BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF012P04

Length=724
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009779466.1|  PREDICTED: receptor-like protein kinase HSL1       211   6e-59   Nicotiana sylvestris
ref|XP_009587881.1|  PREDICTED: receptor-like protein kinase HSL1       210   2e-58   Nicotiana tomentosiformis
ref|XP_004245143.1|  PREDICTED: receptor-like protein kinase HSL1       200   5e-55   Solanum lycopersicum
ref|XP_011093340.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    199   9e-55   Sesamum indicum [beniseed]
ref|XP_006366693.1|  PREDICTED: receptor-like protein kinase HSL1...    199   2e-54   Solanum tuberosum [potatoes]
ref|XP_008220120.1|  PREDICTED: receptor-like protein kinase HSL1       186   7e-50   Prunus mume [ume]
ref|XP_009350259.1|  PREDICTED: receptor-like protein kinase HSL1       184   4e-49   Pyrus x bretschneideri [bai li]
gb|EYU29298.1|  hypothetical protein MIMGU_mgv1a000685mg                184   4e-49   Erythranthe guttata [common monkey flower]
ref|XP_007225351.1|  hypothetical protein PRUPE_ppa000941mg             182   1e-48   
emb|CDP08193.1|  unnamed protein product                                182   2e-48   Coffea canephora [robusta coffee]
gb|KCW81624.1|  hypothetical protein EUGRSUZ_C02985                     179   7e-48   Eucalyptus grandis [rose gum]
ref|XP_004291157.1|  PREDICTED: receptor-like protein kinase 5          179   1e-47   Fragaria vesca subsp. vesca
ref|XP_008377967.1|  PREDICTED: receptor-like protein kinase HSL1       179   2e-47   
ref|XP_010049140.1|  PREDICTED: receptor-like protein kinase HSL1       179   2e-47   Eucalyptus grandis [rose gum]
ref|XP_006450731.1|  hypothetical protein CICLE_v10010761mg             178   3e-47   
gb|KDO79911.1|  hypothetical protein CISIN_1g001706mg                   178   4e-47   Citrus sinensis [apfelsine]
gb|KDO79910.1|  hypothetical protein CISIN_1g001706mg                   178   4e-47   Citrus sinensis [apfelsine]
ref|XP_006475995.1|  PREDICTED: receptor-like protein kinase HSL1...    178   4e-47   Citrus sinensis [apfelsine]
emb|CBI20590.3|  unnamed protein product                                164   2e-46   Vitis vinifera
ref|XP_009367420.1|  PREDICTED: receptor-like protein kinase HSL1       174   1e-45   Pyrus x bretschneideri [bai li]
gb|KDP34178.1|  hypothetical protein JCGZ_07749                         172   6e-45   Jatropha curcas
ref|XP_010668734.1|  PREDICTED: receptor-like protein kinase HSL1       170   3e-44   
ref|XP_010095459.1|  Receptor-like protein kinase HSL1                  169   8e-44   Morus notabilis
ref|XP_010267130.1|  PREDICTED: receptor-like protein kinase HSL1       169   9e-44   Nelumbo nucifera [Indian lotus]
ref|XP_002309529.2|  leucine-rich repeat family protein                 166   1e-42   
ref|XP_010668729.1|  PREDICTED: receptor-like protein kinase HSL1       164   3e-42   
ref|XP_010648290.1|  PREDICTED: receptor-like protein kinase 5 is...    163   5e-42   Vitis vinifera
ref|XP_002516533.1|  serine-threonine protein kinase, plant-type,...    163   7e-42   Ricinus communis
ref|XP_002278306.2|  PREDICTED: receptor-like protein kinase 5 is...    163   7e-42   Vitis vinifera
ref|XP_010648291.1|  PREDICTED: receptor-like protein kinase HSL1       162   1e-41   Vitis vinifera
emb|CAN80774.1|  hypothetical protein VITISV_042330                     162   2e-41   Vitis vinifera
ref|XP_004148398.1|  PREDICTED: receptor-like protein kinase HSL1...    161   3e-41   
ref|XP_004164767.1|  PREDICTED: receptor-like protein kinase HSL1...    161   3e-41   
gb|KJB54767.1|  hypothetical protein B456_009G048200                    160   4e-41   Gossypium raimondii
ref|XP_002324752.1|  leucine-rich repeat family protein                 161   4e-41   Populus trichocarpa [western balsam poplar]
ref|XP_008444991.1|  PREDICTED: receptor-like protein kinase HSL1       160   4e-41   Cucumis melo [Oriental melon]
gb|KJB54766.1|  hypothetical protein B456_009G048200                    160   5e-41   Gossypium raimondii
gb|KJB65638.1|  hypothetical protein B456_010G104300                    160   9e-41   Gossypium raimondii
gb|KHG24857.1|  Receptor-like protein kinase HSL1                       160   9e-41   Gossypium arboreum [tree cotton]
ref|XP_007012181.1|  Kinase family protein with leucine-rich repe...    159   1e-40   
emb|CBI20587.3|  unnamed protein product                                155   3e-39   Vitis vinifera
ref|XP_011010886.1|  PREDICTED: receptor-like protein kinase HSL1...    155   5e-39   Populus euphratica
ref|XP_011010885.1|  PREDICTED: receptor-like protein kinase HSL1...    155   6e-39   Populus euphratica
emb|CBI20588.3|  unnamed protein product                                152   5e-38   Vitis vinifera
ref|XP_007137253.1|  hypothetical protein PHAVU_009G112200g             150   1e-37   Phaseolus vulgaris [French bean]
ref|XP_011019562.1|  PREDICTED: receptor-like protein kinase HSL1       150   2e-37   Populus euphratica
ref|XP_010278042.1|  PREDICTED: receptor-like protein kinase 5          150   3e-37   Nelumbo nucifera [Indian lotus]
ref|XP_003619786.1|  Receptor-like protein kinase                       147   2e-36   Medicago truncatula
ref|XP_008390812.1|  PREDICTED: receptor-like protein kinase HSL1       147   2e-36   
ref|XP_010249486.1|  PREDICTED: receptor-like protein kinase HSL1       147   2e-36   Nelumbo nucifera [Indian lotus]
ref|XP_004512685.1|  PREDICTED: receptor-like protein kinase HSL1...    146   3e-36   Cicer arietinum [garbanzo]
gb|KHN40381.1|  LRR receptor-like serine/threonine-protein kinase...    146   3e-36   Glycine soja [wild soybean]
emb|CBI20585.3|  unnamed protein product                                141   3e-36   Vitis vinifera
ref|XP_002278223.1|  PREDICTED: receptor-like protein kinase HSL1       147   4e-36   Vitis vinifera
ref|XP_003517639.1|  PREDICTED: receptor-like protein kinase HSL1...    147   4e-36   Glycine max [soybeans]
ref|XP_004513049.1|  PREDICTED: receptor-like protein kinase HSL1...    146   4e-36   
ref|XP_003533283.1|  PREDICTED: receptor-like protein kinase HSL1...    146   4e-36   Glycine max [soybeans]
ref|XP_004513050.1|  PREDICTED: receptor-like protein kinase HSL1...    146   5e-36   
ref|XP_004512684.1|  PREDICTED: receptor-like protein kinase HSL1...    146   5e-36   Cicer arietinum [garbanzo]
ref|XP_010106712.1|  Receptor-like protein kinase HSL1                  146   5e-36   
gb|KHN10176.1|  Leucine-rich repeat receptor-like protein kinase ...    138   6e-36   Glycine soja [wild soybean]
ref|XP_004245388.2|  PREDICTED: receptor-like protein kinase 2          145   6e-36   Solanum lycopersicum
ref|XP_003549165.1|  PREDICTED: receptor-like protein kinase HSL1...    145   8e-36   Glycine max [soybeans]
ref|XP_004288894.1|  PREDICTED: receptor-like protein kinase HSL1       145   1e-35   Fragaria vesca subsp. vesca
gb|KHG19858.1|  Receptor-like protein kinase HSL1                       145   1e-35   Gossypium arboreum [tree cotton]
ref|XP_003631769.1|  PREDICTED: receptor-like protein kinase HSL1       145   1e-35   Vitis vinifera
emb|CBI20586.3|  unnamed protein product                                144   1e-35   Vitis vinifera
gb|KEH27213.1|  leucine-rich receptor-like kinase family protein        145   2e-35   Medicago truncatula
ref|XP_003548596.1|  PREDICTED: receptor-like protein kinase HSL1...    145   2e-35   Glycine max [soybeans]
gb|KHN16978.1|  Receptor-like protein kinase HSL1                       145   2e-35   Glycine soja [wild soybean]
ref|XP_006596181.1|  PREDICTED: receptor-like protein kinase HSL1...    144   4e-35   Glycine max [soybeans]
ref|XP_002441406.1|  hypothetical protein SORBIDRAFT_09g026090          143   7e-35   Sorghum bicolor [broomcorn]
gb|KHM99760.1|  LRR receptor-like serine/threonine-protein kinase...    142   7e-35   Glycine soja [wild soybean]
gb|KDP33797.1|  hypothetical protein JCGZ_07368                         142   1e-34   Jatropha curcas
emb|CBI27997.3|  unnamed protein product                                141   1e-34   Vitis vinifera
ref|XP_007152973.1|  hypothetical protein PHAVU_004G175900g             142   1e-34   Phaseolus vulgaris [French bean]
ref|XP_004287478.1|  PREDICTED: receptor-like protein kinase HSL1       142   1e-34   Fragaria vesca subsp. vesca
ref|XP_008390801.1|  PREDICTED: receptor-like protein kinase 5          140   2e-34   
ref|XP_010110882.1|  Receptor-like protein kinase HSL1                  142   2e-34   
gb|KHN18142.1|  Receptor-like protein kinase HSL1                       141   2e-34   Glycine soja [wild soybean]
gb|KJB07471.1|  hypothetical protein B456_001G026000                    142   2e-34   Gossypium raimondii
emb|CDX80548.1|  BnaC07g28960D                                          141   2e-34   
ref|XP_008354538.1|  PREDICTED: receptor-like protein kinase HSL1       141   2e-34   
emb|CAN69391.1|  hypothetical protein VITISV_000950                     141   2e-34   Vitis vinifera
ref|XP_003527853.1|  PREDICTED: receptor-like protein kinase HSL1...    141   3e-34   Glycine max [soybeans]
ref|XP_002280395.1|  PREDICTED: receptor-like protein kinase 5          141   3e-34   Vitis vinifera
ref|XP_010047666.1|  PREDICTED: leucine-rich repeat receptor-like...    133   3e-34   
emb|CDY05337.1|  BnaC02g40450D                                          141   3e-34   
ref|XP_010648289.1|  PREDICTED: receptor-like protein kinase HSL1       141   3e-34   
ref|XP_009627680.1|  PREDICTED: receptor-like protein kinase 5          141   4e-34   Nicotiana tomentosiformis
ref|XP_004501091.1|  PREDICTED: receptor-like protein kinase HSL1...    141   4e-34   
emb|CDX80547.1|  BnaC07g28970D                                          140   4e-34   
ref|XP_007152971.1|  hypothetical protein PHAVU_004G175700g             140   5e-34   Phaseolus vulgaris [French bean]
ref|XP_008362962.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    140   5e-34   
ref|XP_007152972.1|  hypothetical protein PHAVU_004G175800g             140   6e-34   Phaseolus vulgaris [French bean]
ref|XP_003603644.1|  Receptor-like protein kinase                       140   6e-34   Medicago truncatula
ref|XP_006364731.1|  PREDICTED: leucine-rich repeat receptor-like...    139   6e-34   
ref|XP_010095356.1|  Leucine-rich repeat receptor-like protein ki...    131   7e-34   
ref|XP_009759980.1|  PREDICTED: receptor-like protein kinase 5          140   8e-34   Nicotiana sylvestris
gb|KEH27215.1|  leucine-rich receptor-like kinase family protein        140   1e-33   Medicago truncatula
emb|CDY05509.1|  BnaA02g31820D                                          139   1e-33   
gb|KCW79626.1|  hypothetical protein EUGRSUZ_C00986                     139   1e-33   Eucalyptus grandis [rose gum]
ref|XP_004513051.1|  PREDICTED: receptor-like protein kinase HSL1...    139   1e-33   Cicer arietinum [garbanzo]
gb|KCW79628.1|  hypothetical protein EUGRSUZ_C00987                     139   1e-33   Eucalyptus grandis [rose gum]
ref|XP_008242544.1|  PREDICTED: receptor-like protein kinase HSL1       140   2e-33   
ref|XP_010047669.1|  PREDICTED: receptor-like protein kinase 5          139   2e-33   Eucalyptus grandis [rose gum]
ref|XP_011078243.1|  PREDICTED: receptor-like protein kinase HSL1       139   2e-33   Sesamum indicum [beniseed]
ref|XP_007152512.1|  hypothetical protein PHAVU_004G136500g             139   2e-33   Phaseolus vulgaris [French bean]
gb|KCW79120.1|  hypothetical protein EUGRSUZ_C00561                     138   2e-33   Eucalyptus grandis [rose gum]
gb|KCW79629.1|  hypothetical protein EUGRSUZ_C00988                     138   2e-33   Eucalyptus grandis [rose gum]
ref|XP_010047671.1|  PREDICTED: receptor-like protein kinase 5          139   2e-33   Eucalyptus grandis [rose gum]
ref|XP_010050387.1|  PREDICTED: receptor-like protein kinase 5          138   3e-33   
gb|KHN40380.1|  Receptor-like protein kinase HSL1                       138   3e-33   Glycine soja [wild soybean]
ref|XP_003523755.1|  PREDICTED: receptor-like protein kinase HSL1...    138   3e-33   Glycine max [soybeans]
ref|XP_003516786.2|  PREDICTED: receptor-like protein kinase 5-like     138   3e-33   Glycine max [soybeans]
ref|XP_010047673.1|  PREDICTED: receptor-like protein kinase 5          138   3e-33   Eucalyptus grandis [rose gum]
ref|XP_010047253.1|  PREDICTED: LRR receptor-like serine/threonin...    138   4e-33   Eucalyptus grandis [rose gum]
ref|XP_004288893.1|  PREDICTED: receptor-like protein kinase HSL1       138   4e-33   Fragaria vesca subsp. vesca
ref|XP_011007101.1|  PREDICTED: receptor-like protein kinase 5          138   4e-33   Populus euphratica
ref|XP_007203859.1|  hypothetical protein PRUPE_ppa022167mg             138   4e-33   
ref|XP_010421450.1|  PREDICTED: receptor-like protein kinase 5          138   4e-33   Camelina sativa [gold-of-pleasure]
ref|XP_009795019.1|  PREDICTED: receptor-like protein kinase HSL1       138   5e-33   Nicotiana sylvestris
ref|XP_008242546.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    138   5e-33   
ref|XP_009601880.1|  PREDICTED: receptor-like protein kinase 5          137   5e-33   Nicotiana tomentosiformis
ref|XP_010047254.1|  PREDICTED: receptor-like protein kinase 5          137   5e-33   Eucalyptus grandis [rose gum]
ref|XP_010047668.1|  PREDICTED: receptor-like protein kinase 5          137   5e-33   Eucalyptus grandis [rose gum]
emb|CBI39978.3|  unnamed protein product                                137   6e-33   Vitis vinifera
ref|XP_010536218.1|  PREDICTED: receptor-like protein kinase HSL1       137   6e-33   Tarenaya hassleriana [spider flower]
ref|XP_010661160.1|  PREDICTED: receptor-like protein kinase HSL1       137   7e-33   Vitis vinifera
gb|KDP33799.1|  hypothetical protein JCGZ_07370                         137   7e-33   Jatropha curcas
ref|XP_006394841.1|  hypothetical protein EUTSA_v10003585mg             137   7e-33   Eutrema salsugineum [saltwater cress]
ref|XP_010519875.1|  PREDICTED: receptor-like protein kinase 5          137   7e-33   Tarenaya hassleriana [spider flower]
ref|XP_010454934.1|  PREDICTED: receptor-like protein kinase 5          137   9e-33   Camelina sativa [gold-of-pleasure]
ref|XP_009151111.1|  PREDICTED: receptor-like protein kinase 5          137   9e-33   Brassica rapa
ref|NP_197965.1|  protein kinase family protein with leucine-rich...    137   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872190.1|  leucine-rich repeat family protein                 137   1e-32   
ref|XP_006372068.1|  hypothetical protein POPTR_0018s09520g             136   1e-32   
ref|XP_010915378.1|  PREDICTED: receptor-like protein kinase HSL1       136   1e-32   Elaeis guineensis
ref|XP_008649910.1|  PREDICTED: receptor-like protein kinase HSL1       136   2e-32   Zea mays [maize]
ref|XP_010493845.1|  PREDICTED: receptor-like protein kinase 5 is...    136   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_002324453.1|  hypothetical protein POPTR_0018s09510g             136   2e-32   
ref|XP_010050476.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    135   2e-32   
ref|XP_010050391.1|  PREDICTED: receptor-like protein kinase 5          135   2e-32   Eucalyptus grandis [rose gum]
ref|XP_002324455.2|  hypothetical protein POPTR_0018s09540g             135   2e-32   
ref|XP_007203495.1|  hypothetical protein PRUPE_ppa022516mg             135   2e-32   
ref|XP_002324456.2|  hypothetical protein POPTR_0018s09550g             135   2e-32   
ref|XP_009619690.1|  PREDICTED: receptor-like protein kinase 5 is...    135   2e-32   
ref|XP_003548595.1|  PREDICTED: receptor-like protein kinase 5-like     135   3e-32   Glycine max [soybeans]
gb|KHN16977.1|  Receptor-like protein kinase HSL1                       135   3e-32   Glycine soja [wild soybean]
gb|KCW79123.1|  hypothetical protein EUGRSUZ_C00564                     135   3e-32   Eucalyptus grandis [rose gum]
ref|XP_007204807.1|  hypothetical protein PRUPE_ppa019571mg             135   3e-32   Prunus persica
ref|XP_006286985.1|  hypothetical protein CARUB_v10000132mg             135   3e-32   Capsella rubella
ref|XP_008242543.1|  PREDICTED: receptor-like protein kinase HSL1       135   4e-32   
ref|XP_009151112.1|  PREDICTED: receptor-like protein kinase 5          135   4e-32   Brassica rapa
gb|KFK26382.1|  hypothetical protein AALP_AA8G241000                    135   4e-32   Arabis alpina [alpine rockcress]
ref|XP_010047672.1|  PREDICTED: receptor-like protein kinase 5          134   6e-32   Eucalyptus grandis [rose gum]
ref|XP_009600836.1|  PREDICTED: receptor-like protein kinase 5          130   7e-32   Nicotiana tomentosiformis
gb|EYU30701.1|  hypothetical protein MIMGU_mgv1a000689mg                134   9e-32   Erythranthe guttata [common monkey flower]
emb|CDX88206.1|  BnaA06g27970D                                          134   1e-31   
ref|XP_004245385.2|  PREDICTED: LRR receptor-like serine/threonin...    132   2e-31   
ref|XP_007203222.1|  hypothetical protein PRUPE_ppa000737mg             133   2e-31   Prunus persica
emb|CBI20580.3|  unnamed protein product                                134   2e-31   Vitis vinifera
ref|XP_011008121.1|  PREDICTED: receptor-like protein kinase 5          133   2e-31   Populus euphratica
ref|XP_011014419.1|  PREDICTED: receptor-like protein kinase 5          133   2e-31   Populus euphratica
ref|XP_004961447.1|  PREDICTED: receptor-like protein kinase HSL1...    133   3e-31   Setaria italica
emb|CBI20579.3|  unnamed protein product                                132   3e-31   Vitis vinifera
ref|XP_004251639.1|  PREDICTED: receptor-like protein kinase 5          132   3e-31   Solanum lycopersicum
gb|KDP33800.1|  hypothetical protein JCGZ_07371                         132   3e-31   Jatropha curcas
emb|CDP03253.1|  unnamed protein product                                132   3e-31   Coffea canephora [robusta coffee]
emb|CDP03251.1|  unnamed protein product                                132   3e-31   Coffea canephora [robusta coffee]
gb|KCW79613.1|  hypothetical protein EUGRSUZ_C00967                     132   5e-31   Eucalyptus grandis [rose gum]
ref|XP_006451306.1|  hypothetical protein CICLE_v10007383mg             132   5e-31   
gb|KCW79622.1|  hypothetical protein EUGRSUZ_C00979                     132   5e-31   Eucalyptus grandis [rose gum]
ref|XP_006364729.1|  PREDICTED: receptor-like protein kinase 5-like     131   5e-31   Solanum tuberosum [potatoes]
ref|XP_006475586.1|  PREDICTED: receptor-like protein kinase 5-like     132   5e-31   Citrus sinensis [apfelsine]
gb|KDO66581.1|  hypothetical protein CISIN_1g001778mg                   132   5e-31   Citrus sinensis [apfelsine]
ref|XP_011007104.1|  PREDICTED: receptor-like protein kinase HSL1       132   6e-31   Populus euphratica
gb|KCW79119.1|  hypothetical protein EUGRSUZ_C00560                     131   7e-31   Eucalyptus grandis [rose gum]
ref|XP_002456337.1|  hypothetical protein SORBIDRAFT_03g034220          131   7e-31   Sorghum bicolor [broomcorn]
gb|EAY98740.1|  hypothetical protein OsI_20670                          131   8e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_010050386.1|  PREDICTED: receptor-like protein kinase 5          131   9e-31   Eucalyptus grandis [rose gum]
emb|CBI20582.3|  unnamed protein product                                124   1e-30   Vitis vinifera
ref|XP_008337667.1|  PREDICTED: receptor-like protein kinase HSL1       131   1e-30   
ref|XP_010325071.1|  PREDICTED: LRR receptor-like serine/threonin...    130   1e-30   Solanum lycopersicum
gb|KEH27208.1|  LRR receptor-like kinase family protein                 130   2e-30   Medicago truncatula
emb|CBI20633.3|  unnamed protein product                                130   2e-30   Vitis vinifera
ref|XP_006655502.1|  PREDICTED: receptor-like protein kinase 5-like     130   2e-30   
ref|XP_002278863.1|  PREDICTED: receptor-like protein kinase HSL1       130   2e-30   Vitis vinifera
ref|XP_010669046.1|  PREDICTED: receptor-like protein kinase HSL1       130   2e-30   Beta vulgaris subsp. vulgaris [field beet]
gb|AAV44033.1|  putative protein kinase                                 130   2e-30   Oryza sativa Japonica Group [Japonica rice]
gb|EEE64410.1|  hypothetical protein OsJ_19254                          130   2e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009803852.1|  PREDICTED: receptor-like protein kinase HSL1       129   3e-30   Nicotiana sylvestris
ref|XP_006364718.1|  PREDICTED: receptor-like protein kinase HSL1...    124   4e-30   
ref|XP_011008125.1|  PREDICTED: inactive protein kinase SELMODRAF...    121   4e-30   Populus euphratica
ref|XP_010519877.1|  PREDICTED: receptor-like protein kinase 5          129   6e-30   Tarenaya hassleriana [spider flower]
ref|XP_009352556.1|  PREDICTED: receptor-like protein kinase HSL1       129   6e-30   Pyrus x bretschneideri [bai li]
ref|XP_004972171.1|  PREDICTED: receptor-like protein kinase HSL1...    129   6e-30   
ref|XP_010917300.1|  PREDICTED: receptor-like protein kinase 5          126   6e-30   
ref|XP_006353495.1|  PREDICTED: receptor-like protein kinase 5-like     128   7e-30   
ref|XP_010917293.1|  PREDICTED: receptor-like protein kinase 5          127   8e-30   Elaeis guineensis
ref|XP_010925541.1|  PREDICTED: receptor-like protein kinase HSL1       128   9e-30   Elaeis guineensis
dbj|BAJ93662.1|  predicted protein                                      127   2e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW79616.1|  hypothetical protein EUGRSUZ_C009702                    124   2e-29   Eucalyptus grandis [rose gum]
ref|XP_010915380.1|  PREDICTED: receptor-like protein kinase HSL1       127   2e-29   Elaeis guineensis
ref|XP_008794105.1|  PREDICTED: receptor-like protein kinase 5          127   3e-29   Phoenix dactylifera
ref|XP_009416472.1|  PREDICTED: receptor-like protein kinase HSL1       127   3e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS60554.1|  Leucine-rich repeat receptor-like protein kinase ...    126   5e-29   Triticum urartu
gb|KCW79124.1|  hypothetical protein EUGRSUZ_C00565                     123   5e-29   Eucalyptus grandis [rose gum]
ref|XP_004288943.1|  PREDICTED: receptor-like protein kinase HSL1       126   5e-29   Fragaria vesca subsp. vesca
ref|XP_002456336.1|  hypothetical protein SORBIDRAFT_03g034210          124   6e-29   
gb|KJB54274.1|  hypothetical protein B456_009G027700                    126   6e-29   Gossypium raimondii
tpg|DAA57705.1|  TPA: putative leucine-rich repeat receptor-like ...    125   7e-29   
ref|XP_008789188.1|  PREDICTED: receptor-like protein kinase HSL1       125   7e-29   Phoenix dactylifera
ref|XP_006364719.1|  PREDICTED: receptor-like protein kinase HSL1...    124   8e-29   
gb|KCW79630.1|  hypothetical protein EUGRSUZ_C00989                     125   1e-28   Eucalyptus grandis [rose gum]
ref|XP_003566022.1|  PREDICTED: receptor-like protein kinase HSL1       125   1e-28   Brachypodium distachyon [annual false brome]
ref|XP_008778616.1|  PREDICTED: receptor-like protein kinase 5          123   2e-28   
ref|XP_009415677.1|  PREDICTED: receptor-like protein kinase HSL1       124   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI20584.3|  unnamed protein product                                121   2e-28   Vitis vinifera
ref|XP_004135674.1|  PREDICTED: receptor-like protein kinase 5-like     119   3e-28   
emb|CDP08192.1|  unnamed protein product                                122   3e-28   Coffea canephora [robusta coffee]
ref|XP_010232300.1|  PREDICTED: receptor-like protein kinase 5          124   3e-28   Brachypodium distachyon [annual false brome]
ref|XP_006364730.1|  PREDICTED: probable LRR receptor-like serine...    123   3e-28   
gb|EAY75774.1|  hypothetical protein OsI_03690                          124   4e-28   Oryza sativa Indica Group [Indian rice]
gb|KCW79619.1|  hypothetical protein EUGRSUZ_C00974                     123   4e-28   Eucalyptus grandis [rose gum]
ref|XP_002442937.1|  hypothetical protein SORBIDRAFT_08g005070          123   4e-28   
gb|EMS55978.1|  Receptor-like protein kinase HSL1                       122   5e-28   Triticum urartu
gb|KCW79121.1|  hypothetical protein EUGRSUZ_C00562                     123   5e-28   Eucalyptus grandis [rose gum]
ref|NP_001044213.1|  Os01g0742400                                       123   5e-28   
gb|EAZ13493.1|  hypothetical protein OsJ_03409                          123   5e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010911143.1|  PREDICTED: receptor-like protein kinase 5          117   5e-28   Elaeis guineensis
ref|XP_006644690.1|  PREDICTED: receptor-like protein kinase 5-like     122   8e-28   
ref|XP_007013026.1|  Kinase family protein with leucine-rich repe...    122   9e-28   
ref|XP_002442938.1|  hypothetical protein SORBIDRAFT_08g005090          122   1e-27   
ref|XP_011081744.1|  PREDICTED: receptor-like protein kinase 5          121   1e-27   Sesamum indicum [beniseed]
gb|EMS35768.1|  Leucine-rich repeat receptor-like serine/threonin...    114   1e-27   Triticum urartu
ref|XP_008450784.1|  PREDICTED: receptor-like protein kinase 5          122   2e-27   Cucumis melo [Oriental melon]
ref|XP_009415190.1|  PREDICTED: receptor-like protein kinase HSL1       121   3e-27   
ref|XP_004969910.1|  PREDICTED: leucine-rich repeat receptor-like...    120   6e-27   Setaria italica
gb|KGN66180.1|  hypothetical protein Csa_1G574960                       120   8e-27   Cucumis sativus [cucumbers]
ref|XP_002514220.1|  serine-threonine protein kinase, plant-type,...    119   8e-27   
ref|XP_006853707.1|  hypothetical protein AMTR_s00056p00148740          119   8e-27   Amborella trichopoda
ref|XP_004157305.1|  PREDICTED: receptor-like protein kinase 5-like     120   9e-27   
gb|EAZ01332.1|  hypothetical protein OsI_23363                          119   1e-26   Oryza sativa Indica Group [Indian rice]
emb|CAN80773.1|  hypothetical protein VITISV_042329                     116   1e-26   Vitis vinifera
ref|XP_008242547.1|  PREDICTED: LRR receptor-like serine/threonin...    119   1e-26   
ref|NP_001057858.1|  Os06g0557100                                       119   1e-26   
gb|AFW56261.1|  putative leucine-rich repeat receptor-like protei...    117   2e-26   
ref|XP_010924677.1|  PREDICTED: receptor-like protein kinase HSL1       118   3e-26   
ref|XP_007013028.1|  Kinase family protein with leucine-rich repe...    118   3e-26   
ref|XP_007013027.1|  Kinase family protein with leucine-rich repe...    118   3e-26   
ref|XP_008780630.1|  PREDICTED: leucine-rich repeat receptor-like...    110   5e-26   Phoenix dactylifera
gb|EMT24435.1|  Receptor-like protein kinase HSL1                       117   6e-26   
ref|XP_009628518.1|  PREDICTED: receptor protein kinase CLAVATA1-...    116   6e-26   Nicotiana tomentosiformis
ref|XP_004965613.1|  PREDICTED: receptor-like protein kinase 5-like     117   6e-26   Setaria italica
ref|XP_003571136.1|  PREDICTED: receptor-like protein kinase 5          117   6e-26   Brachypodium distachyon [annual false brome]
ref|XP_002437153.1|  hypothetical protein SORBIDRAFT_10g022060          116   1e-25   Sorghum bicolor [broomcorn]
gb|EMS68150.1|  Receptor-like protein kinase HSL1                       116   1e-25   Triticum urartu
ref|XP_003563758.1|  PREDICTED: receptor-like protein kinase 5          116   1e-25   Brachypodium distachyon [annual false brome]
ref|XP_010050472.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    116   1e-25   
ref|XP_009628517.1|  PREDICTED: LRR receptor-like serine/threonin...    115   1e-25   Nicotiana tomentosiformis
ref|XP_009628514.1|  PREDICTED: receptor-like protein kinase 2 is...    115   2e-25   Nicotiana tomentosiformis
gb|EMT17967.1|  LRR receptor-like serine/threonine-protein kinase...    115   2e-25   
dbj|BAJ90890.1|  predicted protein                                      111   3e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001046354.2|  Os02g0227700                                       106   9e-25   
ref|XP_010050392.1|  PREDICTED: receptor-like protein kinase 5          113   1e-24   
gb|EAY85056.1|  hypothetical protein OsI_06414                          112   1e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_006656162.1|  PREDICTED: receptor-like protein kinase 5-like     113   1e-24   Oryza brachyantha
gb|EAY85054.1|  hypothetical protein OsI_06413                          112   2e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_004969911.1|  PREDICTED: receptor-like protein kinase HSL1...    113   2e-24   
emb|CDM84035.1|  unnamed protein product                                112   2e-24   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009415678.1|  PREDICTED: receptor-like protein kinase 5          112   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010050388.1|  PREDICTED: receptor-like protein kinase 5          112   2e-24   
ref|XP_008649140.1|  PREDICTED: receptor-like protein kinase 5          112   3e-24   Zea mays [maize]
gb|EMT29725.1|  LRR receptor-like serine/threonine-protein kinase...    110   3e-24   
dbj|BAD17641.1|  putative CLAVATA1 receptor kinase                      112   3e-24   Oryza sativa Japonica Group [Japonica rice]
gb|KCW79122.1|  hypothetical protein EUGRSUZ_C00563                     111   5e-24   Eucalyptus grandis [rose gum]
dbj|BAD17639.1|  putative CLAVATA1 receptor kinase                      111   6e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008659674.1|  PREDICTED: receptor-like protein kinase 5          111   6e-24   Zea mays [maize]
dbj|BAJ99550.1|  predicted protein                                      110   1e-23   
gb|EAZ22277.1|  hypothetical protein OsJ_05933                          110   1e-23   
dbj|BAD25862.1|  putative LRR receptor-like kinase                      110   2e-23   
gb|KEH27211.1|  LRR receptor-like kinase family protein                 109   2e-23   
ref|XP_010042505.1|  PREDICTED: receptor-like protein kinase 5          107   4e-23   
ref|XP_010910700.1|  PREDICTED: receptor-like protein kinase HSL1...    108   5e-23   
ref|NP_001046355.1|  Os02g0228300                                       108   8e-23   
gb|EAY85088.1|  hypothetical protein OsI_06443                          108   8e-23   
ref|XP_004954582.1|  PREDICTED: receptor-like protein kinase 5-like     107   2e-22   
gb|EAY85094.1|  hypothetical protein OsI_06446                          107   2e-22   
ref|XP_008679785.1|  PREDICTED: receptor-like protein kinase 5          106   3e-22   
ref|XP_006853706.1|  hypothetical protein AMTR_s00056p00148200        99.8    3e-22   
ref|XP_008657242.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    106   3e-22   
gb|ABF73316.1|  clavata-like receptor                                   105   5e-22   
ref|XP_010447946.1|  PREDICTED: leucine-rich repeat receptor-like...  98.6    9e-22   
ref|XP_002457041.1|  hypothetical protein SORBIDRAFT_03g000350          104   1e-21   
ref|XP_010924676.1|  PREDICTED: receptor-like protein kinase 5          103   2e-21   
gb|EMT08968.1|  Receptor protein kinase CLAVATA1                        101   2e-21   
ref|XP_004965611.1|  PREDICTED: receptor-like protein kinase 5-like     103   2e-21   
ref|XP_002437154.1|  hypothetical protein SORBIDRAFT_10g022070          100   3e-21   
ref|XP_002453620.1|  hypothetical protein SORBIDRAFT_04g009100          103   3e-21   
ref|XP_002451877.1|  hypothetical protein SORBIDRAFT_04g009110          102   9e-21   
ref|XP_008789980.1|  PREDICTED: receptor-like protein kinase HSL1       101   1e-20   
ref|XP_009381187.1|  PREDICTED: receptor-like protein kinase HSL1       101   1e-20   
gb|AEP14545.1|  clavata 1-like protein                                  101   1e-20   
ref|XP_009628516.1|  PREDICTED: receptor-like protein kinase 2 is...    100   2e-20   
gb|AEX11047.1|  hypothetical protein 0_1169_01                        94.0    3e-20   
ref|XP_010050474.1|  PREDICTED: receptor-like protein kinase 5          100   4e-20   
gb|AEP14546.1|  clavata 1-like protein                                  100   4e-20   
ref|XP_002965214.1|  hypothetical protein SELMODRAFT_83051            99.8    5e-20   
ref|XP_002962293.1|  hypothetical protein SELMODRAFT_77558            99.8    6e-20   
ref|XP_010050469.1|  PREDICTED: receptor-like protein kinase 5        99.8    6e-20   
ref|XP_010553669.1|  PREDICTED: receptor-like protein kinase HAIKU2   99.8    6e-20   
ref|XP_007159371.1|  hypothetical protein PHAVU_002G232600g           99.8    6e-20   
emb|CBI21904.3|  unnamed protein product                              93.2    6e-20   
ref|XP_010924441.1|  PREDICTED: receptor-like protein kinase 5        99.8    7e-20   
ref|XP_004505098.1|  PREDICTED: receptor-like protein kinase HSL1...  99.4    8e-20   
gb|EMT04436.1|  Receptor-like protein kinase 5                        94.4    8e-20   
gb|KJB69554.1|  hypothetical protein B456_011G030400                  99.4    8e-20   
ref|NP_001236440.1|  uncharacterized protein LOC100527209             92.8    8e-20   
ref|XP_010919346.1|  PREDICTED: receptor-like protein kinase HSL1     99.4    8e-20   
gb|KHN15495.1|  Receptor-like protein kinase HSL1                     99.0    9e-20   
ref|XP_006852580.1|  hypothetical protein AMTR_s00021p00211960        99.0    9e-20   
ref|XP_002451474.1|  hypothetical protein SORBIDRAFT_04g002520        96.7    9e-20   
ref|XP_003528467.1|  PREDICTED: receptor-like protein kinase HSL1...  99.0    9e-20   
gb|EMS53072.1|  Receptor-like protein kinase HSL1                     99.0    1e-19   
ref|XP_010443968.1|  PREDICTED: leucine-rich repeat receptor-like...  99.0    1e-19   
ref|XP_002526416.1|  serine-threonine protein kinase, plant-type,...  94.0    1e-19   
gb|EMT27407.1|  Receptor-like protein kinase HSL1                     98.2    1e-19   
ref|XP_010457382.1|  PREDICTED: leucine-rich repeat receptor-like...  98.6    1e-19   
ref|XP_006285784.1|  hypothetical protein CARUB_v10007258mg           98.6    2e-19   
ref|XP_004485839.1|  PREDICTED: receptor-like protein kinase HSL1...  98.2    2e-19   
emb|CDM82468.1|  unnamed protein product                              98.2    2e-19   
ref|XP_008455491.1|  PREDICTED: receptor-like protein kinase HSL1     98.2    2e-19   
ref|XP_004144606.1|  PREDICTED: receptor-like protein kinase HSL1...  98.2    2e-19   
ref|XP_004169267.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  98.2    2e-19   
ref|XP_011096363.1|  PREDICTED: receptor-like protein kinase HSL1     98.2    2e-19   
gb|KGN43475.1|  hypothetical protein Csa_7G039230                     98.2    2e-19   
gb|KJB57488.1|  hypothetical protein B456_009G166500                  98.2    2e-19   
gb|KHN08487.1|  Receptor-like protein kinase HSL1                     97.8    2e-19   
ref|XP_010483818.1|  PREDICTED: leucine-rich repeat receptor-like...  98.2    2e-19   
gb|KEH30979.1|  LRR receptor-like kinase                              98.2    2e-19   
gb|KHG18466.1|  Receptor-like protein kinase HSL1                     97.8    2e-19   
ref|XP_010916780.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  97.8    2e-19   
ref|XP_009335228.1|  PREDICTED: leucine-rich repeat receptor-like...  97.8    2e-19   
ref|NP_200956.1|  leucine-rich repeat receptor-like protein kinas...  97.8    2e-19   
ref|XP_006643977.1|  PREDICTED: receptor-like protein kinase HSL1...  97.8    2e-19   
ref|XP_002309766.2|  hypothetical protein POPTR_0007s01340g           97.8    2e-19   
dbj|BAJ96356.1|  predicted protein                                    97.8    3e-19   
ref|XP_010042345.1|  PREDICTED: receptor-like protein kinase 5        97.1    3e-19   
ref|XP_010447945.1|  PREDICTED: leucine-rich repeat receptor-like...  97.8    3e-19   
ref|XP_009421476.1|  PREDICTED: receptor-like protein kinase HSL1     97.8    3e-19   
ref|XP_010433191.1|  PREDICTED: leucine-rich repeat receptor-like...  97.8    3e-19   
ref|XP_010438416.1|  PREDICTED: leucine-rich repeat receptor-like...  97.8    3e-19   
ref|XP_010529317.1|  PREDICTED: leucine-rich repeat receptor-like...  97.8    3e-19   
ref|XP_004967337.1|  PREDICTED: receptor-like protein kinase HSL1...  97.4    3e-19   
ref|XP_006372760.1|  hypothetical protein POPTR_0017s04790g           97.4    3e-19   
ref|XP_003541722.1|  PREDICTED: receptor-like protein kinase HSL1...  97.4    3e-19   
gb|KHN01094.1|  Receptor-like protein kinase HSL1                     96.7    4e-19   
gb|KFK29405.1|  hypothetical protein AALP_AA7G129800                  97.1    4e-19   
ref|XP_003625388.1|  Receptor-like protein kinase                     97.1    4e-19   
ref|XP_004485648.1|  PREDICTED: receptor-like protein kinase HAIK...  97.1    4e-19   
ref|XP_007149806.1|  hypothetical protein PHAVU_005G100400g           97.1    5e-19   
ref|XP_010234069.1|  PREDICTED: receptor-like protein kinase HSL1     97.1    5e-19   
ref|XP_011043630.1|  PREDICTED: receptor-like protein kinase HSL1     97.1    5e-19   
ref|XP_006356981.1|  PREDICTED: leucine-rich repeat receptor-like...  97.1    5e-19   
ref|XP_002966807.1|  hypothetical protein SELMODRAFT_168561           96.7    6e-19   
ref|XP_002961203.1|  hypothetical protein SELMODRAFT_164315           96.7    6e-19   
ref|NP_001239710.1|  receptor-like protein kinase HSL1-like           96.3    6e-19   
ref|XP_003526261.1|  PREDICTED: receptor-like protein kinase HSL1...  96.7    6e-19   
ref|XP_002867439.1|  hypothetical protein ARALYDRAFT_328832           96.7    6e-19   
gb|KHN09963.1|  Receptor-like protein kinase HSL1                     96.3    6e-19   
emb|CDO99397.1|  unnamed protein product                              96.7    6e-19   
emb|CDY02141.1|  BnaA03g40260D                                        96.3    7e-19   
ref|XP_011100241.1|  PREDICTED: receptor-like protein kinase HSL1     96.7    7e-19   
ref|XP_007213694.1|  hypothetical protein PRUPE_ppa000813mg           96.3    7e-19   
ref|XP_007025532.1|  HAESA-like 1 isoform 1                           96.3    8e-19   
gb|EEC69150.1|  hypothetical protein OsI_38089                        92.8    8e-19   
gb|KCW47263.1|  hypothetical protein EUGRSUZ_K01060                   95.9    8e-19   
ref|XP_009136481.1|  PREDICTED: leucine-rich repeat receptor-like...  96.3    9e-19   
emb|CDY23065.1|  BnaC07g31220D                                        96.3    9e-19   
ref|XP_007148116.1|  hypothetical protein PHAVU_006G181800g           95.9    9e-19   
ref|XP_004229499.1|  PREDICTED: leucine-rich repeat receptor-like...  95.9    9e-19   
emb|CBI30615.3|  unnamed protein product                              95.5    9e-19   
ref|NP_194594.1|  putative leucine-rich repeat transmembrane prot...  95.9    1e-18   
gb|AES63900.2|  LRR receptor-like kinase family protein               95.9    1e-18   
gb|EAY73225.1|  hypothetical protein OsI_01100                        95.9    1e-18   
ref|NP_001042546.1|  Os01g0239700                                     95.9    1e-18   
emb|CDY35193.1|  BnaA01g08380D                                        92.8    1e-18   
ref|XP_004292244.2|  PREDICTED: leucine-rich repeat receptor-like...  96.3    1e-18   
gb|EAZ11200.1|  hypothetical protein OsJ_01050                        95.9    1e-18   
ref|XP_010035801.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  95.9    1e-18   
ref|XP_002517850.1|  Receptor protein kinase CLAVATA1 precursor, ...  95.9    1e-18   
ref|XP_011086036.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  95.9    1e-18   
ref|XP_002509423.1|  protein with unknown function                    95.9    1e-18   
ref|XP_008442870.1|  PREDICTED: receptor-like protein kinase HSL1     95.9    1e-18   
ref|XP_006394500.1|  hypothetical protein EUTSA_v10003570mg           95.9    1e-18   
ref|XP_006648474.1|  PREDICTED: receptor-like protein kinase HSL1...  95.9    1e-18   
ref|XP_006468213.1|  PREDICTED: receptor-like protein kinase HSL1...  95.9    1e-18   
ref|XP_010904898.1|  PREDICTED: receptor-like protein kinase HSL1     95.5    1e-18   
emb|CDY38373.1|  BnaC01g09820D                                        95.5    1e-18   
ref|XP_008783130.1|  PREDICTED: receptor-like protein kinase HSL1...  95.5    1e-18   
emb|CDY35204.1|  BnaA01g08270D                                        95.5    1e-18   
gb|KDO77710.1|  hypothetical protein CISIN_1g001867mg                 95.5    1e-18   
gb|KGN43819.1|  hypothetical protein Csa_7G069690                     95.5    1e-18   
ref|XP_006449414.1|  hypothetical protein CICLE_v10014138mg           95.5    1e-18   
ref|XP_004967562.1|  PREDICTED: LRR receptor-like serine/threonin...  94.0    1e-18   
ref|XP_009404418.1|  PREDICTED: receptor-like protein kinase HSL1     95.5    1e-18   
ref|XP_003593649.1|  Receptor-like protein kinase HSL1                95.5    1e-18   
emb|CDP04113.1|  unnamed protein product                              95.5    1e-18   
ref|XP_010260335.1|  PREDICTED: receptor-like protein kinase HSL1     95.5    1e-18   
ref|XP_009600411.1|  PREDICTED: leucine-rich repeat receptor-like...  95.5    2e-18   
emb|CAN77471.1|  hypothetical protein VITISV_029764                   95.5    2e-18   
ref|XP_010050389.1|  PREDICTED: receptor-like protein kinase HSL1     95.1    2e-18   
ref|XP_004951399.1|  PREDICTED: receptor-like protein kinase HSL1...  95.5    2e-18   
ref|XP_002278698.1|  PREDICTED: receptor-like protein kinase HSL1     95.5    2e-18   
ref|XP_006412927.1|  hypothetical protein EUTSA_v10024302mg           95.1    2e-18   
ref|XP_006348830.1|  PREDICTED: receptor-like protein kinase HSL1...  95.1    2e-18   
gb|KDP24078.1|  hypothetical protein JCGZ_25735                       95.1    2e-18   
ref|XP_003518489.2|  PREDICTED: leucine-rich repeat receptor-like...  95.1    2e-18   
ref|XP_008455077.1|  PREDICTED: receptor-like protein kinase HAIKU2   95.1    2e-18   
gb|KDO60347.1|  hypothetical protein CISIN_1g001752mg                 95.1    2e-18   
ref|XP_007225361.1|  hypothetical protein PRUPE_ppa000880mg           95.1    2e-18   
ref|XP_010536545.1|  PREDICTED: leucine-rich repeat receptor-like...  95.1    2e-18   
ref|XP_009352847.1|  PREDICTED: receptor-like protein kinase HSL1     95.1    2e-18   
ref|XP_006480075.1|  PREDICTED: leucine-rich repeat receptor-like...  95.1    2e-18   
ref|XP_009763204.1|  PREDICTED: leucine-rich repeat receptor-like...  94.7    2e-18   
ref|XP_008225155.1|  PREDICTED: receptor-like protein kinase HSL1     95.1    2e-18   
ref|XP_003566237.1|  PREDICTED: receptor-like protein kinase HSL1     95.1    2e-18   
ref|XP_002521777.1|  Receptor protein kinase CLAVATA1 precursor, ...  94.7    2e-18   
ref|XP_006443728.1|  hypothetical protein CICLE_v10023610mg           95.1    2e-18   
ref|XP_010245580.1|  PREDICTED: receptor-like protein kinase HSL1     94.7    2e-18   
ref|XP_004293793.1|  PREDICTED: receptor-like protein kinase HSL1     94.7    2e-18   
gb|KHN38370.1|  Leucine-rich repeat receptor-like serine/threonin...  94.7    3e-18   
ref|XP_011047703.1|  PREDICTED: receptor-like protein kinase HSL1     94.7    3e-18   
gb|AAC36318.1|  leucine-rich receptor-like protein kinase             94.7    3e-18   
ref|XP_003553510.2|  PREDICTED: leucine-rich repeat receptor-like...  94.7    3e-18   
gb|ABO61511.1|  LRR receptor-like protein kinase m1'                  94.7    3e-18   
ref|XP_008345968.1|  PREDICTED: receptor-like protein kinase HSL1     94.7    3e-18   
ref|XP_006279936.1|  hypothetical protein CARUB_v10025794mg           94.7    3e-18   
gb|AAT28307.1|  leucine-rich repeat receptor-like protein kinase      94.7    3e-18   
ref|XP_010036153.1|  PREDICTED: leucine-rich repeat receptor-like...  94.7    3e-18   
gb|ABO61514.1|  LRR receptor-like protein kinase m4                   94.4    3e-18   
ref|XP_006446707.1|  hypothetical protein CICLE_v10014127mg           94.7    3e-18   
gb|AAT28309.1|  leucine-rich repeat receptor-like protein kinase      94.4    3e-18   
gb|AAT28308.1|  leucine-rich repeat receptor-like protein kinase      94.4    3e-18   
ref|XP_008383683.1|  PREDICTED: receptor-like protein kinase HSL1     94.4    3e-18   
gb|ABO61513.1|  LRR receptor-like protein kinase m3                   94.4    3e-18   
ref|XP_004170874.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  94.4    3e-18   
ref|XP_009773822.1|  PREDICTED: receptor-like protein kinase HSL1...  94.4    3e-18   
ref|XP_009406257.1|  PREDICTED: receptor-like protein kinase HSL1     94.4    3e-18   
ref|XP_009344359.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  94.4    3e-18   
dbj|BAK02124.1|  predicted protein                                    94.4    4e-18   
ref|XP_009773821.1|  PREDICTED: receptor-like protein kinase HSL1...  94.0    4e-18   
gb|AFW71250.1|  putative leucine-rich repeat receptor-like protei...  94.4    4e-18   
ref|XP_002866438.1|  hypothetical protein ARALYDRAFT_496307           94.4    4e-18   
ref|XP_008645622.1|  PREDICTED: receptor-like protein kinase HSL1     94.4    4e-18   
ref|XP_002991545.1|  hypothetical protein SELMODRAFT_186143           94.4    4e-18   
ref|XP_002971751.1|  hypothetical protein SELMODRAFT_172284           94.0    4e-18   
emb|CDO99488.1|  unnamed protein product                              94.0    4e-18   
ref|XP_009773820.1|  PREDICTED: receptor-like protein kinase HSL1...  94.0    4e-18   
ref|XP_008793131.1|  PREDICTED: leucine-rich repeat receptor-like...  94.0    5e-18   
ref|XP_006852745.1|  hypothetical protein AMTR_s00033p00111080        94.0    5e-18   
gb|ABO61512.1|  LRR receptor-like protein kinase m2                   94.0    5e-18   
ref|XP_009409608.1|  PREDICTED: receptor-like protein kinase HSL1     94.0    5e-18   
emb|CDY38384.1|  BnaC01g09930D                                        90.9    5e-18   
emb|CAN76607.1|  hypothetical protein VITISV_030396                   94.0    5e-18   
ref|XP_009593556.1|  PREDICTED: receptor-like protein kinase HSL1...  93.6    5e-18   
emb|CDY60976.1|  BnaC09g50960D                                        93.6    5e-18   
ref|XP_008793129.1|  PREDICTED: leucine-rich repeat receptor-like...  93.6    6e-18   
ref|XP_006364308.1|  PREDICTED: receptor-like protein kinase HSL1...  93.6    6e-18   
ref|XP_004146619.1|  PREDICTED: receptor-like protein kinase HSL1...  93.6    6e-18   
ref|XP_009363288.1|  PREDICTED: leucine-rich repeat receptor-like...  93.6    6e-18   
ref|XP_009621303.1|  PREDICTED: receptor-like protein kinase HSL1     93.6    6e-18   
ref|XP_010918071.1|  PREDICTED: leucine-rich repeat receptor-like...  93.6    6e-18   
gb|KGN64706.1|  hypothetical protein Csa_1G075600                     93.6    6e-18   
ref|XP_004164018.1|  PREDICTED: receptor-like protein kinase HSL1...  93.6    6e-18   
ref|XP_008349015.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  91.7    7e-18   
gb|KDP26461.1|  hypothetical protein JCGZ_17619                       93.6    7e-18   
ref|XP_008356104.1|  PREDICTED: leucine-rich repeat receptor-like...  93.6    7e-18   
ref|XP_006470176.1|  PREDICTED: receptor-like protein kinase 5-like   93.6    7e-18   
ref|XP_003593346.1|  Receptor-like protein kinase HAIKU2              93.6    7e-18   
gb|KFK27903.1|  hypothetical protein AALP_AA8G445100                  93.2    8e-18   
ref|XP_010322765.1|  PREDICTED: receptor-like protein kinase HAIKU2   93.2    8e-18   
ref|NP_188604.1|  leucine rich repeat kinase HAIKU 2                  93.2    8e-18   
ref|XP_009593555.1|  PREDICTED: receptor-like protein kinase HSL1...  93.2    8e-18   
ref|XP_007043701.1|  HAESA-like 1 isoform 2                           93.2    8e-18   
ref|XP_008655811.1|  PREDICTED: receptor-like protein kinase HSL1     93.2    9e-18   
ref|XP_007043700.1|  HAESA-like 1 isoform 1                           93.2    9e-18   
ref|XP_004232923.1|  PREDICTED: receptor-like protein kinase HSL1     93.2    9e-18   
gb|KEH39191.1|  LRR receptor-like kinase family protein               93.2    9e-18   
ref|XP_009129466.1|  PREDICTED: leucine-rich repeat receptor-like...  93.2    1e-17   
ref|XP_003617299.1|  Receptor-like protein kinase                     92.8    1e-17   
ref|XP_006353616.1|  PREDICTED: receptor-like protein kinase HAIK...  92.8    1e-17   
gb|KJB11032.1|  hypothetical protein B456_001G237400                  92.8    1e-17   
ref|XP_010260843.1|  PREDICTED: leucine-rich repeat receptor-like...  92.8    1e-17   
dbj|BAJ89535.1|  predicted protein                                    92.8    1e-17   
gb|KHG10910.1|  Receptor-like protein kinase HSL1                     92.8    1e-17   
ref|XP_010924539.1|  PREDICTED: leucine-rich repeat receptor-like...  92.8    1e-17   
gb|EMT32870.1|  Receptor-like protein kinase HSL1                     92.8    1e-17   
gb|EYU28016.1|  hypothetical protein MIMGU_mgv1a000702mg              92.8    1e-17   



