BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF012O19

Length=777
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CBI20072.3|  unnamed protein product                                242   9e-75   Vitis vinifera
dbj|BAC98299.1|  LEXYL2                                                 249   2e-74   Solanum lycopersicum
ref|XP_009612011.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    251   5e-74   Nicotiana tomentosiformis
ref|XP_009762535.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    251   6e-74   Nicotiana sylvestris
ref|XP_004230547.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    249   2e-73   
gb|KCW63063.1|  hypothetical protein EUGRSUZ_G00654                     246   5e-73   Eucalyptus grandis [rose gum]
ref|XP_006351808.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    247   2e-72   Solanum tuberosum [potatoes]
gb|KCW63062.1|  hypothetical protein EUGRSUZ_G006531                    244   3e-72   Eucalyptus grandis [rose gum]
ref|XP_010068200.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    246   7e-72   Eucalyptus grandis [rose gum]
ref|NP_001233910.1|  beta-D-xylosidase 1 precursor                      245   1e-71   Solanum lycopersicum
ref|XP_010065531.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    244   2e-71   Eucalyptus grandis [rose gum]
ref|XP_010065530.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    244   2e-71   Eucalyptus grandis [rose gum]
ref|XP_009628814.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    244   3e-71   Nicotiana tomentosiformis
ref|XP_006341844.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    244   3e-71   Solanum tuberosum [potatoes]
ref|XP_011092407.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    243   6e-71   Sesamum indicum [beniseed]
ref|XP_009801214.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    243   8e-71   Nicotiana sylvestris
emb|CDO97479.1|  unnamed protein product                                241   9e-71   Coffea canephora [robusta coffee]
ref|XP_010065529.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    241   3e-70   Eucalyptus grandis [rose gum]
gb|EYU35409.1|  hypothetical protein MIMGU_mgv1a001738mg                241   4e-70   Erythranthe guttata [common monkey flower]
ref|XP_002264183.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    240   7e-70   Vitis vinifera
ref|XP_011087838.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    240   7e-70   Sesamum indicum [beniseed]
emb|CAN78858.1|  hypothetical protein VITISV_030325                     239   8e-70   Vitis vinifera
ref|XP_002268626.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    239   1e-69   Vitis vinifera
gb|KDP30704.1|  hypothetical protein JCGZ_16402                         238   4e-69   Jatropha curcas
ref|XP_010065527.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    238   4e-69   Eucalyptus grandis [rose gum]
ref|XP_011087839.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    238   7e-69   Sesamum indicum [beniseed]
ref|XP_009347830.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    236   4e-68   
ref|XP_009403180.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    235   5e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004301992.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    234   1e-67   Fragaria vesca subsp. vesca
ref|XP_011465594.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    234   1e-67   Fragaria vesca subsp. vesca
ref|XP_007225245.1|  hypothetical protein PRUPE_ppa001692mg             234   2e-67   Prunus persica
ref|XP_011004967.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    233   2e-67   Populus euphratica
ref|XP_007043027.1|  Beta-D-xylosidase 4                                234   2e-67   
ref|XP_008218886.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    233   2e-67   Prunus mume [ume]
ref|XP_009379698.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    233   3e-67   
ref|NP_001054038.1|  Os04g0640700                                       233   3e-67   
gb|EYU18509.1|  hypothetical protein MIMGU_mgv1a001665mg                233   4e-67   Erythranthe guttata [common monkey flower]
gb|EEE61783.1|  hypothetical protein OsJ_16354                          233   5e-67   Oryza sativa Japonica Group [Japonica rice]
emb|CAE03635.1|  OSJNBb0003B01.27                                       233   7e-67   Oryza sativa Japonica Group [Japonica rice]
gb|KJB31996.1|  hypothetical protein B456_005G218000                    226   1e-66   Gossypium raimondii
ref|XP_002298197.2|  beta-glucosidase family protein                    231   1e-66   
ref|XP_008344154.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    231   2e-66   
ref|XP_009401393.1|  PREDICTED: beta-D-xylosidase 4-like                229   7e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008784548.1|  PREDICTED: LOW QUALITY PROTEIN: beta-xylosid...    229   7e-66   
ref|XP_008339210.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    229   7e-66   
gb|ACL53913.1|  unknown                                                 221   1e-65   Zea mays [maize]
gb|KJB31997.1|  hypothetical protein B456_005G218000                    226   1e-65   Gossypium raimondii
ref|XP_009354080.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    228   2e-65   Pyrus x bretschneideri [bai li]
emb|CAJ65922.1|  xylan 1,4-beta-xylosidase                              228   2e-65   Populus tremula x Populus alba [gray poplar]
ref|XP_010937054.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    228   3e-65   Elaeis guineensis
ref|XP_002303181.1|  beta-glucosidase family protein                    228   3e-65   
dbj|BAK03439.1|  predicted protein                                      226   4e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG10349.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           227   5e-65   Gossypium arboreum [tree cotton]
gb|EYU18507.1|  hypothetical protein MIMGU_mgv1a001685mg                227   5e-65   Erythranthe guttata [common monkey flower]
gb|EYU18508.1|  hypothetical protein MIMGU_mgv1a001685mg                227   5e-65   Erythranthe guttata [common monkey flower]
gb|AFW59618.1|  putative O-Glycosyl hydrolase superfamily protein       221   5e-65   
gb|KJB31995.1|  hypothetical protein B456_005G218000                    226   8e-65   Gossypium raimondii
ref|NP_001146416.1|  uncharacterized protein LOC100279996               221   9e-65   
dbj|BAK01582.1|  predicted protein                                      225   9e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004300692.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    226   1e-64   Fragaria vesca subsp. vesca
dbj|BAJ90420.1|  predicted protein                                      226   1e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90315.1|  predicted protein                                      226   1e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010068199.1|  PREDICTED: LOW QUALITY PROTEIN: beta-xylosid...    221   2e-64   Eucalyptus grandis [rose gum]
ref|XP_002513707.1|  Beta-glucosidase, putative                         225   2e-64   Ricinus communis
gb|EMT32951.1|  Beta-D-xylosidase 4                                     226   3e-64   
ref|XP_006653810.1|  PREDICTED: beta-D-xylosidase 4-like                225   3e-64   
ref|XP_008455235.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    225   4e-64   Cucumis melo [Oriental melon]
ref|XP_010261102.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    224   5e-64   Nelumbo nucifera [Indian lotus]
ref|XP_011015574.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    223   1e-63   Populus euphratica
ref|XP_011046123.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    223   1e-63   Populus euphratica
ref|XP_009407358.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    221   1e-63   
ref|XP_008661823.1|  PREDICTED: uncharacterized protein LOC100279...    221   1e-63   Zea mays [maize]
ref|XP_006493288.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    223   2e-63   Citrus sinensis [apfelsine]
gb|AAK38481.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase iso...    223   2e-63   Hordeum vulgare [barley]
ref|XP_006432467.1|  hypothetical protein CICLE_v10000355mg             222   2e-63   Citrus clementina [clementine]
