----DVTSFR----SMSLAN  559

Query  452  NGDTTKTVASSDKAA----------AISKMKGLLVSKRIFSKIWsskggngensgsdsse  303
            N +   +    D+AA          A     G L+ K+I SK+W        +SG +SS 
Sbjct  560  NKNGGVSGGGGDQAACKKPPPSSASAKGSGGGGLMPKKILSKLW----SGKASSGENSSS  615

Query  302  slgSTTMEEAKSTPSRKGRYSVS  234
                +  EE +STPSR  R+SVS
Sbjct  616  DTSESPGEETRSTPSRNTRHSVS  638



>ref|XP_002443443.1| hypothetical protein SORBIDRAFT_08g019560 [Sorghum bicolor]
 gb|EES17281.1| hypothetical protein SORBIDRAFT_08g019560 [Sorghum bicolor]
Length=672

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 120/202 (59%), Gaps = 23/202 (11%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPD---  624
            SK E+KR+C LMDC+KL+ADA  HAVQNERLPLRVVVQVLFFEQVR +A++ + +     
Sbjct  479  SKGEKKRLCALMDCRKLTADASAHAVQNERLPLRVVVQVLFFEQVRQSAAAAACSAAGPA  538

Query  623  ----LPKAIKDLNCASY-GSSRSATTTTEED--WDGVASADEL---RALKGELAALRLGN  474
                LP+     + ASY GSSRSATTT  ED  W G A+        A  G+ ++LR  +
Sbjct  539  RSLVLPRD----DGASYGGSSRSATTTATEDEQWGGGAAVGGAPTTSASGGDASSLRSVS  594

Query  473  AGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgs--dsses  300
               A+++ G +     S D+  A         ++R+  K+WS K  + ENSGS   S   
Sbjct  595  QLSANKSGGRS----GSGDRKKAKGGAVAPAPARRVLGKLWSGKASSVENSGSDDTSESP  650

Query  299  lgSTTMEEAKSTPSRKGRYSVS  234
             GS  +EE KSTPSR  R+SVS
Sbjct  651  AGSLNLEETKSTPSRITRHSVS  672



>ref|XP_011086648.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Sesamum 
indicum]
 ref|XP_011086649.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Sesamum 
indicum]
 ref|XP_011086650.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Sesamum 
indicum]
Length=626

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 86/155 (55%), Gaps = 15/155 (10%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSERKR+CR++DCKKLS +ACMHA QNE LPLRVVVQVLFFEQ RA  + G  T +LP 
Sbjct  470  NKSERKRLCRILDCKKLSMEACMHAAQNEMLPLRVVVQVLFFEQARATMAGGQVT-ELPS  528

Query  614  AIKDLNCASYGSSR-------SATTTTEEDWDGVASADELRALKGELAALRLGNAGMADR  456
             IK L       S+       +AT   E+ W    S   L++ K  L+ L++      D 
Sbjct  529  NIKALLAVHKNPSKANASFSTNATMPPEDQW----SVSGLKSPKSNLSTLKM-KLDEDDD  583

Query  455  ANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIW  351
             + +    +  S K  + S        KR+FSK+W
Sbjct  584  LDDNFPDGIEKSSKLRSFSTTPNR--PKRMFSKLW  616



>ref|NP_001049315.2| Os03g0205700 [Oryza sativa Japonica Group]
 gb|ABF94544.1| transposon protein, putative, Mutator sub-class, expressed [Oryza 
sativa Japonica Group]
 gb|EEE58543.1| hypothetical protein OsJ_09839 [Oryza sativa Japonica Group]
 dbj|BAF11229.2| Os03g0205700 [Oryza sativa Japonica Group]
Length=605

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 79/130 (61%), Gaps = 10/130 (8%)
 Frame = -3

Query  791  KSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPKA  612
            K+E+K++C LMDCKKLS DAC HAVQNERLPLR VVQVL+ EQ RA+A+       +   
Sbjct  438  KNEKKKLCSLMDCKKLSPDACAHAVQNERLPLRTVVQVLYHEQTRASAA-------VTIR  490

Query  611  IKDLNCASYGSSRS-ATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
               +   SY SSRS ATT TE++WDGV   ++L          +L  A  +  +NG   K
Sbjct  491  ADSICVGSYESSRSGATTNTEDEWDGVMVVEDLSL--STKTTTKLDGAANSHCSNGKAKK  548

Query  434  TVASSDKAAA  405
              AS+ K AA
Sbjct  549  GGASTPKKAA  558



>ref|XP_011071147.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Sesamum 
indicum]
 ref|XP_011071148.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Sesamum 
indicum]
 ref|XP_011071149.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Sesamum 
indicum]
Length=619

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 92/153 (60%), Gaps = 14/153 (9%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSERKR+CR++DCKKLS +ACMHA QNE LPLRVVVQVLFFEQ RA  + G    +LP 
Sbjct  466  NKSERKRLCRILDCKKLSVEACMHAAQNEMLPLRVVVQVLFFEQARAAMAGGGQAAELPS  525

Query  614  AIKDLNCASYGSSRSATTT--TEEDWDGVASADELRALKGELAALRLGNA---GMADRAN  450
             IK L       S++  +T  +++ W    S   L++ K  L+ L++  A   G+ D   
Sbjct  526  NIKALLAGHKTQSKATASTIPSQDQW----SLSGLKSPKSNLSTLKMKLAEDDGLDDNFQ  581