>ref|XP_009779466.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana sylvestris]
Length=1019

 Score =   211 bits (537),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 124/158 (78%), Gaps = 2/158 (1%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASN-IDEM  546
             +APEYAYTT+VNEKIDIYSFGVVLLELVTGR+PNFGEEH SLAEWAWK + E +N ID M
Sbjct  862   IAPEYAYTTKVNEKIDIYSFGVVLLELVTGRQPNFGEEHMSLAEWAWKQHGEGNNAIDNM  921

Query  545   LDGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNC  366
             LD EIK+A +L+EM+TVF LGLICTS  PSSRP+MKEV+QIL  C+       K   K  
Sbjct  922   LDSEIKEACYLEEMKTVFRLGLICTSNIPSSRPTMKEVLQILHRCKNFRNSGGKSPDKEY  981

Query  365   DVAPLLARNDDKYVASYKR-SSRKIADESDDDNLMFSV  255
             DVAPLL  N +KY+ASYKR +S K+ D+SDD  L+ +V
Sbjct  982   DVAPLLGNNTEKYIASYKRINSNKVIDDSDDGLLISTV  1019



>ref|XP_009587881.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana tomentosiformis]
Length=1026

 Score =   210 bits (534),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 120/151 (79%), Gaps = 2/151 (1%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASN-IDEM  546
             +APEYAYTT+VNEKIDIYSFGVVLLELVTGR+PNFGEEH SLAEWAWK + E +N ID M
Sbjct  869   IAPEYAYTTKVNEKIDIYSFGVVLLELVTGRQPNFGEEHMSLAEWAWKQHGEGNNAIDNM  928

Query  545   LDGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNC  366
             LD EIK+A +L+EM+TVF LGLICTS  PSSRP+MKEV+QIL  C+       K   K  
Sbjct  929   LDSEIKEACYLEEMKTVFRLGLICTSNLPSSRPTMKEVLQILHRCKNFRNSAGKSPDKEY  988

Query  365   DVAPLLARNDDKYVASYKR-SSRKIADESDD  276
             DVAPLL  N +KY+ASYKR +S K+ D+SDD
Sbjct  989   DVAPLLGNNSEKYIASYKRINSNKVIDDSDD  1019



>ref|XP_004245143.1| PREDICTED: receptor-like protein kinase HSL1 [Solanum lycopersicum]
Length=1043

 Score =   200 bits (509),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 123/158 (78%), Gaps = 3/158 (2%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASN-IDEM  546
             +APEYAYTT+VNEKIDIYSFGVVLLELVTGR+PNFG+EHTSLAEWAWK + E +  ID M
Sbjct  884   IAPEYAYTTKVNEKIDIYSFGVVLLELVTGRQPNFGDEHTSLAEWAWKQHGEGNTAIDNM  943

Query  545   LDGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNC  366
             LD +IK+  +L+EM+TVF LGLICTS  P+SRPSMKE++QIL  C+       K      
Sbjct  944   LDTDIKETCYLEEMKTVFRLGLICTSNLPASRPSMKEILQILHRCKSFRYSGGKSPDTEY  1003

Query  365   DVAPLLARND-DKYVASYKR-SSRKIADESDDDNLMFS  258
             DVAPLL+ N+ +KY+ASYKR +S K+ D+S DD L+ S
Sbjct  1004  DVAPLLSGNNSEKYIASYKRINSNKVIDDSSDDGLIIS  1041



>ref|XP_011093340.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
HSL1 [Sesamum indicum]
Length=1025

 Score =   199 bits (507),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 119/149 (80%), Gaps = 2/149 (1%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYAYTT+VNEKID+YSFGVVLLELVTGREPN G+EHTSLAEWAWK+Y     I ++L
Sbjct  873   IAPEYAYTTKVNEKIDVYSFGVVLLELVTGREPNCGDEHTSLAEWAWKHYGGEKPIADVL  932

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D E+K+A +L+EM  VF LGL+CTS  P+SRPSM+EV QILQ CR LD +E K  GK  D
Sbjct  933   DEEMKEACYLEEMVNVFKLGLMCTSPLPTSRPSMREVSQILQRCRSLDGYEGKKMGKEYD  992

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDD  276
             VAPLL   DDKY++SY+ +S+K+ D S +
Sbjct  993   VAPLLG--DDKYISSYRCNSKKLLDISGN  1019



>ref|XP_006366693.1| PREDICTED: receptor-like protein kinase HSL1-like [Solanum tuberosum]
Length=1032

 Score =   199 bits (505),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 123/158 (78%), Gaps = 3/158 (2%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASN-IDEM  546
             +APEYAYTT+VNEKIDIYSFGVVLLELVTGR+PNFG+EHTSLAEWAWK + E +  ID M
Sbjct  873   IAPEYAYTTKVNEKIDIYSFGVVLLELVTGRQPNFGDEHTSLAEWAWKQHGEGNTAIDNM  932

Query  545   LDGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNC  366
             LD +IK+  +L+EM+TVF LGLICTS  P++RPSMKE++QIL  C+       K      
Sbjct  933   LDTDIKETCYLEEMKTVFRLGLICTSNLPANRPSMKEILQILHRCKSFRYSGGKSPDTEY  992

Query  365   DVAPLLARND-DKYVASYKR-SSRKIADESDDDNLMFS  258
             DVAPLL+ N+ +KY+ASYKR +S K+ D+S DD L+ S
Sbjct  993   DVAPLLSGNNSEKYIASYKRINSNKVIDDSSDDGLIIS  1030



>ref|XP_008220120.1| PREDICTED: receptor-like protein kinase HSL1 [Prunus mume]
Length=1022

 Score =   186 bits (471),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 116/156 (74%), Gaps = 8/156 (5%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYAYTT++NEKID+YSFGVVLLEL TGREPN G+EHTSLAEWAW+ Y+E   I +ML
Sbjct  875   MAPEYAYTTKINEKIDVYSFGVVLLELTTGREPNSGDEHTSLAEWAWRVYSEGKTITDML  934

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D EI K  +L+EM TV  LGLICTS  PS+RPSMKEV+ IL+   P + FE K  G + D
Sbjct  935   DEEITKPCYLEEMATVLKLGLICTSTLPSTRPSMKEVLHILRGYGPSEGFEVKKMGSDFD  994

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDDDNLMFSV  255
             V+PLL+     Y++SYKRS +       DD+L++SV
Sbjct  995   VSPLLS--SATYLSSYKRSKKV------DDSLVYSV  1022



>ref|XP_009350259.1| PREDICTED: receptor-like protein kinase HSL1 [Pyrus x bretschneideri]
Length=1017

 Score =   184 bits (466),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 115/156 (74%), Gaps = 8/156 (5%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEY+YTT++NEKID+YSFGVVLLEL TGREPN G+EHT LAEW W+ Y+E   I + L
Sbjct  870   MAPEYSYTTKINEKIDVYSFGVVLLELTTGREPNRGDEHTGLAEWVWREYSEGKTITDAL  929

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             DGEI K  +L+EM TV  LGLICTS  PS+RPSMKEV+ IL+   P + FE +  G + D
Sbjct  930   DGEIAKPCYLEEMGTVLKLGLICTSTLPSNRPSMKEVLHILRGHGPSEGFEVRQVGSDFD  989

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDDDNLMFSV  255
             V+PLL+     YV+SYKRS      ++ DD+L++SV
Sbjct  990   VSPLLS--TGTYVSSYKRS------KAHDDSLVYSV  1017



>gb|EYU29298.1| hypothetical protein MIMGU_mgv1a000685mg [Erythranthe guttata]
Length=1018

 Score =   184 bits (466),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 113/149 (76%), Gaps = 5/149 (3%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
              APEYAYTT+VNEKID+YSFGVVLLELVTGR PN G+EHTSLAEWAWK Y E   I E +
Sbjct  869   FAPEYAYTTKVNEKIDVYSFGVVLLELVTGRAPNCGDEHTSLAEWAWKRYGEEEPIAEAI  928

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D EIK   +L+E+ +VF LGL+CTS  P+SRP+MKEV +IL  C+ LD    K +GK  D
Sbjct  929   DEEIKDPFYLEEIISVFKLGLMCTSPLPTSRPTMKEVTKILLRCKSLD---GKKAGKEYD  985

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDD  276
             VAPLL   +DKY++SY+  S+K+ DE D+
Sbjct  986   VAPLLG--EDKYISSYRCDSKKLMDEIDN  1012



>ref|XP_007225351.1| hypothetical protein PRUPE_ppa000941mg [Prunus persica]
 gb|EMJ26550.1| hypothetical protein PRUPE_ppa000941mg [Prunus persica]
Length=954

 Score =   182 bits (461),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 114/156 (73%), Gaps = 8/156 (5%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYTT++NEKID+YSFGVVLLEL TGREPN G+EHTSLAEW W+ Y+E   I + L
Sbjct  807  MAPEYAYTTKINEKIDVYSFGVVLLELTTGREPNSGDEHTSLAEWTWRVYSEGKTITDTL  866

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D EI K  +L+EM TV  LGLICTS  PS+RPSMKEV+ IL+   P + FE K  G + D
Sbjct  867  DEEITKPCYLEEMATVLKLGLICTSTLPSTRPSMKEVLHILRGYGPSEGFEVKKMGSDFD  926

Query  362  VAPLLARNDDKYVASYKRSSRKIADESDDDNLMFSV  255
            V+PLL+     Y++SYKRS +       DD+L++SV
Sbjct  927  VSPLLS--SATYLSSYKRSKKV------DDSLVYSV  954



>emb|CDP08193.1| unnamed protein product [Coffea canephora]
Length=984

 Score =   182 bits (461),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 112/149 (75%), Gaps = 4/149 (3%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYTT+VNEK D+YSFGVVLLELVTGREPN G+EHTSL EWAWK+Y E   I + +
Sbjct  834  IAPEYAYTTKVNEKTDVYSFGVVLLELVTGREPNGGDEHTSLVEWAWKHYGEGKPIADAI  893

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D EI++  +L+ M TV  LGL+CT++ P+ RPSMKE++QIL  C PL++     +G  CD
Sbjct  894  DEEIREQRYLEVMTTVLRLGLVCTNSIPNCRPSMKEILQILHRCTPLEDNGGLKAG--CD  951

Query  362  VAPLLARNDDKYVASYKRSSRKIADESDD  276
            +APLL     KY++SYK  S+KI +E DD
Sbjct  952  IAPLLG--SAKYLSSYKCRSKKIVNEDDD  978



>gb|KCW81624.1| hypothetical protein EUGRSUZ_C02985 [Eucalyptus grandis]
Length=824

 Score =   179 bits (453),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 111/156 (71%), Gaps = 8/156 (5%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             APEYAY+T+VNEKID+YSFGVVLLELVTGR PN G+E+ SL EWAW++Y E   I + L
Sbjct  677  FAPEYAYSTKVNEKIDVYSFGVVLLELVTGRGPNSGDENMSLTEWAWRHYGEGKPIADAL  736

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D EIK+   +DEM TVF L L+CTS SPS+RPSMKEV+ ILQSC P +   RK  G   D
Sbjct  737  DEEIKEPCNMDEMTTVFKLALVCTSRSPSTRPSMKEVLHILQSCGPSERSGRKRVGPEFD  796

Query  362  VAPLLARNDDKYVASYKRSSRKIADESDDDNLMFSV  255
              PLL   +  Y++SY+RS +       DDNL++SV
Sbjct  797  FTPLLG--NPTYLSSYRRSRKA------DDNLVYSV  824



>ref|XP_004291157.1| PREDICTED: receptor-like protein kinase 5 [Fragaria vesca subsp. 
vesca]
Length=1020

 Score =   179 bits (455),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 113/156 (72%), Gaps = 8/156 (5%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYAYT ++NEK D++SFGVVLLEL TGREPN G E+T+LAEWAW+ Y E  NIDE L
Sbjct  873   IAPEYAYTMKINEKTDVFSFGVVLLELTTGREPNNGGEYTNLAEWAWQQYGEGKNIDEAL  932

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D ++KK  + +EM TVF LGLICTS  PS+RPSMKEV+ IL+     D ++ K  G   D
Sbjct  933   DEDVKKTCYSEEMATVFKLGLICTSTLPSTRPSMKEVLHILRGYGSSDGYDIKKVGSEFD  992

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDDDNLMFSV  255
             +APLL  N   Y++SYKRS +K      DD+++FSV
Sbjct  993   IAPLL--NTASYLSSYKRSKKK------DDSIVFSV  1020



>ref|XP_008377967.1| PREDICTED: receptor-like protein kinase HSL1 [Malus domestica]
Length=1019

 Score =   179 bits (453),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 113/156 (72%), Gaps = 8/156 (5%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEY+YTT +NEKID+YSFGVVLLEL TGREPN G+EHT LAEWAW+ Y+E   I + L
Sbjct  872   MAPEYSYTTXINEKIDVYSFGVVLLELTTGREPNCGDEHTGLAEWAWREYSEGKTITDAL  931

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             DG+I K  +L+EM TV  LGLICTS  PS+RPSMKEV+ IL+   P + FE +  G + D
Sbjct  932   DGQIAKPCYLEEMTTVLKLGLICTSTLPSTRPSMKEVLHILRGHGPSEGFEVRKVGSDFD  991

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDDDNLMFSV  255
             V+PLL+     Y++SYKR       +  DD+L++SV
Sbjct  992   VSPLLS--TATYLSSYKRG------KEVDDSLVYSV  1019



>ref|XP_010049140.1| PREDICTED: receptor-like protein kinase HSL1 [Eucalyptus grandis]
Length=1023

 Score =   179 bits (453),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 111/156 (71%), Gaps = 8/156 (5%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
              APEYAY+T+VNEKID+YSFGVVLLELVTGR PN G+E+ SL EWAW++Y E   I + L
Sbjct  876   FAPEYAYSTKVNEKIDVYSFGVVLLELVTGRGPNSGDENMSLTEWAWRHYGEGKPIADAL  935

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D EIK+   +DEM TVF L L+CTS SPS+RPSMKEV+ ILQSC P +   RK  G   D
Sbjct  936   DEEIKEPCNMDEMTTVFKLALVCTSRSPSTRPSMKEVLHILQSCGPSERSGRKRVGPEFD  995