ref|XP_008661822.1|  PREDICTED: uncharacterized protein LOC100279...    221   7e-63   
ref|XP_004136861.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    221   8e-63   
gb|KHN39204.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           219   8e-63   Glycine soja [wild soybean]
ref|XP_002448619.1|  hypothetical protein SORBIDRAFT_06g030270          221   1e-62   Sorghum bicolor [broomcorn]
ref|XP_004155509.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    221   2e-62   
ref|XP_010103839.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2      219   3e-62   Morus notabilis
dbj|BAD94522.1|  beta-xylosidase - like protein                         209   3e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003580652.1|  PREDICTED: beta-D-xylosidase 4-like                219   4e-62   Brachypodium distachyon [annual false brome]
ref|XP_003531047.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    219   5e-62   Glycine max [soybeans]
ref|XP_010243340.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    219   5e-62   Nelumbo nucifera [Indian lotus]
dbj|BAD94481.1|  beta-xylosidase                                        214   8e-62   Arabidopsis thaliana [mouse-ear cress]
gb|KEH31243.1|  beta-xylosidase/alpha-L-arabinofuranosidase-like ...    218   1e-61   Medicago truncatula
sp|A5JTQ3.1|XYL2_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...    218   2e-61   Medicago sativa subsp. x varia
ref|XP_010687471.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    217   2e-61   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB77499.1|  hypothetical protein B456_012G140300                    216   3e-61   Gossypium raimondii
ref|XP_003593145.1|  Beta-xylosidase/alpha-L-arabinofuranosidase        216   3e-61   Medicago truncatula
sp|A5JTQ2.1|XYL1_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...    216   4e-61   Medicago sativa subsp. x varia
gb|KHN26728.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 1           214   4e-61   Glycine soja [wild soybean]
ref|XP_007159080.1|  hypothetical protein PHAVU_002G206800g             216   5e-61   Phaseolus vulgaris [French bean]
gb|KHG02719.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           215   9e-61   Gossypium arboreum [tree cotton]
ref|XP_006394136.1|  hypothetical protein EUTSA_v10003678mg             215   1e-60   Eutrema salsugineum [saltwater cress]
ref|XP_003531557.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    214   2e-60   Glycine max [soybeans]
ref|XP_006399455.1|  hypothetical protein EUTSA_v10012739mg             214   2e-60   Eutrema salsugineum [saltwater cress]
ref|XP_004504774.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    214   3e-60   Cicer arietinum [garbanzo]
ref|NP_201262.1|  beta-D-xylosidase 4                                   214   3e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006827121.1|  hypothetical protein AMTR_s00010p00246460          213   8e-60   Amborella trichopoda
ref|XP_009150540.1|  PREDICTED: beta-D-xylosidase 4                     212   1e-59   Brassica rapa
emb|CDY51290.1|  BnaA06g23560D                                          212   2e-59   Brassica napus [oilseed rape]
ref|XP_004976989.1|  PREDICTED: beta-D-xylosidase 4-like isoform X2     212   2e-59   Setaria italica
ref|XP_002866623.1|  beta-xylosidase 4                                  211   4e-59   Arabidopsis lyrata subsp. lyrata
ref|XP_004485551.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    210   5e-59   Cicer arietinum [garbanzo]
ref|XP_003547598.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    210   6e-59   Glycine max [soybeans]
ref|XP_002873418.1|  beta-xylosidase 3                                  210   8e-59   Arabidopsis lyrata subsp. lyrata
gb|KHN33504.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 1           208   8e-59   Glycine soja [wild soybean]
ref|XP_009112141.1|  PREDICTED: beta-D-xylosidase 4-like                209   1e-58   Brassica rapa
emb|CDY18705.1|  BnaA09g06900D                                          209   1e-58   Brassica napus [oilseed rape]
gb|KFK28148.1|  hypothetical protein AALP_AA8G478800                    209   1e-58   Arabis alpina [alpine rockcress]
dbj|BAE44362.1|  alpha-L-arabinofuranosidase                            209   1e-58   Raphanus sativus
ref|XP_007148433.1|  hypothetical protein PHAVU_006G208200g             209   2e-58   Phaseolus vulgaris [French bean]
ref|XP_010422951.1|  PREDICTED: beta-D-xylosidase 3 isoform X2          209   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010491611.1|  PREDICTED: beta-D-xylosidase 3-like isoform X2     209   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010422950.1|  PREDICTED: beta-D-xylosidase 3 isoform X1          209   2e-58   Camelina sativa [gold-of-pleasure]
ref|NP_196535.1|  beta-xylosidase 3                                     209   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010491610.1|  PREDICTED: beta-D-xylosidase 3-like isoform X1     209   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010452969.1|  PREDICTED: beta-D-xylosidase 3-like                208   3e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010484241.1|  PREDICTED: beta-D-xylosidase 4                     208   3e-58   Camelina sativa [gold-of-pleasure]
gb|KCW63060.1|  hypothetical protein EUGRSUZ_G00652                     202   5e-58   Eucalyptus grandis [rose gum]
emb|CDX81229.1|  BnaC09g06400D                                          207   8e-58   
emb|CDY31313.1|  BnaA02g34280D                                          206   1e-57   Brassica napus [oilseed rape]
ref|XP_006280038.1|  hypothetical protein CARUB_v10025915mg             207   1e-57   Capsella rubella
ref|XP_009130462.1|  PREDICTED: beta-D-xylosidase 4-like                206   1e-57   Brassica rapa
emb|CDY56487.1|  BnaCnng30450D                                          206   2e-57   Brassica napus [oilseed rape]
gb|KFK25272.1|  hypothetical protein AALP_AA8G090500                    206   3e-57   Arabis alpina [alpine rockcress]
emb|CDY46812.1|  BnaC02g43200D                                          206   3e-57   Brassica napus [oilseed rape]
ref|XP_009122535.1|  PREDICTED: beta-D-xylosidase 3-like                205   4e-57   Brassica rapa
emb|CDY01780.1|  BnaC06g28200D                                          205   4e-57   
emb|CDX69892.1|  BnaA10g22410D                                          204   1e-56   
gb|EPS65933.1|  hypothetical protein M569_08842                         203   2e-56   Genlisea aurea
ref|XP_010444394.1|  PREDICTED: beta-D-xylosidase 4-like                203   2e-56   Camelina sativa [gold-of-pleasure]
emb|CAB89360.1|  beta-glucosidase-like protein                          197   3e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010461983.1|  PREDICTED: beta-D-xylosidase 4-like                202   3e-56   Camelina sativa [gold-of-pleasure]
emb|CDY35825.1|  BnaC09g37570D                                          202   5e-56   Brassica napus [oilseed rape]
emb|CBI40687.3|  unnamed protein product                                201   1e-55   Vitis vinifera
ref|XP_010546362.1|  PREDICTED: beta-D-xylosidase 4                     201   1e-55   Tarenaya hassleriana [spider flower]
emb|CDX97115.1|  BnaC09g45100D                                          200   2e-55   
ref|NP_196532.2|  Glycosyl hydrolase family protein                     196   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009105246.1|  PREDICTED: beta-D-xylosidase 3-like                197   2e-54   Brassica rapa
emb|CDX96113.1|  BnaA07g26180D                                          199   2e-54   
ref|XP_010424711.1|  PREDICTED: beta-D-xylosidase 4-like                196   1e-53   
ref|XP_010491609.1|  PREDICTED: beta-D-xylosidase 4-like                194   2e-53   Camelina sativa [gold-of-pleasure]
emb|CDP17082.1|  unnamed protein product                                170   2e-48   Coffea canephora [robusta coffee]
emb|CDY21595.1|  BnaC09g46970D                                          182   2e-48   Brassica napus [oilseed rape]
gb|ABK96385.1|  unknown                                                 173   6e-48   Populus trichocarpa x Populus deltoides
ref|XP_010024778.1|  PREDICTED: putative beta-D-xylosidase              177   4e-47   Eucalyptus grandis [rose gum]