Query  449  GDTTKTVASSDKAAAISKMKGLLVSKRIFSKIW  351
             +T K   SS K  ++S +      KR+FSK+W
Sbjct  582  DETQK---SSTKTKSVSMIPN--RPKRMFSKLW  609



>ref|XP_006393947.1| hypothetical protein EUTSA_v10003889mg [Eutrema salsugineum]
 gb|ESQ31233.1| hypothetical protein EUTSA_v10003889mg [Eutrema salsugineum]
Length=587

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 88/148 (59%), Gaps = 35/148 (24%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSE+K ICRLMDC+KLS +AC HAVQNERLPLRVVVQ+LFFEQVR  A+  ++ P LP 
Sbjct  434  TKSEKKSICRLMDCRKLSPEACAHAVQNERLPLRVVVQILFFEQVR--AACPTTKPSLPP  491

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
            +       S+GSSR   TTTEE+ D V +                           D T 
Sbjct  492  S------GSHGSSR---TTTEEECDSVTAT----------------EETTTTTTTRDKT-  525

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIW  351
              +SS+K    +K KG+++S R+FSK+W
Sbjct  526  --SSSEK----TKAKGVVMS-RMFSKLW  546



>ref|XP_008389720.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Malus 
domestica]
 ref|XP_008389721.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Malus 
domestica]
Length=633

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 91/161 (57%), Gaps = 24/161 (15%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSERKR+CR++DCKKLS +ACMHA QNE LPLRVVVQVLFFEQ RA  +SG  T +LP 
Sbjct  474  NKSERKRLCRILDCKKLSMEACMHAAQNELLPLRVVVQVLFFEQARAAMASGKVT-ELPS  532

Query  614  AIKDLNCASYGS---------SRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMA  462
             I++L  AS+           S ++    E+ W    SA  L++ K  ++ L++  A   
Sbjct  533  NIREL-LASHNIDPSRPPPSLSNASIVPAEDQW----SASGLKSPKSRMSTLQMKLA---  584

Query  461  DRANGDTTKTVASSDKAAAISKMKGLLV----SKRIFSKIW  351
               + D  +     D     SKMK L       KR+ SK+W
Sbjct  585  --EDDDLDENNMHPDGIGRNSKMKSLCSLPTRPKRMLSKLW  623



>gb|EMT10822.1| Root phototropism protein 3 [Aegilops tauschii]
Length=606

 Score =   102 bits (254),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 109/182 (60%), Gaps = 21/182 (12%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKS++K++C LMDCKKLS +AC HAVQNERLPLR VVQVL+ EQ RA+A++         
Sbjct  436  SKSDKKKLCCLMDCKKLSPEACAHAVQNERLPLRTVVQVLYHEQTRASAAATVRA-----  490

Query  614  AIKDLNC-ASYGSSRS-ATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
               D  C  SY SSRS ATT TE++WDGV   ++L +L  +    +L     A++++G  
Sbjct  491  ---DSICIGSYESSRSGATTNTEDEWDGVIGVEDL-SLSSK--TTKLEKCHNAEKSHG--  542

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
                  S K+ A  K KG    K++  K+ SSK   GE S SDSS+S    + +  K TP
Sbjct  543  ------SSKSTANGKAKGGATPKKVLGKMLSSKALTGERSSSDSSDSAILRSQDHPKRTP  596

Query  260  SR  255
            SR
Sbjct  597  SR  598



>ref|XP_009770852.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Nicotiana 
sylvestris]
Length=616

 Score =   102 bits (254),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 90/152 (59%), Gaps = 16/152 (11%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSERKR+CR++DCKKLS + CMHA QNE LPLRVVVQVLFFEQ RA A SG    +LP 
Sbjct  466  NKSERKRLCRMLDCKKLSMEVCMHAAQNELLPLRVVVQVLFFEQARA-AMSGGHVTELPS  524

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
             IK L   +  +S +   T  +D    ASA  L++    L+ L++    +A+  + D   
Sbjct  525  NIKALLEDTAKTSATFNKTPVDDQWTTASA--LKSPNSNLSTLKM---KLAEDDDDDDLD  579

Query  434  TVASSDKAAAISKMKGLLV----SKRIFSKIW  351
             +  S      S++K L V     KR+FSK+W
Sbjct  580  QIGKS------SRIKALCVIPNRPKRMFSKLW  605



>emb|CDY29566.1| BnaA03g54110D [Brassica napus]
Length=578

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 74/112 (66%), Gaps = 18/112 (16%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRA-----NASSGSST  630
            +KSE+KRICRLMDC+KLS +AC HAVQNERLP+RVVVQVLFFEQ RA     N  S S+ 
Sbjct  416  NKSEKKRICRLMDCRKLSVEACAHAVQNERLPMRVVVQVLFFEQARANNNNNNNGSSSTG  475

Query  629  PDLPKAIKDLNCASYGSSRSATTTTE-EDWDGVASADELRALKGELAALRLG  477
               P+ I         +SRS  T  E E WD     ++++ L+GELA+LRL 
Sbjct  476  NSTPEIIP--------ASRSTNTEDETESWD----TEDIKTLRGELASLRLA  515