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDDDNLMFSV  255
               PLL   +  Y++SY+RS +       DDNL++SV
Sbjct  996   FTPLLG--NPTYLSSYRRSRKA------DDNLVYSV  1023



>ref|XP_006450731.1| hypothetical protein CICLE_v10010761mg [Citrus clementina]
 gb|ESR63971.1| hypothetical protein CICLE_v10010761mg [Citrus clementina]
Length=987

 Score =   178 bits (451),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 111/149 (74%), Gaps = 3/149 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             APEYAYTT+VNEKIDIYSFGVVLLELVTG+E N+G+EHTSLAEWAW++YAE   I + L
Sbjct  839  FAPEYAYTTKVNEKIDIYSFGVVLLELVTGKEANYGDEHTSLAEWAWRHYAEEKPITDAL  898

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D  I +  +L+EM TV+ L LICTS  PSSRPSMKEV+QIL+ C P + +  K  G++ D
Sbjct  899  DKGIAEPCYLEEMTTVYRLALICTSTLPSSRPSMKEVLQILRRCCPTENYGGKKMGRDVD  958

Query  362  VAPLLARNDDKYVASYKRSSRKIADESDD  276
             APLL      Y+  +KR S+K+A E D+
Sbjct  959  SAPLLG--TAGYLFGFKR-SKKVAAEEDN  984



>gb|KDO79911.1| hypothetical protein CISIN_1g001706mg [Citrus sinensis]
Length=969

 Score =   178 bits (451),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 111/149 (74%), Gaps = 3/149 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             APEYAYTT+VNEKIDIYSFGVVLLELVTG+E N+G+EHTSLAEWAW++YAE   I + L
Sbjct  821  FAPEYAYTTKVNEKIDIYSFGVVLLELVTGKEANYGDEHTSLAEWAWRHYAEEKPITDAL  880

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D  I +  +L+EM TV+ L LICTS  PSSRPSMKEV+QIL+ C P + +  K  G++ D
Sbjct  881  DKGIAEPCYLEEMTTVYRLALICTSTLPSSRPSMKEVLQILRRCCPTENYGGKKMGRDVD  940

Query  362  VAPLLARNDDKYVASYKRSSRKIADESDD  276
             APLL      Y+  +KR S+K+A E D+
Sbjct  941  SAPLLG--TAGYLFGFKR-SKKVAAEEDN  966



>gb|KDO79910.1| hypothetical protein CISIN_1g001706mg [Citrus sinensis]
Length=1024

 Score =   178 bits (451),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 111/149 (74%), Gaps = 3/149 (2%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
              APEYAYTT+VNEKIDIYSFGVVLLELVTG+E N+G+EHTSLAEWAW++YAE   I + L
Sbjct  876   FAPEYAYTTKVNEKIDIYSFGVVLLELVTGKEANYGDEHTSLAEWAWRHYAEEKPITDAL  935

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D  I +  +L+EM TV+ L LICTS  PSSRPSMKEV+QIL+ C P + +  K  G++ D
Sbjct  936   DKGIAEPCYLEEMTTVYRLALICTSTLPSSRPSMKEVLQILRRCCPTENYGGKKMGRDVD  995

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDD  276
              APLL      Y+  +KR S+K+A E D+
Sbjct  996   SAPLLG--TAGYLFGFKR-SKKVAAEEDN  1021



>ref|XP_006475995.1| PREDICTED: receptor-like protein kinase HSL1-like [Citrus sinensis]
Length=1024

 Score =   178 bits (451),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 111/149 (74%), Gaps = 3/149 (2%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
              APEYAYTT+VNEKIDIYSFGVVLLELVTG+E N+G+EHTSLAEWAW++YAE   I + L
Sbjct  876   FAPEYAYTTKVNEKIDIYSFGVVLLELVTGKEANYGDEHTSLAEWAWRHYAEEKPITDAL  935

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D  I +  +L+EM TV+ L LICTS  PSSRPSMKEV+QIL+ C P + +  K  G++ D
Sbjct  936   DKGIAEPCYLEEMTTVYRLALICTSTLPSSRPSMKEVLQILRRCCPTENYGGKKMGRDVD  995

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDD  276
              APLL      Y+  +KR S+K+A E D+
Sbjct  996   SAPLLG--TAGYLFGFKR-SKKVAAEEDN  1021



>emb|CBI20590.3| unnamed protein product [Vitis vinifera]
Length=175

 Score =   164 bits (414),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 109/156 (70%), Gaps = 4/156 (3%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYTT+VNEKID+YSFGVVLLELVTGREPN G EH  L EWAW  + E   I+E++
Sbjct  21   IAPEYAYTTKVNEKIDVYSFGVVLLELVTGREPNSGNEHMCLVEWAWDQFREEKTIEEVM  80

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D EIK+     ++ T+FTLGL+CT+  PS+RP+MKEV++IL+ C P +   RK   K+ +
Sbjct  81   DEEIKEECDTAQVTTLFTLGLMCTTTLPSTRPTMKEVLEILRQCNPQEGHGRKK--KDHE  138

Query  362  VAPLLARNDDKYVASYKRSSRKIADESDDDNLMFSV  255
            VAPLL   +  Y A+ K S +   +E DD +  F +
Sbjct  139  VAPLL--QNGTYPATNKHSDKGSNNEDDDVHPSFKI  172



>ref|XP_009367420.1| PREDICTED: receptor-like protein kinase HSL1 [Pyrus x bretschneideri]
Length=1021

 Score =   174 bits (441),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 112/156 (72%), Gaps = 8/156 (5%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEY+YT ++NEKID+YSFGVVLLEL TGREP  G+EHT LAEWAW+ Y+E   I + L
Sbjct  874   MAPEYSYTMKINEKIDVYSFGVVLLELTTGREPYCGDEHTGLAEWAWRLYSEGKTITDAL  933

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D EI +  +L+EM TV  LGLICTS  PS+RPSMKEV+ IL+   P + FE K  G++ D
Sbjct  934   DEEITEPCYLEEMATVLKLGLICTSTLPSTRPSMKEVMHILRGYGPSEGFEVKKVGRDFD  993

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDDDNLMFSV  255
             ++PLL      Y+ASYKRS +       DD+L++SV
Sbjct  994   ISPLLGA--ATYLASYKRSKKV------DDSLVYSV  1021



>gb|KDP34178.1| hypothetical protein JCGZ_07749 [Jatropha curcas]
Length=1026

 Score =   172 bits (435),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 113/155 (73%), Gaps = 4/155 (3%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYAYTT+VNEKID+YSFGVVLLELVTGRE N G+E++SLAEWAW+  AE     + L
Sbjct  874   IAPEYAYTTKVNEKIDVYSFGVVLLELVTGREANSGDENSSLAEWAWRQSAEGKPFVDCL  933

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D +I++  +L+EM TVF LGLICTS  PS+RPSMK+V+Q+L+ C P D   R+  G   D
Sbjct  934   DEKIREPCYLEEMTTVFKLGLICTSKLPSARPSMKDVLQVLRRCSPRD--NREKMGMEFD  991

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDDDNLMFS  258
             VAPLL      Y++SY+RS R   D+  +  L++S
Sbjct  992   VAPLLG--SSTYLSSYRRSKRVADDDDFESGLIYS  1024



>ref|XP_010668734.1| PREDICTED: receptor-like protein kinase HSL1 [Beta vulgaris subsp. 
vulgaris]
Length=1023

 Score =   170 bits (430),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 80/148 (54%), Positives = 110/148 (74%), Gaps = 2/148 (1%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEY YTT+VNEKIDIYSFGVVLLELVTG+EP+ G+E +SLAEWAWK+Y+E  +I+ + 
Sbjct  876   MAPEYCYTTKVNEKIDIYSFGVVLLELVTGKEPHIGDERSSLAEWAWKHYSERHSIEVVF  935

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D E+ +  F +EM +VF +GL+CTS  PSSRPSMKEVV++LQ    ++  +R  +    D
Sbjct  936   DKEVAEPCFSEEMTSVFKVGLMCTSTIPSSRPSMKEVVRMLQQHSTIEGSDRTKARHERD  995

Query  362   VAPLLARNDDKYVASYKRSSRKIADESD  279
             V+PL+    + Y++S K S RK+ D+ D
Sbjct  996   VSPLIG--SENYISSCKNSKRKVEDDCD  1021



>ref|XP_010095459.1| Receptor-like protein kinase HSL1 [Morus notabilis]
 gb|EXB60285.1| Receptor-like protein kinase HSL1 [Morus notabilis]
Length=1032

 Score =   169 bits (427),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 107/149 (72%), Gaps = 2/149 (1%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             LAPEYAYT +VNEKID+YSFGVVLLEL TGREPN  EE  +LAEWAW++Y +   I + L
Sbjct  878   LAPEYAYTAKVNEKIDVYSFGVVLLELATGREPNCEEEDMNLAEWAWQHYGDEKPISDAL  937

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D EIKK   LDEM TVF LGL+CTS SPS+RPSMKEV+QIL+     + +E K  G   D
Sbjct  938   DVEIKKPCNLDEMTTVFKLGLMCTSTSPSARPSMKEVLQILRRYGSPEAYEAKRVGSEFD  997

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDD  276
             VAPL+   + KY+ SY+    + ++E +D
Sbjct  998   VAPLMG--NTKYLTSYRGKKERGSEEDED  1024



>ref|XP_010267130.1| PREDICTED: receptor-like protein kinase HSL1 [Nelumbo nucifera]
Length=1045

 Score =   169 bits (427),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 115/159 (72%), Gaps = 8/159 (5%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             LAPEYAYTT+VNEK+D+YSFGVVLLEL TGRE   G+  T LA+WAW++  E   I E L
Sbjct  892   LAPEYAYTTKVNEKVDVYSFGVVLLELTTGREAGDGDGDTCLAQWAWRHLQEDKPIVEAL  951

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPL-DEFERKMSGKN-  369
             D +I++A +LDEM  VF LGLICT   PS+RPSMKEVVQ+L  C PL D  E++  G+  
Sbjct  952   DKQIREACYLDEMSIVFKLGLICTGTLPSTRPSMKEVVQVLMRCSPLQDHGEKEKVGRGE  1011

Query  368   CDVAPLLARNDDKYVASYKRS-SRKIADESDDDNLMFSV  255
              DVAPLL+    KY++SYK S SR+    SDDD+L ++V
Sbjct  1012  YDVAPLLS--SAKYISSYKESRSRR---TSDDDSLSYNV  1045



>ref|XP_002309529.2| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEE93052.2| leucine-rich repeat family protein [Populus trichocarpa]
Length=1015

 Score =   166 bits (419),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 96/126 (76%), Gaps = 1/126 (1%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYTTRVNEKID+YSFGVVLLEL TGREPN G+EHTSLAEWAW+ + +   + + L
Sbjct  876  MAPEYAYTTRVNEKIDVYSFGVVLLELATGREPNSGDEHTSLAEWAWQQFGQGKPVVDCL  935

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D EIK+  FL EM TVF LGLICT +SPS+RPSMKEV++IL+        E+K +G   D
Sbjct  936  DQEIKEPCFLQEMTTVFNLGLICTHSSPSTRPSMKEVLEILRRASADSNGEKK-TGAELD  994

Query  362  VAPLLA  345
            V PLL 
Sbjct  995  VVPLLG  1000



>ref|XP_010668729.1| PREDICTED: receptor-like protein kinase HSL1 [Beta vulgaris subsp. 
vulgaris]
Length=1026

 Score =   164 bits (415),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 76/153 (50%), Positives = 114/153 (75%), Gaps = 2/153 (1%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEY YTT+VNEKIDIYSFGVVLLELVTG+EP+ G+EHT+LAEWAW++Y++   I ++L
Sbjct  876   MAPEYCYTTKVNEKIDIYSFGVVLLELVTGKEPHIGDEHTNLAEWAWRHYSQGYPIKDVL  935

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D E+++  +L+EM TVF +GL+CT+  P+SRPSMK+V+Q+L+    L+++ R  +    D
Sbjct  936   DKEVEEPCYLEEMSTVFMIGLMCTNTLPASRPSMKDVLQLLRRHSTLEDYGRAKAKHERD  995

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDDDNLM  264
             V+PL+    + Y++S   S R    E+D  +++
Sbjct  996   VSPLIG--GENYISSCGNSKRVRGVEADKYDMV  1026



>ref|XP_010648290.1| PREDICTED: receptor-like protein kinase 5 isoform X2 [Vitis vinifera]
Length=982

 Score =   163 bits (413),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 111/153 (73%), Gaps = 5/153 (3%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYTT+VNEKID+YSFGVVLLELVTGREPN  +EH  L EWAW  + E   I+E++
Sbjct  835  IAPEYAYTTKVNEKIDVYSFGVVLLELVTGREPNSRDEHMCLVEWAWDQFKEEKTIEEVM  894

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D EIK+     ++ T+F+LGL+CT+ SPS+RP+MKEV++IL+ C P +   RK   K+ +
Sbjct  895  DEEIKEQCERAQVTTLFSLGLMCTTRSPSTRPTMKEVLEILRQCSPQEGHGRK--KKDHE  952

Query  362  VAPLLARNDDKYVASYKRSSRKIADESDDDNLM  264
             APLL   +  Y A+YK S ++ +D  DDDN +
Sbjct  953  AAPLL--QNGTYPATYKHSEKE-SDNEDDDNFI  982



>ref|XP_002516533.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF45874.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=1026

 Score =   163 bits (413),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 113/156 (72%), Gaps = 6/156 (4%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYAYT +VNEKID+YSFGVVLLELVTGREPN G+E++SLAEWAW+  AE + I +  
Sbjct  877   IAPEYAYTIKVNEKIDVYSFGVVLLELVTGREPNNGDENSSLAEWAWRQNAEGTPIIDCF  936

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D EI++  +L+EM  VF LGL CTS  P+ RPSMK+V+Q+L+   P   ++  M G   D
Sbjct  937   DEEIRQPCYLEEMTAVFNLGLFCTSNMPNQRPSMKDVLQVLRRYSP-TSYKENM-GSEFD  994

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDDDNLMFSV  255
             VAPLLA     Y++SYK S R ++DE D   L++SV
Sbjct  995   VAPLLA--SATYLSSYKHSKR-VSDEYDCS-LVYSV  1026



>ref|XP_002278306.2| PREDICTED: receptor-like protein kinase 5 isoform X1 [Vitis vinifera]
Length=1021

 Score =   163 bits (412),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 111/153 (73%), Gaps = 5/153 (3%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYAYTT+VNEKID+YSFGVVLLELVTGREPN  +EH  L EWAW  + E   I+E++
Sbjct  874   IAPEYAYTTKVNEKIDVYSFGVVLLELVTGREPNSRDEHMCLVEWAWDQFKEEKTIEEVM  933

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D EIK+     ++ T+F+LGL+CT+ SPS+RP+MKEV++IL+ C P +   RK   K+ +
Sbjct  934   DEEIKEQCERAQVTTLFSLGLMCTTRSPSTRPTMKEVLEILRQCSPQEGHGRK--KKDHE  991

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDDDNLM  264
              APLL   +  Y A+YK S ++ +D  DDDN +
Sbjct  992   AAPLL--QNGTYPATYKHSEKE-SDNEDDDNFI  1021



>ref|XP_010648291.1| PREDICTED: receptor-like protein kinase HSL1 [Vitis vinifera]
Length=1029

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 109/156 (70%), Gaps = 4/156 (3%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYAYTT+VNEKID+YSFGVVLLELVTGREPN G EH  L EWAW  + E   I+E++
Sbjct  875   IAPEYAYTTKVNEKIDVYSFGVVLLELVTGREPNSGNEHMCLVEWAWDQFREEKTIEEVM  934

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D EIK+     ++ T+FTLGL+CT+  PS+RP+MKEV++IL+ C P +   RK   K+ +
Sbjct  935   DEEIKEECDTAQVTTLFTLGLMCTTTLPSTRPTMKEVLEILRQCNPQEGHGRK--KKDHE  992

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDDDNLMFSV  255
             VAPLL   +  Y A+ K S +   +E DD +  F +
Sbjct  993   VAPLLQ--NGTYPATNKHSDKGSNNEDDDVHPSFKI  1026



>emb|CAN80774.1| hypothetical protein VITISV_042330 [Vitis vinifera]
Length=983

 Score =   162 bits (409),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 109/156 (70%), Gaps = 4/156 (3%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYTT+VNEKID+YSFGVVLLELVTGREPN G EH  L EWAW  + E   I+E++
Sbjct  829  IAPEYAYTTKVNEKIDVYSFGVVLLELVTGREPNSGNEHMCLVEWAWDQFREEKTIEEVM  888

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D EIK+     ++ T+FTLGL+CT+  PS+RP+MKEV++IL+ C P +   RK   K+ +
Sbjct  889  DEEIKEECDTAQVTTLFTLGLMCTTTLPSTRPTMKEVLEILRQCSPQEGHGRK--KKDHE  946

Query  362  VAPLLARNDDKYVASYKRSSRKIADESDDDNLMFSV  255
            VAPLL   +  Y A+ K S +   +E DD +  F +
Sbjct  947  VAPLL--QNGTYPATNKHSDKGSNNEDDDVHPSFKI  980



>ref|XP_004148398.1| PREDICTED: receptor-like protein kinase HSL1-like [Cucumis sativus]
 gb|KGN62796.1| hypothetical protein Csa_2G373400 [Cucumis sativus]
Length=1090

 Score =   161 bits (408),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYAYTT+VNEKID+YSFGVVLLEL TGREPN G+EHTSLAEWAW+ Y+E   I + L
Sbjct  962   IAPEYAYTTKVNEKIDVYSFGVVLLELTTGREPNSGDEHTSLAEWAWQQYSEGKTITDSL  1021

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D EIK     +EM T+F LGLICTS  P  RPSMKEV++IL+ C P +  +R+      D
Sbjct  1022  DEEIKNPCNFEEMSTMFKLGLICTSMLPEIRPSMKEVLRILRQCSPPEACDRRKHAIEFD  1081

Query  362   VAPLLA  345
               PLL 
Sbjct  1082  AIPLLG  1087



>ref|XP_004164767.1| PREDICTED: receptor-like protein kinase HSL1-like [Cucumis sativus]
Length=1004

 Score =   161 bits (407),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYAYTT+VNEKID+YSFGVVLLEL TGREPN G+EHTSLAEWAW+ Y+E   I + L
Sbjct  876   IAPEYAYTTKVNEKIDVYSFGVVLLELTTGREPNSGDEHTSLAEWAWQQYSEGKTITDSL  935

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D EIK     +EM T+F LGLICTS  P  RPSMKEV++IL+ C P +  +R+      D
Sbjct  936   DEEIKNPCNFEEMSTMFKLGLICTSMLPEIRPSMKEVLRILRQCSPPEACDRRKHAIEFD  995

Query  362   VAPLLA  345
               PLL 
Sbjct  996   AIPLLG  1001



>gb|KJB54767.1| hypothetical protein B456_009G048200 [Gossypium raimondii]
Length=975

 Score =   160 bits (406),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 119/156 (76%), Gaps = 5/156 (3%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            LAPE+AYTT+VN KID+YSFGVVLLELVTGRE N  +++ SL +WAW++++E   + E+L
Sbjct  825  LAPEHAYTTKVNAKIDVYSFGVVLLELVTGREANSTDQNMSLVQWAWQHFSEDKPVVEIL  884

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D EI+++ +L+E++ V+ +G++CT ASPS+RPSMKEV+ +L+SC P D    K    + D
Sbjct  885  DPEIRESPYLEEIKMVYKVGIVCTRASPSTRPSMKEVLHVLRSCCPEDGKGAKKKVSDID  944

Query  362  VAPLLARNDDKYVASYKRSSRKIADESDDDNLMFSV  255
            VAPLL      Y+ SYK +S+K+++E  DD+++++V
Sbjct  945  VAPLLG--TATYLYSYK-NSKKVSNE--DDSMIYNV  975



>ref|XP_002324752.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEF03317.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=1019

 Score =   161 bits (407),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 112/157 (71%), Gaps = 6/157 (4%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGE-EHTSLAEWAWKNYAEASNIDEM  546
             +APEYAYTT+VNEKID+YSFGVVLLEL TGREPN G+ E TSLAEWAW+ + +   +   
Sbjct  868   IAPEYAYTTKVNEKIDVYSFGVVLLELATGREPNSGDDEDTSLAEWAWRQFGQGKPVSNC  927

Query  545   LDGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNC  366
             LD EIK+  FL EM  VF LGL+CT + PS+RPSMK+V++IL+ C P +  E++   +  
Sbjct  928   LDQEIKEPCFLQEMTAVFNLGLVCTHSLPSNRPSMKDVLEILRRCSPDNNGEKRTVSE-F  986

Query  365   DVAPLLARNDDKYVASYKRSSRKIADESDDDNLMFSV  255
             D+ PLL    +    S  R S +++D+ +DD+L++SV
Sbjct  987   DIVPLLG---NVTCLSSNRRSNRLSDD-NDDSLVYSV  1019



>ref|XP_008444991.1| PREDICTED: receptor-like protein kinase HSL1 [Cucumis melo]
 ref|XP_008444992.1| PREDICTED: receptor-like protein kinase HSL1 [Cucumis melo]
Length=1003

 Score =   160 bits (406),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYTT+VNEKID+YS+GVVLLEL TGREPN G+EHTSLAEWAW+ Y+E   I E L
Sbjct  875  IAPEYAYTTKVNEKIDVYSYGVVLLELTTGREPNSGDEHTSLAEWAWQQYSEGKPIIESL  934

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D EIK    L+EM T+F LGLICTS  P  RPSMKEV++IL+ C P +  +R+      D
Sbjct  935  DEEIKNPCNLEEMTTMFKLGLICTSMLPEIRPSMKEVLRILRQCSPPEACDRRKHAIEFD  994

Query  362  VAPLLA  345
              PLL 
Sbjct  995  AIPLLG  1000



>gb|KJB54766.1| hypothetical protein B456_009G048200 [Gossypium raimondii]
Length=1012

 Score =   160 bits (406),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 119/156 (76%), Gaps = 5/156 (3%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             LAPE+AYTT+VN KID+YSFGVVLLELVTGRE N  +++ SL +WAW++++E   + E+L
Sbjct  862   LAPEHAYTTKVNAKIDVYSFGVVLLELVTGREANSTDQNMSLVQWAWQHFSEDKPVVEIL  921

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D EI+++ +L+E++ V+ +G++CT ASPS+RPSMKEV+ +L+SC P D    K    + D
Sbjct  922   DPEIRESPYLEEIKMVYKVGIVCTRASPSTRPSMKEVLHVLRSCCPEDGKGAKKKVSDID  981

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDDDNLMFSV  255
             VAPLL      Y+ SYK +S+K+++E  DD+++++V
Sbjct  982   VAPLLG--TATYLYSYK-NSKKVSNE--DDSMIYNV  1012



>gb|KJB65638.1| hypothetical protein B456_010G104300 [Gossypium raimondii]
 gb|KJB65639.1| hypothetical protein B456_010G104300 [Gossypium raimondii]
Length=1018

 Score =   160 bits (404),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 110/156 (71%), Gaps = 3/156 (2%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             LAPEYAYTT+VN K+D+YSFGVVLLELVTGR+ N  +E+ SL EWAW++++E   ID++L
Sbjct  866   LAPEYAYTTKVNAKVDVYSFGVVLLELVTGRKANNIDENMSLVEWAWQHFSEDKPIDQIL  925

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D E+K+  +++EM  V+ +G++CT ASPS+RPSM EV  IL+SC   D    K  G   +
Sbjct  926   DPEVKEPSYMEEMILVYKVGILCTHASPSTRPSMNEVSNILRSCCLPDGHAAKKVGSEFE  985

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDDDNLMFSV  255
             VA  L R+ D Y +SYK S +      +DD++++ V
Sbjct  986   VAQRLGRDTDAYFSSYKHSKK---GSEEDDSMIYVV  1018



>gb|KHG24857.1| Receptor-like protein kinase HSL1 [Gossypium arboreum]
Length=1012

 Score =   160 bits (404),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 119/156 (76%), Gaps = 5/156 (3%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             LAPE+AYTT+VN KID+YSFGVVLLELVTGRE N  + + SL +WAW++++E   + E+L
Sbjct  862   LAPEHAYTTKVNAKIDVYSFGVVLLELVTGREANSMDHNMSLVQWAWQHFSEDKPVVEIL  921

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D EI+++ +L+E++ V+ +G++CT ASPS+RPSMKEV+ +L+SC P D    K    + D
Sbjct  922   DPEIRESPYLEEIKMVYKVGIVCTRASPSTRPSMKEVLHVLRSCCPEDGKGAKKKVSDID  981

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDDDNLMFSV  255
             VAPLL      Y+++YK +S+K+++E  DD+++++V
Sbjct  982   VAPLLGT--ATYLSTYK-NSKKVSNE--DDSMIYNV  1012



>ref|XP_007012181.1| Kinase family protein with leucine-rich repeat domain, putative 
[Theobroma cacao]
 gb|EOY29800.1| Kinase family protein with leucine-rich repeat domain, putative 
[Theobroma cacao]
Length=1017

 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 109/156 (70%), Gaps = 5/156 (3%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYAYTT+VN K+D+YSFGVVLLELVTGRE N  +E TSL EWAW+  +E   I E+L
Sbjct  867   IAPEYAYTTKVNAKVDVYSFGVVLLELVTGREANSADESTSLVEWAWQRDSEDKPIVEIL  926

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D EIK+  +LDEM  V+ +G++CT ASPS+RPSMKEV+ +L SC    +   K    +  
Sbjct  927   DPEIKEPSYLDEMIMVYKVGIVCTRASPSTRPSMKEVLHVLSSCGTPHDNGAKNVASDFG  986

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDDDNLMFSV  255
             VAPL+      Y++SYKRS +   +  +DD +++SV
Sbjct  987   VAPLIG--SATYLSSYKRSKK---ESEEDDRIIYSV  1017



>emb|CBI20587.3| unnamed protein product [Vitis vinifera]
Length=944

 Score =   155 bits (393),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 109/152 (72%), Gaps = 5/152 (3%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYTT+VNEKID+YSFGVVLLELVTGREPN G+E   L EWAW  + E   I+E++
Sbjct  771  IAPEYAYTTKVNEKIDVYSFGVVLLELVTGREPNNGDELMCLVEWAWDQFREGKTIEEVM  830

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D +IK+     ++ T+F+LGL+CT+ SP++RP+MKEV++IL+ C P +   RK   K+ +
Sbjct  831  DEDIKEQCERAQVTTLFSLGLMCTTRSPATRPTMKEVLEILRQCSPQEGHGRK--KKDHE  888

Query  362  VAPLLARNDDKYVASYKRSSRKIADESDDDNL  267
            VAPLL   +    A+YK  + K +D  DDD L
Sbjct  889  VAPLL--QNGTCPATYKH-NEKGSDNEDDDKL  917


 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYTT+VNEKID+YSFGVVLLELVTGR+PN G+EH  L EW W  + E   I+E++
Sbjct  85   IAPEYAYTTKVNEKIDVYSFGVVLLELVTGRKPNSGDEHMCLVEWVWDQFREGKTIEEVM  144

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQ  417
            D EIK+     ++ T+F+LGL+CT+  PS+RP+MKEV++IL+
Sbjct  145  DEEIKEQCERTQVTTLFSLGLMCTTTLPSTRPTMKEVLEILR  186



>ref|XP_011010886.1| PREDICTED: receptor-like protein kinase HSL1 isoform X2 [Populus 
euphratica]
Length=991

 Score =   155 bits (391),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 111/157 (71%), Gaps = 5/157 (3%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGE-EHTSLAEWAWKNYAEASNIDEM  546
            +APEYAYT +VNEKID+YSFGVVLLEL TGREPN G+ E TSLAEWAW+ + +   +   
Sbjct  839  IAPEYAYTAKVNEKIDVYSFGVVLLELATGREPNSGDDEDTSLAEWAWQQFGQGKPVFNC  898

Query  545  LDGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNC  366
            LD EIK+  FL EM  VF LGL+CT +SPS+RPSMK+V++IL+ C P +  E++   +  
Sbjct  899  LDQEIKEPCFLQEMTAVFNLGLVCTHSSPSNRPSMKDVLEILRRCSPDNNGEKRTVSE-F  957

Query  365  DVAPLLARNDDKYVASYKRSSRKIADESDDDNLMFSV  255
            D+ PLL    +    S  R S +++D+ DD +L++SV
Sbjct  958  DIVPLLG---NVTCLSSNRRSNRLSDDDDDGSLVYSV  991



>ref|XP_011010885.1| PREDICTED: receptor-like protein kinase HSL1 isoform X1 [Populus 
euphratica]
Length=1020

 Score =   155 bits (391),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 111/157 (71%), Gaps = 5/157 (3%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGE-EHTSLAEWAWKNYAEASNIDEM  546
             +APEYAYT +VNEKID+YSFGVVLLEL TGREPN G+ E TSLAEWAW+ + +   +   
Sbjct  868   IAPEYAYTAKVNEKIDVYSFGVVLLELATGREPNSGDDEDTSLAEWAWQQFGQGKPVFNC  927

Query  545   LDGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNC  366
             LD EIK+  FL EM  VF LGL+CT +SPS+RPSMK+V++IL+ C P +  E++   +  
Sbjct  928   LDQEIKEPCFLQEMTAVFNLGLVCTHSSPSNRPSMKDVLEILRRCSPDNNGEKRTVSE-F  986

Query  365   DVAPLLARNDDKYVASYKRSSRKIADESDDDNLMFSV  255
             D+ PLL    +    S  R S +++D+ DD +L++SV
Sbjct  987   DIVPLLG---NVTCLSSNRRSNRLSDDDDDGSLVYSV  1020



>emb|CBI20588.3| unnamed protein product [Vitis vinifera]
Length=1318

 Score =   152 bits (385),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 101/137 (74%), Gaps = 4/137 (3%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYTT+VNEKID+YSFGVVLLELVTGREPN  +EH  L EWAW  + E   I+E++
Sbjct  509  IAPEYAYTTKVNEKIDVYSFGVVLLELVTGREPNSRDEHMCLVEWAWDQFKEEKTIEEVM  568

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D EIK+     ++ T+F+LGL+CT+ SPS+RP+MKEV++IL+ C P +   RK   K+ +
Sbjct  569  DEEIKEQCERAQVTTLFSLGLMCTTRSPSTRPTMKEVLEILRQCSPQEGHGRK--KKDHE  626

Query  362  VAPLLARNDDKYVASYK  312
             APLL   +  Y A+YK
Sbjct  627  AAPLL--QNGTYPATYK  641


 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAW  582
             +APEYAYTT+VNEKID+YSFGVVLLELV  REPN  +EH  L EWAW
Sbjct  1271  IAPEYAYTTKVNEKIDVYSFGVVLLELVMKREPNSRDEHMCLVEWAW  1317



>ref|XP_007137253.1| hypothetical protein PHAVU_009G112200g [Phaseolus vulgaris]
 gb|ESW09247.1| hypothetical protein PHAVU_009G112200g [Phaseolus vulgaris]
Length=1018

 Score =   150 bits (380),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 105/148 (71%), Gaps = 4/148 (3%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNF-GEEHTSLAEWAWKNYAEASNIDEM  546
             + PEYAY+T++NEK+D+YSFGVVLLELVTGR+PN  GE   SL EWAW+++ EA ++ + 
Sbjct  873   IPPEYAYSTKINEKVDVYSFGVVLLELVTGRKPNMRGEHACSLVEWAWEHFTEAKSLTDA  932

Query  545   LDGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNC  366
              D +IK+  + +EM  VF LGL+CTS+ PS+RPS KE++Q+L+ C       R++ G   
Sbjct  933   FDEDIKEPRYAEEMANVFKLGLLCTSSLPSTRPSAKEIMQVLRRCCHSGSTRRRV-GNEF  991

Query  365   DVAPLLARNDDKYVASYKRSSRKIADES  282
             D+APLL+  D +YV SYK S+    + S
Sbjct  992   DIAPLLS--DPRYVCSYKESNAATNNSS  1017



>ref|XP_011019562.1| PREDICTED: receptor-like protein kinase HSL1 [Populus euphratica]
 ref|XP_011019563.1| PREDICTED: receptor-like protein kinase HSL1 [Populus euphratica]
 ref|XP_011019564.1| PREDICTED: receptor-like protein kinase HSL1 [Populus euphratica]
 ref|XP_011019565.1| PREDICTED: receptor-like protein kinase HSL1 [Populus euphratica]
Length=1014

 Score =   150 bits (380),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 93/126 (74%), Gaps = 1/126 (1%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYTTRVNEKID+YSFGVVLLEL TGREPN G+EHTSLAEWA + + +   + + L
Sbjct  875  MAPEYAYTTRVNEKIDVYSFGVVLLELATGREPNSGDEHTSLAEWARQQFGQGKPVVDCL  934

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D EIK+  FL EM TVF LGLICT +  S+RPSMK+V++IL+        E+K +G   D
Sbjct  935  DPEIKEPCFLQEMTTVFNLGLICTHSLSSTRPSMKDVLEILRRGFADSNGEKK-TGAELD  993

Query  362  VAPLLA  345
            V PLL 
Sbjct  994  VFPLLG  999



>ref|XP_010278042.1| PREDICTED: receptor-like protein kinase 5 [Nelumbo nucifera]
Length=1024

 Score =   150 bits (378),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 105/148 (71%), Gaps = 5/148 (3%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             LAPEY YTT+VNEK+DIYSFGVVLLELVTGRE N G ++TSLAEWAW++  +   I + L
Sbjct  876   LAPEYGYTTKVNEKVDIYSFGVVLLELVTGREANDGGDNTSLAEWAWQHLKDGKPIVDAL  935

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D +IK+  +L EM  VF LG+ CTS+ PS+RPSMK+V+Q+L    PL   ++K+   + D
Sbjct  936   DEQIKEPCYLAEMSVVFQLGIHCTSSLPSTRPSMKQVLQVLTRYIPL---QQKVVRYDFD  992