ref|XP_009348894.1|  PREDICTED: putative beta-D-xylosidase              176   8e-47   
ref|XP_009369955.1|  PREDICTED: putative beta-D-xylosidase              175   1e-46   
ref|XP_002316021.1|  beta-D-xylosidase family protein                   175   2e-46   Populus trichocarpa [western balsam poplar]
ref|NP_001280797.1|  putative beta-D-xylosidase precursor               174   3e-46   Malus domestica [apple tree]
ref|XP_006855294.1|  hypothetical protein AMTR_s00057p00049120          174   3e-46   Amborella trichopoda
dbj|BAF79669.1|  beta-D-xylosidase                                      174   4e-46   Pyrus pyrifolia [sha li]
dbj|BAD98523.1|  alpha-L-arabinofuranosidase / beta-D-xylosidase        174   5e-46   Pyrus pyrifolia [sha li]
gb|AGR44452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase 2         174   5e-46   Pyrus x bretschneideri [bai li]
ref|XP_008353169.1|  PREDICTED: putative beta-D-xylosidase              173   1e-45   
ref|XP_008390557.1|  PREDICTED: putative beta-D-xylosidase              172   1e-45   
ref|XP_011009934.1|  PREDICTED: putative beta-D-xylosidase              172   2e-45   Populus euphratica
emb|CDO98788.1|  unnamed protein product                                171   3e-45   Coffea canephora [robusta coffee]
ref|XP_008341125.1|  PREDICTED: putative beta-D-xylosidase              171   6e-45   
ref|XP_011020382.1|  PREDICTED: putative beta-D-xylosidase              170   8e-45   Populus euphratica
gb|KDP27887.1|  hypothetical protein JCGZ_18967                         170   1e-44   Jatropha curcas
ref|XP_010652235.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    168   2e-44   Vitis vinifera
ref|XP_010094323.1|  Beta-D-xylosidase 1                                169   3e-44   Morus notabilis
ref|XP_002270249.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    168   4e-44   Vitis vinifera
ref|XP_010520456.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    167   1e-43   
ref|XP_007035744.1|  Periplasmic beta-glucosidase, putative             167   1e-43   
dbj|BAJ51947.1|  putative beta-D-xylosidase                             160   2e-43   Glycyrrhiza uralensis [Chinese licorice]
ref|XP_002519194.1|  Periplasmic beta-glucosidase precursor, puta...    166   3e-43   Ricinus communis
ref|XP_011082425.1|  PREDICTED: probable beta-D-xylosidase 2            166   4e-43   Sesamum indicum [beniseed]
ref|XP_002311398.2|  beta-D-xylosidase family protein                   165   6e-43   
gb|KCW61272.1|  hypothetical protein EUGRSUZ_H04033                     165   7e-43   Eucalyptus grandis [rose gum]
ref|XP_010914548.1|  PREDICTED: probable beta-D-xylosidase 2            165   8e-43   Elaeis guineensis
ref|XP_008458374.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    164   2e-42   
ref|XP_010087253.1|  putative beta-D-xylosidase 2                       164   2e-42   Morus notabilis
ref|XP_004172482.1|  PREDICTED: beta-D-xylosidase 1-like                162   2e-42   
gb|KDO71842.1|  hypothetical protein CISIN_1g0062242mg                  159   3e-42   Citrus sinensis [apfelsine]
dbj|BAO45878.1|  beta-D-xylosidase                                      163   4e-42   Acacia mangium
ref|XP_006349198.1|  PREDICTED: probable beta-D-xylosidase 2-like       163   5e-42   Solanum tuberosum [potatoes]
gb|KHN08645.1|  Putative beta-D-xylosidase 2                            162   5e-42   Glycine soja [wild soybean]
ref|XP_003519750.1|  PREDICTED: probable beta-D-xylosidase 2-like       162   5e-42   Glycine max [soybeans]
gb|KDO87030.1|  hypothetical protein CISIN_1g0041901mg                  160   6e-42   Citrus sinensis [apfelsine]
ref|XP_010313018.1|  PREDICTED: slArf/Xyl1 protein isoform X1           161   7e-42   Solanum lycopersicum
dbj|BAF43576.1|  arabinofuranosidase/xylosidase homolog                 157   8e-42   Prunus persica
gb|KHG28205.1|  putative beta-D-xylosidase 2 -like protein              160   8e-42   Gossypium arboreum [tree cotton]
gb|KDO71849.1|  hypothetical protein CISIN_1g0062242mg                  159   8e-42   Citrus sinensis [apfelsine]
ref|XP_010268028.1|  PREDICTED: probable beta-D-xylosidase 2            162   9e-42   Nelumbo nucifera [Indian lotus]
ref|XP_011079568.1|  PREDICTED: probable beta-D-xylosidase 2            162   1e-41   Sesamum indicum [beniseed]
ref|XP_004151112.1|  PREDICTED: beta-D-xylosidase 1-like                162   1e-41   Cucumis sativus [cucumbers]
ref|NP_001266104.1|  SlArf/Xyl1 protein precursor                       161   1e-41   
ref|XP_007051080.1|  Beta-xylosidase 2                                  162   1e-41   
gb|KJB49844.1|  hypothetical protein B456_008G140600                    161   2e-41   Gossypium raimondii
ref|NP_001266107.1|  SlArf/Xyl2 protein precursor                       161   2e-41   Solanum lycopersicum
ref|XP_002276351.1|  PREDICTED: putative beta-D-xylosidase              161   2e-41   Vitis vinifera
gb|KDO71843.1|  hypothetical protein CISIN_1g0062242mg                  159   2e-41   Citrus sinensis [apfelsine]
gb|KDO71845.1|  hypothetical protein CISIN_1g0062242mg                  159   2e-41   Citrus sinensis [apfelsine]
ref|XP_006444470.1|  hypothetical protein CICLE_v10018959mg             160   2e-41   Citrus clementina [clementine]
gb|KDO71844.1|  hypothetical protein CISIN_1g0062242mg                  159   2e-41   Citrus sinensis [apfelsine]
gb|KHN14659.1|  Beta-D-xylosidase 1                                     160   2e-41   Glycine soja [wild soybean]
ref|XP_008223305.1|  PREDICTED: putative beta-D-xylosidase              160   3e-41   Prunus mume [ume]
gb|AFU54451.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase           160   3e-41   Prunus salicina [Japanese plum]
gb|AFU54452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase           160   3e-41   Prunus salicina [Japanese plum]
ref|XP_003591420.1|  Beta xylosidase                                    160   4e-41   Medicago truncatula
sp|P83344.1|XYNB_PRUPE  RecName: Full=Putative beta-D-xylosidase;...    157   5e-41   Prunus persica
ref|XP_011041424.1|  PREDICTED: probable beta-D-xylosidase 2            160   5e-41   Populus euphratica
gb|ACD93208.1|  beta xylosidase                                         160   6e-41   Camellia sinensis [black tea]
ref|XP_010671663.1|  PREDICTED: beta-D-xylosidase 1                     160   6e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003546334.1|  PREDICTED: beta-D-xylosidase 1-like                160   6e-41   Glycine max [soybeans]
ref|XP_003535953.1|  PREDICTED: probable beta-D-xylosidase 2            159   7e-41   Glycine max [soybeans]
gb|ADV41671.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase           158   7e-41   Actinidia deliciosa var. deliciosa
ref|XP_011042236.1|  PREDICTED: probable beta-D-xylosidase 2            159   8e-41   Populus euphratica
ref|XP_009593976.1|  PREDICTED: probable beta-D-xylosidase 2            159   9e-41   Nicotiana tomentosiformis
ref|XP_009383731.1|  PREDICTED: probable beta-D-xylosidase 2            159   9e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011015623.1|  PREDICTED: probable beta-D-xylosidase 2            159   9e-41   Populus euphratica
ref|XP_008451490.1|  PREDICTED: probable beta-D-xylosidase 2            159   1e-40   Cucumis melo [Oriental melon]
ref|XP_006418321.1|  hypothetical protein EUTSA_v10006876mg             159   1e-40   Eutrema salsugineum [saltwater cress]
gb|KHG05051.1|  putative beta-D-xylosidase 2 -like protein              159   2e-40   Gossypium arboreum [tree cotton]
ref|XP_010259348.1|  PREDICTED: putative beta-D-xylosidase              158   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_006419427.1|  hypothetical protein CICLE_v10004369mg             158   3e-40   
ref|XP_006306830.1|  hypothetical protein CARUB_v10008371mg             156   4e-40   
ref|XP_010679361.1|  PREDICTED: probable beta-D-xylosidase 2            157   5e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010457247.1|  PREDICTED: probable beta-D-xylosidase 2            157   6e-40   Camelina sativa [gold-of-pleasure]
ref|XP_007225668.1|  hypothetical protein PRUPE_ppa001718mg             157   6e-40   Prunus persica
ref|XP_010481135.1|  PREDICTED: probable beta-D-xylosidase 2            157   6e-40   Camelina sativa [gold-of-pleasure]