>gb|KHN14527.1| BTB/POZ domain-containing protein [Glycine soja]
Length=635

 Score =   102 bits (254),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 90/157 (57%), Gaps = 16/157 (10%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSERKR+CR++DCKKLS +ACMHA QNE LPLRVVVQVLFFEQ RA A +G    DLP 
Sbjct  473  NKSERKRLCRILDCKKLSMEACMHAAQNELLPLRVVVQVLFFEQARA-AQAGGKVTDLPT  531

Query  614  AIKDLNCA-----SYGSSRSATTTT---EEDWDGVASADELRALKGELAALRLGNAGMAD  459
             IK L  A     S  ++  +TTT+   E++W    S    ++ K   + LR+  A   D
Sbjct  532  NIKALLTAHGIDPSKPTAPLSTTTSIHAEDNW----SVSNFKSPKSRSSTLRMKLAEDDD  587

Query  458  -RANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIW  351
               NG T   +  + +  AI  +      K++ SK W
Sbjct  588  FNQNGLTHDGIGRNSRFKAICAIPT--QPKKMLSKFW  622



>ref|XP_009138500.1| PREDICTED: BTB/POZ domain-containing protein NPY5 [Brassica rapa]
Length=578

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 74/112 (66%), Gaps = 18/112 (16%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRA-----NASSGSST  630
            +KSE+KRICRLMDC+KLS +AC HAVQNERLP+RVVVQVLFFEQ RA     N  S S+ 
Sbjct  416  NKSEKKRICRLMDCRKLSVEACAHAVQNERLPMRVVVQVLFFEQARANNNNNNNGSSSTG  475

Query  629  PDLPKAIKDLNCASYGSSRSATTTTE-EDWDGVASADELRALKGELAALRLG  477
               P+ I         +SRS  T  E E WD     ++++ L+GELA+LRL 
Sbjct  476  NSTPEIIP--------ASRSTNTEDETESWD----TEDIKTLRGELASLRLA  515



>gb|KHN00400.1| BTB/POZ domain-containing protein [Glycine soja]
Length=636

 Score =   102 bits (253),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 90/157 (57%), Gaps = 16/157 (10%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSERKR+CR++DCKKLS +ACMHA QNE LPLRVVVQVLFFEQ RA A +G    DLP 
Sbjct  474  NKSERKRLCRILDCKKLSMEACMHAAQNELLPLRVVVQVLFFEQARA-AQAGGKVTDLPT  532

Query  614  AIKDLNCA-----SYGSSRSATTTT---EEDWDGVASADELRALKGELAALRLGNAGMAD  459
             IK L  A     S  ++  +TTT+   EE+W    S    ++ K + + LR+  A   D
Sbjct  533  NIKALLTAHGIDPSKPTAPLSTTTSINAEENW----SVSNFKSPKSKSSTLRMKLAEDED  588

Query  458  -RANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIW  351
               NG     +  + +  AI  +      K++ +K W
Sbjct  589  FNQNGLAHDGIGRNSRFKAICAIPT--QPKKMLTKFW  623



>ref|XP_010464031.1| PREDICTED: BTB/POZ domain-containing protein NPY3 [Camelina sativa]
 ref|XP_010464037.1| PREDICTED: BTB/POZ domain-containing protein NPY3 [Camelina sativa]
Length=590

 Score =   101 bits (252),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 87/148 (59%), Gaps = 35/148 (24%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSE+K + RLMDC+KLS +AC HAVQNERLPLRVVVQ+LFFEQVRA   +    P LP 
Sbjct  437  TKSEKKSLSRLMDCRKLSPEACAHAVQNERLPLRVVVQILFFEQVRATCPAAK--PSLPP  494

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
            +       S+GSSR   TTTEE+ D V +                    M D+       
Sbjct  495  S------GSHGSSR---TTTEEECDSVTA-----------TEETTTTTTMRDK-------  527

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIW  351
             ++SS+K    +K KG+++S RIFSK+W
Sbjct  528  -MSSSEK----TKAKGVVMS-RIFSKLW  549



>ref|NP_001146461.1| putative phototropic-responsive NPH3 family protein isoform 1 
[Zea mays]
 ref|XP_008658516.1| PREDICTED: putative phototropic-responsive NPH3 family protein 
isoform 1 isoform X1 [Zea mays]
 gb|ACN31846.1| unknown [Zea mays]
 gb|ACN32003.1| unknown [Zea mays]
 gb|AFW89291.1| putative phototropic-responsive NPH3 family protein isoform 1 
[Zea mays]
 gb|AFW89292.1| putative phototropic-responsive NPH3 family protein isoform 2 
[Zea mays]
 gb|AFW89293.1| putative phototropic-responsive NPH3 family protein isoform 3 
[Zea mays]
 gb|AIB05808.1| orphans transcription factor, partial [Zea mays]
Length=624

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 68/93 (73%), Gaps = 7/93 (8%)
 Frame = -3

Query  791  KSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPKA  612
            KS++KR+C LMDCKKLS DAC HAVQNERLPLR+VVQVL+ EQ RA A++ +   D    
Sbjct  438  KSDKKRLCALMDCKKLSPDACAHAVQNERLPLRIVVQVLYHEQTRACAAATAIRAD----  493

Query  611  IKDLNCASYGSSRS-ATTTTEEDWDGVASADEL  516
               +   SY SSRS ATT TE++WDGV + ++L
Sbjct  494  --SIGIGSYESSRSGATTNTEDEWDGVMAVEDL  524