Query  362   VAPLLARNDDKYVASYKRSSRKIADESD  279
             +AP+L      Y++S +RS ++  D  D
Sbjct  993   IAPVLT--SSTYLSSNQRSKKRSMDVDD  1018



>ref|XP_003619786.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES76004.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1039

 Score =   147 bits (372),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 70/135 (52%), Positives = 101/135 (75%), Gaps = 4/135 (3%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEY  TTRV EKID++SFGVVLLEL TG+E N+G++++SL+EWAW++    +N++E+L
Sbjct  897   IAPEYVQTTRVTEKIDVFSFGVVLLELTTGKEANYGDQYSSLSEWAWRHILLGTNVEELL  956

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQS-CRPLDEFERKMSGKNC  366
             D ++ +A ++DEM TVF LG++CT+  PSSRPSMKEV+Q L S   PL   E+K+ G   
Sbjct  957   DKDVMEASYMDEMCTVFKLGVMCTATLPSSRPSMKEVLQTLLSFAEPLPYVEKKV-GHYY  1015

Query  365   DVAPLL--ARNDDKY  327
             D  PLL  ++ D ++
Sbjct  1016  DADPLLKDSKKDTRF  1030



>ref|XP_008390812.1| PREDICTED: receptor-like protein kinase HSL1 [Malus domestica]
Length=1019

 Score =   147 bits (372),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 90/113 (80%), Gaps = 1/113 (1%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA+TTRVNEKID+YSFGV+LLEL TGRE N G+EHT+LAEWAW+++ E + I + L
Sbjct  878  MAPEYAHTTRVNEKIDVYSFGVILLELTTGREANDGDEHTALAEWAWRHFQEENAIADAL  937

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC-RPLDEFER  387
            D + K+  +LDEM +VF LGLICT   P+SRPSMKEV+Q+L  C RP+   E+
Sbjct  938  DQDAKEPCYLDEMCSVFKLGLICTERLPASRPSMKEVLQMLLRCSRPVINSEK  990



>ref|XP_010249486.1| PREDICTED: receptor-like protein kinase HSL1 [Nelumbo nucifera]
Length=1034

 Score =   147 bits (371),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
              APEYAYTT+VNEK+D+YSFGVVLLELVTGRE N G E++SLAEWAW++  +   I + L
Sbjct  877   FAPEYAYTTKVNEKVDVYSFGVVLLELVTGREANDGGENSSLAEWAWQHLQDGKPIQDAL  936

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGK-NC  366
             D +I++  +L EMR VF LG+ CTS  PS+RPSMK+V Q+L    PL +   +  GK + 
Sbjct  937   DEQIREPCYLAEMRVVFQLGIHCTSTLPSTRPSMKQVSQVLTRYDPLHQGHGEKVGKGDF  996

Query  365   DVAPLLA  345
             D+APLL 
Sbjct  997   DIAPLLT  1003



>ref|XP_004512685.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X2 
[Cicer arietinum]
Length=836

 Score =   146 bits (369),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 69/126 (55%), Positives = 96/126 (76%), Gaps = 2/126 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEY  TTRV+EKID++SFGV+LLEL TG+E N+G++H+SL+EWAW+      N++E+L
Sbjct  698  IAPEYVQTTRVSEKIDVFSFGVILLELTTGKEANYGDQHSSLSEWAWRQVLLGINVEELL  757

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQS-CRPLDEFERKMSGKNC  366
            D ++ +  +LDEM TVF LG++CT+  PSSRPSMKEV+Q+L +   PL   E+K+ G   
Sbjct  758  DKDVMEGSYLDEMCTVFKLGVMCTATLPSSRPSMKEVLQLLLNFAEPLVYGEKKV-GHYY  816

Query  365  DVAPLL  348
            DV PLL
Sbjct  817  DVDPLL  822



>gb|KHN40381.1| LRR receptor-like serine/threonine-protein kinase HSL2 [Glycine 
soja]
Length=804

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 96/127 (76%), Gaps = 5/127 (4%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA TTRV+EKID++SFGV+LLEL TG+E N+G+EH+SLAEWAW++    SNI+E+L
Sbjct  666  IAPEYAKTTRVSEKIDVFSFGVILLELTTGKEANYGDEHSSLAEWAWRHQQLGSNIEELL  725

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMS--GKN  369
            D ++ +  +LD M  VF LG++C++  PSSRPSMKEV+QIL SC   D F +  S  G  
Sbjct  726  DKDVMETSYLDGMCKVFKLGIMCSATLPSSRPSMKEVLQILLSCE--DSFSKGESIIGHY  783

Query  368  CDVAPLL  348
             DV PLL
Sbjct  784  DDV-PLL  789



>emb|CBI20585.3| unnamed protein product [Vitis vinifera]
Length=321

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYTT+VN+KID+YSFGVVLLELVTGREPN G+EH  LAEWAW  + E   I+E++
Sbjct  21   IAPEYAYTTKVNKKIDVYSFGVVLLELVTGREPNNGDEHVCLAEWAWDQFREEKTIEEVM  80

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFER  387
            D EIK+     ++ T+F LG+ CT+  PS+RP+MK V++ILQ C P +   R
Sbjct  81   DEEIKEECDRAQVATLFKLGIRCTNKLPSNRPTMKGVLKILQQCSPQEGHGR  132



>ref|XP_002278223.1| PREDICTED: receptor-like protein kinase HSL1 [Vitis vinifera]
Length=1004

 Score =   147 bits (370),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 100/137 (73%), Gaps = 4/137 (3%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYAYTT+VN+KID+YSFGVVLLELVTGREPN G+EH  LAEWAW  + E   I+E++
Sbjct  871   IAPEYAYTTKVNKKIDVYSFGVVLLELVTGREPNNGDEHVCLAEWAWDQFREEKTIEEVM  930

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D EIK+     ++ T+F LG+ CT+  PS+RP+MK V++ILQ C P +   R  + K+ +
Sbjct  931   DEEIKEECDRAQVATLFKLGIRCTNKLPSNRPTMKGVLKILQQCSPQEGHGR--NKKDHE  988

Query  362   VAPLLARNDDKYVASYK  312
             VAP L RN D Y  +YK
Sbjct  989   VAPPL-RN-DTYPTTYK  1003



>ref|XP_003517639.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=1010

 Score =   147 bits (370),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 75/151 (50%), Positives = 104/151 (69%), Gaps = 12/151 (8%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYA TTRV+EKID++SFGV+LLEL TG+E N+G+EH+SLAEWAW++    SNI+E+L
Sbjct  872   IAPEYAKTTRVSEKIDVFSFGVILLELTTGKEANYGDEHSSLAEWAWRHQQLGSNIEELL  931

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D ++ +  +LD M  VF LG++C++  PSSRPSMKEV+QIL SC   D F +  S     
Sbjct  932   DKDVMETSYLDGMCKVFKLGIMCSATLPSSRPSMKEVLQILLSCE--DSFSKGES-----  984

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDDDN  270
                ++   DD  V   K S R+   + D+D+
Sbjct  985   ---IIGHYDD--VPLLKNSKREHKLDIDNDS  1010



>ref|XP_004513049.1| PREDICTED: receptor-like protein kinase HSL1-like [Cicer arietinum]
Length=1012

 Score =   146 bits (369),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 73/150 (49%), Positives = 98/150 (65%), Gaps = 9/150 (6%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEY  TTRVNEKID++SFGV+LLEL TG+E  +G+EH+SL EW+W +  E SNI+E+L
Sbjct  872   MAPEYVQTTRVNEKIDVFSFGVILLELTTGKEATYGDEHSSLVEWSWSHVHEGSNIEELL  931

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D +  +  +LDEM  +F LG++CT+  PSSRPSMKEVV  L  C     F ++ + +  D
Sbjct  932   DKDFVEPSYLDEMCNIFKLGIMCTTTLPSSRPSMKEVVHTLLRCEGGLVFGQR-NVEEYD  990

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDDD  273
             V P L  +        KR SR    +SD D
Sbjct  991   VVPFLKNS--------KRDSRLNIVDSDTD  1012



>ref|XP_003533283.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=1008

 Score =   146 bits (369),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 71/149 (48%), Positives = 103/149 (69%), Gaps = 8/149 (5%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEY  TTRV+EKID++SFGVVLLEL TG+E N+G++H+SL+EWAW++     N++E+L
Sbjct  867   IAPEYVQTTRVSEKIDVFSFGVVLLELTTGKEANYGDQHSSLSEWAWRHVLIGGNVEELL  926

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC-RPLDEFERKMSGKNC  366
             D ++ +A + DEM TVF LG++CT+  P+SRPSM+E +QIL+S   P    ++K  G   
Sbjct  927   DKDVMEAIYSDEMCTVFKLGVLCTATLPASRPSMREALQILKSLGEPFAYGDQKKFGHYY  986

Query  365   DVAPLLARNDDKYVASYKRSSRKIADESD  279
             D  PLL        +S K +   +AD S+
Sbjct  987   DAIPLLK-------SSEKETRLNVADHSE  1008



>ref|XP_004513050.1| PREDICTED: receptor-like protein kinase HSL1-like [Cicer arietinum]
Length=1014

 Score =   146 bits (369),  Expect = 5e-36, Method: Composition-based stats.
 Identities = 69/132 (52%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEY  TTRV+EKID++SFGV+LLEL TG+E N+G+EH+SLAEW+W +    SNI+E+L
Sbjct  872   MAPEYVQTTRVSEKIDVFSFGVILLELTTGKEANYGDEHSSLAEWSWCHIQAGSNIEELL  931

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEF-ERKMSGKNC  366
             D E+ ++  L+ M  VF LG++CTS  PSSRPSMKEV+++L +C  L  + ER + G N 
Sbjct  932   DKEVMESSHLNGMCKVFKLGVMCTSTLPSSRPSMKEVLEVLLNCGELFAYGERNIVGHNV  991

Query  365   DVAPLLARNDDK  330
             +    L RN  +
Sbjct  992   NDGVPLLRNSKR  1003



>ref|XP_004512684.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X1 
[Cicer arietinum]
Length=1025

 Score =   146 bits (369),  Expect = 5e-36, Method: Composition-based stats.
 Identities = 69/126 (55%), Positives = 96/126 (76%), Gaps = 2/126 (2%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEY  TTRV+EKID++SFGV+LLEL TG+E N+G++H+SL+EWAW+      N++E+L
Sbjct  887   IAPEYVQTTRVSEKIDVFSFGVILLELTTGKEANYGDQHSSLSEWAWRQVLLGINVEELL  946

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQS-CRPLDEFERKMSGKNC  366
             D ++ +  +LDEM TVF LG++CT+  PSSRPSMKEV+Q+L +   PL   E+K+ G   
Sbjct  947   DKDVMEGSYLDEMCTVFKLGVMCTATLPSSRPSMKEVLQLLLNFAEPLVYGEKKV-GHYY  1005

Query  365   DVAPLL  348
             DV PLL
Sbjct  1006  DVDPLL  1011



>ref|XP_010106712.1| Receptor-like protein kinase HSL1 [Morus notabilis]
 gb|EXC11523.1| Receptor-like protein kinase HSL1 [Morus notabilis]
Length=1194

 Score =   146 bits (369),  Expect = 5e-36, Method: Composition-based stats.
 Identities = 77/150 (51%), Positives = 100/150 (67%), Gaps = 13/150 (9%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYA++TRVNEKID+YSFGVVLLEL TGRE N G+EHTSLAEWAW++  +   I++ L
Sbjct  1050  MAPEYAHSTRVNEKIDVYSFGVVLLELATGREANSGDEHTSLAEWAWRHVQDDKPIEDAL  1109

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQ-ILQSCRPLDEFERKMSGKNC  366
             D EIK   +++EM  VF LG+ CT+  PS+RPSMK+V+Q +L+  R +   E K  G   
Sbjct  1110  DEEIKDPIYVEEMSCVFKLGIYCTTTLPSTRPSMKDVLQLLLRHSRQMANGE-KFVGTEY  1168

Query  365   DVAPLLARNDDKYVASYKRSSRKIADESDD  276
             D  PLL           K S R+ + E DD
Sbjct  1169  DATPLL-----------KNSKRERSLEDDD  1187



>gb|KHN10176.1| Leucine-rich repeat receptor-like protein kinase PXL2 [Glycine 
soja]
Length=231

 Score =   138 bits (347),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 97/138 (70%), Gaps = 4/138 (3%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHT-SLAEWAWKNYAEASNIDEM  546
            + PEYAY+T++NEK+D+YSFGVVLLELVTGR+PN G EH  SL EWAW +++E  ++ + 
Sbjct  96   IPPEYAYSTKINEKVDVYSFGVVLLELVTGRKPNKGGEHACSLVEWAWDHFSEGKSLTDA  155

Query  545  LDGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNC  366
             D +IK   +  +M +VF L L+CTS+ PS+RPS K+++ +L+ C       R+ +G   
Sbjct  156  FDEDIKDECYAVQMTSVFKLALLCTSSLPSTRPSAKDILLVLRQCCHSGSTCRR-AGNEF  214

Query  365  DVAPLLARNDDKYVASYK  312
            D+APLL   D +Y+ SYK
Sbjct  215  DIAPLLG--DTRYIYSYK  230



>ref|XP_004245388.2| PREDICTED: receptor-like protein kinase 2 [Solanum lycopersicum]
Length=807

 Score =   145 bits (366),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            LAPEYAYT++VN KID+YSFGVVLLELVTGREP  G+EH +LA+WAW ++ E + + + +
Sbjct  699  LAPEYAYTSKVNAKIDVYSFGVVLLELVTGREPINGDEHINLAQWAWNHHEEGNPVVDAI  758

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQIL  420
            D EIK+A FL+EM ++F LGLICTS  PS+RPSMKEV+QIL
Sbjct  759  DEEIKEACFLNEMSSMFKLGLICTSTIPSARPSMKEVLQIL  799



>ref|XP_003549165.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
 gb|KHN24478.1| Receptor-like protein kinase HSL1 [Glycine soja]
Length=1009

 Score =   145 bits (367),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 71/149 (48%), Positives = 102/149 (68%), Gaps = 8/149 (5%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEY  TTRV+EKID++SFGVVLLEL TG+E N+G++H+SL+EWAW++     N++E+L
Sbjct  868   IAPEYVQTTRVSEKIDVFSFGVVLLELTTGKEANYGDQHSSLSEWAWRHVLIGGNVEELL  927

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC-RPLDEFERKMSGKNC  366
             D ++ +A + DEM TVF LG++CT+  P+SRPSM+E +QILQS   P    ++K  G   
Sbjct  928   DKDVMEAIYSDEMCTVFKLGVLCTATLPASRPSMREALQILQSLGEPFAYGDQKNFGHYY  987

Query  365   DVAPLLARNDDKYVASYKRSSRKIADESD  279
             D  PLL        +S K +   + D S+
Sbjct  988   DAIPLLK-------SSEKETRLDVVDHSE  1009



>ref|XP_004288894.1| PREDICTED: receptor-like protein kinase HSL1 [Fragaria vesca 
subsp. vesca]
Length=1013

 Score =   145 bits (366),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 93/125 (74%), Gaps = 3/125 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA++TRVNEKID+YSFGV+LLEL TGREPN G+EHTSLAEWAW++  E     + L
Sbjct  873  MAPEYAHSTRVNEKIDVYSFGVILLELTTGREPNEGDEHTSLAEWAWRHAQEGKPFGDAL  932

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D ++K+  ++DEM  VF LG++CT  +PS+RPSMKEV++IL+   P     R+ +G    
Sbjct  933  DQDVKEPCYMDEMNAVFKLGIMCTEKNPSNRPSMKEVLRILKETCP-APVRREKTGN--A  989

Query  362  VAPLL  348
             APLL
Sbjct  990  AAPLL  994



>gb|KHG19858.1| Receptor-like protein kinase HSL1 [Gossypium arboreum]
Length=1009

 Score =   145 bits (366),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 99/142 (70%), Gaps = 3/142 (2%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEA-SNIDEM  546
             LAPEYAYTT+VN K+D+YSFGVVLLELVTGRE N   E  SL + AW+N++E   +I E+
Sbjct  860   LAPEYAYTTKVNTKVDVYSFGVVLLELVTGREANSANESMSLVQKAWQNFSEGDKSIIEI  919

Query  545   LDGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNC  366
             LD E+K++  L+ M  V+ +G++CT ASPS+RPSMKEV+ +LQ   P D +  K  G   
Sbjct  920   LDPEVKESCCLEAMVMVYKVGIVCTRASPSTRPSMKEVLHVLQRWCPEDGWSTKRVGSEF  979

Query  365   DVAPLL--ARNDDKYVASYKRS  306
             D+APLL  A     Y +SYK S
Sbjct  980   DIAPLLGGASAGATYFSSYKNS  1001



>ref|XP_003631769.1| PREDICTED: receptor-like protein kinase HSL1 [Vitis vinifera]
Length=999

 Score =   145 bits (366),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 92/125 (74%), Gaps = 4/125 (3%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYTT+VNEKID+YSFGVVLLELVTGREPN   EH  L EWAW  + E   I+E++
Sbjct  875  IAPEYAYTTKVNEKIDVYSFGVVLLELVTGREPN--NEHMCLVEWAWDQFREGKTIEEVV  932

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D EIK+     ++ T+F LGL+CT+  PS+RP+MKEV++ILQ C P ++  RK   K+ +
Sbjct  933  DEEIKEQCDRAQVTTLFNLGLMCTTTLPSTRPTMKEVLEILQQCNPQEDHGRK--KKDHE  990

Query  362  VAPLL  348
              PLL
Sbjct  991  ATPLL  995



>emb|CBI20586.3| unnamed protein product [Vitis vinifera]
Length=822

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYTT+VNEKID+YSFGVVLLELVTGREPN G+EH  L EWAW  + E   I+E++
Sbjct  85   IAPEYAYTTKVNEKIDVYSFGVVLLELVTGREPNSGDEHMCLVEWAWDQFKEGKTIEEVM  144

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR  408
            D EIK+     ++ T+F+LGL+CT+  PS+RP+MKEV++IL+ C 
Sbjct  145  DEEIKEQCERAQVTTLFSLGLMCTTTLPSTRPTMKEVLEILRQCN  189


 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAE  591
            +APEYAYTT+VN+KID+YSFGVVLLELVTGREPN G+EH  LAE
Sbjct  779  IAPEYAYTTKVNKKIDVYSFGVVLLELVTGREPNNGDEHMCLAE  822



>gb|KEH27213.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=1015

 Score =   145 bits (365),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 74/147 (50%), Positives = 101/147 (69%), Gaps = 7/147 (5%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEY  TT+V+EKID+YSFGV+LLEL TG+E N+G+EH+SLAEW+W++    SNI+E+L
Sbjct  876   MAPEYIQTTKVSEKIDVYSFGVILLELTTGKEANYGDEHSSLAEWSWRHIQAGSNIEELL  935

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D E+ +   L+ M  VF LG++CTS  PSSRPSMKEV+++L +C  L  +  +  G   D
Sbjct  936   DKEVMEPSHLNGMCKVFKLGVMCTSTLPSSRPSMKEVLEVLLNCGELFGYAERNIGLIND  995

Query  362   VAPLLARNDDKYVASYKRSSRKIADES  282
               PLL RN      S + S   I D+S
Sbjct  996   GVPLL-RN------SKRESKLDIDDDS  1015



>ref|XP_003548596.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=1013

 Score =   145 bits (365),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 73/151 (48%), Positives = 103/151 (68%), Gaps = 12/151 (8%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEY  TTRV+EKID++SFGV+LLEL TG+E N+G+EH+SLAEWAW++    SNI+E+L
Sbjct  875   MAPEYVQTTRVSEKIDVFSFGVMLLELTTGKEANYGDEHSSLAEWAWRHQQLGSNIEELL  934

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D ++ +  +LD M  VF LG++CT+  PSSRPSMKEV+++L SC   D F +  S     
Sbjct  935   DKDVMETSYLDGMCKVFKLGIMCTATLPSSRPSMKEVLRVLLSCE--DSFSKGES-----  987

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDDDN  270
                ++   DD  V   K S R+   + D+D+
Sbjct  988   ---IIGHYDD--VPLLKNSKREHKLDIDNDS  1013



>gb|KHN16978.1| Receptor-like protein kinase HSL1 [Glycine soja]
Length=1013

 Score =   145 bits (365),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 73/151 (48%), Positives = 103/151 (68%), Gaps = 12/151 (8%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEY  TTRV+EKID++SFGV+LLEL TG+E N+G+EH+SLAEWAW++    SNI+E+L
Sbjct  875   MAPEYVQTTRVSEKIDVFSFGVMLLELTTGKEANYGDEHSSLAEWAWRHQQLGSNIEELL  934

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D ++ +  +LD M  VF LG++CT+  PSSRPSMKEV+++L SC   D F +  S     
Sbjct  935   DKDVMETSYLDGMCKVFKLGIMCTATLPSSRPSMKEVLRVLLSCE--DSFSKGES-----  987

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDDDN  270
                ++   DD  V   K S R+   + D+D+
Sbjct  988   ---IIGHYDD--VPLLKNSKREHKLDIDNDS  1013



>ref|XP_006596181.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X1 
[Glycine max]
Length=1032

 Score =   144 bits (362),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 108/158 (68%), Gaps = 5/158 (3%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEH-TSLAEWAWKNYAEASNIDEM  546
             + PEYAYTT+++EK D+YSFGVVLLELVTG+EP  G +H T+L +WAW++Y E   + + 
Sbjct  878   IPPEYAYTTKIDEKADVYSFGVVLLELVTGKEPYSGGQHATNLVDWAWQHYREGKCLTDA  937

Query  545   LDGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQIL-QSCRPLDEFERKMSGKN  369
              D EI +  +++EM TVF LGL CTS  PS+RPSMKE++Q+L + C P     R+  G  
Sbjct  938   SDEEIIETSYVEEMITVFKLGLGCTSRLPSNRPSMKEILQVLRECCYPSASNGRRRVGIG  997

Query  368   CDVAPLLARNDDKYVASYKRSSRKIADESDDDNLMFSV  255
              D+A  L   D  YV+SYK S+ K   E ++++ ++SV
Sbjct  998   FDIA--LLHGDTTYVSSYKDSNNKAISE-NEESCLYSV  1032



>ref|XP_002441406.1| hypothetical protein SORBIDRAFT_09g026090 [Sorghum bicolor]
 gb|EES19836.1| hypothetical protein SORBIDRAFT_09g026090 [Sorghum bicolor]
Length=1051

 Score =   143 bits (361),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 70/127 (55%), Positives = 89/127 (70%), Gaps = 4/127 (3%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APE AYT +VNEK+D+YSFGVVLLEL TGRE N G EH SLA+WAW++     +ID+  
Sbjct  897   MAPECAYTRKVNEKVDVYSFGVVLLELTTGREANDGGEHGSLADWAWRHLQSGKSIDDAA  956

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDE--FERKMSGKN  369
             D  I  AG+ DE+  VF LG+ICT   PSSRP+MK V+QILQ C    +  F+ K++  +
Sbjct  957   DKHIADAGYGDEVEAVFKLGIICTGRQPSSRPTMKGVLQILQRCEQAHQKTFDEKVA--D  1014

Query  368   CDVAPLL  348
              D APLL
Sbjct  1015  YDNAPLL  1021



>gb|KHM99760.1| LRR receptor-like serine/threonine-protein kinase HSL2 [Glycine 
soja]
Length=766

 Score =   142 bits (358),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 103/149 (69%), Gaps = 8/149 (5%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEY  TTRV+EKID++SFGVVLLEL TG+E N+G++H+SL+EWAW++     N++E+L
Sbjct  625  IAPEYVQTTRVSEKIDVFSFGVVLLELTTGKEANYGDQHSSLSEWAWRHVLIGGNVEELL  684

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC-RPLDEFERKMSGKNC  366
            D ++ +A + DEM TVF LG++CT+  P+SRPSM+E +QIL+S   P    ++K  G   
Sbjct  685  DKDVMEAIYSDEMCTVFKLGVLCTATLPASRPSMREALQILKSLGEPFAYGDQKKFGHYY  744

Query  365  DVAPLLARNDDKYVASYKRSSRKIADESD  279
            D  PLL        +S K +   +A+ S+
Sbjct  745  DAIPLLK-------SSEKETRLNVANHSE  766



>gb|KDP33797.1| hypothetical protein JCGZ_07368 [Jatropha curcas]
Length=835

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA T+RVNEK D+YSFGVVLLEL T +E NFG+E+T LA+WAW+   E   I + L
Sbjct  679  IAPEYAVTSRVNEKTDVYSFGVVLLELTTRKEANFGDENTCLADWAWRYMNEGKAIVDAL  738

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D EIK+A +LD+M  VF LG+ CTS  PS+RPSM+EV+QIL  CR    +  + +G+  D
Sbjct  739  DKEIKEASYLDKMTIVFKLGVRCTSKLPSARPSMREVLQILVRCRNPLAYGLEENGREND  798

Query  362  VAPLL  348
             APL 
Sbjct  799  DAPLF  803



>emb|CBI27997.3| unnamed protein product [Vitis vinifera]
Length=750

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 93/126 (74%), Gaps = 1/126 (1%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APE A+T RV+EK D+YSFGV+LLELVTGRE + G+EHT L EWAW++  E  +  + L
Sbjct  606  MAPESAHTARVSEKTDVYSFGVILLELVTGREASDGDEHTCLVEWAWQHIQEGKHTADAL  665

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQI-LQSCRPLDEFERKMSGKNC  366
            D EIK+  +LDEM +VF LG+ICT   PS+RPSM++V++I LQ   PL+ +  + +G+  
Sbjct  666  DKEIKEPCYLDEMSSVFKLGIICTGTLPSTRPSMRKVLKILLQYSNPLEVYGGENTGREY  725

Query  365  DVAPLL  348
            D APLL
Sbjct  726  DAAPLL  731



>ref|XP_007152973.1| hypothetical protein PHAVU_004G175900g [Phaseolus vulgaris]
 gb|ESW24967.1| hypothetical protein PHAVU_004G175900g [Phaseolus vulgaris]
Length=1005

 Score =   142 bits (358),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 70/151 (46%), Positives = 100/151 (66%), Gaps = 10/151 (7%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEY  TTRV+EKID++SFGVVLLEL TG+E N+G+EH+SLAEW+W++    S I+E+L
Sbjct  864   MAPEYVQTTRVSEKIDVFSFGVVLLELTTGKEANYGDEHSSLAEWSWRHIIVGSKIEELL  923

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D +     + +EM +VF LG++CTS  P++RPSMKEV+ IL + R    F    + + CD
Sbjct  924   DNDFMDPSYTNEMCSVFKLGVLCTSTLPANRPSMKEVLHILVTIREGFAFGEG-NVRQCD  982

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDDDN  270
               PLL  +         R   ++ D SD+D+
Sbjct  983   GVPLLKNS---------RWKSRLDDASDNDS  1004



>ref|XP_004287478.1| PREDICTED: receptor-like protein kinase HSL1 [Fragaria vesca 
subsp. vesca]
Length=1013

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA++TRVN KID+YSFGVVLLEL TGREPN G+EHTSLAEWAW++  E   I + L
Sbjct  873  MAPEYAHSTRVNGKIDVYSFGVVLLELTTGREPNEGDEHTSLAEWAWRHGQEGKPIADAL  932

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRP  405
            D ++K+  ++DEM  VF LG++CT  +PS+RPSM+EV+ IL +  P
Sbjct  933  DQDVKEPCYMDEMNAVFKLGIMCTEKNPSNRPSMREVLHILVNTCP  978



>ref|XP_008390801.1| PREDICTED: receptor-like protein kinase 5 [Malus domestica]
Length=668

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA+TTRVNEKID+YSFGV+LLEL TG+E N G+EHT+ AEWAW++  E + I + L
Sbjct  527  MAPEYAHTTRVNEKIDVYSFGVILLELTTGKEANDGDEHTAXAEWAWRHVQEENAIADAL  586

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC-RPLDEFER  387
            D ++K+  +LDEM +VF LGL CT   P+SRPSMK V+QIL  C RP+   E+
Sbjct  587  DQDVKEPCYLDEMCSVFKLGLSCTETLPASRPSMKVVLQILLRCSRPVINGEK  639



>ref|XP_010110882.1| Receptor-like protein kinase HSL1 [Morus notabilis]
 gb|EXC28701.1| Receptor-like protein kinase HSL1 [Morus notabilis]
Length=1055

 Score =   142 bits (358),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 76/147 (52%), Positives = 98/147 (67%), Gaps = 13/147 (9%)
 Frame = -3

Query  713   EYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEMLDGE  534
             EYA++TRVNEKID+YSFGVVLLEL TGRE N G+EHTSLAEWAW++  +   I++ LD E
Sbjct  914   EYAHSTRVNEKIDVYSFGVVLLELATGREANSGDEHTSLAEWAWRHVQDDKPIEDALDEE  973

Query  533   IKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQ-ILQSCRPLDEFERKMSGKNCDVA  357
             IK   +++EM  VF LG+ CT+  PS+RPSMK+V+Q +L+  R +   E K  G   D A
Sbjct  974   IKDPIYVEEMSCVFKLGIYCTTTLPSTRPSMKDVLQLLLRHSRQMANGE-KFVGTEYDAA  1032

Query  356   PLLARNDDKYVASYKRSSRKIADESDD  276
             PLL           K S R+ + E DD
Sbjct  1033  PLL-----------KNSKRERSLEDDD  1048



>gb|KHN18142.1| Receptor-like protein kinase HSL1 [Glycine soja]
Length=857

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 98/141 (70%), Gaps = 4/141 (3%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHT-SLAEWAWKNYAEASNIDEM  546
            + PEYAY+T++NEK+D+YSFGVVLLELVTGR PN   +H  SL EWAW++++E  +I + 
Sbjct  712  IPPEYAYSTKINEKVDVYSFGVVLLELVTGRNPNKAGDHACSLVEWAWEHFSEGKSITDA  771

Query  545  LDGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNC  366
             D +IK   + ++M +VF L L+CTS+ PS+RPS KE++Q+L  C       R++ G   
Sbjct  772  FDEDIKDPCYAEQMTSVFKLALLCTSSLPSTRPSTKEILQVLHRCCHSGSTRRRV-GNEF  830

Query  365  DVAPLLARNDDKYVASYKRSS  303
            ++ PLL   D +Y+ SYK S+
Sbjct  831  NITPLLG--DTRYIYSYKESN  849



>gb|KJB07471.1| hypothetical protein B456_001G026000 [Gossypium raimondii]
Length=1011

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 102/151 (68%), Gaps = 2/151 (1%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEA-SNIDEM  546
             LAPEYAYTT+VN K+D+YSFGVVLLELVTGRE N   +  SL + AW+N++E   +I E+
Sbjct  860   LAPEYAYTTKVNTKVDVYSFGVVLLELVTGREANSANDSMSLVQKAWQNFSEGDKSIIEI  919

Query  545   LDGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNC  366
             LD E+K++  L  M  V+ +G++CT ASPS+RPSMKEV+ +LQ   P D +  K  G   
Sbjct  920   LDPEVKESCCLGAMIMVYKVGIVCTRASPSTRPSMKEVLHVLQRWCPEDGWSTKRVGSEF  979

Query  365   DVAPLLARNDDKYVASYKRSSRKIADESDDD  273
             DVAPLL        A+Y  SS K ++E  +D
Sbjct  980   DVAPLLGGAGAAAGATY-FSSYKNSEEGSED  1009



>emb|CDX80548.1| BnaC07g28960D [Brassica napus]
Length=906

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 103/147 (70%), Gaps = 9/147 (6%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYT++V+EKID+YSFGVVLLELVTGRE N G+EHT+LA+W+W++Y     I E  
Sbjct  765  IAPEYAYTSKVDEKIDVYSFGVVLLELVTGREGNNGDEHTNLADWSWRHYQSKKPITEAF  824

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D +IK+A   +EM TVF LGL+CT+  PS RPSMKEV+ +L+  + L   ++  +     
Sbjct  825  DEDIKEASSTEEMTTVFKLGLMCTNTLPSHRPSMKEVLYVLRQ-QGLGGAQK--TAAEAP  881

Query  362  VAPLLARNDDKYVASYKRSSRKIADES  282
             APLL         S +R+S+++ADE+
Sbjct  882  EAPLLVS------LSGRRTSKRVADEA  902



>ref|XP_008354538.1| PREDICTED: receptor-like protein kinase HSL1 [Malus domestica]
Length=1016

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA+TTRVNEKID+YSFGV+LLEL TGRE   G+EHT+LAEWAW++  E + I + L
Sbjct  875  MAPEYAHTTRVNEKIDVYSFGVILLELTTGREAXXGDEHTALAEWAWRHXXEENAIXDAL  934

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC-RPLDEFER  387
            D ++K+  +LDEM +VF LGL CT   P+SRPSMK V+QIL  C RP+   E+
Sbjct  935  DQDVKEPCYLDEMCSVFKLGLSCTEXLPASRPSMKVVLQILLRCSRPVINGEK  987



>emb|CAN69391.1| hypothetical protein VITISV_000950 [Vitis vinifera]
Length=1041

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 97/134 (72%), Gaps = 4/134 (3%)
 Frame = -3

Query  713   EYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEMLDGE  534
             EYAYTT+VN+KID+YSFGVVLLELVTGREPN G+EH  LAEWAW  + E   I+E++D E
Sbjct  911   EYAYTTKVNKKIDVYSFGVVLLELVTGREPNNGDEHVCLAEWAWDQFREEKTIEEVMDEE  970

Query  533   IKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCDVAP  354
             IK+     ++ T+F LG+ CT+  PS+RP+MK V++ILQ C P +   R  + K+ +VAP
Sbjct  971   IKEECDRAQVATLFKLGIRCTNKLPSNRPTMKGVLKILQQCSPQEGHGR--NKKDHEVAP  1028

Query  353   LLARNDDKYVASYK  312
              L RN D Y  +YK
Sbjct  1029  PL-RN-DTYPTTYK  1040



>ref|XP_003527853.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=1021

 Score =   141 bits (356),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 98/141 (70%), Gaps = 4/141 (3%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHT-SLAEWAWKNYAEASNIDEM  546
             + PEYAY+T++NEK+D+YSFGVVLLELVTGR PN   +H  SL EWAW++++E  +I + 
Sbjct  876   IPPEYAYSTKINEKVDVYSFGVVLLELVTGRNPNKAGDHACSLVEWAWEHFSEGKSITDA  935