gb|AAP83934.1|  auxin-induced beta-glucosidase                          156   8e-40   Oxybasis rubra [pigweed]
gb|KHG14371.1|  Beta-D-xylosidase 1 -like protein                       156   9e-40   Gossypium arboreum [tree cotton]
ref|XP_009609889.1|  PREDICTED: putative beta-D-xylosidase              154   9e-40   
ref|XP_006306829.1|  hypothetical protein CARUB_v10008371mg             156   9e-40   Capsella rubella
ref|XP_007138975.1|  hypothetical protein PHAVU_009G254300g             156   1e-39   Phaseolus vulgaris [French bean]
ref|XP_002302758.2|  hypothetical protein POPTR_0002s19830g             156   1e-39   
ref|XP_002515300.1|  Beta-glucosidase, putative                         156   1e-39   Ricinus communis
gb|KJB38535.1|  hypothetical protein B456_006G259500                    156   2e-39   Gossypium raimondii
ref|XP_002320310.2|  hypothetical protein POPTR_0014s11730g             155   2e-39   
ref|XP_009757165.1|  PREDICTED: probable beta-D-xylosidase 2            155   2e-39   Nicotiana sylvestris
ref|XP_004136155.1|  PREDICTED: probable beta-D-xylosidase 2-like       155   2e-39   Cucumis sativus [cucumbers]
ref|XP_007145157.1|  hypothetical protein PHAVU_007G215100g             155   2e-39   Phaseolus vulgaris [French bean]
ref|XP_010522822.1|  PREDICTED: probable beta-D-xylosidase 2            155   2e-39   Tarenaya hassleriana [spider flower]
ref|XP_004162442.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    155   2e-39   
ref|XP_008808663.1|  PREDICTED: beta-D-xylosidase 1-like                155   3e-39   Phoenix dactylifera
gb|KHN12900.1|  Beta-D-xylosidase 1                                     155   4e-39   Glycine soja [wild soybean]
ref|XP_004295104.1|  PREDICTED: putative beta-D-xylosidase              155   4e-39   Fragaria vesca subsp. vesca
dbj|BAC41913.1|  putative beta-xylosidase                               154   5e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889410.1|  hypothetical protein ARALYDRAFT_470222             154   5e-39   
ref|XP_003533205.2|  PREDICTED: beta-D-xylosidase 1-like                155   5e-39   
gb|EYU46800.1|  hypothetical protein MIMGU_mgv1a018473mg                154   6e-39   Erythranthe guttata [common monkey flower]
ref|NP_196618.1|  putative beta-D-xylosidase 6                          154   6e-39   Arabidopsis thaliana [mouse-ear cress]
gb|KJB09457.1|  hypothetical protein B456_001G143600                    154   7e-39   Gossypium raimondii
gb|KJB72795.1|  hypothetical protein B456_011G198200                    154   9e-39   Gossypium raimondii
ref|XP_004979939.1|  PREDICTED: probable beta-D-xylosidase 2-like       154   1e-38   Setaria italica
ref|XP_011100796.1|  PREDICTED: beta-D-xylosidase 1                     153   2e-38   Sesamum indicum [beniseed]
gb|KDP28242.1|  hypothetical protein JCGZ_14013                         152   2e-38   Jatropha curcas
ref|XP_006352077.1|  PREDICTED: beta-D-xylosidase 1-like                152   2e-38   Solanum tuberosum [potatoes]
ref|XP_009119616.1|  PREDICTED: probable beta-D-xylosidase 2            152   2e-38   Brassica rapa
ref|NP_563659.1|  probable beta-D-xylosidase 2                          152   3e-38   Arabidopsis thaliana [mouse-ear cress]
dbj|BAQ19511.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase          152   3e-38   Persea americana
ref|XP_004487789.1|  PREDICTED: beta-D-xylosidase 1-like                152   3e-38   Cicer arietinum [garbanzo]
ref|XP_009804070.1|  PREDICTED: beta-D-xylosidase 1 isoform X1          152   3e-38   Nicotiana sylvestris
gb|AAS17751.2|  beta xylosidase                                         152   3e-38   Fragaria x ananassa
gb|AAG10624.1|AC022521_2  Similar to xylosidase                         152   3e-38   Arabidopsis thaliana [mouse-ear cress]
emb|CDX89954.1|  BnaA10g01280D                                          152   3e-38   
ref|XP_004300463.1|  PREDICTED: probable beta-D-xylosidase 2            152   3e-38   Fragaria vesca subsp. vesca
gb|KCW58371.1|  hypothetical protein EUGRSUZ_H010551                    150   4e-38   Eucalyptus grandis [rose gum]
ref|XP_006287090.1|  hypothetical protein CARUB_v10000252mg             152   4e-38   
ref|XP_010453089.1|  PREDICTED: probable beta-D-xylosidase 6            152   5e-38   
ref|XP_002873465.1|  glycosyl hydrolase family 3 protein                152   6e-38   Arabidopsis lyrata subsp. lyrata
gb|EYU23074.1|  hypothetical protein MIMGU_mgv1a019840mg                150   8e-38   Erythranthe guttata [common monkey flower]
emb|CDY15255.1|  BnaC05g01340D                                          151   8e-38   Brassica napus [oilseed rape]
ref|XP_008386729.1|  PREDICTED: probable beta-D-xylosidase 2            150   1e-37   
ref|XP_001784462.1|  predicted protein                                  150   1e-37   
ref|XP_010069867.1|  PREDICTED: probable beta-D-xylosidase 2            150   1e-37   Eucalyptus grandis [rose gum]
ref|XP_009339788.1|  PREDICTED: probable beta-D-xylosidase 2            150   2e-37   Pyrus x bretschneideri [bai li]
gb|KFK42620.1|  hypothetical protein AALP_AA1G019000                    149   3e-37   Arabis alpina [alpine rockcress]
ref|XP_010491733.1|  PREDICTED: probable beta-D-xylosidase 6            149   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006399554.1|  hypothetical protein EUTSA_v10012725mg             149   4e-37   Eutrema salsugineum [saltwater cress]
ref|XP_003594795.1|  Beta xylosidase                                    149   5e-37   Medicago truncatula
ref|XP_010254644.1|  PREDICTED: probable beta-D-xylosidase 6            148   8e-37   Nelumbo nucifera [Indian lotus]
dbj|BAF02134.1|  xylosidase                                             142   1e-36   Arabidopsis thaliana [mouse-ear cress]
gb|KFK25328.1|  hypothetical protein AALP_AA8G098500                    148   1e-36   
ref|XP_003625957.1|  Beta-xylosidase                                    147   1e-36   
ref|XP_003567059.2|  PREDICTED: beta-D-xylosidase 1-like                147   2e-36   
ref|XP_009378701.1|  PREDICTED: probable beta-D-xylosidase 2            147   2e-36   
emb|CDX97026.1|  BnaC09g45990D                                          146   3e-36   
emb|CDX69822.1|  BnaA10g21710D                                          146   4e-36   
ref|XP_010527498.1|  PREDICTED: probable beta-D-xylosidase 6            146   6e-36   
ref|XP_009400278.1|  PREDICTED: probable beta-D-xylosidase 6            145   6e-36   
gb|AFK46503.1|  unknown                                                 137   1e-35   
emb|CBI22910.3|  unnamed protein product                                144   1e-35   
ref|XP_009122041.1|  PREDICTED: probable beta-D-xylosidase 6            144   2e-35   
ref|XP_007141155.1|  hypothetical protein PHAVU_008G171800g             138   3e-35   
ref|XP_007200621.1|  hypothetical protein PRUPE_ppa001656mg             144   3e-35   
gb|KHN19223.1|  Putative beta-D-xylosidase 2                            143   4e-35   
ref|XP_010482214.1|  PREDICTED: beta-D-xylosidase 1-like                144   4e-35   
ref|XP_010442400.1|  PREDICTED: beta-D-xylosidase 1-like                142   5e-35   
gb|KHG29436.1|  putative beta-D-xylosidase 5 -like protein              140   6e-35   
ref|XP_002963750.1|  hypothetical protein SELMODRAFT_80102              143   6e-35   
gb|KHN24914.1|  Putative beta-D-xylosidase 7                            141   1e-34   
ref|XP_003520749.2|  PREDICTED: probable beta-D-xylosidase 2-like       142   1e-34   
ref|XP_006280043.1|  hypothetical protein CARUB_v10025920mg             142   1e-34   
ref|XP_010440503.1|  PREDICTED: beta-D-xylosidase 1                     141   2e-34   
ref|XP_008454299.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    141   2e-34   
gb|EEE61389.1|  hypothetical protein OsJ_15562                          141   2e-34   
ref|XP_008454298.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    141   2e-34   
emb|CAJ86207.1|  B1011H02.4                                             141   2e-34   
ref|XP_002987446.1|  hypothetical protein SELMODRAFT_426206             141   2e-34   
ref|NP_001053392.1|  Os04g0530700                                       141   3e-34   
ref|XP_003554544.1|  PREDICTED: probable beta-D-xylosidase 2-like       141   3e-34   