>ref|XP_002311763.1| phototropic-responsive NPH3 family protein [Populus trichocarpa]
 gb|EEE89130.1| phototropic-responsive NPH3 family protein [Populus trichocarpa]
Length=628

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 86/155 (55%), Gaps = 15/155 (10%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSERKR+CR +DCKKLS +ACMHA QNE LPLRVVVQVLFFEQ RA   SG  T +LP 
Sbjct  470  NKSERKRLCRTLDCKKLSVEACMHAAQNELLPLRVVVQVLFFEQARAAMGSGKVT-ELPS  528

Query  614  AIKDLNCA-SYGSSRSAT---TTTEEDWDGVASADELRALKGELAALRLGNAGMADRANG  447
             IK L  A +   SR  T   TTT    D   S   LR+ K +++ LR+        A  
Sbjct  529  NIKALLAAHNIDPSRPTTALSTTTSIPADDQWSVSGLRSPKSKVSTLRM------KLAED  582

Query  446  DTTKTVASSDKAAAISKMKGLLV----SKRIFSKI  354
            D  ++   S+     SK K         KR+FSK 
Sbjct  583  DLDESDLQSEGLRRTSKFKSFCALPTRPKRMFSKF  617



>ref|XP_010251055.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Nelumbo 
nucifera]
Length=623

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 89/160 (56%), Gaps = 21/160 (13%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSERK++CR++DCKKLS +ACMHA QNE LPLRVVVQVLF+EQVR   + G  T +LP 
Sbjct  463  TKSERKQLCRILDCKKLSMEACMHAAQNELLPLRVVVQVLFYEQVRTALAGGQLT-ELPS  521

Query  614  AIKDL------NCASYGSSRSATTTTEED--WDGVASADELRALKGELAALRLGNAGMAD  459
             IK L      + A +  S S T T  ED  W    S   L++ + +L+ LR+  A    
Sbjct  522  NIKTLLAVHEDDPARHPHSLSITATGPEDDEW----SVSGLKSSRSKLSTLRMKLA----  573

Query  458  RANGDTTKTVASSDKAAAISKMKGLLV----SKRIFSKIW  351
              + +    V   D     S++K         K++F+K W
Sbjct  574  EEDNNVDDNVIHQDGIRKTSRLKAFCSFPTRPKKMFNKFW  613



>ref|XP_003519715.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Glycine 
max]
Length=636

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 90/157 (57%), Gaps = 16/157 (10%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKR+CR++DCKKLS +ACMHA QNE LPLRVVVQVLFFEQ RA A +G    DLP 
Sbjct  474  SKSERKRLCRILDCKKLSMEACMHAAQNELLPLRVVVQVLFFEQARA-AQAGGKVTDLPT  532

Query  614  AIKDLNCA-----SYGSSRSATTTT---EEDWDGVASADELRALKGELAALRLGNAGMAD  459
             IK L  A     S  ++  +TTT+   E++W    S    ++ K + + LR+  A   D
Sbjct  533  NIKALLTAHGIDPSKPTAPLSTTTSINAEDNW----SVSNFKSPKSKSSTLRMKLAEDED  588

Query  458  -RANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIW  351
               NG     +  + +  AI  +      K++ +K W
Sbjct  589  FNQNGLAHDGIGRNSRFKAICAIPT--QPKKMLTKFW  623



>ref|XP_010248658.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Nelumbo 
nucifera]
 ref|XP_010248659.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Nelumbo 
nucifera]
 ref|XP_010248660.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Nelumbo 
nucifera]
Length=624

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 86/157 (55%), Gaps = 14/157 (9%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KS+RKR+CR++DCKKLS +ACMHA QNE LPLRVVVQVLFFEQ R   + G  T +LPK
Sbjct  471  TKSDRKRLCRILDCKKLSMEACMHAAQNELLPLRVVVQVLFFEQARTTLAGGKVT-ELPK  529

Query  614  AIKDL-----NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRAN  450
             IK L     N       RS  TT     D   S   L+  K +L+ LR+      D  +
Sbjct  530  NIKALLTLHENDPDQRHLRSLHTTETSPVDDEWSISGLKLPKSKLSTLRMK----LDEDD  585

Query  449  GDTTKTVASSDKAAAISKMKGLLV----SKRIFSKIW  351
             +    V+  +     S++K         KR+FSK+W
Sbjct  586  NEMDDNVSHQEGIVKTSRLKAFCSLPTRPKRMFSKLW  622



>ref|XP_010682456.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010682457.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010682458.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Beta 
vulgaris subsp. vulgaris]
Length=627

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 76/122 (62%), Gaps = 12/122 (10%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSERKR+CR++DCKKLS D CMHA QNE LPLRVVVQVLFFEQ R+  + G  T DLP 
Sbjct  473  NKSERKRLCRVLDCKKLSMDVCMHAAQNELLPLRVVVQVLFFEQARSAMAGGKVT-DLPP  531

Query  614  AIKDLNCASYGSSRS----ATTTT----EEDW--DGVASAD-ELRALKGELAALRLGNAG  468
             IK L      SSR     +TTTT    E+ W   G+ S + +L  LK +LA   L   G
Sbjct  532  NIKALLATHDESSRPTAALSTTTTNPGAEDQWSVSGLKSPNSKLATLKMKLAEDDLEENG  591