Query  545   LDGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNC  366
              D +IK   + ++M +VF L L+CTS+ PS+RPS KE++Q+L  C       R++ G   
Sbjct  936   FDEDIKDPCYAEQMTSVFKLALLCTSSLPSTRPSTKEILQVLHRCCHSGSTRRRV-GNEF  994

Query  365   DVAPLLARNDDKYVASYKRSS  303
             ++ PLL   D +Y+ SYK S+
Sbjct  995   NITPLLG--DTRYIYSYKESN  1013



>ref|XP_002280395.1| PREDICTED: receptor-like protein kinase 5 [Vitis vinifera]
Length=1021

 Score =   141 bits (356),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 93/126 (74%), Gaps = 1/126 (1%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APE A+T RV+EK D+YSFGV+LLELVTGRE + G+EHT L EWAW++  E  +  + L
Sbjct  877   MAPESAHTARVSEKTDVYSFGVILLELVTGREASDGDEHTCLVEWAWQHIQEGKHTADAL  936

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQI-LQSCRPLDEFERKMSGKNC  366
             D EIK+  +LDEM +VF LG+ICT   PS+RPSM++V++I LQ   PL+ +  + +G+  
Sbjct  937   DKEIKEPCYLDEMSSVFKLGIICTGTLPSTRPSMRKVLKILLQYSNPLEVYGGENTGREY  996

Query  365   DVAPLL  348
             D APLL
Sbjct  997   DAAPLL  1002



>ref|XP_010047666.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2 
[Eucalyptus grandis]
Length=202

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 82/126 (65%), Gaps = 0/126 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            LAPEYA+TT+VNEKID+YSFGVVLLEL TGRE    +E   L +WAW++  +   I + +
Sbjct  57   LAPEYAHTTKVNEKIDVYSFGVVLLELTTGREAKGRDEDMCLVDWAWRHILDGKAISDAI  116

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D EI    FL E+ +VF LG+ CT   PS RP MK+VVQ L  C        + S +N D
Sbjct  117  DEEINHDSFLGEISSVFKLGIFCTVERPSKRPPMKKVVQALLKCSDRLYVVEQTSRRNLD  176

Query  362  VAPLLA  345
            VAPLLA
Sbjct  177  VAPLLA  182



>emb|CDY05337.1| BnaC02g40450D [Brassica napus]
Length=972

 Score =   141 bits (355),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 99/146 (68%), Gaps = 9/146 (6%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYT++V+EKID+YSFGVVLLELVTGRE N G+EHT+LA+W+W++Y     I+E L
Sbjct  831  IAPEYAYTSKVDEKIDVYSFGVVLLELVTGREGNKGDEHTNLADWSWRHYQSGKPIEEAL  890

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D +I +    +EM TVF LGL+CT+  P +RP+MKEV+ +L   R     E K +     
Sbjct  891  DEDINEPSNTEEMTTVFKLGLMCTNTLPGNRPTMKEVLYML---RQQGHGETKKTATEAH  947

Query  362  VAPLLARNDDKYVASYKRSSRKIADE  285
             APLL         S +R+S++I DE
Sbjct  948  EAPLLVS------LSGRRTSKRIEDE  967



>ref|XP_010648289.1| PREDICTED: receptor-like protein kinase HSL1 [Vitis vinifera]
Length=1008

 Score =   141 bits (355),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 85/113 (75%), Gaps = 2/113 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYTT+VNEKID+YSFGVVLLELVTGREPN   EH  L EWAW  + E   I+E++
Sbjct  875  IAPEYAYTTKVNEKIDVYSFGVVLLELVTGREPN--SEHMCLVEWAWDQFREGKTIEEVV  932

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERK  384
            D EIK+     ++ T+F LGL+CT+  PS+RP+MKEV++IL+ C P  +  RK
Sbjct  933  DEEIKEQCNRAQVTTLFNLGLMCTTTLPSTRPTMKEVLEILRQCNPQKDHGRK  985



>ref|XP_009627680.1| PREDICTED: receptor-like protein kinase 5 [Nicotiana tomentosiformis]
Length=1015

 Score =   141 bits (355),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 72/149 (48%), Positives = 96/149 (64%), Gaps = 11/149 (7%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYA TT+VNEKID+YSFGV+LLELVTG+E N+G+E + LA+WAW+   +   I  +L
Sbjct  871   IAPEYARTTKVNEKIDVYSFGVILLELVTGKEANYGDEDSCLADWAWRRIQQGYPIVNVL  930

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D  IK+  +LDEM  VF LG+ CTS  PSSRP+MK+V+QIL  C        K +    D
Sbjct  931   DETIKEPQYLDEMCNVFKLGIFCTSTFPSSRPTMKQVLQILLQCNNTLVSGEKKNETERD  990

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDD  276
              +PLL           K S R+  +++DD
Sbjct  991   ASPLL-----------KNSRRERIEDNDD  1008



>ref|XP_004501091.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X1 
[Cicer arietinum]
Length=1030

 Score =   141 bits (355),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 71/164 (43%), Positives = 110/164 (67%), Gaps = 22/164 (13%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHT-SLAEWAWKNYAEASNIDEM  546
             + PEYAY+T+++EK+D+YSFGVVLLELVTGREPN G ++  SL +WAW++Y+E   I + 
Sbjct  881   IPPEYAYSTKIDEKVDVYSFGVVLLELVTGREPNNGGDNACSLVDWAWQHYSEGKCITDA  940

Query  545   LDGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNC  366
              D +I++  +  EM +VF LGL+CTS  PS+RPS KE++Q+L+ C          SG  C
Sbjct  941   FDEDIRETSYAAEMTSVFKLGLMCTSTLPSTRPSTKEILQVLRQCS---------SGSTC  991

Query  365   -------DVAPLLARNDDKYVASYKRSSRKIADESDDDNLMFSV  255
                    D+ PL+   +  Y++SYK  SR +++  ++++ ++SV
Sbjct  992   NRLATEFDITPLIG--NTTYISSYK-DSRTVSE--NEESCLYSV  1030



>emb|CDX80547.1| BnaC07g28970D [Brassica napus]
Length=902

 Score =   140 bits (354),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 102/147 (69%), Gaps = 9/147 (6%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYT++V+EKID+YSFGVVLLELVTGRE N G+EHT+LA+W+W++Y     I E  
Sbjct  761  IAPEYAYTSKVDEKIDVYSFGVVLLELVTGREGNNGDEHTNLADWSWRHYQSKKPITEAF  820

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D +I  A   +EM T+F LGL+CT+  PS RPSMKEV+ +L+  + L+E +R  +     
Sbjct  821  DEDINDASNTEEMTTLFKLGLMCTNTLPSHRPSMKEVLYVLRQ-QGLEETKR--TATEAH  877

Query  362  VAPLLARNDDKYVASYKRSSRKIADES  282
             APLL         S +R+S+++ DE+
Sbjct  878  EAPLLVS------LSGRRTSKRVEDEA  898



>ref|XP_007152971.1| hypothetical protein PHAVU_004G175700g [Phaseolus vulgaris]
 gb|ESW24965.1| hypothetical protein PHAVU_004G175700g [Phaseolus vulgaris]
Length=1011

 Score =   140 bits (354),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA TTRVNEKID+YSFGVVLLEL TG+E N G+E++SLAEW+W++    ++++++L
Sbjct  872  IAPEYAQTTRVNEKIDVYSFGVVLLELTTGKEANHGDEYSSLAEWSWRHIELGTDVEDIL  931

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC  411
            D EIK+A ++DE+  +F LG++CT+  P+SRPSMKEV++IL +C
Sbjct  932  DKEIKEACYMDEICNIFKLGVMCTATLPASRPSMKEVLKILLNC  975



>ref|XP_008362962.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
5 [Malus domestica]
Length=1018

 Score =   140 bits (354),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA+TTRVNEKID+YSFGV+LLEL T RE N G+EH +LAEWAW+++ E + I + L
Sbjct  877  MAPEYAHTTRVNEKIDVYSFGVILLELTTRREANAGDEHXALAEWAWRHFQEENAIADAL  936

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC-RPLDEFER  387
            D ++K+  +LDEM +VF LGL CT   P+SRPSMK V+QIL  C RP+   E+
Sbjct  937  DQDVKEPCYLDEMCSVFKLGLXCTERLPASRPSMKVVLQILLRCSRPVINGEK  989



>ref|XP_007152972.1| hypothetical protein PHAVU_004G175800g [Phaseolus vulgaris]
 gb|ESW24966.1| hypothetical protein PHAVU_004G175800g [Phaseolus vulgaris]
Length=1016

 Score =   140 bits (353),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 65/121 (54%), Positives = 94/121 (78%), Gaps = 4/121 (3%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEY  TTRV+EKID++SFGV+LLEL TG+E N+G+EH+SLAEWAW+++   SNI+E+L
Sbjct  878  MAPEYIQTTRVSEKIDVFSFGVILLELTTGKEANYGDEHSSLAEWAWRHHQLGSNIEELL  937

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFER-KMSGKNC  366
            D E+ ++     M  VF LG++CT+  PS+RPSMKEV+Q+L SC   +EF + +++  +C
Sbjct  938  DREVMESSNSGGMCKVFKLGVMCTATLPSTRPSMKEVLQVLLSC---EEFSKGEINIGHC  994

Query  365  D  363
            D
Sbjct  995  D  995



>ref|XP_003603644.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES73895.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=1033

 Score =   140 bits (353),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 69/157 (44%), Positives = 105/157 (67%), Gaps = 7/157 (4%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHT-SLAEWAWKNYAEASNIDEM  546
             + PEYAY+TR++EK+D+YSFGVVLLELVTGREPN+G E+  SL +WAW++  E   + + 
Sbjct  883   IPPEYAYSTRIDEKVDVYSFGVVLLELVTGREPNYGGENACSLVDWAWQHCNEGKCVTDA  942

Query  545   LDGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNC  366
              D  +++  + +EM  VF LGL+CTS  PS+RPS KE++Q+L+ C       ++MS    
Sbjct  943   FDEVMRETRYAEEMTKVFKLGLMCTSTLPSTRPSTKEILQVLRQCCSSSSTRKRMS-IEV  1001

Query  365   DVAPLLARNDDKYVASYKRSSRKIADESDDDNLMFSV  255
             D+ PLL   +  Y++SYK S        ++++ ++SV
Sbjct  1002  DITPLLG--NTTYISSYKDSR---TGSENEESCLYSV  1033



>ref|XP_006364731.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g17230-like [Solanum tuberosum]
Length=709

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            LAPEYAYT++VN KID+YSFGVVLLELVTGREP  G+EH +LA+ AW ++ E + + + +
Sbjct  601  LAPEYAYTSKVNAKIDVYSFGVVLLELVTGREPINGDEHINLAQRAWNHHEEGNPVVDAI  660

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQIL  420
            D EIK+A FL+EM ++F LG+ICTS  PS+RPSMKEV+QIL
Sbjct  661  DEEIKEACFLNEMSSMFKLGIICTSTVPSARPSMKEVLQIL  701



>ref|XP_010095356.1| Leucine-rich repeat receptor-like protein kinase PXL2 [Morus 
notabilis]
 gb|EXB59775.1| Leucine-rich repeat receptor-like protein kinase PXL2 [Morus 
notabilis]
Length=182

 Score =   131 bits (330),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA T R NEKID+YSFGVVLLEL TGRE   G+E+TSLA+WAW++  E   I+E L
Sbjct  77   IAPEYARTARANEKIDVYSFGVVLLELATGREAREGDEYTSLAQWAWRHLQEDKPIEEAL  136

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC  411
            D +IK+   ++EM  VF LG+ICT   PS+RPSMK+V+ +L  C
Sbjct  137  DEDIKEPNNVEEMSCVFKLGIICTGTQPSTRPSMKDVLTVLLRC  180



>ref|XP_009759980.1| PREDICTED: receptor-like protein kinase 5 [Nicotiana sylvestris]
Length=1042

 Score =   140 bits (353),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 97/149 (65%), Gaps = 11/149 (7%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYA TT+VNEKID+YSFGV+LLELVTG+E N+G+E + LA+WAW+   +   I  +L
Sbjct  898   IAPEYARTTKVNEKIDVYSFGVILLELVTGKEANYGDEDSCLADWAWRRIQQGYPIVNVL  957

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D  IK+  +LDEM  VF LG+ CTS  PSSRP+MK+V+QIL  C     +  K +    D
Sbjct  958   DEAIKEPQYLDEMSNVFKLGIFCTSTFPSSRPTMKQVLQILFQCNNTLVYGEKKNETERD  1017

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDD  276
              +PLL           K S R+  +++DD
Sbjct  1018  ASPLL-----------KNSRRERIEDNDD  1035



>gb|KEH27215.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=1012

 Score =   140 bits (352),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 95/126 (75%), Gaps = 3/126 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA T RVNEKID+YSFGVVLLEL TG+E N G+E +SLAEWAW++    ++I+E+L
Sbjct  876  IAPEYAQTIRVNEKIDVYSFGVVLLELTTGKEANHGDEFSSLAEWAWRHIQIGTDIEELL  935

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR-PLDEFERKMSGKNC  366
            D +  +   ++EM ++F LG++CTS  P+SRPSMKEVV+IL++C+ PL   E+ +     
Sbjct  936  DDDAMEPSNVEEMCSIFKLGVMCTSTLPASRPSMKEVVKILRNCKDPLANVEKIVDIY--  993

Query  365  DVAPLL  348
            D APLL
Sbjct  994  DAAPLL  999



>emb|CDY05509.1| BnaA02g31820D [Brassica napus]
Length=966

 Score =   139 bits (351),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 98/146 (67%), Gaps = 9/146 (6%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYT++V+EKID+YSFGVVLLELVTGRE N G+EHT+LA+W+W++Y     I+E  
Sbjct  825  IAPEYAYTSKVDEKIDVYSFGVVLLELVTGREGNKGDEHTNLADWSWRHYQSGKPIEEAF  884

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D +IK+    +EM TVF LGL+CT+  P +RP+MKEV+ +L   R     E K       
Sbjct  885  DEDIKEPSNTEEMTTVFQLGLMCTNTLPGNRPTMKEVLYML---RQQVHGETKKIATEAH  941

Query  362  VAPLLARNDDKYVASYKRSSRKIADE  285
             APLL         S +R+S++I DE
Sbjct  942  EAPLLVS------LSGRRTSKRIEDE  961



>gb|KCW79626.1| hypothetical protein EUGRSUZ_C00986 [Eucalyptus grandis]
Length=893

 Score =   139 bits (350),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 88/126 (70%), Gaps = 2/126 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            LAPEYA+TTRVNEKID+YSFGVVLLEL TGRE N G+E   LA+W W++  + + I + L
Sbjct  748  LAPEYAHTTRVNEKIDVYSFGVVLLELTTGREANDGDEDMCLADWTWRHIQDGNPISDAL  807

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR-PLDEFERKMSGKNC  366
            D EIK    +DE+  VF LG+ CT+  PS+RP+MKEV+Q+L  C  PL   E+K   K  
Sbjct  808  DEEIKDESNIDEISNVFKLGIFCTATLPSTRPTMKEVLQVLLKCSDPLYNVEKKSRHK-F  866

Query  365  DVAPLL  348
            D  PLL
Sbjct  867  DAVPLL  872



>ref|XP_004513051.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X1 
[Cicer arietinum]
Length=1012

 Score =   139 bits (351),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA T RVNEKID+YSFGVVLLEL TG+E N G+E++SLAEWAW++    SNI+++L
Sbjct  876  IAPEYAQTIRVNEKIDVYSFGVVLLELTTGKEANHGDEYSSLAEWAWRHIQIGSNIEDLL  935

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR-PLDEFERKMSGKNC  366
            D +  +   L+EM ++F LG++CTS  P+SRPSMKEV++IL +C+ P    E+ +S    
Sbjct  936  DDDAAEPSNLEEMCSIFKLGVMCTSTLPASRPSMKEVLKILVNCKDPHANVEKVVSIY--  993

Query  365  DVAPLL  348
            D  PLL
Sbjct  994  DAVPLL  999



>gb|KCW79628.1| hypothetical protein EUGRSUZ_C00987 [Eucalyptus grandis]
Length=873

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 89/126 (71%), Gaps = 2/126 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            LAPEYA+TTRVNEKID+YSFGVVLLEL TGRE N  +E   LA+WAW++  + + I + L
Sbjct  728  LAPEYAHTTRVNEKIDVYSFGVVLLELTTGREANDEDEDMCLADWAWRHIQDGNPISDAL  787

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR-PLDEFERKMSGKNC  366
            D EIK    +DE+  VF LG+ CT+  PS+RP+MKEV+Q+L  C  PL   E+K   K  
Sbjct  788  DEEIKDDSNIDEISNVFKLGIFCTATLPSTRPTMKEVLQVLLKCSDPLYNVEKKSRHK-F  846

Query  365  DVAPLL  348
            DV PLL
Sbjct  847  DVVPLL  852



>ref|XP_008242544.1| PREDICTED: receptor-like protein kinase HSL1 [Prunus mume]
Length=1858

 Score =   140 bits (352),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 67/107 (63%), Positives = 83/107 (78%), Gaps = 1/107 (1%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APE A+T RVNEKID+YSFGVVLLEL TGRE N G+EHT+LAEWAW +  E + + + L
Sbjct  1719  IAPECAHTIRVNEKIDVYSFGVVLLELTTGREANDGDEHTALAEWAWHHVQEDNPLADAL  1778

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC-RP  405
             D +IK+  +LDEM +VF LG+ CT   PS+RPSMKEV+QIL  C RP
Sbjct  1779  DKDIKEPCYLDEMCSVFRLGIYCTEKLPSARPSMKEVLQILLRCGRP  1825



>ref|XP_010047669.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=1020

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 88/126 (70%), Gaps = 2/126 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            LAPEYA+TTRVNEKID+YSFGVVLLEL TGRE N G+E   LA+W W++  + + I + L
Sbjct  875  LAPEYAHTTRVNEKIDVYSFGVVLLELTTGREANDGDEDMCLADWTWRHIQDGNPISDAL  934

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR-PLDEFERKMSGKNC  366
            D EIK    +DE+  VF LG+ CT+  PS+RP+MKEV+Q+L  C  PL   E+K   K  
Sbjct  935  DEEIKDESNIDEISNVFKLGIFCTATLPSTRPTMKEVLQVLLKCSDPLYNVEKKSRHK-F  993

Query  365  DVAPLL  348
            D  PLL
Sbjct  994  DAVPLL  999



>ref|XP_011078243.1| PREDICTED: receptor-like protein kinase HSL1 [Sesamum indicum]
Length=1018

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 91/143 (64%), Gaps = 8/143 (6%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYA T RVNEKID+YSFGV+LLEL+TGR+ + G+E +SLAEW W++  E   I + L
Sbjct  875   MAPEYAQTRRVNEKIDVYSFGVILLELITGRKAHSGDESSSLAEWVWRHVKEGKPIVDAL  934

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D +I +  +LDE+ TV  LGLICTS  PSSRP+MK+V+QIL  C    +   K      D
Sbjct  935   DEDINEPHYLDEINTVLKLGLICTSTFPSSRPAMKDVLQILLRCSQRLQTGEKTKRNEYD  994

Query  362   VAPLLAR--------NDDKYVAS  318
             V PLL          NDD    S
Sbjct  995   VTPLLQNSKPDRTLENDDSVFTS  1017



>ref|XP_007152512.1| hypothetical protein PHAVU_004G136500g [Phaseolus vulgaris]
 gb|ESW24506.1| hypothetical protein PHAVU_004G136500g [Phaseolus vulgaris]
Length=1003

 Score =   139 bits (350),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 61/125 (49%), Positives = 92/125 (74%), Gaps = 0/125 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEY  +TRV+EK+D++SFGV+LLEL TG+E ++G++H+SL+EWAW++     N++E+L
Sbjct  866  IAPEYVQSTRVSEKVDVFSFGVILLELTTGKEASYGDQHSSLSEWAWRHILIGGNVEELL  925

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D ++ +  +LDEM +VF LG++CT+  P+SRPSMK+ +QILQS      +  K  G   D
Sbjct  926  DKDVVEGSYLDEMCSVFKLGVMCTATLPTSRPSMKDALQILQSLGEPLFYGEKNFGHYYD  985

Query  362  VAPLL  348
              PLL
Sbjct  986  AIPLL  990



>gb|KCW79120.1| hypothetical protein EUGRSUZ_C00561 [Eucalyptus grandis]
Length=851

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 89/126 (71%), Gaps = 2/126 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            LAPEYA+TTRVNEKID+YSFGVVLLEL TGRE N  +E   LA+WAW++  + + I + L
Sbjct  706  LAPEYAHTTRVNEKIDVYSFGVVLLELTTGREANDRDEDMCLADWAWRHIQDGNPISDAL  765

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR-PLDEFERKMSGKNC  366
            D EIK    +DE+  VF LG+ CT+  PS+RP+MKEV+Q+L  C  PL   E+K   K  
Sbjct  766  DEEIKDDSNVDEISNVFKLGIFCTATLPSTRPTMKEVLQVLLKCSDPLYNVEKKSQHK-F  824

Query  365  DVAPLL  348
            DV PLL
Sbjct  825  DVVPLL  830



>gb|KCW79629.1| hypothetical protein EUGRSUZ_C00988 [Eucalyptus grandis]
Length=873

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 89/126 (71%), Gaps = 2/126 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            LAPEYA+TTRVNEKID+YSFGVVLLEL TG E N G+E   LA+WAW++  + + I + L
Sbjct  728  LAPEYAHTTRVNEKIDVYSFGVVLLELTTGSEANDGDEDMCLADWAWRHIQDGNPISDAL  787

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR-PLDEFERKMSGKNC  366
            D +IK    +DE+  VF LG+ CT+  PS+RP+MKEV+Q+L  C  PL   E+K   K  
Sbjct  788  DEDIKDDSNVDEISNVFKLGIFCTATLPSTRPTMKEVLQVLLKCSDPLYNVEKKSRHK-F  846

Query  365  DVAPLL  348
            DV PLL
Sbjct  847  DVVPLL  852



>ref|XP_010047671.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=1020

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 89/126 (71%), Gaps = 2/126 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            LAPEYA+TTRVNEKID+YSFGVVLLEL TGRE N  +E   LA+WAW++  + + I + L
Sbjct  875  LAPEYAHTTRVNEKIDVYSFGVVLLELTTGREANDEDEDMCLADWAWRHIQDGNPISDAL  934

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR-PLDEFERKMSGKNC  366
            D EIK    +DE+  VF LG+ CT+  PS+RP+MKEV+Q+L  C  PL   E+K   K  
Sbjct  935  DEEIKDDSNIDEISNVFKLGIFCTATLPSTRPTMKEVLQVLLKCSDPLYNVEKKSRHK-F  993

Query  365  DVAPLL  348
            DV PLL
Sbjct  994  DVVPLL  999



>ref|XP_010050387.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=1000

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 89/126 (71%), Gaps = 2/126 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            LAPEYA+TTRVNEKID+YSFGVVLLEL TGRE N  +E   LA+WAW++  + + I + L
Sbjct  855  LAPEYAHTTRVNEKIDVYSFGVVLLELTTGREANDRDEDMCLADWAWRHIQDGNPISDAL  914

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR-PLDEFERKMSGKNC  366
            D EIK    +DE+  VF LG+ CT+  PS+RP+MKEV+Q+L  C  PL   E+K   K  
Sbjct  915  DEEIKDDSNVDEISNVFKLGIFCTATLPSTRPTMKEVLQVLLKCSDPLYNVEKKSQHK-F  973

Query  365  DVAPLL  348
            DV PLL
Sbjct  974  DVVPLL  979



>gb|KHN40380.1| Receptor-like protein kinase HSL1 [Glycine soja]
Length=930

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 95/125 (76%), Gaps = 1/125 (1%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA TTRVNEKID+YSFGVVLLEL TG+E N G+E++ LAEWAW++    ++++++L
Sbjct  791  IAPEYAQTTRVNEKIDVYSFGVVLLELTTGKEANRGDEYSCLAEWAWRHIQIGTDVEDIL  850

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D EIK+A +++E+  +F LG++CT+  P+SRPSMKEV++IL +C  L     K +G   D
Sbjct  851  DEEIKEACYMEEICNIFRLGVMCTATLPASRPSMKEVLKILLTCSNLLTNGEKNAGF-YD  909

Query  362  VAPLL  348
              PLL
Sbjct  910  SIPLL  914



>ref|XP_003523755.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=1011

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 97/138 (70%), Gaps = 4/138 (3%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHT-SLAEWAWKNYAEASNIDEM  546
             + PEYAY+T++NEK+D+YSFGVVLLELVTGR+PN G EH  SL EWAW +++E  ++ + 
Sbjct  876   IPPEYAYSTKINEKVDVYSFGVVLLELVTGRKPNKGGEHACSLVEWAWDHFSEGKSLTDA  935

Query  545   LDGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNC  366
              D +IK   +  +M +VF L L+CTS+ PS+RPS K+++ +L+ C       R+ +G   
Sbjct  936   FDEDIKDECYAVQMTSVFKLALLCTSSLPSTRPSAKDILLVLRQCCHSGSTCRR-AGNEF  994

Query  365   DVAPLLARNDDKYVASYK  312
             D+APLL   D +Y+ SYK
Sbjct  995   DIAPLLG--DTRYIYSYK  1010



>ref|XP_003516786.2| PREDICTED: receptor-like protein kinase 5-like [Glycine max]
Length=1013

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 95/125 (76%), Gaps = 1/125 (1%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA TTRVNEKID+YSFGVVLLEL TG+E N G+E++ LAEWAW++    ++++++L
Sbjct  874  IAPEYAQTTRVNEKIDVYSFGVVLLELTTGKEANRGDEYSCLAEWAWRHIQIGTDVEDIL  933

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D EIK+A +++E+  +F LG++CT+  P+SRPSMKEV++IL +C  L     K +G   D
Sbjct  934  DEEIKEACYMEEICNIFRLGVMCTATLPASRPSMKEVLKILLTCSNLLTNGEKNAGF-YD  992

Query  362  VAPLL  348
              PLL
Sbjct  993  SIPLL  997



>ref|XP_010047673.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=1020

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 89/126 (71%), Gaps = 2/126 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            LAPEYA+TTRVNEKID+YSFGVVLLEL TG E N G+E   LA+WAW++  + + I + L
Sbjct  875  LAPEYAHTTRVNEKIDVYSFGVVLLELTTGSEANDGDEDMCLADWAWRHIQDGNPISDAL  934

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR-PLDEFERKMSGKNC  366
            D +IK    +DE+  VF LG+ CT+  PS+RP+MKEV+Q+L  C  PL   E+K   K  
Sbjct  935  DEDIKDDSNVDEISNVFKLGIFCTATLPSTRPTMKEVLQVLLKCSDPLYNVEKKSRHK-F  993

Query  365  DVAPLL  348
            DV PLL
Sbjct  994  DVVPLL  999



>ref|XP_010047253.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Eucalyptus grandis]
 gb|KCW79117.1| hypothetical protein EUGRSUZ_C00558 [Eucalyptus grandis]
Length=1026

 Score =   138 bits (347),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 87/132 (66%), Gaps = 2/132 (2%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             LAPEYA+TTRVNEKID+YSFGVVLLEL TGRE N G E   LA+WA  +  +   I   +
Sbjct  881   LAPEYAHTTRVNEKIDVYSFGVVLLELTTGREANNGTEDMCLADWARHHVQDGKPISNAI  940

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D +IK   +LDE+  VF LG+ CT+  PSSRP+MKEV+Q+L  C        K S  N D
Sbjct  941   DEKIKGNSYLDEVSNVFKLGIFCTATLPSSRPTMKEVLQLLLKCSDQLHNVEKKSRHNFD  1000

Query  362   VAPLLARNDDKY  327
             VAPLL   + KY
Sbjct  1001  VAPLLG--NSKY  1010



>ref|XP_004288893.1| PREDICTED: receptor-like protein kinase HSL1 [Fragaria vesca 
subsp. vesca]
Length=1012

 Score =   138 bits (347),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 83/105 (79%), Gaps = 1/105 (1%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA++ RVNEKID+YSFGVVLLEL TG+EPN G+EHTSLAEWAW++  E   I + L
Sbjct  873  MAPEYAHSARVNEKIDVYSFGVVLLELTTGKEPNEGDEHTSLAEWAWRHAQEGKPIADAL  932

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQIL-QSC  411
            D ++K+  ++DEM  VF LG+ CT  + S+RPSMKEV+ IL Q+C
Sbjct  933  DQDVKEPCYMDEMDAVFILGIRCTEKNHSNRPSMKEVLHILVQTC  977



>ref|XP_011007101.1| PREDICTED: receptor-like protein kinase 5 [Populus euphratica]
Length=982

 Score =   138 bits (347),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA T RVNEKID+YSFGVVLLEL TG+  N+G+E T LA+WAW++  E   ID++L
Sbjct  865  IAPEYAQTVRVNEKIDVYSFGVVLLELTTGKAANYGDEDTCLAKWAWRHMQEGKPIDDVL  924

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQIL  420
            D EIK+  ++DEMR VF LG+ CTS  PS RP+M+EVVQIL
Sbjct  925  DEEIKEPCYVDEMRDVFKLGVFCTSMLPSERPNMEEVVQIL  965



>ref|XP_007203859.1| hypothetical protein PRUPE_ppa022167mg [Prunus persica]
 gb|EMJ05058.1| hypothetical protein PRUPE_ppa022167mg [Prunus persica]
Length=1016

 Score =   138 bits (347),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APE A+TTRVNEKID+YSFGVVLLEL TGRE N G+EHTSLAEWAW+   E + + + L
Sbjct  878  IAPECAHTTRVNEKIDVYSFGVVLLELTTGREANDGDEHTSLAEWAWRLAQEDNPLADAL  937

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC  411
            D +IK+  +LDEM +VF LG+ CT   PS+RPSMK+V+QIL  C
Sbjct  938  DQDIKEPCYLDEMCSVFKLGIYCTEKLPSARPSMKDVLQILLQC  981



>ref|XP_010421450.1| PREDICTED: receptor-like protein kinase 5 [Camelina sativa]
Length=1007

 Score =   138 bits (347),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 96/146 (66%), Gaps = 9/146 (6%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYAYT++V+EKID+YSFGVVLLELVTGRE N G+EHT+LA+W+W++Y       E  
Sbjct  866   IAPEYAYTSKVDEKIDVYSFGVVLLELVTGREGNNGDEHTNLADWSWRHYQSGKPTAEAF  925

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D +IK+A   + M TVF LGL+CT+  PS RPSMKE++ +L   R       K +     
Sbjct  926   DEDIKEASMTEAMTTVFKLGLMCTNTLPSHRPSMKEILYVL---RQQGAEATKKTATEAH  982

Query  362   VAPLLARNDDKYVASYKRSSRKIADE  285
              APLL         S +R+S+++ DE
Sbjct  983   EAPLLVS------LSGRRTSKRVQDE  1002



>ref|XP_009795019.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana sylvestris]
Length=1018

 Score =   138 bits (347),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 73/140 (52%), Positives = 95/140 (68%), Gaps = 11/140 (8%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYA  TRV EK+D+YSFGV+LLELVT +E NFG+E + LA+WAW+   +   I ++L
Sbjct  873   IAPEYARKTRVTEKVDVYSFGVILLELVTRKEANFGDEDSCLADWAWRQLQKGHPIVDVL  932

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC--RPLDEFERKMSGKN  369
             D  IKK+ +LDE+ TVF LG+ CTS  PSSRP+MKEV+QIL  C        E+K   ++
Sbjct  933   DENIKKSLYLDEICTVFKLGIFCTSTFPSSRPTMKEVLQILLQCNNNSPTSGEKKDETEH  992

Query  368   CDVAPLL--------ARNDD  333
              DV+PLL        A NDD
Sbjct  993   -DVSPLLKNSRSERIAENDD  1011



>ref|XP_008242546.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
5 [Prunus mume]
Length=1100

 Score =   138 bits (347),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APE A+T RVNEKID+YSFGVVLLEL TGRE N G+EHT+LAEWAW++  E + + + L
Sbjct  959   IAPECAHTIRVNEKIDVYSFGVVLLELTTGREANDGDEHTALAEWAWRHVQEDNPLADAL  1018

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC  411
             D +IK+  +LDEM +VF LG+ CT   PS+RPSMKEV+QIL  C
Sbjct  1019  DKDIKEPCYLDEMCSVFRLGIYCTEKLPSTRPSMKEVLQILLRC  1062



>ref|XP_009601880.1| PREDICTED: receptor-like protein kinase 5 [Nicotiana tomentosiformis]
Length=1018

 Score =   137 bits (346),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 71/139 (51%), Positives = 91/139 (65%), Gaps = 9/139 (6%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYA  TRV EK+D+YSFGV+LLELVT +E NFG+E + LA+WAW++  +   I + L
Sbjct  873   IAPEYARKTRVTEKVDVYSFGVILLELVTSKEANFGDEDSCLADWAWRHLQKGHPIVDTL  932

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFE-RKMSGKNC  366
             D  IK++ +LDE+ TVF LG+ CTS  PSSRP+MKEV+QIL  C         K      
Sbjct  933   DENIKESRYLDEICTVFKLGIFCTSTFPSSRPTMKEVLQILIQCNNSSPTSGEKKDETEH  992

Query  365   DVAPLL--------ARNDD  333
             DV+PLL        A NDD
Sbjct  993   DVSPLLKNSRSERIAENDD  1011



>ref|XP_010047254.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
 gb|KCW79116.1| hypothetical protein EUGRSUZ_C00557 [Eucalyptus grandis]
Length=1020