ref|NP_199747.1|  bifunctional {beta}-D-xylosidase/{alpha}-L-arab...    141   3e-34   
ref|XP_011026854.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    141   4e-34   
gb|KHN43468.1|  Putative beta-D-xylosidase 2                            141   4e-34   
ref|XP_010546993.1|  PREDICTED: beta-D-xylosidase 1-like isoform X1     140   4e-34   
ref|XP_008235191.1|  PREDICTED: probable beta-D-xylosidase 2            140   5e-34   
ref|XP_003544783.1|  PREDICTED: probable beta-D-xylosidase 7-like       140   6e-34   
ref|XP_007163167.1|  hypothetical protein PHAVU_001G212100g             140   6e-34   
ref|XP_002980053.1|  hypothetical protein SELMODRAFT_112087             140   7e-34   
ref|XP_006298950.1|  hypothetical protein CARUB_v10015075mg             140   9e-34   
ref|XP_009404942.1|  PREDICTED: probable beta-D-xylosidase 6            140   9e-34   
gb|KHN26079.1|  Putative beta-D-xylosidase 7                            138   9e-34   
gb|AHA84291.1|  beta-D-xylosidase                                       132   1e-33   
ref|XP_006653619.1|  PREDICTED: probable beta-D-xylosidase 6-like       139   1e-33   
ref|XP_002865732.1|  beta-xylosidase 1                                  139   2e-33   
ref|XP_004512546.1|  PREDICTED: probable beta-D-xylosidase 6-like       139   2e-33   
ref|XP_004976327.1|  PREDICTED: probable beta-D-xylosidase 6-like       132   2e-33   
ref|XP_003542472.1|  PREDICTED: probable beta-D-xylosidase 7-like       139   2e-33   
ref|XP_007140931.1|  hypothetical protein PHAVU_008G153300g             139   2e-33   
ref|XP_003526589.1|  PREDICTED: probable beta-D-xylosidase 7-like...    139   2e-33   
ref|XP_002974833.1|  hypothetical protein SELMODRAFT_101733             139   2e-33   
ref|XP_003638778.1|  Xylan 1 4-beta-xylosidase                          139   2e-33   
gb|KGN48676.1|  hypothetical protein Csa_6G497270                       137   2e-33   
gb|KJB77632.1|  hypothetical protein B456_012G147500                    138   3e-33   
ref|XP_003612944.1|  Beta-D-xylosidase                                  138   3e-33   
gb|ABY48135.1|  beta-D-xylosidase                                       138   3e-33   
gb|EPS60429.1|  hypothetical protein M569_14372                         138   4e-33   
ref|XP_011457868.1|  PREDICTED: probable beta-D-xylosidase 5            138   4e-33   
ref|XP_006830079.1|  hypothetical protein AMTR_s00125p00113140          138   4e-33   
ref|XP_010507856.1|  PREDICTED: probable beta-D-xylosidase 5            137   5e-33   
gb|KHN09132.1|  Putative beta-D-xylosidase 7                            136   5e-33   
gb|KJB44020.1|  hypothetical protein B456_007G230000                    137   5e-33   
ref|XP_004160150.1|  PREDICTED: probable beta-D-xylosidase 6-like       137   6e-33   
ref|XP_004143540.1|  PREDICTED: probable beta-D-xylosidase 6-like       137   7e-33   
ref|XP_002513892.1|  Periplasmic beta-glucosidase precursor, puta...    137   8e-33   
ref|XP_009612183.1|  PREDICTED: probable beta-D-xylosidase 6            137   8e-33   
ref|XP_008440505.1|  PREDICTED: probable beta-D-xylosidase 6            137   9e-33   
ref|XP_004231972.1|  PREDICTED: probable beta-D-xylosidase 6            137   9e-33   
emb|CDY49607.1|  BnaA09g03310D                                          137   9e-33   
dbj|BAG28345.1|  arabinofuranosidase                                    137   1e-32   
ref|NP_188596.1|  putative beta-D-xylosidase 5                          137   1e-32   
dbj|BAJ94317.1|  predicted protein                                      137   1e-32   
emb|CDX85405.1|  BnaC07g27160D                                          136   1e-32   
ref|XP_006488872.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    137   1e-32   
ref|XP_006850394.1|  hypothetical protein AMTR_s00184p00056440          136   2e-32   
dbj|BAB02547.1|  beta-1,4-xylosidase                                    136   2e-32   
ref|XP_009151303.1|  PREDICTED: beta-D-xylosidase 1                     136   2e-32   
gb|EYU23816.1|  hypothetical protein MIMGU_mgv1a0042531mg               129   2e-32   
ref|XP_004494414.1|  PREDICTED: probable beta-D-xylosidase 2-like       135   3e-32   
ref|XP_006395069.1|  hypothetical protein EUTSA_v10003681mg             135   4e-32   
gb|KCW59657.1|  hypothetical protein EUGRSUZ_H02409                     134   4e-32   
ref|XP_009390582.1|  PREDICTED: probable beta-D-xylosidase 7            134   4e-32   
ref|XP_010466113.1|  PREDICTED: probable beta-D-xylosidase 5            135   4e-32   
ref|XP_002885319.1|  beta-1,4-xylosidase                                135   4e-32   
ref|XP_007042636.1|  Glycosyl hydrolase family protein                  135   4e-32   
emb|CDY05634.1|  BnaC02g39030D                                          135   5e-32   
gb|KDP44489.1|  hypothetical protein JCGZ_16322                         135   5e-32   
ref|XP_002527213.1|  Thermostable beta-glucosidase B, putative          132   5e-32   
ref|XP_003615008.1|  Xylan 1 4-beta-xylosidase                          135   5e-32   
gb|AES97966.2|  glycoside hydrolase family 3 protein                    135   5e-32   
emb|CDY71910.1|  BnaAnng39260D                                          130   5e-32   
ref|XP_008385726.1|  PREDICTED: probable beta-D-xylosidase 6            135   6e-32   
gb|ACG29242.1|  auxin-induced beta-glucosidase                          133   7e-32   
ref|XP_009795794.1|  PREDICTED: probable beta-D-xylosidase 6            134   7e-32   
ref|XP_007018826.1|  Glycosyl hydrolase family protein                  134   8e-32   
ref|XP_010105119.1|  putative beta-D-xylosidase 6                       134   8e-32   
ref|XP_003615006.1|  Xylan 1 4-beta-xylosidase                          134   8e-32   
ref|XP_002451244.1|  hypothetical protein SORBIDRAFT_05g026400          134   1e-31   
ref|XP_002448225.1|  hypothetical protein SORBIDRAFT_06g023450          134   1e-31   
ref|NP_001266114.1|  SlArf/Xyl4 protein precursor                       134   1e-31   
ref|XP_006357757.1|  PREDICTED: probable beta-D-xylosidase 6-like       134   1e-31   
gb|KCW55109.1|  hypothetical protein EUGRSUZ_I01067                     133   1e-31   
ref|XP_002264114.2|  PREDICTED: probable beta-D-xylosidase 5            134   1e-31   
ref|NP_001145980.1|  putative O-Glycosyl hydrolase superfamily pr...    134   1e-31   
ref|XP_006354009.1|  PREDICTED: probable beta-D-xylosidase 7-like       133   1e-31   
gb|AFI25186.1|  putative beta-D-xylosidase                              133   2e-31   
ref|XP_010023414.1|  PREDICTED: probable beta-D-xylosidase 6            133   2e-31   
gb|AES97964.2|  glycoside hydrolase family 3 amino-terminal domai...    133   2e-31   
ref|XP_009111875.1|  PREDICTED: beta-D-xylosidase 1-like                133   2e-31   
ref|XP_004513829.1|  PREDICTED: probable beta-D-xylosidase 7-like       133   2e-31   
ref|XP_010111676.1|  putative beta-D-xylosidase 5                       133   2e-31   
ref|XP_010937520.1|  PREDICTED: uncharacterized protein LOC105056876    134   2e-31   
gb|KDP32160.1|  hypothetical protein JCGZ_12621                         133   2e-31   
ref|XP_003580200.2|  PREDICTED: probable beta-D-xylosidase 6            133   2e-31   
ref|XP_010030625.1|  PREDICTED: probable beta-D-xylosidase 5            132   3e-31   
ref|XP_007047697.1|  Glycosyl hydrolase family protein                  133   3e-31   
ref|XP_007018824.1|  Glycosyl hydrolase family protein isoform 2        134   3e-31   
ref|XP_007206430.1|  hypothetical protein PRUPE_ppa001583mg             132   3e-31   
ref|XP_011011484.1|  PREDICTED: probable beta-D-xylosidase 7            131   3e-31   
ref|XP_008236665.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    132   3e-31   
ref|XP_007018825.1|  Glycosyl hydrolase family protein isoform 3        134   3e-31   
ref|XP_007018823.1|  Glycosyl hydrolase family protein isoform 1        134   3e-31   
emb|CAN82161.1|  hypothetical protein VITISV_035506                     133   3e-31   
emb|CBI25718.3|  unnamed protein product                                132   4e-31   
emb|CDP02677.1|  unnamed protein product                                132   4e-31   
gb|KDO49896.1|  hypothetical protein CISIN_1g003980mg                   132   4e-31   
ref|XP_006423474.1|  hypothetical protein CICLE_v10027856mg             132   4e-31   