Query  467  MA  462
             A
Sbjct  592  FA  593



>gb|EMS51026.1| Root phototropism protein 3 [Triticum urartu]
Length=606

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 109/182 (60%), Gaps = 21/182 (12%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKS++K++C LMDCKKLS +AC HAVQNERLPLR VVQVL+ EQ RA+A++         
Sbjct  436  SKSDKKKLCCLMDCKKLSPEACAHAVQNERLPLRTVVQVLYHEQTRASAAATVRA-----  490

Query  614  AIKDLNC-ASYGSSRS-ATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDT  441
               D  C  SY SSRS ATT TE++WDGV + ++L +L  +    +L     A++++G  
Sbjct  491  ---DSICIGSYESSRSGATTNTEDEWDGVIAVEDL-SLSSK--TTKLEKCHSAEKSHG--  542

Query  440  TKTVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP  261
                  S K+    K KG    K++  K+ SSK   GE S SDSS+S    + +  K TP
Sbjct  543  ------SSKSTTNGKAKGGATPKKVLGKMLSSKALTGERSSSDSSDSAILRSQDHPKRTP  596

Query  260  SR  255
            SR
Sbjct  597  SR  598



>ref|XP_006649594.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Oryza 
brachyantha]
Length=604

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 66/93 (71%), Gaps = 8/93 (9%)
 Frame = -3

Query  791  KSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPKA  612
            KS++K++C LMDCKKLS DAC HAVQNERLPLR VVQVL+ EQ RA+A+       +   
Sbjct  438  KSDKKKLCSLMDCKKLSPDACAHAVQNERLPLRTVVQVLYHEQTRASAA-------VTIR  490

Query  611  IKDLNCASYGSSRS-ATTTTEEDWDGVASADEL  516
               +   SY SSRS ATT TE++WDGV + ++L
Sbjct  491  ADSICVGSYESSRSGATTNTEDEWDGVMAVEDL  523



>ref|XP_010265570.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like [Nelumbo 
nucifera]
Length=601

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 91/148 (61%), Gaps = 17/148 (11%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +K ER+RIC LMD K L+ DACMHA QNERLPLRVVVQVLFFEQV+  A+ G + P    
Sbjct  427  TKIERRRICGLMDVKNLTTDACMHAAQNERLPLRVVVQVLFFEQVKT-AAGGFNVP----  481

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
              ++++C    +SRS T T  EDW+     ++  +LK +++ +++   G     NG+  K
Sbjct  482  --QNVSC---DNSRSTTNT--EDWNR-TDLEDYNSLKQQISHMKI--HGKECERNGEKKK  531

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIW  351
              +S ++ + +  +     SKRIF K+W
Sbjct  532  KKSSKNRGSGVLLLPSR--SKRIFDKLW  557



>ref|XP_009614413.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Nicotiana 
tomentosiformis]
Length=617

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 87/152 (57%), Gaps = 15/152 (10%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSERKR+CR++DCKKLS + CMHA QNE LPLRVVVQVLFFEQ RA A SG    +LP 
Sbjct  466  NKSERKRLCRMLDCKKLSMEVCMHAAQNELLPLRVVVQVLFFEQARA-AMSGGHVTELPS  524

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
             IK L   +  +S +   T  +D    ASA  L++    L+ L++  A        +   
Sbjct  525  NIKALLEDTAKTSATFNKTPVDDQWTTASA--LKSPNSNLSTLKMKLA--------EDDD  574

Query  434  TVASSDKAAAISKMKGLLV----SKRIFSKIW  351
                 D+    S++K L V     KR+FSK+W
Sbjct  575  DDDDLDEIGKSSRIKALRVIPNRPKRMFSKLW  606



>gb|KCW59745.1| hypothetical protein EUGRSUZ_H02493 [Eucalyptus grandis]
Length=522

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 76/114 (67%), Gaps = 15/114 (13%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSERKR+CR++DCKKLS +ACMHA QNE LPLRVVVQVLFFEQ RA  +SG  T +LP 
Sbjct  360  NKSERKRLCRILDCKKLSMEACMHAAQNELLPLRVVVQVLFFEQARATMASGKVT-ELPS  418

Query  614  AIKDLNCASYG--SSR------SATTTTEEDWDGVA-----SADELRALKGELA  492
             IK L  A++G  SSR      + T+ T ED   V+     S  +L  LK +LA
Sbjct  419  NIKAL-LAAHGLDSSRPPAPLSTTTSITHEDQWSVSGLKSPSKSKLSTLKMKLA  471



>ref|XP_011036689.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like [Populus 
euphratica]
Length=612

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 94/150 (63%), Gaps = 22/150 (15%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +K+E+K+IC LMD KKL+ +A MHA QNERLPLRVVVQVLFFEQVR  A+SG        
Sbjct  439  TKAEKKKICGLMDVKKLTMEASMHAAQNERLPLRVVVQVLFFEQVR--AASG--------  488

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
             ++ LN  +  +S S TT T+E+W+  A AD+ ++LK +++ +++ +     R NG   K
Sbjct  489  -VQALNNNARDTSNS-TTNTDEEWEKTA-ADDNKSLKKQMSRMKIKDEDF--RKNGKLLK  543

Query  434  TVASSDKAAAISKMKGLLV--SKRIFSKIW  351
              + S K+        LL   S+RIF ++W
Sbjct  544  KNSKSTKSGV-----QLLPSRSRRIFDRLW  568