 Score =   137 bits (346),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 86/125 (69%), Gaps = 0/125 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            LAPEYA+TTRVNEKID+YSFGVVLLEL TGRE N  +E   LA+WAW++  + + I + L
Sbjct  875  LAPEYAHTTRVNEKIDVYSFGVVLLELTTGREANDRDEDMCLADWAWRHIQDGNPISDAL  934

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D EIK    +DE+  VF LG+ CT+  PS+RP+MKEV+Q+L  C  L     K S    D
Sbjct  935  DEEIKDDSNVDEISNVFKLGIFCTATLPSTRPTMKEVLQVLLKCSDLLYNVEKKSRHKFD  994

Query  362  VAPLL  348
            V PLL
Sbjct  995  VVPLL  999



>ref|XP_010047668.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
 gb|KCW79625.1| hypothetical protein EUGRSUZ_C00984 [Eucalyptus grandis]
Length=1026

 Score =   137 bits (346),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 87/132 (66%), Gaps = 2/132 (2%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             LAPEYA+TTRVNEKID+YSFGVVLLEL TGRE N G E   LA+WA  +  +   I   +
Sbjct  881   LAPEYAHTTRVNEKIDVYSFGVVLLELTTGREANNGTEDMCLADWARHHVQDGKPISNAI  940

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D +IK   +LDE+  VF LG+ CT+  PSSRP+MKEV+Q+L  C        K S  N D
Sbjct  941   DEKIKGNSYLDEVSNVFKLGIFCTATLPSSRPTMKEVLQLLLKCGDQLHNVEKKSRHNFD  1000

Query  362   VAPLLARNDDKY  327
             VAPLL   + KY
Sbjct  1001  VAPLLG--NSKY  1010



>emb|CBI39978.3| unnamed protein product [Vitis vinifera]
Length=912

 Score =   137 bits (345),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYT + N+KID+YSFGVVLLEL TGRE N G EH +LA+WAW+++ E   I E L
Sbjct  798  IAPEYAYTRKANKKIDVYSFGVVLLELATGREANRGNEHMNLAQWAWQHFGEGKFIVEAL  857

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRP  405
            D EI +  +++EM  VF LGL+CTS  PS RPSM+EV+ IL  C P
Sbjct  858  DEEIMEECYMEEMSNVFKLGLMCTSKVPSDRPSMREVLLILDRCGP  903



>ref|XP_010536218.1| PREDICTED: receptor-like protein kinase HSL1 [Tarenaya hassleriana]
Length=1014

 Score =   137 bits (346),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 87/107 (81%), Gaps = 3/107 (3%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYT++VNEKID YSFGVVLLELVTGRE N G+EHT+LA+W+W++Y   + I +  
Sbjct  866  IAPEYAYTSKVNEKIDAYSFGVVLLELVTGREGNNGDEHTNLADWSWRHYQSGNPIPDAF  925

Query  542  DGEIKK--AGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQIL-QSC  411
            D +IK+  + +++EM TVF LGL+CTS  P+ RPSMKE+++IL QSC
Sbjct  926  DPDIKEELSSYIEEMTTVFKLGLMCTSTLPNHRPSMKEILRILHQSC  972



>ref|XP_010661160.1| PREDICTED: receptor-like protein kinase HSL1 [Vitis vinifera]
Length=1007

 Score =   137 bits (345),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYAYT + N+KID+YSFGVVLLEL TGRE N G EH +LA+WAW+++ E   I E L
Sbjct  896   IAPEYAYTRKANKKIDVYSFGVVLLELATGREANRGNEHMNLAQWAWQHFGEGKFIVEAL  955

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRP  405
             D EI +  +++EM  VF LGL+CTS  PS RPSM+EV+ IL  C P
Sbjct  956   DEEIMEECYMEEMSNVFKLGLMCTSKVPSDRPSMREVLLILDRCGP  1001



>gb|KDP33799.1| hypothetical protein JCGZ_07370 [Jatropha curcas]
Length=968

 Score =   137 bits (345),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 88/125 (70%), Gaps = 0/125 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA T+RVNEK D+YSFGVVLLEL T +E NFG+E+T L +WA     E   I + L
Sbjct  812  IAPEYAVTSRVNEKTDVYSFGVVLLELTTRKEANFGDENTCLTDWARLYMNEGKAIVDAL  871

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D EIK+A +LDEM  VF LG+ CTS SPS+RPSM+EV+QIL  CR    +  + +G+  D
Sbjct  872  DKEIKEASYLDEMTIVFKLGVRCTSKSPSARPSMREVLQILVRCRNPLAYGLEENGREND  931

Query  362  VAPLL  348
             APL 
Sbjct  932  DAPLF  936



>ref|XP_006394841.1| hypothetical protein EUTSA_v10003585mg [Eutrema salsugineum]
 gb|ESQ32127.1| hypothetical protein EUTSA_v10003585mg [Eutrema salsugineum]
Length=1005

 Score =   137 bits (345),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 99/146 (68%), Gaps = 9/146 (6%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYT++V+EKID+YSFGVVLLELVTGRE N G+EHT+LA+W+W +Y       E  
Sbjct  864  IAPEYAYTSKVDEKIDVYSFGVVLLELVTGREGNNGDEHTNLADWSWGHYQSGKPTAEAF  923

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D +IK+A   +EM TVF LGL+CT+  PS RPSMKEV+ +L+  + L+    K +     
Sbjct  924  DEDIKEASKTEEMTTVFKLGLMCTNTLPSHRPSMKEVLYVLRQ-QGLE--ATKKTATEAH  980

Query  362  VAPLLARNDDKYVASYKRSSRKIADE  285
             APLL         S +R+S+++ DE
Sbjct  981  EAPLLVS------LSGRRTSKRVEDE  1000



>ref|XP_010519875.1| PREDICTED: receptor-like protein kinase 5 [Tarenaya hassleriana]
Length=1009

 Score =   137 bits (345),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 85/104 (82%), Gaps = 2/104 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYT++VNEKID+YSFGVVLLELVTGRE N G+EHT+LA+W+W++Y   + I E  
Sbjct  866  IAPEYAYTSKVNEKIDVYSFGVVLLELVTGREGNNGDEHTNLADWSWRHYQTGNPIQEAF  925

Query  542  DGEIKK--AGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQ  417
            D +I++  + + +EM+ VF LGL+CTSA P+ RPSMKEV+ +L+
Sbjct  926  DRDIRQDSSSYAEEMKRVFKLGLMCTSALPNHRPSMKEVLHVLE  969



>ref|XP_010454934.1| PREDICTED: receptor-like protein kinase 5 [Camelina sativa]
Length=1007

 Score =   137 bits (345),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 96/146 (66%), Gaps = 9/146 (6%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYAYT++V+EKID+YSFGVVLLELVTGRE N G+EHT+LA+W+W++Y       E  
Sbjct  866   IAPEYAYTSKVDEKIDVYSFGVVLLELVTGREGNNGDEHTNLADWSWRHYQSGKPTAEAF  925

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D +IK+A   + M TVF LGL+CT+  PS RPSMKE++ +L   R       K +     
Sbjct  926   DEDIKEASTTEAMTTVFKLGLMCTNTLPSHRPSMKEILYVL---RQQGADATKKTATEAQ  982

Query  362   VAPLLARNDDKYVASYKRSSRKIADE  285
              APLL         S +R+S+++ DE
Sbjct  983   EAPLLVS------LSGRRTSKRVQDE  1002



>ref|XP_009151111.1| PREDICTED: receptor-like protein kinase 5 [Brassica rapa]
Length=1006

 Score =   137 bits (344),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 99/146 (68%), Gaps = 9/146 (6%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYAYT++V+EKID+YSFGVVLLELVTGRE N G+EHT+LA+W+W++Y     I E  
Sbjct  865   IAPEYAYTSKVDEKIDVYSFGVVLLELVTGREGNNGDEHTNLADWSWRHYQSKKPITEAF  924

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D +IK A   +EM TVF LGL+CT+  PS RPSMKEV+ +L+  + L+    K +     
Sbjct  925   DEDIKGASNTEEMTTVFKLGLMCTNTLPSHRPSMKEVLYVLRQ-QGLE--GAKKTAAEAP  981

Query  362   VAPLLARNDDKYVASYKRSSRKIADE  285
              APLL         S +R+S++  DE
Sbjct  982   EAPLLVS------LSGRRASKRAEDE  1001



>ref|NP_197965.1| protein kinase family protein with leucine-rich repeat domain 
[Arabidopsis thaliana]
 gb|AAD40144.1|AF149413_25 contains similarity to protein kinase domains (Pfam F00069, Score=162.6, 
E=6.8e-45, N=1) and leucien rich repeats (Pfam PF00560, 
Score=210.7, E=2.2e-59, N=10) [Arabidopsis thaliana]
 gb|AAO42089.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|ACN59374.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED93502.1| protein kinase family protein with leucine-rich repeat domain 
[Arabidopsis thaliana]
Length=1005

 Score =   137 bits (344),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 99/146 (68%), Gaps = 9/146 (6%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYT++V+EKID+YSFGVVLLELVTGRE N G+EHT+LA+W+WK+Y       E  
Sbjct  864  IAPEYAYTSKVDEKIDVYSFGVVLLELVTGREGNNGDEHTNLADWSWKHYQSGKPTAEAF  923

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D +IK+A   + M TVF LGL+CT+  PS RPSMKEV+ +L+  + L+    K +     
Sbjct  924  DEDIKEASTTEAMTTVFKLGLMCTNTLPSHRPSMKEVLYVLRQ-QGLE--ATKKTATEAY  980

Query  362  VAPLLARNDDKYVASYKRSSRKIADE  285
             APLL         S +R+S+++ DE
Sbjct  981  EAPLLVS------LSGRRTSKRVEDE  1000



>ref|XP_002872190.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48449.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=1005

 Score =   137 bits (344),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 96/146 (66%), Gaps = 9/146 (6%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYT++V+EKID+YSFGVVLLELVTGRE N G+EHT+LA+W+W++Y       E  
Sbjct  864  IAPEYAYTSKVDEKIDVYSFGVVLLELVTGREGNNGDEHTNLADWSWRHYQSGKPTAEAF  923

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D +IK+A   + M TVF LGL+CT+  PS RPSMKE++ +L   R       K +     
Sbjct  924  DEDIKEASTTEAMTTVFKLGLMCTNTLPSHRPSMKEILYVL---RQQGLGATKKTATEAH  980

Query  362  VAPLLARNDDKYVASYKRSSRKIADE  285
             APLL         S +R+S+++ DE
Sbjct  981  EAPLLVS------LSGRRTSKRVEDE  1000



>ref|XP_006372068.1| hypothetical protein POPTR_0018s09520g, partial [Populus trichocarpa]
 gb|ERP49865.1| hypothetical protein POPTR_0018s09520g, partial [Populus trichocarpa]
Length=955

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA T RVNEKID+YSFGVVLLEL TG+  N+G+E T LAEWAW++  E   I ++L
Sbjct  854  IAPEYARTVRVNEKIDVYSFGVVLLELTTGKAANYGDEDTCLAEWAWRHMQEGKPIVDVL  913

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQIL  420
            D EIK+  ++DEMR VF LG+ CTS  PS RP+MK+VVQIL
Sbjct  914  DEEIKEPCYVDEMRDVFKLGVFCTSMLPSERPNMKDVVQIL  954



>ref|XP_010915378.1| PREDICTED: receptor-like protein kinase HSL1 [Elaeis guineensis]
Length=1033

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 94/149 (63%), Gaps = 7/149 (5%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APE  Y  +++EK+D++SFGVVLLELVTGRE N G EH  LA+WAW  Y E S + +++
Sbjct  882   MAPECGYLRKIDEKVDVFSFGVVLLELVTGREANDGGEHGCLADWAWHRYQEGSRLIDII  941

Query  542   DGEIKKA-GFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNC  366
             D EI+ A  +LDEM  VF LGL CT  +PS RPSMKEV+Q+L  C P  E   ++  +  
Sbjct  942   DEEIQNALLYLDEMEVVFRLGLFCTGKTPSGRPSMKEVLQVLIKCDPRLEAPNRLH-REF  1000

Query  365   DVAPLLARNDDKYVASYKRSSRKIADESD  279
             D APLL           +R S   ADE +
Sbjct  1001  DAAPLLQTKKGS-----RRESLSDADEGE  1024



>ref|XP_008649910.1| PREDICTED: receptor-like protein kinase HSL1 [Zea mays]
 gb|AFW78821.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1084

 Score =   136 bits (343),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 72/152 (47%), Positives = 94/152 (62%), Gaps = 9/152 (6%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APE  YT +VNEK+D+YSFGVVLLEL TGR  N G EH SLA+WAW++     +I E  
Sbjct  931   MAPESVYTRKVNEKVDVYSFGVVLLELTTGRLANDGGEHGSLADWAWRHLQSGKSIAEAA  990

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDE--FERKMSGKN  369
             D  I  AG+ D++  VF LG+ICT   PSSRP+MK V+QILQ C    +  F+ K++  +
Sbjct  991   DKSIADAGYGDQVEAVFKLGIICTGRQPSSRPTMKGVLQILQRCEQAHQRTFDEKVA--D  1048

Query  368   CDVAPLLARNDDKYVASYKRSSRKIADESDDD  273
              D APLL  +        +R     A+  DDD
Sbjct  1049  YDAAPLLQVH-----GGSRRKQLSDAEVIDDD  1075



>ref|XP_010493845.1| PREDICTED: receptor-like protein kinase 5 isoform X1 [Camelina 
sativa]
 ref|XP_010493847.1| PREDICTED: receptor-like protein kinase 5 isoform X2 [Camelina 
sativa]
Length=1007

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 96/147 (65%), Gaps = 9/147 (6%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYAYT++V+EKID+YSFGVVLLELVTGRE N G+EHT+LA+W+W+ Y       E  
Sbjct  866   IAPEYAYTSKVDEKIDVYSFGVVLLELVTGREGNNGDEHTNLADWSWRQYQSGKPTAEAF  925

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D +IK+A   + M TVF LGL+CT+  P+ RPSMKE++ +L   R       K +     
Sbjct  926   DEDIKEASTTEAMTTVFKLGLMCTNTLPTHRPSMKEILYVL---RQQGAEATKKTATEAH  982

Query  362   VAPLLARNDDKYVASYKRSSRKIADES  282
              APLL         S +R+S+++ DE+
Sbjct  983   EAPLLVS------LSGRRTSKRVQDEA  1003



>ref|XP_002324453.1| hypothetical protein POPTR_0018s09510g [Populus trichocarpa]
 gb|EEF03018.1| hypothetical protein POPTR_0018s09510g [Populus trichocarpa]
Length=982

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA T RVNEKID+YSFGVVLLEL TG+  N+G+E T LAEWAW++  E   I ++L
Sbjct  865  IAPEYARTVRVNEKIDVYSFGVVLLELTTGKAANYGDEDTCLAEWAWRHMQEGKPIVDVL  924

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQIL  420
            D EIK+  ++DEMR VF LG+ CTS  PS RP+MK+VVQIL
Sbjct  925  DEEIKEPCYVDEMRDVFKLGVFCTSMLPSERPNMKDVVQIL  965



>ref|XP_010050476.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
5 [Eucalyptus grandis]
Length=916

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            LAPEYA+TTRVNEKID+YSFGVVLLEL TG E N G+E   LA+WAW++  + + I + L
Sbjct  771  LAPEYAHTTRVNEKIDVYSFGVVLLELTTGSEANDGDEDMCLADWAWRHIEDGNPISDAL  830

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR-PLDEFERKMSGKNC  366
            D EIK    +DE+  VF L + CT+  PS+RP+MKEV+Q+L  C+ PL   E+K S    
Sbjct  831  DEEIKDDSNVDEISKVFKLEIFCTATLPSTRPTMKEVLQMLLKCKDPLYNVEKK-SRHEF  889

Query  365  DVAPLLARNDDKYV  324
            DV PLL  ++ + V
Sbjct  890  DVVPLLENSEHEEV  903



>ref|XP_010050391.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=883

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 89/132 (67%), Gaps = 2/132 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            LAPEYA+TTR NEKID+YSFGVVLLEL TGR+ N G+E   LA+W   +      I + +
Sbjct  728  LAPEYAHTTRANEKIDVYSFGVVLLELTTGRKANDGKEGMGLADWTCCHIQHGKPISDAI  787

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR-PLDEFERKMSGKNC  366
            D EIK + +LDE+  VF LG+ CT+  PS RP+MKEVVQ+L  C  PL   E+K+   + 
Sbjct  788  DEEIKDSSYLDEIINVFKLGIFCTATRPSMRPAMKEVVQMLLRCSDPLHNVEKKLQ-HSL  846

Query  365  DVAPLLARNDDK  330
            D +PLL  + +K
Sbjct  847  DASPLLGNSKNK  858



>ref|XP_002324455.2| hypothetical protein POPTR_0018s09540g [Populus trichocarpa]
 gb|EEF03020.2| hypothetical protein POPTR_0018s09540g [Populus trichocarpa]
Length=984

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA T RVNEKID+YSFGVVLLEL TG+  N+G+E T LA+WAW++  E   I ++L
Sbjct  867  IAPEYAQTVRVNEKIDVYSFGVVLLELTTGKAANYGDEDTCLAKWAWRHMQEGKPIVDVL  926

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQIL  420
            D E+K+  ++DEMR VF LG+ CTS  PS RP+MKEVVQIL
Sbjct  927  DEEVKEPCYVDEMRDVFKLGVFCTSMLPSERPNMKEVVQIL  967



>ref|XP_007203495.1| hypothetical protein PRUPE_ppa022516mg, partial [Prunus persica]
 gb|EMJ04694.1| hypothetical protein PRUPE_ppa022516mg, partial [Prunus persica]
Length=866

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA+TTRVNEKID+YS+GV+LLEL TGRE N G+EHTSLAEWA  ++ E   + + L
Sbjct  744  IAPEYAHTTRVNEKIDVYSYGVILLELTTGREANDGDEHTSLAEWARHHFQENYPLVDAL  803

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC  411
            D +IK+  +LDEM +VF LG+ CT   PS+RPSMKEV+ IL  C
Sbjct  804  DQDIKEPCYLDEMCSVFKLGIYCTETLPSARPSMKEVLHILLRC  847



>ref|XP_002324456.2| hypothetical protein POPTR_0018s09550g [Populus trichocarpa]
 gb|EEF03021.2| hypothetical protein POPTR_0018s09550g [Populus trichocarpa]
Length=1010

 Score =   135 bits (341),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 73/148 (49%), Positives = 90/148 (61%), Gaps = 11/148 (7%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYA T RVNEK D+YSFGVVLLEL TG+  N+G+EHT LA+WA ++  E   I + L
Sbjct  867   IAPEYAQTVRVNEKTDVYSFGVVLLELTTGKAANYGDEHTGLAKWALRHMQEGKTIVDAL  926

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D EIK+  ++DEM  VF LG+ CTS  PS+RP MKEV+QIL        +  K  G   D
Sbjct  927   DDEIKEPCYVDEMSNVFLLGVFCTSEVPSARPHMKEVLQILLGRNHPLVYGVKNIGSEYD  986

Query  362   VAPLLARNDDKYVASYKRSSRKIADESD  279
               PLL           K S R+   ESD
Sbjct  987   STPLL-----------KNSKREGQSESD  1003



>ref|XP_009619690.1| PREDICTED: receptor-like protein kinase 5 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009619691.1| PREDICTED: receptor-like protein kinase 5 isoform X2 [Nicotiana 
tomentosiformis]
Length=1044

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 95/149 (64%), Gaps = 11/149 (7%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYA TT+VNEKID+YSFGV+LLELVTG+E N+G+E + LA+WAW+   +   I  +L
Sbjct  900   IAPEYARTTKVNEKIDVYSFGVILLELVTGKEANYGDEDSCLADWAWRRIQQGYPIVNVL  959

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
                IK+  +LDEM  VF LG+ CTS  PSSRP+MK+V+QIL  C        K +    D
Sbjct  960   HEAIKEPQYLDEMSNVFKLGIFCTSTFPSSRPTMKQVLQILLQCNNTLVSGEKKNETERD  1019

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDD  276
              +PLL           K S R+  +++DD
Sbjct  1020  ASPLL-----------KNSRRERIEDNDD  1037



>ref|XP_003548595.1| PREDICTED: receptor-like protein kinase 5-like [Glycine max]
Length=1011

 Score =   135 bits (341),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEY  TTRV+EKID++SFGV+LLEL TG+E N+G+EH+SLAEWAW+     SNI+E+L
Sbjct  869  MAPEYVQTTRVSEKIDVFSFGVILLELTTGKEANYGDEHSSLAEWAWRQIIVGSNIEELL  928

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC  411
            D +     + +EM +VF LG++CTS  P+ RPSMKEV+ IL  C
Sbjct  929  DIDFMDPSYKNEMCSVFKLGVLCTSTLPAKRPSMKEVLHILLRC  972



>gb|KHN16977.1| Receptor-like protein kinase HSL1 [Glycine soja]
Length=1011

 Score =   135 bits (341),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEY  TTRV+EKID++SFGV+LLEL TG+E N+G+EH+SLAEWAW+     SNI+E+L
Sbjct  869  MAPEYVQTTRVSEKIDVFSFGVILLELTTGKEANYGDEHSSLAEWAWRQIIVGSNIEELL  928

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC  411
            D +     + +EM +VF LG++CTS  P+ RPSMKEV+ IL  C
Sbjct  929  DIDFMDPSYKNEMCSVFKLGVLCTSTLPAKRPSMKEVLHILLRC  972



>gb|KCW79123.1| hypothetical protein EUGRSUZ_C00564, partial [Eucalyptus grandis]
Length=958

 Score =   135 bits (340),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 89/132 (67%), Gaps = 2/132 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            LAPEYA+TTR NEKID+YSFGVVLLEL TGR+ N G+E   LA+W   +      I + +
Sbjct  824  LAPEYAHTTRANEKIDVYSFGVVLLELTTGRKANDGKEGMGLADWTCCHIQHGKPISDAI  883

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR-PLDEFERKMSGKNC  366
            D EIK + +LDE+  VF LG+ CT+  PS RP+MKEVVQ+L  C  PL   E+K+   + 
Sbjct  884  DEEIKDSSYLDEIINVFKLGIFCTATRPSMRPAMKEVVQMLLRCSDPLHNVEKKLQ-HSL  942

Query  365  DVAPLLARNDDK  330
            D +PLL  + +K
Sbjct  943  DASPLLGNSKNK  954



>ref|XP_007204807.1| hypothetical protein PRUPE_ppa019571mg [Prunus persica]
 gb|EMJ06006.1| hypothetical protein PRUPE_ppa019571mg [Prunus persica]
Length=1018

 Score =   135 bits (340),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APE A+T RVNEKID+YSFGVVLLEL TGRE N  +EHT+LAEWAW++  E + + + L
Sbjct  877  IAPECAHTIRVNEKIDVYSFGVVLLELTTGREANDSDEHTALAEWAWRHVQEDNPLADAL  936

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC  411
            D +IK+  +LDEM +VF LG+ CT   PS+RPSMKEV+QIL  C
Sbjct  937  DKDIKEPCYLDEMCSVFRLGIYCTEKLPSTRPSMKEVLQILLRC  980



>ref|XP_006286985.1| hypothetical protein CARUB_v10000132mg [Capsella rubella]
 gb|EOA19883.1| hypothetical protein CARUB_v10000132mg [Capsella rubella]
Length=1006

 Score =   135 bits (340),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 96/146 (66%), Gaps = 9/146 (6%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYAYT++V+EKID+YSFGVVLLELVTGRE N G+EHT+LA+W+W++Y       E  
Sbjct  865   IAPEYAYTSKVDEKIDVYSFGVVLLELVTGREGNNGDEHTNLADWSWRHYQSGKPTAEAF  924

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D +IK+A   + M TVF LGL+CT+  PS RPSMKE++ +L   R       K +     
Sbjct  925   DEDIKEASTAEAMTTVFKLGLMCTNTLPSHRPSMKEILYVL---RQQGADATKKTVTEAH  981

Query  362   VAPLLARNDDKYVASYKRSSRKIADE  285
              APLL         S +R+S+++ DE
Sbjct  982   EAPLLIS------LSGRRTSKRVQDE  1001



>ref|XP_008242543.1| PREDICTED: receptor-like protein kinase HSL1 [Prunus mume]
Length=938

 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 85/113 (75%), Gaps = 1/113 (1%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APE A+T RVNEKID+YSFGVVLLEL TGRE N G+EHTSLAEWAW+   E + + + L
Sbjct  806  IAPECAHTIRVNEKIDVYSFGVVLLELTTGREANDGDEHTSLAEWAWRLAQEDNPLADAL  865

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC-RPLDEFER  387
            D +IK+  +LD+M +VF LG+ CT   PS+RPSMK+V+QIL  C  P+   E+
Sbjct  866  DQDIKEPCYLDDMCSVFKLGIYCTEKLPSARPSMKDVLQILLRCNHPVVHIEK  918



>ref|XP_009151112.1| PREDICTED: receptor-like protein kinase 5 [Brassica rapa]
Length=904

 Score =   135 bits (339),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYT++V+EKID+YSFGVVLLELVTGRE N G+EHT+LA+W+W++Y     I E  
Sbjct  762  IAPEYAYTSKVDEKIDVYSFGVVLLELVTGREGNNGDEHTNLADWSWRHYQSKKPITEAF  821

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQ  417
            D  IK A   +EM TVF LGL+CT+  PS RPSMK+V+ +L+
Sbjct  822  DENIKGASNTEEMATVFKLGLMCTTTLPSHRPSMKQVLYVLR  863



>gb|KFK26382.1| hypothetical protein AALP_AA8G241000 [Arabis alpina]
Length=1011

 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 95/146 (65%), Gaps = 9/146 (6%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYAYT++V+EKID+YSFGVVLLELVTGRE N G+EHT+LA+W+W++Y     + E  
Sbjct  869   IAPEYAYTSKVDEKIDVYSFGVVLLELVTGREGNNGDEHTNLADWSWRHYQTGRPVAEAF  928

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D +I +A   +EM TVF LGL+CT+  PS RPSMKE++ +L   R       K +     
Sbjct  929   DEDISEASMTEEMTTVFKLGLMCTNTLPSHRPSMKEILYVL---RQQGSEATKKTATEAH  985

Query  362   VAPLLARNDDKYVASYKRSSRKIADE  285
              APLL         S +R+S ++  E
Sbjct  986   EAPLLVS------LSGRRTSNRVEAE  1005



>ref|XP_010047672.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=985

 Score =   134 bits (338),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            LAPEYA+TTRVNEKID+YSFGVVLLEL TGRE N G+E   LA+WAW++  + + I + L
Sbjct  875  LAPEYAHTTRVNEKIDVYSFGVVLLELTTGREANDGDEDMCLADWAWRHIQDGNPISDAL  934

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC  411
            D EIK    +DE+  VF LG+ CT+  PS+RP+MKEV+Q+L  C
Sbjct  935  DEEIKHDSNVDEISNVFKLGIFCTATLPSTRPTMKEVLQVLLKC  978



>ref|XP_009600836.1| PREDICTED: receptor-like protein kinase 5 [Nicotiana tomentosiformis]
Length=405

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA T +VN K DIYSFGVVLLEL TGREP   +E  +LA+W+ +++ E ++I E L
Sbjct  297  IAPEYASTFKVNVKTDIYSFGVVLLELATGREPIIRDEQMNLAQWSQQHFREGNSIVEAL  356

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR  408
            DGEI +A  L++M +VF LGL+CT A PS RPSMK+V  ILQSCR
Sbjct  357  DGEIIEATNLEQMTSVFKLGLMCTGALPSGRPSMKDVCHILQSCR  401



>gb|EYU30701.1| hypothetical protein MIMGU_mgv1a000689mg [Erythranthe guttata]
Length=1017

 Score =   134 bits (337),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 90/131 (69%), Gaps = 0/131 (0%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYA T RV+EKID+YSFGVVLLEL+TGRE + G+E++SLA+WAW++  +   I + L
Sbjct  874   MAPEYAQTRRVSEKIDVYSFGVVLLELITGREAHSGDENSSLADWAWRHVQQGKPIIDAL  933

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D +IK+  + +++ TV  LG ICTS  PSSRP+M +V+QIL  C        K +    D
Sbjct  934   DEDIKEPTYFEDINTVLKLGFICTSKFPSSRPAMTDVLQILLRCSQRLPLADKTNRNEYD  993

Query  362   VAPLLARNDDK  330
              APLL  ++ K
Sbjct  994   AAPLLLNSNSK  1004



>emb|CDX88206.1| BnaA06g27970D [Brassica napus]
Length=1007

 Score =   134 bits (336),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYT++V+EKID+YSFGVVLLELVTGRE N G+EHT+LA+W+W++Y     I E  
Sbjct  865  IAPEYAYTSKVDEKIDVYSFGVVLLELVTGREGNNGDEHTNLADWSWRHYQSKKPITEAF  924

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQ  417
              +IK+A   +EM TVF LGL+CT+  PS RPSMKEV+ +L+
Sbjct  925  AEDIKEASNTEEMTTVFKLGLMCTNTLPSHRPSMKEVLYVLR  966



>ref|XP_004245385.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
HSL2 [Solanum lycopersicum]
Length=683

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA T +VN K DIYS+GVVLLEL TGREP   +E  +LAEWA + Y E ++I + L
Sbjct  575  IAPEYASTFKVNVKTDIYSYGVVLLELTTGREPVLRDEQMNLAEWALQRYREGNSILDAL  634

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR  408
            D E+ +   L++MR+VF LGL+CT ASPS RPSMKEV  +LQSCR
Sbjct  635  DKEVMETSNLEQMRSVFKLGLMCTGASPSGRPSMKEVCYVLQSCR  679



>ref|XP_007203222.1| hypothetical protein PRUPE_ppa000737mg [Prunus persica]
 gb|EMJ04421.1| hypothetical protein PRUPE_ppa000737mg [Prunus persica]
Length=1018

 Score =   133 bits (335),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APE A+  RVNEKID+YSFGVVLLEL TG+E N G+EHT+LAEWAW++  E + + + L
Sbjct  877  IAPECAHRIRVNEKIDVYSFGVVLLELTTGKEANNGDEHTALAEWAWRHVQEDNPLADAL  936

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC  411
            D +IK+  +LDEM +VF LG+ CT   PS+RPSMK+V QIL  C
Sbjct  937  DKDIKEPSYLDEMCSVFRLGIYCTEKLPSARPSMKDVTQILLRC  980



>emb|CBI20580.3| unnamed protein product [Vitis vinifera]
Length=1269

 Score =   134 bits (336),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 80/102 (78%), Gaps = 2/102 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYTT+VNEKID+YSFGVVLLELVTGREPN   EH  L EWAW  + E   I+E++
Sbjct  688  IAPEYAYTTKVNEKIDVYSFGVVLLELVTGREPN--NEHMCLVEWAWDQFREGKTIEEVV  745

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQ  417
            D EIK+     ++ T+F LGL+CT+  PS+RP+MKEV++ILQ
Sbjct  746  DEEIKEQCDRAQVTTLFNLGLMCTTTLPSTRPTMKEVLEILQ  787



>ref|XP_011008121.1| PREDICTED: receptor-like protein kinase 5 [Populus euphratica]
Length=1012

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 90/148 (61%), Gaps = 11/148 (7%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYA T RVNEK D+YSFGVVLLEL +G+  N+G+EHT LA+WA ++  E   I + L
Sbjct  869   IAPEYAQTVRVNEKTDVYSFGVVLLELTSGKAANYGDEHTGLAKWALRHMQEGKTIVDAL  928

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D EIK+  ++DEM  VF LG+ CTS  PS+RP MKEV+QIL        +  K  G   D
Sbjct  929   DEEIKEPCYVDEMSNVFLLGVFCTSEVPSARPHMKEVLQILLGRNHPLVYGMKNIGSEYD  988

Query  362   VAPLLARNDDKYVASYKRSSRKIADESD  279
               PLL           K S R+   ESD
Sbjct  989   STPLL-----------KNSKRERQSESD  1005



>ref|XP_011014419.1| PREDICTED: receptor-like protein kinase 5 [Populus euphratica]
Length=1012

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 90/148 (61%), Gaps = 11/148 (7%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYA T RVNEK D+YSFGVVLLEL +G+  N+G+EHT LA+WA ++  E   I + L
Sbjct  869   IAPEYAQTVRVNEKTDVYSFGVVLLELTSGKAANYGDEHTGLAKWALRHMQEGKTIVDAL  928

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D EIK+  ++DEM  VF LG+ CTS  PS+RP MKEV+QIL        +  K  G   D
Sbjct  929   DEEIKEPCYVDEMSNVFLLGVFCTSEVPSARPHMKEVLQILLGRNHPLVYGMKNIGSEYD  988

Query  362   VAPLLARNDDKYVASYKRSSRKIADESD  279
               PLL           K S R+   ESD
Sbjct  989   STPLL-----------KNSKRERQSESD  1005



>ref|XP_004961447.1| PREDICTED: receptor-like protein kinase HSL1-like [Setaria italica]
Length=1057

 Score =   133 bits (334),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 86/128 (67%), Gaps = 5/128 (4%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APE AY+ +VNEK+D+YSFGVVLLEL TGRE N G EH SLA+WAW++      I +  
Sbjct  901   MAPECAYSRKVNEKVDVYSFGVVLLELTTGREANDGGEHGSLADWAWRHLQSGRRIADAA  960

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGK---  372
             D  I+ AG+ D++  VF LG+ICT   PS+RP+MK+V+QILQ C      +R    K   
Sbjct  961   DKCIRDAGYGDDVEAVFKLGIICTGRQPSTRPTMKDVLQILQRCE--QAHQRAADEKVAA  1018

Query  371   NCDVAPLL  348
             + D APLL
Sbjct  1019  DYDAAPLL  1026



>emb|CBI20579.3| unnamed protein product [Vitis vinifera]
Length=730

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYT + N+KID+YSFGVVLLEL TGRE N G EH +LA+WAW+++ E  +I E L
Sbjct  580  IAPEYAYTRKANKKIDVYSFGVVLLELATGREANRGNEHMNLAQWAWQHFGEGKSIVEAL  639