ref|XP_008236660.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    132   4e-31   
ref|XP_002264031.2|  PREDICTED: probable beta-D-xylosidase 6            132   4e-31   
gb|KFK26586.1|  hypothetical protein AALP_AA8G267600                    132   4e-31   
emb|CDY00033.1|  BnaC09g02680D                                          132   5e-31   
gb|KJB29303.1|  hypothetical protein B456_005G093200                    132   5e-31   
ref|XP_007158321.1|  hypothetical protein PHAVU_002G142900g             132   6e-31   
ref|XP_010531790.1|  PREDICTED: probable beta-D-xylosidase 7            130   6e-31   
gb|KJB29304.1|  hypothetical protein B456_005G093200                    132   7e-31   
ref|XP_009391116.1|  PREDICTED: probable beta-D-xylosidase 7            131   7e-31   
gb|KHN38910.1|  Putative beta-D-xylosidase 6                            130   7e-31   
ref|XP_002527511.1|  Beta-glucosidase, putative                         132   7e-31   
gb|KDP20226.1|  hypothetical protein JCGZ_09858                         131   7e-31   
ref|XP_007136230.1|  hypothetical protein PHAVU_009G029300g             131   7e-31   
emb|CDY33913.1|  BnaA02g30740D                                          131   1e-30   
ref|XP_009129779.1|  PREDICTED: beta-D-xylosidase 1-like                131   1e-30   
ref|XP_003534261.1|  PREDICTED: probable beta-D-xylosidase 6-like       131   1e-30   
ref|XP_009782574.1|  PREDICTED: probable beta-D-xylosidase 7            131   1e-30   
ref|XP_003615019.1|  hypothetical protein MTR_5g062650                  131   1e-30   
ref|XP_010687347.1|  PREDICTED: probable beta-D-xylosidase 5            130   1e-30   
gb|EMS60786.1|  putative beta-D-xylosidase 6                            130   1e-30   
ref|XP_009592501.1|  PREDICTED: probable beta-D-xylosidase 7            130   1e-30   
ref|XP_009390583.1|  PREDICTED: probable beta-D-xylosidase 7            130   2e-30   
ref|XP_003615003.1|  Xylan 1 4-beta-xylosidase                          130   2e-30   
ref|XP_004152230.1|  PREDICTED: probable beta-D-xylosidase 2-like       130   2e-30   
ref|XP_004156823.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    130   2e-30   
ref|XP_010556264.1|  PREDICTED: beta-D-xylosidase 1-like                130   2e-30   
gb|KHG05631.1|  putative beta-D-xylosidase 7 -like protein              129   3e-30   
ref|XP_008808183.1|  PREDICTED: probable beta-D-xylosidase 7            129   3e-30   
emb|CDO97277.1|  unnamed protein product                                129   3e-30   
ref|XP_009145766.1|  PREDICTED: probable beta-D-xylosidase 5            129   4e-30   
ref|XP_009391118.1|  PREDICTED: probable beta-D-xylosidase 7            129   4e-30   
ref|XP_008346038.1|  PREDICTED: probable beta-D-xylosidase 7            126   5e-30   
ref|XP_006487370.1|  PREDICTED: probable beta-D-xylosidase 5-like       129   5e-30   
ref|XP_011099456.1|  PREDICTED: probable beta-D-xylosidase 6            129   6e-30   
gb|AAD09291.1|  beta-glucosidase                                        122   6e-30   
ref|XP_001775759.1|  predicted protein                                  129   7e-30   
ref|XP_003592512.1|  Xylosidase                                         129   7e-30   
ref|XP_004288313.2|  PREDICTED: probable beta-D-xylosidase 6 isof...    129   7e-30   
ref|XP_002306583.2|  hypothetical protein POPTR_0005s16660g             128   8e-30   
gb|EYU22676.1|  hypothetical protein MIMGU_mgv1a0027542mg               121   8e-30   
emb|CAJ65923.1|  xylan 1,4-beta-xylosidase                              127   1e-29   
ref|XP_008808189.1|  PREDICTED: probable beta-D-xylosidase 7            128   1e-29   
gb|EYU44551.1|  hypothetical protein MIMGU_mgv1a001559mg                128   1e-29   
emb|CDY58860.1|  BnaCnng33860D                                          127   1e-29   
gb|KDO78722.1|  hypothetical protein CISIN_1g003606mg                   127   1e-29   
ref|XP_010683056.1|  PREDICTED: probable beta-D-xylosidase 6            127   1e-29   
ref|XP_006426203.1|  hypothetical protein CICLE_v10024911mg             128   1e-29   
gb|KDO78723.1|  hypothetical protein CISIN_1g003606mg                   127   2e-29   
ref|XP_006466365.1|  PREDICTED: probable beta-D-xylosidase 6-like       127   2e-29   
gb|KDP20227.1|  hypothetical protein JCGZ_09859                         127   2e-29   
gb|KJB59942.1|  hypothetical protein B456_009G282000                    126   2e-29   
ref|XP_010914750.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    127   2e-29   
ref|XP_006383491.1|  hypothetical protein POPTR_0005s16650g             127   2e-29   
ref|XP_002535159.1|  Thermostable beta-glucosidase B, putative          125   2e-29   
ref|XP_009391117.1|  PREDICTED: probable beta-D-xylosidase 7            127   2e-29   
gb|ABA95273.1|  Beta-D-xylosidase, putative, expressed                  127   3e-29   
gb|EYU33327.1|  hypothetical protein MIMGU_mgv1a001678mg                127   3e-29   
ref|NP_001068441.1|  Os11g0673200                                       127   3e-29   
ref|XP_008371868.1|  PREDICTED: probable beta-D-xylosidase 7            127   3e-29   
gb|KJB59940.1|  hypothetical protein B456_009G282000                    126   4e-29   
ref|XP_007200259.1|  hypothetical protein PRUPE_ppa015037mg             126   5e-29   
gb|EAY81823.1|  hypothetical protein OsI_36995                          126   5e-29   
gb|EYU39877.1|  hypothetical protein MIMGU_mgv1a018879mg                126   5e-29   
ref|XP_008384517.1|  PREDICTED: probable beta-D-xylosidase 5            126   5e-29   
ref|XP_002299457.1|  hypothetical protein POPTR_0001s10850g             126   6e-29   
emb|CDP01027.1|  unnamed protein product                                126   8e-29   
gb|EYU26836.1|  hypothetical protein MIMGU_mgv1a024762mg                124   8e-29   
gb|EPS73741.1|  hypothetical protein M569_01013                         125   1e-28   
ref|XP_002980054.1|  hypothetical protein SELMODRAFT_419541             125   1e-28   
gb|KHG13360.1|  putative beta-D-xylosidase 7 -like protein              125   1e-28   
ref|XP_002987447.1|  hypothetical protein SELMODRAFT_426207             125   1e-28   
gb|KJB16244.1|  hypothetical protein B456_002G219200                    123   1e-28   
gb|EYU23224.1|  hypothetical protein MIMGU_mgv1a001695mg                125   2e-28   
gb|ADE76904.1|  unknown                                                 120   2e-28   
gb|KJB59094.1|  hypothetical protein B456_009G239100                    124   2e-28   
ref|XP_007225247.1|  hypothetical protein PRUPE_ppa001675mg             124   2e-28   
gb|KHG02566.1|  putative beta-D-xylosidase 7                            124   3e-28   
ref|XP_006449654.1|  hypothetical protein CICLE_v10018058mg             124   3e-28   
gb|KHG02565.1|  putative beta-D-xylosidase 7                            124   3e-28   
ref|XP_009603126.1|  PREDICTED: probable beta-D-xylosidase 5            124   3e-28   
ref|XP_008236322.1|  PREDICTED: probable beta-D-xylosidase 5            124   4e-28   
ref|XP_009599906.1|  PREDICTED: probable beta-D-xylosidase 7            123   5e-28   
gb|EYU23220.1|  hypothetical protein MIMGU_mgv1a001636mg                123   5e-28   
ref|XP_011074159.1|  PREDICTED: probable beta-D-xylosidase 7            123   5e-28   
ref|XP_004163321.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    123   6e-28   
ref|XP_004150696.1|  PREDICTED: probable beta-D-xylosidase 7-like       123   6e-28   
gb|EMT31561.1|  Putative beta-D-xylosidase 2                            122   6e-28   
ref|XP_010269792.1|  PREDICTED: probable beta-D-xylosidase 2            123   6e-28   
emb|CAJ65921.1|  xylan 1,4-beta-xylosidase                              122   7e-28   
ref|XP_004301317.1|  PREDICTED: probable beta-D-xylosidase 7            123   7e-28   
ref|XP_009369659.1|  PREDICTED: probable beta-D-xylosidase 7            123   7e-28   
gb|EYU23223.1|  hypothetical protein MIMGU_mgv1a001417mg                123   7e-28   
ref|XP_008234021.1|  PREDICTED: probable beta-D-xylosidase 7            122   8e-28   
emb|CBI22460.3|  unnamed protein product                                123   8e-28   
ref|NP_001266109.1|  SlArf/Xyl3 protein precursor                       122   8e-28   
gb|KJB16242.1|  hypothetical protein B456_002G219200                    122   9e-28   