>emb|CBI16786.3| unnamed protein product [Vitis vinifera]
Length=472

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 77/126 (61%), Gaps = 15/126 (12%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKR+CR++DCKKLS +ACMHA QNE LPLRVVVQVLFFEQ RA  + G  T +LP 
Sbjct  323  SKSERKRLCRILDCKKLSVEACMHAAQNELLPLRVVVQVLFFEQARAAMAGGQVT-ELPN  381

Query  614  AIKDLNCASYGSSRS------ATTTT---EEDWDGVASADELRALKGELAALRLGNAGMA  462
             IK L  A++    S      +TTTT   E+ W    S   L++ K  L+ LR+  A   
Sbjct  382  NIKAL-LATHNVDPSRPPAPLSTTTTVAAEDQW----SISGLKSPKSSLSTLRMKLAEDD  436

Query  461  DRANGD  444
            D    D
Sbjct  437  DLEEND  442



>ref|XP_006357600.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Solanum 
tuberosum]
Length=628

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 92/159 (58%), Gaps = 22/159 (14%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +K+ERKR+CR++DCKKLS D CMHA QNE LPLRVVVQVLFFEQ R  A SG    +LP 
Sbjct  469  NKNERKRLCRILDCKKLSMDVCMHAAQNELLPLRVVVQVLFFEQART-AMSGGHVTELPS  527

Query  614  AIK-------DLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADR  456
             IK       D    S   +++  T   + W   ++A  L++ K  ++ L++    +A+ 
Sbjct  528  NIKALLANHDDTAKTSASFNKAKMTPVNDQW---SNASGLKSPKSNISTLKM---KLAED  581

Query  455  ANGDTTKTVASSDKAAAISKMKGLLV----SKRIFSKIW  351
             + D      ++D+    S++K L V     K++FSK+W
Sbjct  582  DDLDE----HNADEIGKSSRIKALCVLPNRPKKMFSKLW  616



>ref|XP_011034060.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Populus 
euphratica]
 ref|XP_011034061.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Populus 
euphratica]
 ref|XP_011034062.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Populus 
euphratica]
 ref|XP_011034063.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Populus 
euphratica]
Length=628

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 84/155 (54%), Gaps = 15/155 (10%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSERKR+CR +DCKKLS +ACMHA QNE LPLRVVVQVLFFEQ R    SG  T +LP 
Sbjct  470  NKSERKRLCRTLDCKKLSVEACMHAAQNELLPLRVVVQVLFFEQARPAMGSGKVT-ELPS  528

Query  614  AIKDLNCA-SYGSSRSAT---TTTEEDWDGVASADELRALKGELAALRLGNAGMADRANG  447
             IK L  A +   SR  T   TTT    D   S   LR  K +++ LR+        A  
Sbjct  529  NIKALLAAHNIDPSRPETALSTTTSIPADDQWSVSGLRTPKSKVSTLRM------KLAED  582

Query  446  DTTKTVASSDKAAAISKMKGLLV----SKRIFSKI  354
            D  ++   S+     SK K         KR+FSK 
Sbjct  583  DLNESDLQSEGLRRTSKFKSFCALPTRPKRMFSKF  617



>ref|XP_007158393.1| hypothetical protein PHAVU_002G149400g [Phaseolus vulgaris]
 gb|ESW30387.1| hypothetical protein PHAVU_002G149400g [Phaseolus vulgaris]
Length=632

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 90/157 (57%), Gaps = 16/157 (10%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSERKR+CR++DCKKLS +ACMHA QNE LPLR+VVQVLFFEQ RA A +G    DLP 
Sbjct  473  NKSERKRLCRILDCKKLSMEACMHAAQNELLPLRLVVQVLFFEQARA-AQAGGKVTDLPT  531

Query  614  AIKDLNCA-----SYGSSRSATTTT---EEDWDGVASADELRALKGELAALRLGNAGMAD  459
             IK L  A     +  ++  +TTT+   E++W    S    ++ K   + LR+  A   D
Sbjct  532  NIKALLTAHGIDPAKPTAPLSTTTSIHAEDNW----SVSNFKSPKSRSSTLRMKLAEDDD  587

Query  458  -RANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIW  351
               NG T   +  + +  AI  +      K++ SK W
Sbjct  588  FNQNGLTHDGIGRNSRFKAICAIPT--QPKKMLSKFW  622



>ref|XP_006852352.1| hypothetical protein AMTR_s00049p00216130 [Amborella trichopoda]
 gb|ERN13819.1| hypothetical protein AMTR_s00049p00216130 [Amborella trichopoda]
Length=687

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 73/132 (55%), Gaps = 10/132 (8%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SKSERKR+CRL+DCKKLS +ACMHA QNE LPLR+VVQVLFFEQVRA  S      +LP 
Sbjct  466  SKSERKRLCRLLDCKKLSMEACMHAAQNELLPLRLVVQVLFFEQVRAATSGNGPAAELPH  525

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
             +K L   S           E+ W    S   L+  K +L  LR+  A     A+ D   
Sbjct  526  NLKAL--LSAHEEDGVCRAREDSW----SVGGLKPSKQKLTTLRMRLA----EADNDQED  575

Query  434  TVASSDKAAAIS  399
             VA  D    +S
Sbjct  576  EVAMHDGGGCVS  587