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKE  435
            D EI +  F++EM TVF LGL+CTS +PS RPSM+E
Sbjct  640  DEEIMEECFMEEMITVFKLGLMCTSKAPSDRPSMRE  675



>ref|XP_004251639.1| PREDICTED: receptor-like protein kinase 5 [Solanum lycopersicum]
Length=1008

 Score =   132 bits (333),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 71/154 (46%), Positives = 96/154 (62%), Gaps = 12/154 (8%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYA  TRV EKID+YSFGV+LLELVTG+E N G+E + LA+WAW++  +   + + L
Sbjct  863   IAPEYARKTRVTEKIDVYSFGVILLELVTGKEANLGDEDSCLADWAWRHLQKGKPMADAL  922

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFE-RKMSGKNC  366
             D +IK+  +L+E+  VF LG+ CTS  PSSRP+MKEV+QIL  C         K +    
Sbjct  923   DEDIKETRYLEEIFIVFKLGIFCTSTFPSSRPTMKEVLQILIQCNNSSPTSGEKKNETEQ  982

Query  365   DVAPLLARNDDKYVASYKRSSRKIADESDDDNLM  264
             DV PLL           K S  +  +E+DD  L+
Sbjct  983   DVLPLL-----------KNSRSERIEENDDVGLI  1005



>gb|KDP33800.1| hypothetical protein JCGZ_07371 [Jatropha curcas]
Length=978

 Score =   132 bits (333),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA T+RVNEK D+YSFGVVLLEL TG++ NFG+E+T L +WAW+   E   I  +L
Sbjct  857  IAPEYAATSRVNEKTDVYSFGVVLLELTTGKKANFGDENTCLVDWAWRYMNEGKAIVNVL  916

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC  411
            D EI++A +L EM  VF LG+ CT   PS+RPSM++V+QIL+ C
Sbjct  917  DKEIREASYLHEMTVVFQLGVRCTDKLPSARPSMRDVLQILRQC  960



>emb|CDP03253.1| unnamed protein product [Coffea canephora]
Length=934

 Score =   132 bits (332),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 85/125 (68%), Gaps = 0/125 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA T RVNEK+D+YSFGV+LLELVTGRE N+G+E +SLAEWAW+++ E   I +  
Sbjct  790  IAPEYAQTRRVNEKVDVYSFGVILLELVTGREGNYGDETSSLAEWAWRHFQEGKPIIDAF  849

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D +I +  +LDE+  VF LG+ CT   PS+RP+M++V+QIL           K      D
Sbjct  850  DEDIMEPCYLDEIANVFKLGIFCTGLVPSNRPTMRDVLQILLRSVHSVPMGEKNGRSEYD  909

Query  362  VAPLL  348
             APLL
Sbjct  910  FAPLL  914



>emb|CDP03251.1| unnamed protein product [Coffea canephora]
Length=982

 Score =   132 bits (333),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 85/125 (68%), Gaps = 0/125 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA T RVNEK+D+YSFGV+LLELVTGRE N+G+E +SLAEWAW+++ E   I +  
Sbjct  838  IAPEYAQTRRVNEKVDVYSFGVILLELVTGREGNYGDETSSLAEWAWRHFQEGKPIIDAF  897

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D +I +  +LDE+  VF LG+ CT   PS+RP+M++V+QIL           K      D
Sbjct  898  DEDIMEPCYLDEIANVFKLGIFCTGLVPSNRPTMRDVLQILLRSVHSVPMGEKNGRSEYD  957

Query  362  VAPLL  348
             APLL
Sbjct  958  FAPLL  962



>gb|KCW79613.1| hypothetical protein EUGRSUZ_C00967 [Eucalyptus grandis]
Length=986

 Score =   132 bits (332),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 82/126 (65%), Gaps = 0/126 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            LAPEYA+TT+VNEKID+YSFGVVLLEL TGRE    +E   L +WAW++  +   I + +
Sbjct  841  LAPEYAHTTKVNEKIDVYSFGVVLLELTTGREAKGRDEDMCLVDWAWRHILDGKAISDAI  900

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D EI    FL E+ +VF LG+ CT   PS RP MK+VVQ L  C        + S +N D
Sbjct  901  DEEINHDSFLGEISSVFKLGIFCTVERPSKRPPMKKVVQALLKCSDRLYVVEQTSRRNLD  960

Query  362  VAPLLA  345
            VAPLLA
Sbjct  961  VAPLLA  966



>ref|XP_006451306.1| hypothetical protein CICLE_v10007383mg [Citrus clementina]
 gb|ESR64546.1| hypothetical protein CICLE_v10007383mg [Citrus clementina]
Length=934

 Score =   132 bits (331),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 93/149 (62%), Gaps = 12/149 (8%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA T +VNEK DIYSFGV+LLEL TG+E N G+EHT LA+WAW++  E   I + L
Sbjct  791  IAPEYARTRKVNEKTDIYSFGVILLELTTGKEANNGDEHTCLAQWAWRHIQEGKPIVDAL  850

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D EI +  FL+EM  VF LG+ICTS  P+ RP+M+ V+QIL +  P+   E+    K   
Sbjct  851  DKEIDEPCFLEEMIRVFKLGVICTSMLPTERPNMRMVLQILLN-NPIFPTEKNGGRKYDH  909

Query  362  VAPLLARNDDKYVASYKRSSRKIADESDD  276
            V PLL             S R+   ESDD
Sbjct  910  VTPLLT-----------DSKREKMSESDD  927



>gb|KCW79622.1| hypothetical protein EUGRSUZ_C00979 [Eucalyptus grandis]
Length=992

 Score =   132 bits (331),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 81/114 (71%), Gaps = 1/114 (1%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            LAPEY +T RVNEKID+YSFGVVLLEL TGREP  G E   LAEWAW ++     I +++
Sbjct  878  LAPEYNHTKRVNEKIDVYSFGVVLLELTTGREPCEGNEDMGLAEWAWFHFNHGKPISDVI  937

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR-PLDEFERK  384
            D EI+   +LD++  VF LG+ CT+  PS+RP+MKEVVQ+L  C  P  + E+K
Sbjct  938  DEEIRDNSYLDQISNVFKLGIFCTARLPSTRPTMKEVVQMLLKCSDPHYDVEKK  991



>ref|XP_006364729.1| PREDICTED: receptor-like protein kinase 5-like [Solanum tuberosum]
Length=698

 Score =   131 bits (329),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA T +VN K DIYS+GVVLLEL TGREP   +E  +LA+WA + Y E ++I E L
Sbjct  590  IAPEYASTFKVNVKTDIYSYGVVLLELTTGREPILRDEQMNLAQWALQRYREGNSILEAL  649

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR  408
            D E+ +   L++MR+VF LG++CT ASPS RPSMKEV  +LQSCR
Sbjct  650  DEEVMETSNLEQMRSVFKLGVMCTGASPSGRPSMKEVCYVLQSCR  694



>ref|XP_006475586.1| PREDICTED: receptor-like protein kinase 5-like [Citrus sinensis]
Length=1014

 Score =   132 bits (331),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 93/149 (62%), Gaps = 12/149 (8%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYA T +VNEK DIYSFGV+LLEL TG+E N G+EHT LA+WAW++  E   I + L
Sbjct  871   IAPEYARTRKVNEKTDIYSFGVILLELTTGKEANNGDEHTCLAQWAWRHIQEGKPIVDAL  930

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D EI +  FL+EM  VF LG+ICTS  P+ RP+M+ V+QIL +  P+   E+    K   
Sbjct  931   DKEIDEPCFLEEMIRVFKLGVICTSMLPTERPNMRMVLQILLN-NPIFPTEKNGGRKYDH  989

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDD  276
             V PLL             S R+   ESDD
Sbjct  990   VTPLLT-----------DSKREKMSESDD  1007



>gb|KDO66581.1| hypothetical protein CISIN_1g001778mg [Citrus sinensis]
Length=1014

 Score =   132 bits (331),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 93/149 (62%), Gaps = 12/149 (8%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYA T +VNEK DIYSFGV+LLEL TG+E N G+EHT LA+WAW++  E   I + L
Sbjct  871   IAPEYARTRKVNEKTDIYSFGVILLELTTGKEANNGDEHTCLAQWAWRHIQEGKPIVDAL  930

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D EI +  FL+EM  VF LG+ICTS  P+ RP+M+ V+QIL +  P+   E+    K   
Sbjct  931   DKEIDEPCFLEEMIRVFKLGVICTSMLPTERPNMRMVLQILLN-NPIFPTEKNGGRKYDH  989

Query  362   VAPLLARNDDKYVASYKRSSRKIADESDD  276
             V PLL             S R+   ESDD
Sbjct  990   VTPLLT-----------DSKREKMSESDD  1007



>ref|XP_011007104.1| PREDICTED: receptor-like protein kinase HSL1 [Populus euphratica]
Length=982

 Score =   132 bits (331),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA T RVNEKID+YSFGVVLLEL TG+  N+G+E T LAEWAW++  +   I ++L
Sbjct  865  MAPEYARTGRVNEKIDVYSFGVVLLELTTGKAANYGDEDTCLAEWAWRHMQDGKPIVDVL  924

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQIL  420
            D EIK+  ++DEMR VF LG+ CTS   S RP+MK+VVQIL
Sbjct  925  DEEIKEPCYVDEMRDVFKLGVFCTSVLSSGRPNMKDVVQIL  965



>gb|KCW79119.1| hypothetical protein EUGRSUZ_C00560 [Eucalyptus grandis]
Length=909

 Score =   131 bits (330),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 86/127 (68%), Gaps = 3/127 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            LAPEY +T RVNEKID+YSFGVVLLEL TGREP  G E   LA+WAW ++     I +++
Sbjct  765  LAPEYNHTKRVNEKIDVYSFGVVLLELTTGREPCEGNEDMGLADWAWFHFNHGKPISDVI  824

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR-PLDEFERKMSGKNC  366
            D EI+   +L E+  VF LG+ CT+  PS+RP+MKEVVQ+L  C  P  + E+K   K  
Sbjct  825  DEEIRDNSYL-EISNVFKLGIFCTARLPSTRPTMKEVVQMLLKCSDPHYDVEKKFQHK-L  882

Query  365  DVAPLLA  345
            D APLL 
Sbjct  883  DAAPLLG  889



>ref|XP_002456337.1| hypothetical protein SORBIDRAFT_03g034220 [Sorghum bicolor]
 gb|EES01457.1| hypothetical protein SORBIDRAFT_03g034220 [Sorghum bicolor]
Length=1044

 Score =   131 bits (330),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 89/126 (71%), Gaps = 1/126 (1%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APE AYT +VNEK+D+YSFGVVLLEL TG+E + G EH  LAEWA  +Y    +I +  
Sbjct  890   MAPESAYTNKVNEKVDVYSFGVVLLELTTGKEASAGGEHGGLAEWARHHYQSGGSIPDAT  949

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKM-SGKNC  366
             D  I+ AG+ +E++ VF+LG++CT+  PSSRP+MK+V+QIL  C      + KM +G+  
Sbjct  950   DKSIRYAGYSEEIQVVFSLGVLCTADMPSSRPTMKDVLQILLKCSEQTCQKSKMENGQEY  1009

Query  365   DVAPLL  348
             + APLL
Sbjct  1010  EAAPLL  1015



>gb|EAY98740.1| hypothetical protein OsI_20670 [Oryza sativa Indica Group]
Length=1046

 Score =   131 bits (330),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 88/127 (69%), Gaps = 2/127 (2%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APE AYT +VNEK+D+YSFGVVLLEL+TGRE + G EH SLAEWAW++     +I + +
Sbjct  892   MAPECAYTRKVNEKVDVYSFGVVLLELITGREAHDGGEHGSLAEWAWRHLQSGRSIADAV  951

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPL--DEFERKMSGKN  369
             D  I  AG+ D+   VF LG+ICT A P++RP+M++V+QIL  C     +  + K++  +
Sbjct  952   DRCITDAGYGDDAEVVFKLGIICTGAQPATRPTMRDVLQILVRCEQALQNTVDGKVAEYD  1011

Query  368   CDVAPLL  348
              D AP L
Sbjct  1012  GDGAPFL  1018



>ref|XP_010050386.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=1026

 Score =   131 bits (330),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 86/127 (68%), Gaps = 3/127 (2%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             LAPEY +T RVNEKID+YSFGVVLLEL TGREP  G E   LA+WAW ++     I +++
Sbjct  882   LAPEYNHTKRVNEKIDVYSFGVVLLELTTGREPCEGNEDMGLADWAWFHFNHGKPISDVI  941

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR-PLDEFERKMSGKNC  366
             D EI+   +L E+  VF LG+ CT+  PS+RP+MKEVVQ+L  C  P  + E+K   K  
Sbjct  942   DEEIRDNSYL-EISNVFKLGIFCTARLPSTRPTMKEVVQMLLKCSDPHYDVEKKFQHK-L  999

Query  365   DVAPLLA  345
             D APLL 
Sbjct  1000  DAAPLLG  1006



>emb|CBI20582.3| unnamed protein product [Vitis vinifera]
Length=244

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 76/102 (75%), Gaps = 2/102 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYT +V EK D+YSFGVVLLELVTGREPN   EH  L EWAW  + E   I+E++
Sbjct  64   IAPEYAYTPKVKEKTDVYSFGVVLLELVTGREPN--SEHMCLVEWAWDQFREGKTIEEVV  121

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQ  417
            D EIK+     ++ T F LGL+CT+  PS+RP+MKEV++IL+
Sbjct  122  DEEIKEQCDRAQVTTFFNLGLMCTTTLPSTRPTMKEVLEILR  163



>ref|XP_008337667.1| PREDICTED: receptor-like protein kinase HSL1, partial [Malus 
domestica]
Length=1013

 Score =   131 bits (329),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 97/158 (61%), Gaps = 18/158 (11%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYA+T R+NEKID+YSFGV+LLEL TGRE N G+E T+LAEWA  +  E   I + L
Sbjct  872   IAPEYAHTMRLNEKIDVYSFGVILLELTTGREANDGDEXTALAEWARCHVQENKAIADAL  931

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D +IK+   LDEM +VF LGLICT   P  RPSMKEV+QIL  C                
Sbjct  932   DKDIKEPCHLDEMCSVFKLGLICTERLPDDRPSMKEVLQILLLCS---------------  976

Query  362   VAPLLARNDDKYVAS--YKRSSRKIADESDDDNLMFSV  255
               P+L+R   ++VAS   + S  +   E DD +L  +V
Sbjct  977   -RPVLSREKTEHVASPLLQNSKXERTLEDDDGSLATNV  1013



>ref|XP_010325071.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
HSL2 [Solanum lycopersicum]
Length=697

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 77/105 (73%), Gaps = 0/105 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA T RVN K DIYSFGVVLLEL TGR+P   EE  +LA+WA + Y + + I E L
Sbjct  589  IAPEYASTFRVNIKTDIYSFGVVLLELTTGRQPILREEQMNLAQWAQQRYKDGNYIVEAL  648

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR  408
            D EI +   +++MR VF LGL+CT ASPSSRPSMKEV  ILQS R
Sbjct  649  DEEIMETSNVEQMRDVFKLGLMCTGASPSSRPSMKEVCNILQSLR  693



>gb|KEH27208.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=981

 Score =   130 bits (327),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 57/101 (56%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEY  TTRVNEKID++SFGV+LLEL TG++   G+E++SLA+WAW++    SNI E+L
Sbjct  856  MAPEYVQTTRVNEKIDVFSFGVILLELTTGKKATRGDEYSSLAQWAWRHIQAESNIIELL  915

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQIL  420
            D E+ +   LDEM  +F LG++CT+  PSSRPSMK+V+  L
Sbjct  916  DNEVMEQSCLDEMCCIFKLGIMCTATRPSSRPSMKKVLHTL  956



>emb|CBI20633.3| unnamed protein product [Vitis vinifera]
Length=905

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APE+AYT +VNEKID+YSFGVVLLELV+GREPN   EH  L EWAW  + E  +I+E++
Sbjct  788  IAPEFAYTRKVNEKIDVYSFGVVLLELVSGREPNSVNEHKCLVEWAWDQFREEKSIEEVV  847

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC  411
            D EIK+     ++ T+F LG+ CT  SPS RP+MK+V++ILQ C
Sbjct  848  DEEIKEQCDRAQVTTLFNLGVRCTQTSPSDRPTMKKVLEILQRC  891


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNI  555
            LAPEYAY T+VNEK D+Y FGVVL ELVTGRE N   EH  L EWAW  + +   I
Sbjct  21   LAPEYAYATKVNEKNDVYGFGVVLPELVTGRERN--GEHMCLVEWAWGQFRKVLEI  74



>ref|XP_006655502.1| PREDICTED: receptor-like protein kinase 5-like [Oryza brachyantha]
Length=973

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APE AYT +VNEK+D+YSFGVVLLEL+TGRE + G EH SLAEW+W++     +I E  
Sbjct  819  MAPECAYTRKVNEKVDVYSFGVVLLELITGREAHDGGEHGSLAEWSWRHLQSGRSIAEAA  878

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC  411
            D  I  AG+ D++  VF LG+ICT A P++RP+M++V+QIL  C
Sbjct  879  DSCITDAGYGDDVEVVFKLGIICTGAQPATRPTMRDVLQILVRC  922



>ref|XP_002278863.1| PREDICTED: receptor-like protein kinase HSL1 [Vitis vinifera]
Length=990

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APE+AYT +VNEKID+YSFGVVLLELV+GREPN   EH  L EWAW  + E  +I+E++
Sbjct  873  IAPEFAYTRKVNEKIDVYSFGVVLLELVSGREPNSVNEHKCLVEWAWDQFREEKSIEEVV  932

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC  411
            D EIK+     ++ T+F LG+ CT  SPS RP+MK+V++ILQ C
Sbjct  933  DEEIKEQCDRAQVTTLFNLGVRCTQTSPSDRPTMKKVLEILQRC  976



>ref|XP_010669046.1| PREDICTED: receptor-like protein kinase HSL1 [Beta vulgaris subsp. 
vulgaris]
Length=950

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEY  T R+NEKID+YSFGVVLLEL TG++P  G EH +LA+W+W++  +   I + L
Sbjct  832  IAPEYWQTKRLNEKIDVYSFGVVLLELATGKDPCTGNEHLNLADWSWQHCCDEHPIIDAL  891

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFER  387
            D +IK+  F+++M  VF LGLICTS  PSSRPSMK+V+Q+L +C   +   R
Sbjct  892  DEDIKEPRFIEQMVKVFKLGLICTSKMPSSRPSMKQVLQLLNACSHYENHGR  943



>gb|AAV44033.1| putative protein kinase [Oryza sativa Japonica Group]
 gb|AAV59323.1| putative protein kinase [Oryza sativa Japonica Group]
Length=1014

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 88/127 (69%), Gaps = 2/127 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APE AYT +VNEK+D+YSFGVVLLEL+TGRE + G EH SLAEWAW++     +I + +
Sbjct  860  MAPECAYTRKVNEKVDVYSFGVVLLELITGREAHDGGEHGSLAEWAWRHLQSGRSIADAV  919

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPL--DEFERKMSGKN  369
            D  I  +G+ D+   VF LG+ICT A P++RP+M++V+QIL  C     +  + K++  +
Sbjct  920  DRCITDSGYGDDAEVVFKLGIICTGAQPATRPTMRDVLQILVRCEQALQNTVDGKVAEYD  979

Query  368  CDVAPLL  348
             D AP L
Sbjct  980  GDGAPFL  986



>gb|EEE64410.1| hypothetical protein OsJ_19254 [Oryza sativa Japonica Group]
Length=1004

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 88/127 (69%), Gaps = 2/127 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APE AYT +VNEK+D+YSFGVVLLEL+TGRE + G EH SLAEWAW++     +I + +
Sbjct  850  MAPECAYTRKVNEKVDVYSFGVVLLELITGREAHDGGEHGSLAEWAWRHLQSGRSIADAV  909

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPL--DEFERKMSGKN  369
            D  I  +G+ D+   VF LG+ICT A P++RP+M++V+QIL  C     +  + K++  +
Sbjct  910  DRCITDSGYGDDAEVVFKLGIICTGAQPATRPTMRDVLQILVRCEQALQNTVDGKVAEYD  969

Query  368  CDVAPLL  348
             D AP L
Sbjct  970  GDGAPFL  976



>ref|XP_009803852.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana sylvestris]
Length=709

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA T +VN K DIYSFGVVLLEL TGREP   +E  +LA+W+ +++ E ++I E +
Sbjct  601  IAPEYASTFKVNVKTDIYSFGVVLLELTTGREPILRDEQMNLAQWSQQHFREGNSILEAV  660

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR  408
            DGEI +A  L++M +VF LGL+CT A PS RPSMKEV  +LQSCR
Sbjct  661  DGEIMEATNLEQMTSVFKLGLMCTGALPSGRPSMKEVCYMLQSCR  705



>ref|XP_006364718.1| PREDICTED: receptor-like protein kinase HSL1-like [Solanum tuberosum]
Length=310

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 75/105 (71%), Gaps = 0/105 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA T RVN K DIYSFGVVLLEL TGR+P   EE  +LA+WA + Y + + I E L
Sbjct  202  IAPEYASTFRVNIKTDIYSFGVVLLELTTGRQPILREEQMNLAQWAQQRYRDGNFIVEAL  261

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR  408
            D EI +   +++MR VF LGL+CT A+P  RPSMKEV  ILQS R
Sbjct  262  DEEIMETSNVEQMRGVFKLGLMCTGATPYGRPSMKEVCNILQSFR  306



>ref|XP_011008125.1| PREDICTED: inactive protein kinase SELMODRAFT_444075-like [Populus 
euphratica]
Length=186

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 89/149 (60%), Gaps = 15/149 (10%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA T+RVNEK D+YSFGVVLLEL TG+  N+G+  T LAEWA ++  E   I + L
Sbjct  21   IAPEYAQTSRVNEKTDVYSFGVVLLELTTGKAANYGD--TGLAEWALRHMQEGKTIVDAL  78

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQ-ILQSCRPLDEFERKMSGKNC  366
            D EIK+  ++DEM  VF LG+ CT   PS+RP MKEV+Q +L    PL  +  K  G   
Sbjct  79   DEEIKEPCYVDEMSNVFLLGVFCTRRDPSARPHMKEVLQNLLGRNHPL-VYGMKNIGSEY  137

Query  365  DVAPLLARNDDKYVASYKRSSRKIADESD  279
            D  P           S K S R+   ESD
Sbjct  138  DSTP-----------SLKNSKRERQSESD  155



>ref|XP_010519877.1| PREDICTED: receptor-like protein kinase 5 [Tarenaya hassleriana]
Length=975

 Score =   129 bits (323),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 78/108 (72%), Gaps = 2/108 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            LAPEYAYT++VNEKID+YSFGVVLLELVTGRE   G +H +LA+W+W++Y     I E  
Sbjct  865  LAPEYAYTSKVNEKIDVYSFGVVLLELVTGREGTRGHDHMNLADWSWRHYRAGDPIQEAF  924

Query  542  DGEIKK--AGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRP  405
            D +I++     ++EM+ VF LGL+CTS  P  RPSMKEV+ IL    P
Sbjct  925  DPDIRQDSPSHVEEMKRVFKLGLMCTSTLPHHRPSMKEVLHILLKTCP  972



>ref|XP_009352556.1| PREDICTED: receptor-like protein kinase HSL1 [Pyrus x bretschneideri]
Length=1023

 Score =   129 bits (323),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA+T R+NEKID+YSFGV+LLEL TGRE N G+EHT+LAEWA  +  E   I + L
Sbjct  882  IAPEYAHTMRLNEKIDVYSFGVILLELTTGREANDGDEHTALAEWARCHVQENKAIADAL  941

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQIL  420
            D +IK+   LD+M +VF LGLICT   P  RPSMKEV+QIL
Sbjct  942  DKDIKEPCHLDKMCSVFKLGLICTERLPDDRPSMKEVLQIL  982



>ref|XP_004972171.1| PREDICTED: receptor-like protein kinase HSL1-like [Setaria italica]
Length=1011

 Score =   129 bits (323),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 86/127 (68%), Gaps = 1/127 (1%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APE AYT +V+EK+D+YSFGVVLLEL TG+E N+G EH SLAEWA  +Y    +I +  
Sbjct  868  MAPECAYTKKVSEKVDVYSFGVVLLELTTGKEANYGGEHGSLAEWARHHYQSGGSIPDAT  927

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMS-GKNC  366
            D  I+ AG+ D++  VF LG++CT+  PSSRP+M +V+QIL  C      + K   G   
Sbjct  928  DKSIRYAGYSDDIEVVFRLGVLCTAEMPSSRPTMNDVLQILVKCSERTHQKGKTERGPEY  987

Query  365  DVAPLLA  345
            + APLL+
Sbjct  988  EAAPLLS  994



>ref|XP_010917300.1| PREDICTED: receptor-like protein kinase 5 [Elaeis guineensis]
Length=526

 Score =   126 bits (316),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 92/148 (62%), Gaps = 20/148 (14%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APE AY+T+VNEK D+YSFGVVLLEL TGRE N G  + SLAEW W++  + + + +++
Sbjct  382  MAPECAYSTKVNEKTDVYSFGVVLLELTTGREANDGGAYGSLAEWIWRHVQDGNKLMDVI  441

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC--------RPLDEFER  387
            D +I+   ++DE+  V  LG+ICT   PS+RP+MKEV+QIL  C        +PL E+  
Sbjct  442  DQDIRDLPYVDEIAAVLKLGIICTGTLPSTRPTMKEVLQILLKCERMHGIGDKPLVEY--  499

Query  386  KMSGKNCDVAPLLARNDDKYVASYKRSS  303
                   D APLL     K     KRSS
Sbjct  500  -------DGAPLL---QTKRGGRNKRSS  517



>ref|XP_006353495.1| PREDICTED: receptor-like protein kinase 5-like [Solanum tuberosum]
Length=885

 Score =   128 bits (322),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA  TRV EKID+YSFGV+LLELVTG+E N G+E + LA+WAW++  +   + + L
Sbjct  740  IAPEYARKTRVTEKIDVYSFGVILLELVTGKEANLGDEDSCLADWAWRHLQKGKPMADAL  799

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC  411
            D +IK+  +L+E+  VF LG+ CTS  PSSRP+MKE +QIL  C
Sbjct  800  DEDIKETRYLEEIFIVFKLGIFCTSTFPSSRPTMKEALQILIQC  843



>ref|XP_010917293.1| PREDICTED: receptor-like protein kinase 5 [Elaeis guineensis]
Length=742

 Score =   127 bits (320),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 94/154 (61%), Gaps = 14/154 (9%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAY+ RVNEK+D+YSFGVVLLEL TGRE N G EH SLAEW W++  + + + +++
Sbjct  592  MAPEYAYSRRVNEKVDVYSFGVVLLELTTGREANDGGEHGSLAEWIWRHVQDGNKLMDVI  651

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D  I+   ++DE+  V  LG+ICT   PS+RP+M EV+QIL     +     K   +  D
Sbjct  652  DQNIRDPLYVDEIAAVLKLGIICTGTLPSTRPTMNEVLQILLRYERMHGIGDKPYAE-YD  710

Query  362  VAPLLARNDDKYVASYKRSSRKI----ADESDDD  273
             APLL           +RSSR       DE +DD
Sbjct  711  GAPLL---------QARRSSRNKRPSDGDECNDD  735



>ref|XP_010925541.1| PREDICTED: receptor-like protein kinase HSL1 [Elaeis guineensis]
Length=1033

 Score =   128 bits (322),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 93/152 (61%), Gaps = 14/152 (9%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APE  +  +VN+K+D++SFGVVLLELVTGR  N G E   L EWAW+ Y E   + +++
Sbjct  885   MAPECGHLRKVNQKVDVFSFGVVLLELVTGRGANVGGEDECLTEWAWRYYQEGGGLIDII  944

Query  542   DGEIK-KAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNC  366
             D EI+    +LDEM  VF LGL CT+  PSSRPSMKEV+Q+L  C      ++++  +N 
Sbjct  945   DTEIRDPVLYLDEMEVVFRLGLFCTAKVPSSRPSMKEVLQVLAKC------DKRLGPQNT  998

Query  365   --DVAPLLARNDDKYVASYKRSSRKIADESDD  276
               D APLL           +R SR  A E +D
Sbjct  999   LHDAAPLLQTKKGS-----RRKSRSDASERED  1025



>dbj|BAJ93662.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1046

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 83/130 (64%), Gaps = 8/130 (6%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APE AYT + NEK+D+YSFGVVLLEL TGRE   G EH SLAEWAW++     +I +  
Sbjct  890   MAPECAYTRKANEKVDVYSFGVVLLELATGREAGSGGEHCSLAEWAWRHLQSGKSIADAA  949

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC-----RPLDEFERKMS  378
             D  I  A   D+   VF LG+ICT A PS+RP+MK+V+QIL  C     + +DE   K +
Sbjct  950   DECIGDARHSDDFEVVFKLGIICTGAQPSTRPTMKDVLQILLRCVQAHRKTIDE---KTT  1006

Query  377   GKNCDVAPLL  348
                 D APLL
Sbjct  1007  ASEYDAAPLL  1016



>gb|KCW79616.1| hypothetical protein EUGRSUZ_C009702, partial [Eucalyptus grandis]
Length=418

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 80/123 (65%), Gaps = 2/123 (2%)
 Frame = -3

Query  713  EYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEMLDGE  534
            +YA+TT+VNEKID+YSFGV+LLEL TGRE   G+E   L +WAW++  +   I + +D E
Sbjct  276  KYAHTTKVNEKIDVYSFGVILLELTTGREAKGGDEDMCLVDWAWRHILDGKAIADAIDEE  335

Query  533  IKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR-PLDEFERKMSGKNCDVA  357
            I    FL E+  VF LG+ CT   PS RP MK+VVQ L  C  PL   E + S  N DVA
Sbjct  336  INHYSFLGEISNVFKLGISCTVKRPSKRPPMKKVVQALLKCSDPLYVVE-QTSRHNLDVA  394

Query  356  PLL  348
            PLL
Sbjct  395  PLL  397



>ref|XP_010915380.1| PREDICTED: receptor-like protein kinase HSL1 [Elaeis guineensis]
Length=1034

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 92/158 (58%), Gaps = 15/158 (9%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APE  Y  +V+EK+D++SFGVVLLELVTGR  N G EH  LA+WAW  Y E   + +++
Sbjct  883   MAPECGYLWKVDEKVDVFSFGVVLLELVTGRGANDGGEHGCLADWAWHRYQEGGRVIDII  942

Query  542   DGEIKKA-GFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC----RPLDEFERKMS  378
             D EI+    +LDEM  VF LGL CT  +PS RPS+KEV Q+L  C     P +   R+  
Sbjct  943   DEEIQNPLLYLDEMEVVFMLGLFCTRKTPSDRPSIKEVSQVLTKCDQRRGPPNRLHREF-  1001

Query  377   GKNCDVAPLLARNDDKYVASYKRSSRKIADESDDDNLM  264
                 D  PLL    D      +R S   ADE++  N +
Sbjct  1002  ----DAPPLLQTKKDS-----QRESLSDADEAEGHNYL  1030



>ref|XP_008794105.1| PREDICTED: receptor-like protein kinase 5 [Phoenix dactylifera]
Length=1033

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 95/159 (60%), Gaps = 17/159 (11%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APE  Y+ +VNEK+D++SFGVVLLELVTGR  N G EH  LAEWAW++Y E   + +++
Sbjct  882   MAPECGYSRKVNEKVDVFSFGVVLLELVTGRGANDGGEHECLAEWAWRHYQEGGRVIDII  941

Query  542   DGEIKKA-GFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNC  366
             D EI+    + DE+  VF LGL CT  +PS RPSMKEV Q+L       +++R++  +N 
Sbjct  942   DEEIRDPLLYFDEIEVVFRLGLFCTGRTPSCRPSMKEVSQVLA------KWDRRLRPRNL  995

Query  365   -----DVAPLLARNDDKYVASYKRSSRKIADESDDDNLM  264
                  D AP L           +R S   A E +D N +
Sbjct  996   LHGQFDAAPFLQTKKGS-----RRQSLSEASEREDHNYL  1029



>ref|XP_009416472.1| PREDICTED: receptor-like protein kinase HSL1 [Musa acuminata 
subsp. malaccensis]
Length=1014

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 93/154 (60%), Gaps = 18/154 (12%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APE  Y+ R+NEK+D+YSFGVVLLEL TGR  N   E  +LAEWAWK   E +N+ + +
Sbjct  867   MAPECGYSRRLNEKVDVYSFGVVLLELTTGRRANNEGEQCNLAEWAWKQIQEGANLRDAV  926

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC-RPLDEFERKMSGKNC  366
             D  IK +  +D++ TVF LGL CT + PS RPSMK+V+Q+L  C RP     R    K C
Sbjct  927   DPAIKDSPQMDDITTVFKLGLRCTESLPSRRPSMKDVLQVLMRCNRP-----RGDDCKPC  981

Query  365   ---DVAPLLARNDDKYVASYKRSSRKIADESDDD  273
                DVAPLL         S K  SR+    +D D
Sbjct  982   AERDVAPLL---------SSKTGSRRKGSPNDGD  1006



>gb|EMS60554.1| Leucine-rich repeat receptor-like protein kinase PXL2 [Triticum 
urartu]
Length=900

 Score =   126 bits (316),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 82/126 (65%), Gaps = 1/126 (1%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APE  YT +V EK+D+YSFGVVLLEL TGR  N G E  SLAEWA   Y    +I E  
Sbjct  746  MAPECGYTRKVTEKVDVYSFGVVLLELTTGRAANDGGEDGSLAEWARHLYQSGGSITEGT  805

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQI-LQSCRPLDEFERKMSGKNC  366
            D  I+ AG  DE+  VF LG++CTSASPSSRP+MK+V+ I L+ C    +  +   G+  
Sbjct  806  DSRIRYAGCSDEIEVVFRLGVMCTSASPSSRPAMKDVLHILLRCCEQTHQKGKAEPGREF  865