>emb|CBI20072.3| unnamed protein product [Vitis vinifera]
Length=333

 Score =   242 bits (618),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 145/186 (78%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPDP +GYPGRTYRFYTG T++ FG GLSYT+F H ++QA
Sbjct  148  PTTWYPQSYVDKVPMTNMNMRPDPASGYPGRTYRFYTGETIYTFGDGLSYTQFNHHLIQA  207

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
              SVS+ +++GH C S+KC+SVDA +++C + A DIHL V N G +SG H+V LFSSPP+
Sbjct  208  PKSVSIPIEEGHSCHSSKCKSVDAVQESCQNLAFDIHLRVNNAGNISGSHTVFLFSSPPS  267

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HN+P+K L+GF+KV ++   + +V F VDVCK LS+VDE G RKVALGLHVLH+G+LKH
Sbjct  268  VHNSPQKHLLGFEKVFVTAKAEALVRFKVDVCKDLSIVDELGTRKVALGLHVLHVGNLKH  327

Query  237  SLTVEI  220
            SL V I
Sbjct  328  SLNVRI  333



>dbj|BAC98299.1| LEXYL2 [Solanum lycopersicum]
Length=633

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 150/187 (80%), Gaps = 1/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MR DPKTG+PGR+YRFY GPT+F FG GLSYT+++H +V+A
Sbjct  447  PMTWYPQSYVDKVDMTNMNMRADPKTGFPGRSYRFYKGPTVFNFGDGLSYTQYKHHLVKA  506

Query  597  QDSVSLALDQGHPCRSTKCESVDAA-EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPP  421
               VS+ L++GH CRSTKC+S+DA  EQ C +  LDIHL V+NVG + G H+VLLF+SPP
Sbjct  507  PKFVSIPLEEGHACRSTKCKSIDAVNEQGCNNLGLDIHLKVQNVGKMRGSHTVLLFTSPP  566

Query  420  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
            ++HNAP+K L+ FQK+ L+P  + VV FN+DVCKHLSVVDE GNRKVALGLHVLHIG LK
Sbjct  567  SVHNAPQKHLLDFQKIHLTPQSEGVVKFNLDVCKHLSVVDEVGNRKVALGLHVLHIGDLK  626

Query  240  HSLTVEI  220
            HSLT+ I
Sbjct  627  HSLTLRI  633



>ref|XP_009612011.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 {ECO:0000303|PubMed:17615411, 
ECO:0000312|EMBL:ABQ45228.1}-like 
[Nicotiana tomentosiformis]
Length=778

 Score =   251 bits (642),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 150/187 (80%), Gaps = 1/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS AD V M +M MR DPKTG+PGR+YRFY GPT+F FG GLSY+ ++H +VQA
Sbjct  592  PMTWYPQSYADKVDMTNMNMRADPKTGFPGRSYRFYKGPTVFNFGDGLSYSDYKHHLVQA  651

Query  597  QDSVSLALDQGHPCRSTKCESVDAA-EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPP  421
               VS+ L++GH CRST+C+S+DA  EQ+C++   DIHL VKNVG +SG H+V LF+SPP
Sbjct  652  PKYVSIPLEEGHACRSTRCKSIDAVNEQSCSNLGFDIHLRVKNVGKMSGSHTVFLFTSPP  711

Query  420  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
            ++HNAP+K L+ FQK+ L+P  + +V F +DVCKHLSVVDE GN+KVALGLHVLHIG LK
Sbjct  712  SVHNAPQKHLLEFQKIHLTPQSEGIVKFKLDVCKHLSVVDEVGNKKVALGLHVLHIGDLK  771

Query  240  HSLTVEI  220
            HSLTV I
Sbjct  772  HSLTVRI  778



>ref|XP_009762535.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nicotiana sylvestris]
Length=779

 Score =   251 bits (642),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 150/187 (80%), Gaps = 1/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS AD V M +M MR DPKTG+PGR+YRFY GPT+F FG GLSY+ ++H +VQA
Sbjct  593  PMTWYPQSYADKVDMTNMNMRADPKTGFPGRSYRFYNGPTVFNFGDGLSYSNYKHHLVQA  652

Query  597  QDSVSLALDQGHPCRSTKCESVDAA-EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPP  421
               VS+ L++GH CRST+C+S+DA  EQ+C++   DIHL VKNVG +SG H+V LF+SPP
Sbjct  653  PKYVSIPLEEGHACRSTRCKSIDAVNEQSCSNLGYDIHLRVKNVGKMSGSHTVFLFTSPP  712

Query  420  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
            ++HNAP+K L+ FQK+ L+P  + +V F +DVCKHLSVVDE GN+KVALGLHVLHIG LK
Sbjct  713  SVHNAPQKHLLEFQKIHLTPQSEGIVKFKLDVCKHLSVVDEVGNKKVALGLHVLHIGDLK  772

Query  240  HSLTVEI  220
            HSLTV I
Sbjct  773  HSLTVRI  779



>ref|XP_004230547.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Solanum 
lycopersicum]
Length=778

 Score =   249 bits (637),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 150/187 (80%), Gaps = 1/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MR DPKTG+PGR+YRFY GPT+F FG GLSYT+++H +V+A
Sbjct  592  PMTWYPQSYVDKVDMTNMNMRADPKTGFPGRSYRFYKGPTVFNFGDGLSYTQYKHHLVKA  651

Query  597  QDSVSLALDQGHPCRSTKCESVDAA-EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPP  421
               VS+ L++GH CRSTKC+S+DA  EQ C +  LDIHL V+NVG + G H+VLLF+SPP
Sbjct  652  PKFVSIPLEEGHACRSTKCKSIDAVNEQGCNNLGLDIHLKVQNVGKMRGSHTVLLFTSPP  711

Query  420  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
            ++HNAP+K L+ FQK+ L+P  + VV FN+DVCKHLSVVDE GNRKVALGLHVLHIG LK
Sbjct  712  SVHNAPQKHLLDFQKIHLTPQSEGVVKFNLDVCKHLSVVDEVGNRKVALGLHVLHIGDLK  771

Query  240  HSLTVEI  220
            HSLT+ I
Sbjct  772  HSLTLRI  778



>gb|KCW63063.1| hypothetical protein EUGRSUZ_G00654 [Eucalyptus grandis]
Length=621

 Score =   246 bits (627),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS AD+V M +M MRPDP  GYPGRTYRFYTGPTL+ FG GLSY+ F HS+VQA
Sbjct  436  PMTWYPQSYADTVPMTNMTMRPDPAMGYPGRTYRFYTGPTLYSFGDGLSYSSFNHSLVQA  495

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               +S+ L++GH CRS+ CES++A  +TC++   D+HLNVKNVG  SG H+V LFSSPP+
Sbjct  496  PRVMSVPLEEGHVCRSSACESLEATGETCSNLTFDVHLNVKNVGNFSGSHTVFLFSSPPS  555

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +H AP+KQL+GF+KV L+   +  V F VDVCK LSVVDE G+RKVALG++VLH+G LKH
Sbjct  556  VHRAPQKQLLGFEKVFLASQSEAQVQFKVDVCKDLSVVDELGHRKVALGMYVLHVGDLKH  615