>ref|XP_010023464.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Eucalyptus 
grandis]
 ref|XP_010023465.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Eucalyptus 
grandis]
 ref|XP_010023466.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Eucalyptus 
grandis]
 ref|XP_010023467.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Eucalyptus 
grandis]
 gb|KCW59742.1| hypothetical protein EUGRSUZ_H02493 [Eucalyptus grandis]
 gb|KCW59743.1| hypothetical protein EUGRSUZ_H02493 [Eucalyptus grandis]
Length=633

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 76/114 (67%), Gaps = 15/114 (13%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSERKR+CR++DCKKLS +ACMHA QNE LPLRVVVQVLFFEQ RA  +SG  T +LP 
Sbjct  471  NKSERKRLCRILDCKKLSMEACMHAAQNELLPLRVVVQVLFFEQARATMASGKVT-ELPS  529

Query  614  AIKDLNCASYG--SSR------SATTTTEEDWDGVA-----SADELRALKGELA  492
             IK L  A++G  SSR      + T+ T ED   V+     S  +L  LK +LA
Sbjct  530  NIKAL-LAAHGLDSSRPPAPLSTTTSITHEDQWSVSGLKSPSKSKLSTLKMKLA  582



>gb|KJB15638.1| hypothetical protein B456_002G187700 [Gossypium raimondii]
Length=629

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 85/155 (55%), Gaps = 15/155 (10%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSERK++CR++DCKKLS +ACMHA QNE+LPLRVVVQVLFFEQ RA A+ G    +LP 
Sbjct  471  NKSERKKLCRILDCKKLSVEACMHAAQNEKLPLRVVVQVLFFEQARA-ATVGGKVAELPS  529

Query  614  AIKDL----NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANG  447
             IK L    N       R+ +TTT    D   S   L++ K   + LR+        A  
Sbjct  530  NIKALLAAHNIDPSRPPRTLSTTTSIRGDDQWSVSGLKSPKSRTSTLRM------KLAED  583

Query  446  DTTKTVASSDKAAAISKMKGLLV----SKRIFSKI  354
            D  +   + D     SK K         K++FSK+
Sbjct  584  DLDEYDMNPDGLGRSSKFKAFCALPTGPKKMFSKL  618



>ref|XP_007044812.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
 gb|EOY00644.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
Length=632

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 88/156 (56%), Gaps = 16/156 (10%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSERK++CR++DCKKLS +ACMHA QNE+LPLRVVVQVLFFEQ RA A++G    +LP 
Sbjct  473  NKSERKKLCRVLDCKKLSVEACMHAAQNEKLPLRVVVQVLFFEQARA-ATAGGKVTELPS  531

Query  614  AIKDLNCASYGSSRS-----ATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRAN  450
             IK L  AS+    S      +TTT    D   S   L++ K  ++ LR+  A   D   
Sbjct  532  NIKAL-LASHNIDPSRPPGPLSTTTSIQADDQWSVSGLKSPKSRISTLRMKLAEDDDLDE  590

Query  449  GDTTKTVASSDKAAAISKMKGLLV----SKRIFSKI  354
             D       +D     SK K         K++FSK+
Sbjct  591  KDM-----HTDGMGRPSKFKAFCALPARPKKMFSKL  621



>ref|XP_009786908.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Nicotiana 
sylvestris]
 ref|XP_009786909.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Nicotiana 
sylvestris]
Length=612

 Score = 99.0 bits (245),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 88/152 (58%), Gaps = 18/152 (12%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +K+ERKR+CR++DCKKLS   CMHA QNE LPLRVVVQVLFFEQ RA  S G  T +LP 
Sbjct  464  NKNERKRLCRMLDCKKLSMKVCMHAAQNELLPLRVVVQVLFFEQARATMSGGHIT-ELPS  522

Query  614  AIKDL----NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANG  447
             IK L    +  S  S+    T  ++ W   +++ +L  LK +LA     +    D  NG
Sbjct  523  HIKVLLANHDDISKTSASFKMTPADDQW---SASGKLSTLKMKLAENEDLDENYVD-GNG  578

Query  446  DTTKTVASSDKAAAISKMKGLLVSKRIFSKIW  351
             +++      KA+ I   +     KR+FSK+W
Sbjct  579  TSSRI-----KASCIFPSR----PKRMFSKLW  601



>gb|KHG03539.1| hypothetical protein F383_27138 [Gossypium arboreum]
Length=632

 Score = 99.0 bits (245),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 85/155 (55%), Gaps = 14/155 (9%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSERKR+CR++DC+KLS +ACMHA QNE+LPLRVVVQVLFFEQ RA A++G+   DLP 
Sbjct  473  NKSERKRLCRILDCRKLSVEACMHAAQNEKLPLRVVVQVLFFEQARA-ATTGAKVADLPS  531

Query  614  AIKDL----NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANG  447
             IK L    N          +TTT    D   S   +++ K   + LR   AG  D    
Sbjct  532  NIKALLASHNIDPSKPPGPLSTTTSIPADDEWSNSGIKSPKSRNSRLRNKVAGEDDLDEN  591

Query  446  DTTKTVASSDKAAAISKMKGLLV----SKRIFSKI  354
            +  +     D     SK K         KR+F+K+
Sbjct  592  EMNR-----DGMGRPSKFKAFCALPRRPKRMFNKL  621



>ref|XP_006857240.1| hypothetical protein AMTR_s00065p00211770 [Amborella trichopoda]
 gb|ERN18707.1| hypothetical protein AMTR_s00065p00211770 [Amborella trichopoda]
Length=610