Query  365  DVAPLL  348
            + APLL
Sbjct  866  EAAPLL  871



>gb|KCW79124.1| hypothetical protein EUGRSUZ_C00565 [Eucalyptus grandis]
Length=510

 Score =   123 bits (309),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 75/112 (67%), Gaps = 1/112 (1%)
 Frame = -3

Query  716  PEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEMLDG  537
            PEYA+TTR NEKID+YSFGVVLLEL TGRE N G+E   LA+W   +      I + +D 
Sbjct  395  PEYAHTTRANEKIDVYSFGVVLLELTTGREANDGKEGMGLADWTCCHIQHGKPISDAIDE  454

Query  536  EIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR-PLDEFERK  384
            EIK + +LDE+  VF L + CT+  PS RP+MKEVVQ+L  C  PL   ER 
Sbjct  455  EIKDSSYLDEIINVFKLRIFCTATRPSMRPAMKEVVQMLLRCSDPLHNVERN  506



>ref|XP_004288943.1| PREDICTED: receptor-like protein kinase HSL1 [Fragaria vesca 
subsp. vesca]
Length=989

 Score =   126 bits (316),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 78/106 (74%), Gaps = 2/106 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA + RVNEKID+YSFGVVLLEL TGR P   + HTSLAEWAW++  E   I + L
Sbjct  873  MAPEYARSLRVNEKIDVYSFGVVLLELTTGRGP--FDVHTSLAEWAWQHAQEGKPIADAL  930

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRP  405
            D ++K+  ++DEM  VF LG++CT  +PS+RPSM+EV+ IL    P
Sbjct  931  DQDVKEPCYMDEMNAVFKLGIMCTETNPSNRPSMREVLHILVKTCP  976



>ref|XP_002456336.1| hypothetical protein SORBIDRAFT_03g034210 [Sorghum bicolor]
 gb|EES01456.1| hypothetical protein SORBIDRAFT_03g034210 [Sorghum bicolor]
Length=592

 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APE AYT +VNEK+D+YSFGVVLLEL TG+EPN G EH SLA WA   Y    +I E  
Sbjct  438  MAPECAYTKKVNEKVDVYSFGVVLLELTTGKEPNDGGEHGSLAGWARHLYQSRGSITEAT  497

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC  411
            D  I+ AG+ DE+  VF LG++CT+   SSRP+M +V+QIL  C
Sbjct  498  DMSIRYAGYSDEIEVVFRLGVLCTAEMASSRPTMDDVLQILLKC  541



>gb|KJB54274.1| hypothetical protein B456_009G027700 [Gossypium raimondii]
Length=1005

 Score =   126 bits (316),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 91/138 (66%), Gaps = 9/138 (7%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYA+T R+NEK+D++SFGV+LLEL TGR+P+ G+E+ SLAEWA + Y + ++I + L
Sbjct  864   IAPEYAHTRRINEKVDVFSFGVILLELTTGRKPDQGDENRSLAEWAQRYYEQGNSIFDAL  923

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQIL-QSCRPLD--------EFE  390
                IKK   L++M  VF LGL CT   P  RPSM++V+QIL QS  PLD        EF+
Sbjct  924   AEGIKKPCHLNQMCNVFKLGLCCTRTLPPLRPSMRDVLQILVQSAHPLDYQSKSAEKEFD  983

Query  389   RKMSGKNCDVAPLLARND  336
             + +S +     P    N+
Sbjct  984   KAVSLQKLKDGPTFGPNN  1001



>tpg|DAA57705.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1054

 Score =   125 bits (315),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APE AYT +VNEK+D+YS+GVVLLEL TG+EPN G EH SL  WA  +Y    +I +  
Sbjct  900   MAPECAYTKKVNEKVDVYSYGVVLLELTTGKEPNDGGEHGSLVAWARHHYLSGGSIPDAT  959

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC  411
             D  IK AG+ DE+  VF LG++CT   PSSRP+M +V+Q+L  C
Sbjct  960   DKSIKYAGYSDEIEVVFKLGVLCTGEMPSSRPTMDDVLQVLLKC  1003



>ref|XP_008789188.1| PREDICTED: receptor-like protein kinase HSL1 [Phoenix dactylifera]
Length=1035

 Score =   125 bits (315),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 83/130 (64%), Gaps = 10/130 (8%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APE     +VNEK+D++SFGVVLLELVTGR  N G+EH  LAEWAW+ Y E S + +++
Sbjct  884   MAPECGQVRKVNEKVDVFSFGVVLLELVTGRGANDGDEHGCLAEWAWRRYQEGSRVIDII  943

Query  542   DGEIKKAG-FLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC----RPLDEFERKMS  378
             D EI+    ++DEM  VF L L CT   PS RPSMKEV+Q+L  C     P +   R+  
Sbjct  944   DEEIQNPRVYIDEMEVVFRLALFCTGKVPSGRPSMKEVLQVLIKCGQRLGPPNMLHREF-  1002

Query  377   GKNCDVAPLL  348
                 D APLL
Sbjct  1003  ----DAAPLL  1008



>ref|XP_006364719.1| PREDICTED: receptor-like protein kinase HSL1-like [Solanum tuberosum]
Length=637

 Score =   124 bits (311),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 75/105 (71%), Gaps = 0/105 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA T RVN K DIYSFGVVLLEL TGR+P   EE  +LA+WA + Y + + I E L
Sbjct  529  IAPEYASTFRVNIKTDIYSFGVVLLELTTGRQPILREEQMNLAQWAQQRYRDGNFIVEAL  588

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR  408
            D EI +   +++MR VF LGL+CT A+P  RPSMKEV  ILQS R
Sbjct  589  DEEIMETSNVEQMRGVFKLGLMCTGATPYGRPSMKEVCNILQSFR  633



>gb|KCW79630.1| hypothetical protein EUGRSUZ_C00989, partial [Eucalyptus grandis]
Length=939

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            LAPEYA+TTRVNEKID+YSFGVVLLEL TGRE N G+E   LA+WAW++  + + I + L
Sbjct  844  LAPEYAHTTRVNEKIDVYSFGVVLLELTTGREANDGDEDMCLADWAWRHIQDGNPISDAL  903

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKE  435
            D EIK    +DE+  VF LG+ CT+  PS+RP+MKE
Sbjct  904  DEEIKHDSNVDEISNVFKLGIFCTATLPSTRPTMKE  939



>ref|XP_003566022.1| PREDICTED: receptor-like protein kinase HSL1 [Brachypodium distachyon]
Length=1031

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 91/155 (59%), Gaps = 11/155 (7%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APE AYT + NEK+D+YSFGVVLLEL TGRE   G EH SLAEWAW++      + +  
Sbjct  885   MAPECAYTRKANEKVDVYSFGVVLLELATGREARDGGEHGSLAEWAWRHLQSGRPVADAA  944

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGK--N  369
             D  +  A   D++  +F LG+ICT A PS+RP+MK+V+QIL  C      +    GK   
Sbjct  945   DKRLGDAAHGDDVEVMFKLGIICTGAQPSTRPTMKDVLQILLRCEQAANQKTATDGKVSE  1004

Query  368   CDVAPLL-ARNDDKYVASYKRSSRKIADESDDDNL  267
              D APLL AR   +         +K+ D+  D N+
Sbjct  1005  YDAAPLLPARGGSR--------RKKVPDDGFDCNV  1031



>ref|XP_008778616.1| PREDICTED: receptor-like protein kinase 5 [Phoenix dactylifera]
Length=731

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 96/160 (60%), Gaps = 27/160 (17%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APE AY+ +VNEK+D+YSFGVVLLEL TGRE N G EH SLAEW W++  + + + +++
Sbjct  581  MAPECAYSRKVNEKVDVYSFGVVLLELTTGREANDGGEHGSLAEWIWRHVQDGNRLMDVI  640

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC--------RPLDEFER  387
            D +I+   ++DE+  V  LG+ICT   PS+RP+MK+V++IL           +PL E+  
Sbjct  641  DRDIRDPSYVDEVAAVLKLGIICTGTLPSTRPTMKKVLEILHRYQRMHGLGDKPLVEY--  698

Query  386  KMSGKNCDVAPLLARNDDKYVASYKRSSR-KIADESDDDN  270
                   D APLL           KR  R K   + D+DN
Sbjct  699  -------DGAPLL---------QIKRGGRSKRPSDGDEDN  722



>ref|XP_009415677.1| PREDICTED: receptor-like protein kinase HSL1 [Musa acuminata 
subsp. malaccensis]
Length=1024

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APE  Y+ R+NEK+D+YSFGVVLLEL TGRE N   E  +LAEWAW+   E + + + +
Sbjct  874  IAPECGYSRRLNEKVDVYSFGVVLLELTTGREANNDGEQCNLAEWAWQQLREEAELSDAI  933

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC-RP  405
            D  I+ + ++D+M TVF LGL+CT   PS RPSMKEV+ IL  C RP
Sbjct  934  DTAIRDSPYMDDMTTVFKLGLLCTETLPSRRPSMKEVLHILLRCHRP  980



>emb|CBI20584.3| unnamed protein product [Vitis vinifera]
Length=506

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 84/126 (67%), Gaps = 12/126 (10%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYTT+VN+KID+YSFGVVLLELVTGREPN G+EH  LAEWA   + E   I+E++
Sbjct  85   IAPEYAYTTKVNKKIDVYSFGVVLLELVTGREPNNGDEHMCLAEWALDQFRERKTIEEVV  144

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D EIK+     ++ T+F LG+ CT+  PS+R +MKE +             +K+  + CD
Sbjct  145  DEEIKEQCDRAQVATLFKLGIRCTNKLPSNRSTMKETIT------------KKIPARICD  192

Query  362  VAPLLA  345
            +  L+ 
Sbjct  193  LKNLIV  198



>ref|XP_004135674.1| PREDICTED: receptor-like protein kinase 5-like [Cucumis sativus]
Length=277

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA T R+NEKID++SFGV+LLEL TG+E   G+  +SLAEWAW+   +   I + L
Sbjct  159  IAPEYAQTPRINEKIDVFSFGVILLELATGKEALDGDADSSLAEWAWEYIKKGKPIVDAL  218

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR  408
            D ++K+  +LDEM +VF LG+ICTS  P+ RP+M + +QIL   R
Sbjct  219  DEDVKEPQYLDEMCSVFKLGVICTSGLPTHRPNMNQALQILIGSR  263



>emb|CDP08192.1| unnamed protein product [Coffea canephora]
Length=635

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYT+++N K D+YSFGVVLLEL TGR+P   +E  +L +WAW++Y E  +I   L
Sbjct  515  IAPEYAYTSKLNVKSDVYSFGVVLLELTTGRQPVIVDEQMNLVQWAWQHYEEEKSIITAL  574

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC  411
            D EI +  +L+ M  V  LGL CTS SPS RP+M E++QIL SC
Sbjct  575  DEEIMEPYYLETMTAVLKLGLKCTSPSPSQRPAMNEILQILLSC  618



>ref|XP_010232300.1| PREDICTED: receptor-like protein kinase 5 [Brachypodium distachyon]
Length=1057

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 84/127 (66%), Gaps = 3/127 (2%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APE AYT +V EK+D+YSFGVVLLEL TGR  N G EH SLAEWA  +Y    +I +  
Sbjct  903   MAPECAYTRKVTEKVDVYSFGVVLLELTTGRAANEGGEHGSLAEWARLHYQSGGSIPDAT  962

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSG--KN  369
             D  I+ AG  +E+  VF L ++CT ASPSSRP+MK+V+QIL  C      ++  +G  + 
Sbjct  963   DTRIRYAGCSEEIEAVFRLAVMCTGASPSSRPTMKDVLQILLKCSE-QTLQKGKTGHRRE  1021

Query  368   CDVAPLL  348
              + APLL
Sbjct  1022  HEAAPLL  1028



>ref|XP_006364730.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110-like [Solanum tuberosum]
Length=709

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA T RVN K DIYSFGVVLLEL TGR+P   E+  +LA+WA + Y +  N    L
Sbjct  602  IAPEYASTFRVNIKTDIYSFGVVLLELTTGRQPILREDQMNLAQWAQQRYRDG-NFIVAL  660

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR  408
            D EI +   +++MR VF LGL+CT ASPSSRPSMKEV  ILQS R
Sbjct  661  DEEIMETSNVEQMRGVFKLGLMCTGASPSSRPSMKEVCNILQSLR  705



>gb|EAY75774.1| hypothetical protein OsI_03690 [Oryza sativa Indica Group]
Length=1065

 Score =   124 bits (310),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 87/127 (69%), Gaps = 2/127 (2%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APE  YT +V+EK+D+YSFGVVLLEL TG+  N G EH SLA+WA  +Y    +I +  
Sbjct  908   MAPECGYTRKVDEKVDVYSFGVVLLELTTGKAANDGGEHGSLADWARHHYQSGESIPDAT  967

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKM-SGK-N  369
             D  I+ AG+ DE+  VF LG++CT A+P+SRP+MK+V+QIL  C      + K  SG+  
Sbjct  968   DQCIRYAGYSDEIEVVFRLGVMCTGATPASRPTMKDVLQILVKCSEQTHQKCKAESGQEE  1027

Query  368   CDVAPLL  348
              +VAPLL
Sbjct  1028  YEVAPLL  1034



>gb|KCW79619.1| hypothetical protein EUGRSUZ_C00974 [Eucalyptus grandis]
Length=945

 Score =   123 bits (309),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            LAPEYA+TTRVNEKID+YSFGVVLLEL TGRE N G+E   LA+WAW++  + + I + L
Sbjct  808  LAPEYAHTTRVNEKIDVYSFGVVLLELTTGREANDGDEDMCLADWAWRHIQDGNPISDAL  867

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQ  426
            D EIK    +DE+  VF  G+ CT+  PS+RP+MKE+ +
Sbjct  868  DEEIKDDSNVDEISNVFKFGIFCTATLPSTRPTMKELYE  906



>ref|XP_002442937.1| hypothetical protein SORBIDRAFT_08g005070 [Sorghum bicolor]
 gb|EES16775.1| hypothetical protein SORBIDRAFT_08g005070 [Sorghum bicolor]
Length=902

 Score =   123 bits (309),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYT +VNEK+D++ FGVVLLEL T +  N G +H SLAEWA  +Y   ++I +  
Sbjct  784  MAPEYAYTRKVNEKVDVFGFGVVLLELTTDKNANDGGDHGSLAEWAGHHYRSGASIPDAT  843

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC  411
            D  I+ AG+ DE+ TVF LG+ CT+ SPSSRP+M++V+QIL  C
Sbjct  844  DICIRYAGYADEIETVFRLGVKCTANSPSSRPTMEDVLQILLKC  887



>gb|EMS55978.1| Receptor-like protein kinase HSL1 [Triticum urartu]
Length=691

 Score =   122 bits (307),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 81/130 (62%), Gaps = 8/130 (6%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APE  YT + NEK+D+YSFGVVLLEL TGRE   G EH SLAEWAW++     +I +  
Sbjct  539  MAPECGYTRKANEKVDVYSFGVVLLELATGREAGNGGEHCSLAEWAWRHLQSGKSIADAA  598

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC-----RPLDEFERKMS  378
            D  I  A   D    VF LG+ICT A PS+RP+MK+V+QIL  C     + LDE   K +
Sbjct  599  DECIGDARQSDNFDVVFKLGIICTGAQPSTRPTMKDVLQILLRCEQAHRKNLDE---KTA  655

Query  377  GKNCDVAPLL  348
                D APLL
Sbjct  656  VSEYDGAPLL  665



>gb|KCW79121.1| hypothetical protein EUGRSUZ_C00562 [Eucalyptus grandis]
Length=1002

 Score =   123 bits (309),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 80/126 (63%), Gaps = 2/126 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            LAPEYA+TT+VNEKID+YSFGVVLLEL TGRE   G+E   L +WA  +  +   I + +
Sbjct  857  LAPEYAHTTKVNEKIDVYSFGVVLLELTTGREAKGGDEDMCLVDWACHHILDGKAIADAI  916

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR-PLDEFERKMSGKNC  366
            D EI    FL E+  VF LG+ CT   PS RP MK+VVQ L  C  PL   E+  S    
Sbjct  917  DEEINHDSFLGEISNVFKLGISCTVKPPSKRPPMKKVVQALLKCSDPLYVVEQT-SRHKL  975

Query  365  DVAPLL  348
            DVAPLL
Sbjct  976  DVAPLL  981



>ref|NP_001044213.1| Os01g0742400 [Oryza sativa Japonica Group]
 dbj|BAD87898.1| putative LRK1 protein [Oryza sativa Japonica Group]
 dbj|BAF06127.1| Os01g0742400 [Oryza sativa Japonica Group]
Length=1066

 Score =   123 bits (309),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 96/153 (63%), Gaps = 4/153 (3%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APE  YT +V+EK+D+YSFGVVLLEL TG+  N G EH SLA+WA  +Y    +I +  
Sbjct  909   MAPECGYTRKVDEKVDVYSFGVVLLELTTGKAANDGGEHGSLADWARHHYQSGESIPDAT  968

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKM-SGK-N  369
             D  I+ AG+ DE+  VF LG++CT A+P+SRP+MK+V+QIL  C      + K  SG+  
Sbjct  969   DQCIRYAGYSDEIEVVFRLGVMCTGATPASRPTMKDVLQILVKCSEQTHQKCKAESGQEE  1028

Query  368   CDVAPLL--ARNDDKYVASYKRSSRKIADESDD  276
              +VAPLL   R   +   +  + +   ADE  D
Sbjct  1029  YEVAPLLLPQRGSRRKQPAKAKGADDDADERSD  1061



>gb|EAZ13493.1| hypothetical protein OsJ_03409 [Oryza sativa Japonica Group]
Length=1063

 Score =   123 bits (309),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 96/153 (63%), Gaps = 4/153 (3%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APE  YT +V+EK+D+YSFGVVLLEL TG+  N G EH SLA+WA  +Y    +I +  
Sbjct  906   MAPECGYTRKVDEKVDVYSFGVVLLELTTGKAANDGGEHGSLADWARHHYQSGESIPDAT  965

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKM-SGK-N  369
             D  I+ AG+ DE+  VF LG++CT A+P+SRP+MK+V+QIL  C      + K  SG+  
Sbjct  966   DQCIRYAGYSDEIEVVFRLGVMCTGATPASRPTMKDVLQILVKCSEQTHQKCKAESGQEE  1025

Query  368   CDVAPLL--ARNDDKYVASYKRSSRKIADESDD  276
              +VAPLL   R   +   +  + +   ADE  D
Sbjct  1026  YEVAPLLLPQRGSRRKQPAKAKGADDDADERSD  1058



>ref|XP_010911143.1| PREDICTED: receptor-like protein kinase 5 [Elaeis guineensis]
Length=228

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APE A++ ++NE++D+YSFGV+LLEL  G++ N GEE+ +LAEWAW+   +A  + + +
Sbjct  115  MAPECAHSRKINERMDVYSFGVILLELTIGKKANDGEENRNLAEWAWRCLQKADKMIDAI  174

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR  408
            D +IK    ++E+  VF LG++CTS  PSSRP+MK+V+QIL  C+
Sbjct  175  DQDIKDPTNIEEIAMVFKLGVMCTSTLPSSRPTMKDVLQILLRCQ  219



>ref|XP_006644690.1| PREDICTED: receptor-like protein kinase 5-like [Oryza brachyantha]
Length=1056

 Score =   122 bits (307),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 93/152 (61%), Gaps = 3/152 (2%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APE AYT +V+EK+D+YSFGVVLLEL TG+  N G EH  LA WA  ++    +I +  
Sbjct  900   MAPECAYTRKVDEKVDVYSFGVVLLELTTGKAANDGGEHGCLANWARHHHQSRGSIPDAT  959

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKM-SGKNC  366
             D  I+ AG+ DE+  VF LG++CT ASPSSRP+ K+V+QIL  C      + K+  G+  
Sbjct  960   DKCIRYAGYSDEIEVVFRLGVMCTGASPSSRPTTKDVLQILAKCAEQTHQKCKVEGGQEY  1019

Query  365   DVAPLLARNDD--KYVASYKRSSRKIADESDD  276
             + APLL +     K ++  K      +DE  D
Sbjct  1020  EAAPLLLQQGSRRKQLSKAKGCGEDDSDERSD  1051



>ref|XP_007013026.1| Kinase family protein with leucine-rich repeat domain, putative 
[Theobroma cacao]
 gb|EOY30645.1| Kinase family protein with leucine-rich repeat domain, putative 
[Theobroma cacao]
Length=1006

 Score =   122 bits (307),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA TTR++EKID+YSFGV+LLEL TGRE + G+++ SLAEWA   + + ++I + L
Sbjct  881  IAPEYARTTRIDEKIDVYSFGVILLELTTGREAHNGDKNRSLAEWAQHYFQDNNSIVDAL  940

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQ  417
            D EIK+A +LD+M  VF +G+ CT  SPS RP M++V+Q+LQ
Sbjct  941  DEEIKEACYLDQMCNVFKVGIHCTRTSPSRRPCMRKVLQMLQ  982



>ref|XP_002442938.1| hypothetical protein SORBIDRAFT_08g005090 [Sorghum bicolor]
 gb|EES16776.1| hypothetical protein SORBIDRAFT_08g005090 [Sorghum bicolor]
Length=1021

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYT +VNEK+D+YSFGVVLLEL TG++ N G E   LAEWA   Y   ++I +++
Sbjct  894  MAPEYAYTRKVNEKVDVYSFGVVLLELTTGKKANDGAELGCLAEWARHCYQSGASILDVI  953

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC  411
            D  I+ AG+ +E+ T F LG+ CTS  PS RP+MK V+QIL  C
Sbjct  954  DKSIRYAGYPNEIETAFRLGVKCTSILPSPRPTMKNVLQILHKC  997



>ref|XP_011081744.1| PREDICTED: receptor-like protein kinase 5 [Sesamum indicum]
Length=730

 Score =   121 bits (303),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 58/105 (55%), Positives = 77/105 (73%), Gaps = 0/105 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYT +VN K D+YSFGVVLLEL T R+     +H +LA WA   Y+  + I + L
Sbjct  606  IAPEYAYTRKVNTKGDVYSFGVVLLELTTRRQAVTQGDHMNLAGWAQLQYSAKNAIVDAL  665

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR  408
            D EIK++  LD++ TVF LG+ICT+ SPS+RPSMK+ + ILQ+CR
Sbjct  666  DAEIKESIHLDQIITVFRLGVICTATSPSNRPSMKDCLHILQNCR  710



>gb|EMS35768.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Triticum urartu]
Length=174

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 76/104 (73%), Gaps = 2/104 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNID--E  549
            +APE+  + ++NEK+D+YSFGVVL+ELVTGR  N G  + +LA+WAW+ + +  +I    
Sbjct  70   IAPEFGSSRKMNEKVDVYSFGVVLVELVTGRRANGGGGYENLAQWAWRQFHQDEDIHLTN  129

Query  548  MLDGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQ  417
            ++D +I+   +  E++ V  LGLICT  +PSSRPSMK+V+Q+LQ
Sbjct  130  VIDADIRDPAYSREVQLVLKLGLICTGTNPSSRPSMKQVLQVLQ  173



>ref|XP_008450784.1| PREDICTED: receptor-like protein kinase 5 [Cucumis melo]
Length=995

 Score =   122 bits (305),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 56/105 (53%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA T R+NEKID++SFGV+LLEL TG+E   G+  +SLAEWAW    +   I + L
Sbjct  877  IAPEYAQTPRINEKIDVFSFGVILLELATGKEALNGDADSSLAEWAWDYIQKGKPIADAL  936

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR  408
            D ++K+  +LDEM +VF LGLICTS  P++RP+M + +QIL   R
Sbjct  937  DEDVKEPQYLDEMCSVFKLGLICTSGLPTNRPNMNQALQILIRSR  981



>ref|XP_009415190.1| PREDICTED: receptor-like protein kinase HSL1 [Musa acuminata 
subsp. malaccensis]
Length=1066

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 75/107 (70%), Gaps = 1/107 (1%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APE  Y+ R+NEK+D+YSFGVVLLEL TGRE N   E  +LAEWAW+   E + + + +
Sbjct  913   IAPECGYSRRLNEKVDVYSFGVVLLELTTGREANNDGEQCNLAEWAWQQLQEEAELSDAI  972

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC-RP  405
             D  I+ + + ++M TVF LGL+CT   PS RPSMKEV+ IL  C RP
Sbjct  973   DTAIRDSPYTNDMTTVFKLGLLCTETLPSRRPSMKEVLHILLRCHRP  1019



>ref|XP_004969910.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Setaria italica]
Length=1052

 Score =   120 bits (301),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APE AYT +V+EK+D+YSFGVVLLEL TG+E N G EH  LA+WA  +Y    +I +  
Sbjct  900   MAPECAYTMKVSEKVDVYSFGVVLLELTTGKEANDGGEHGCLADWARHHYQSGGSIPDAT  959

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC  411
             D  I+  G+ DE+  VF LG++CT+  PSSRP+M +V+QIL  C
Sbjct  960   DKSIRYDGYSDEIEVVFRLGVLCTADMPSSRPTMNDVLQILVKC  1003



>gb|KGN66180.1| hypothetical protein Csa_1G574960 [Cucumis sativus]
Length=996

 Score =   120 bits (300),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 55/105 (52%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA T R+NEKID++SFGV+LLEL TG+E   G+  +SLAEWAW+   +   I + L
Sbjct  878  IAPEYAQTPRINEKIDVFSFGVILLELATGKEALDGDADSSLAEWAWEYIKKGKPIVDAL  937

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR  408
            D ++K+  +LDEM +VF LG+ICTS  P+ RP+M + +QIL   R
Sbjct  938  DEDVKEPQYLDEMCSVFKLGVICTSGLPTHRPNMNQALQILIGSR  982



>ref|XP_002514220.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF48174.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=769

 Score =   119 bits (298),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 61/133 (46%), Positives = 83/133 (62%), Gaps = 12/133 (9%)
 Frame = -3

Query  668  SFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEMLDGEIKKAGFLDEMRTVFT  489
            +FGVVLLEL TG+E NFG+E++ LA+WAW + +E S + + LD EI +  +L EM  VF 
Sbjct  648  NFGVVLLELTTGKEANFGDENSCLADWAWHHMSEGSAVVDALDKEIVEPSYLGEMSIVFK  707

Query  488  LGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCDVAPLLARNDDKYVASYKR  309
            LG+ CTS  PS+RPSM E +QIL  C     FE K+ G+  DVAPLL            +
Sbjct  708  LGVKCTSKMPSARPSMSEALQILLQCSRPQVFEVKIMGREYDVAPLL------------K  755

Query  308  SSRKIADESDDDN  270
            SS++     +D+N
Sbjct  756  SSKREQSSGNDEN  768



>ref|XP_006853707.1| hypothetical protein AMTR_s00056p00148740 [Amborella trichopoda]
 gb|ERN15174.1| hypothetical protein AMTR_s00056p00148740 [Amborella trichopoda]
Length=1015

 Score =   119 bits (299),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 84/148 (57%), Gaps = 1/148 (1%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYAYT +V EK D+YSFGVVLLELVTGR  N  + H+SL +W         +I  +L
Sbjct  861   IAPEYAYTMKVTEKSDVYSFGVVLLELVTGRSANKCDGHSSLVDWTLTQIQNDKSIYGVL  920

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
             D  I +  F ++M  V  LGL+C   SPS RPSMKE V IL  C P     +K+ G   D
Sbjct  921   DKAICEPRFAEDMGLVLRLGLMCAIHSPSQRPSMKEAVNILLQCSP-GGTGKKIMGPEFD  979

Query  362   VAPLLARNDDKYVASYKRSSRKIADESD  279
              APL  ++   Y    + S R  + E D
Sbjct  980   AAPLHPKSPSVYFLGIRGSRRHKSIEED  1007



>ref|XP_004157305.1| PREDICTED: receptor-like protein kinase 5-like [Cucumis sativus]
Length=1267

 Score =   120 bits (300),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 55/105 (52%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = -3

Query  722   LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             +APEYA T R+NEKID++SFGV+LLEL TG+E   G+  +SLAEWAW+   +   I + L
Sbjct  1149  IAPEYAQTPRINEKIDVFSFGVILLELATGKEALDGDADSSLAEWAWEYIKKGKPIVDAL  1208

Query  542   DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCR  408
             D ++K+  +LDEM +VF LG+ICTS  P+ RP+M + +QIL   R
Sbjct  1209  DEDVKEPQYLDEMCSVFKLGVICTSGLPTHRPNMNQALQILIGSR  1253



>gb|EAZ01332.1| hypothetical protein OsI_23363 [Oryza sativa Indica Group]
Length=897

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 77/103 (75%), Gaps = 1/103 (1%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYA-EASNIDEM  546
            +APE+  + ++NEK+D+YSFGVVLLEL TGR  N G  + +LA+WAW+ +  E   + ++
Sbjct  794  MAPEFGSSRKINEKVDVYSFGVVLLELTTGRFANGGGGYENLAQWAWRRFQDEDFQLIDV  853

Query  545  LDGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQ  417
            +DG+I+   +L E++ VF LGLICT A P SRPSMKEV+Q+LQ
Sbjct  854  IDGDIQDPAYLQEVQLVFKLGLICTGAKPLSRPSMKEVLQVLQ  896



>emb|CAN80773.1| hypothetical protein VITISV_042329 [Vitis vinifera]
Length=471

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 84/125 (67%), Gaps = 13/125 (10%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYTT+VNEKID+YSFGVVLLELV  REPN  +EH            E   I+E++
Sbjct  356  IAPEYAYTTKVNEKIDVYSFGVVLLELVMEREPNSRDEHI-----------ERKTIEEVM  404

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERKMSGKNCD  363
            D EIK+     ++ T+F+LGL+CT+ SPS+RP+MKEV++IL+ C   +   RK +    +
Sbjct  405  DEEIKEQCERAQVTTLFSLGLMCTTRSPSTRPTMKEVLEILRQCSHQEGHGRKKNDN--E  462

Query  362  VAPLL  348
              PLL
Sbjct  463  ATPLL  467



>ref|XP_008242547.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
HSL2 [Prunus mume]
Length=979

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 75/104 (72%), Gaps = 2/104 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
             APE+ YT R+NEKID+YSFGV+LLEL TGRE    +EHT+L EWAW+++ + + + + L
Sbjct  875  FAPEFGYTRRMNEKIDVYSFGVILLELTTGREAK--DEHTNLVEWAWRHFEKRNPLADAL  932

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC  411
            D +I++  +LDEM  VFTL + CT   P  RPSM EVV+IL  C
Sbjct  933  DEDIREPCWLDEMCFVFTLAIRCTQRLPCDRPSMMEVVRILNRC  976



>ref|NP_001057858.1| Os06g0557100 [Oryza sativa Japonica Group]
 dbj|BAD54139.1| putative serine-threonine protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF19772.1| Os06g0557100 [Oryza sativa Japonica Group]
 gb|EAZ01330.1| hypothetical protein OsI_23361 [Oryza sativa Indica Group]
 gb|EAZ37344.1| hypothetical protein OsJ_21683 [Oryza sativa Japonica Group]
Length=1041

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 73/104 (70%), Gaps = 0/104 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEY Y+ RVNEK+D+YSFGVVLLEL TG+  N       LAEWAW+ Y +    D+++
Sbjct  883  MAPEYGYSKRVNEKVDVYSFGVVLLELTTGKVANDAAADFCLAEWAWRRYQKGPPFDDVI  942

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC  411
            D +I++   L ++ +VFTLG+ICT  +P +RPSMKEV+  L  C
Sbjct  943  DADIREQASLPDIMSVFTLGVICTGENPPARPSMKEVLHHLIRC  986



>gb|AFW56261.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=630

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 73/104 (70%), Gaps = 2/104 (2%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYAYT RVNEK+D++ FGVVLLEL T R  N G +H SLA+WA   Y   ++I    
Sbjct  514  MAPEYAYTRRVNEKVDVFGFGVVLLELTTDRNANDGGDHGSLADWAGHQYRSGASIAT--  571

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSC  411
            D  +  AG+ DE+ TVF LG+ CT++SPSSRP+M E +QIL  C
Sbjct  572  DICVGYAGYADEIETVFRLGVKCTASSPSSRPTMAEALQILLRC  615



>ref|XP_010924677.1| PREDICTED: receptor-like protein kinase HSL1 [Elaeis guineensis]
Length=836

 Score =   118 bits (295),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APE AY+ ++NEK+D+YSFGV+LLEL TG++ N G E+ +LAEWAW+   EA  + + +
Sbjct  721  MAPECAYSRKINEKMDVYSFGVILLELTTGKKANDGGEYGNLAEWAWRCLQEADKVIDAI  780

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQIL  420
            D +IK   +++E+  +F LG++CTS  PSSRP+MK+V+QIL
Sbjct  781  DQDIKDPTYVEEIAFIFKLGVMCTSPLPSSRPTMKDVLQIL  821



>ref|XP_007013028.1| Kinase family protein with leucine-rich repeat domain, putative 
isoform 2 [Theobroma cacao]
 gb|EOY30647.1| Kinase family protein with leucine-rich repeat domain, putative 
isoform 2 [Theobroma cacao]
Length=1019

 Score =   118 bits (295),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 77/113 (68%), Gaps = 0/113 (0%)
 Frame = -3

Query  722  LAPEYAYTTRVNEKIDIYSFGVVLLELVTGREPNFGEEHTSLAEWAWKNYAEASNIDEML  543
            +APEYA T R+NEKID+YSFGVVLLEL TGRE N+G+E+ SLAEWA   +   ++I + L
Sbjct  878  MAPEYARTKRINEKIDVYSFGVVLLELTTGREANYGDEYRSLAEWAQDYFQGGNSIVDAL  937

Query  542  DGEIKKAGFLDEMRTVFTLGLICTSASPSSRPSMKEVVQILQSCRPLDEFERK  384
            D  I++A  L++M  VF LG+ CT   PS RP M+ V+Q+L     L   + K
Sbjct  938  DEGIREACHLNQMCNVFKLGIYCTRTLPSERPCMRTVLQMLLQSAHLPNHQDK  990



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1287001441440