 Score = 99.0 bits (245),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 106/188 (56%), Gaps = 24/188 (13%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +K E+K+IC LMD KKLS +AC+HA QNERLPLRVVVQVLFFEQVR + +  ++  + P 
Sbjct  446  TKGEKKKICSLMDVKKLSMEACVHAAQNERLPLRVVVQVLFFEQVRVSNAGLTTLVENPN  505

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
                  C S+ SS+SAT T EE WD   + +EL+  K +L        G A  A   + K
Sbjct  506  -----ECGSHESSQSATNTDEE-WD--HTINELKPPKQDL--------GFA--AKIGSGK  547

Query  434  TVASSDKAAAISKMKGLLVSKRIFSKIWsskggngensgsdsseslgSTTMEEAKSTP-S  258
              +     A +        S+RIF +IW SKG    +  S SS+S  S    E KST  S
Sbjct  548  KKSKVKVGALLPSR-----SRRIFDRIWPSKGETRSSETSGSSQSPTSVNPIEVKSTTGS  602

Query  257  RKGRYSVS  234
            R  R+SVS
Sbjct  603  RNRRHSVS  610



>ref|XP_007011711.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
 ref|XP_007011712.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
 ref|XP_007011713.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
 gb|EOY29330.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
 gb|EOY29331.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
 gb|EOY29332.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
Length=615

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 90/149 (60%), Gaps = 20/149 (13%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +K+ERK++C LMD KK + DA MHA QNERLPLRVVVQVLFFEQVRA A+   S  + P+
Sbjct  442  TKAERKKLCGLMDVKKFTMDASMHAAQNERLPLRVVVQVLFFEQVRA-AAGVQSLANNPR  500

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
             I             +TT T+E+W+  A A++  +LK +++ +++   G   + NG   K
Sbjct  501  DIS-----------HSTTNTDEEWEKTA-AEDCNSLKKQMSQMKVKEDGF--QKNGKLAK  546

Query  434  TVASSDKAAAISKMKGLLV-SKRIFSKIW  351
              + + K    S M+ L   S+RIF K+W
Sbjct  547  KNSKNSK----SGMQLLPSRSRRIFDKLW  571



>ref|XP_008803708.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like [Phoenix 
dactylifera]
Length=613

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 102/195 (52%), Gaps = 28/195 (14%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            SK E+KRIC LMD KKLS DAC+HA QNERLPLRVVVQVLFFEQ+RA AS  +++     
Sbjct  439  SKVEKKRICSLMDVKKLSTDACLHAAQNERLPLRVVVQVLFFEQMRATASGLTAST----  494

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
                 N   +G +RS     EE W   A  + L + K +L  L++     +D+       
Sbjct  495  -----NDTLHGRTRS-RANVEEFWKRPA-PENLTSAKKQLGNLKVEEECWSDKGKKSNRD  547

Query  434  TVASSDKAAAISKMKGLLV---SKRIFSKIWsskggngensgsdsseslgSTT---MEEA  273
               S DK        GLL+   S+RI  K W  KG     S   S  S    T   + EA
Sbjct  548  ---SKDKGG------GLLLQSRSRRILDKFWVGKGHRENKSSETSGSSQSPPTSAKLGEA  598

Query  272  KS--TPSRKGRYSVS  234
            KS  T SR+ RYSVS
Sbjct  599  KSSGTSSRQRRYSVS  613



>ref|XP_007011710.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 gb|EOY29329.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
Length=645

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 90/149 (60%), Gaps = 20/149 (13%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +K+ERK++C LMD KK + DA MHA QNERLPLRVVVQVLFFEQVRA A+   S  + P+
Sbjct  472  TKAERKKLCGLMDVKKFTMDASMHAAQNERLPLRVVVQVLFFEQVRA-AAGVQSLANNPR  530

Query  614  AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTTK  435
             I             +TT T+E+W+  A A++  +LK +++ +++   G   + NG   K
Sbjct  531  DIS-----------HSTTNTDEEWEKTA-AEDCNSLKKQMSQMKVKEDGF--QKNGKLAK  576

Query  434  TVASSDKAAAISKMKGLLV-SKRIFSKIW  351
              + + K    S M+ L   S+RIF K+W
Sbjct  577  KNSKNSK----SGMQLLPSRSRRIFDKLW  601



>ref|XP_008221906.1| PREDICTED: BTB/POZ domain-containing protein At1g67900 [Prunus 
mume]
Length=631

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 89/156 (57%), Gaps = 14/156 (9%)
 Frame = -3

Query  794  SKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPK  615
            +KSERKR+CR++DCKKLS +ACMHA QNE LPLRVVVQVLFFEQ RA  + G  T +LP 
Sbjct  471  NKSERKRLCRILDCKKLSMEACMHAAQNELLPLRVVVQVLFFEQARAAMAGGKVT-ELPS  529

Query  614  AIKDL----NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANG  447
             I+ L    N          +T++    D   S   L++ + +++ LR+  A      + 
Sbjct  530  NIRALLATHNIDPSRPPAPLSTSSLMPADDQWSVSGLKSPRSKMSTLRMKLA-----EDD  584

Query  446  DTTKTVASSDKAAAISKMKGLLV----SKRIFSKIW  351
            D  +   + D     SK+K L +     KR+FSK+W
Sbjct  585  DLDENDLNPDGIGRSSKLKALCLLPARPKRMFSKLW  620



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1566999573790