Query  237  SLTVEI  220
            +L+V+I
Sbjct  616  ALSVQI  621



>ref|XP_006351808.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Solanum tuberosum]
Length=778

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 149/187 (80%), Gaps = 1/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MR DPKTG+PGR+YRFY GPT+F FG GLSYT+++H +V+A
Sbjct  592  PMTWYPQSYVDKVDMTNMNMRADPKTGFPGRSYRFYKGPTVFNFGDGLSYTQYKHHLVKA  651

Query  597  QDSVSLALDQGHPCRSTKCESVDAA-EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPP  421
               VS+ L++GH CRSTKC+S+D+  EQ C +   DIHL V+NVG + G H+VLLF+SPP
Sbjct  652  PKFVSIPLEEGHACRSTKCKSIDSVNEQGCNNLGFDIHLKVQNVGKMRGSHTVLLFTSPP  711

Query  420  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
            ++HNAP+K L+ FQK+ L+P  + VV FN+DVCKHLSVVDE GNRKVALGLHVLHIG LK
Sbjct  712  SVHNAPQKHLLDFQKIHLTPQSEGVVKFNLDVCKHLSVVDEVGNRKVALGLHVLHIGDLK  771

Query  240  HSLTVEI  220
            HSLT+ I
Sbjct  772  HSLTLRI  778



>gb|KCW63062.1| hypothetical protein EUGRSUZ_G006531, partial [Eucalyptus grandis]
Length=642

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 146/186 (78%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS AD+V M +M MRPDP TGYPGRTYRFYTGPT++KFG GLSY+ F HS+VQA
Sbjct  444  PMTWYPQSYADAVPMTNMNMRPDPATGYPGRTYRFYTGPTVYKFGDGLSYSNFSHSLVQA  503

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++GH CRS  CES++A  + C++ ALD+HLNVKNVG  SG H+V LFSSPP+
Sbjct  504  PQVVSVPLEEGHVCRSLACESLEATGEMCSNLALDVHLNVKNVGRFSGSHTVFLFSSPPS  563

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +H AP+K L+GF+KV L+   +  V F VD+CK L VVDE G +KVALG HVLHIG LKH
Sbjct  564  VHRAPQKHLLGFEKVFLASQSEAQVQFKVDICKDLGVVDELGCQKVALGTHVLHIGDLKH  623

Query  237  SLTVEI  220
            +L+V+I
Sbjct  624  ALSVQI  629



>ref|XP_010068200.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
Length=777

 Score =   246 bits (627),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS AD+V M +M MRPDP  GYPGRTYRFYTGPTL+ FG GLSY+ F HS+VQA
Sbjct  592  PMTWYPQSYADTVPMTNMTMRPDPAMGYPGRTYRFYTGPTLYSFGDGLSYSSFNHSLVQA  651

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               +S+ L++GH CRS+ CES++A  +TC++   D+HLNVKNVG  SG H+V LFSSPP+
Sbjct  652  PRVMSVPLEEGHVCRSSACESLEATGETCSNLTFDVHLNVKNVGNFSGSHTVFLFSSPPS  711

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +H AP+KQL+GF+KV L+   +  V F VDVCK LSVVDE G+RKVALG++VLH+G LKH
Sbjct  712  VHRAPQKQLLGFEKVFLASQSEAQVQFKVDVCKDLSVVDELGHRKVALGMYVLHVGDLKH  771

Query  237  SLTVEI  220
            +L+V+I
Sbjct  772  ALSVQI  777



>ref|NP_001233910.1| beta-D-xylosidase 1 precursor [Solanum lycopersicum]
 dbj|BAC98298.1| LEXYL1 [Solanum lycopersicum]
Length=770

 Score =   245 bits (626),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 146/186 (78%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS AD V M DM MRP+P T YPGRTYRFYTGPT+F FG+GLSY++F+H + +A
Sbjct  585  PMTWYPQSYADVVPMTDMNMRPNPATNYPGRTYRFYTGPTVFTFGHGLSYSQFKHHLDKA  644

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VSL L + H CR +KC++VDA  Q+C++   DIHL VKNVG +SG H + LF+SPP+
Sbjct  645  PQFVSLPLGEKHTCRLSKCKTVDAVGQSCSNMGFDIHLRVKNVGKISGSHIIFLFTSPPS  704

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP+K L+GF+KV L+P  + VV FNV+VCKHLSV DE GNRKVALG HVLHIG LKH
Sbjct  705  VHNAPKKHLLGFEKVHLTPQGEGVVKFNVNVCKHLSVHDELGNRKVALGPHVLHIGDLKH  764

Query  237  SLTVEI  220
            SLTV I
Sbjct  765  SLTVRI  770



>ref|XP_010065531.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63059.1| hypothetical protein EUGRSUZ_G00651 [Eucalyptus grandis]
Length=789

 Score =   244 bits (624),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 146/186 (78%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS AD+V M +M MRPDP TGYPGRTYRFYTGPT++ FG GLSY+ F H++VQ 
Sbjct  591  PMTWYPQSYADAVPMTNMNMRPDPATGYPGRTYRFYTGPTVYLFGDGLSYSNFSHTLVQV  650

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++GH CRS+ CES++A  + C++ ALD+HLNVKNVG  SG H+V LFSSPP+
Sbjct  651  PQLVSVPLEEGHVCRSSACESLEATNEMCSNLALDVHLNVKNVGRFSGSHTVFLFSSPPS  710

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +H APRK L+GF+KV L+   +  V F VDVCK L VVDE G RKVALG+H+LH+G LKH
Sbjct  711  VHRAPRKHLLGFEKVFLASQSEAQVQFKVDVCKDLGVVDELGCRKVALGMHILHVGDLKH  770

Query  237  SLTVEI  220
            +L+V+I
Sbjct  771  ALSVQI  776



>ref|XP_010065530.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
Length=789

 Score =   244 bits (624),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 146/186 (78%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS AD+V M +M MRPDP TGYPGRTYRFYTGPT++KFG GLSY+ F HS+VQA
Sbjct  591  PMTWYPQSYADAVPMTNMNMRPDPATGYPGRTYRFYTGPTVYKFGDGLSYSNFSHSLVQA  650

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++GH CRS  CES++A  + C++ ALD+HLNVKNVG  SG H+V LFSSPP+
Sbjct  651  PQVVSVPLEEGHVCRSLACESLEATGEMCSNLALDVHLNVKNVGRFSGSHTVFLFSSPPS  710

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +H AP+K L+GF+KV L+   +  V F VD+CK L VVDE G +KVALG HVLHIG LKH
Sbjct  711  VHRAPQKHLLGFEKVFLASQSEAQVQFKVDICKDLGVVDELGCQKVALGTHVLHIGDLKH  770

Query  237  SLTVEI  220
            +L+V+I
Sbjct  771  ALSVQI  776



>ref|XP_009628814.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 {ECO:0000303|PubMed:17615411, 
ECO:0000312|EMBL:ABQ45228.1}-like 
[Nicotiana tomentosiformis]
Length=781

 Score =   244 bits (623),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS AD+V M  M MRPDP T YPGRTYRFYTGPT+F FG+GLSY++F+H + QA
Sbjct  596  PMTWYPQSYADAVPMTIMNMRPDPATNYPGRTYRFYTGPTVFTFGHGLSYSQFKHRLDQA  655

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++ H CRSTKC+S+D  EQ+C++   ++HL VKN+G +SG H++ LF+SPP+
Sbjct  656  PTFVSIPLEEKHTCRSTKCKSIDTVEQSCSNLGFNVHLRVKNMGKISGSHTIFLFNSPPS  715

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP+K L+GF+KV L+P E+ VV FNVDVCKHLS  DE GN+KVALG HVLHIG LKH
Sbjct  716  VHNAPQKHLLGFEKVHLTPQEEGVVKFNVDVCKHLSGHDELGNKKVALGQHVLHIGDLKH  775

Query  237  SLTVEI  220
            S TV+I
Sbjct  776  SFTVKI  781



>ref|XP_006341844.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Solanum tuberosum]
Length=806

 Score =   244 bits (623),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 147/186 (79%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS AD V M +M MRP+P T YPGRTYRFYTGPT+F FG+GLSY++F+H + +A
Sbjct  621  PMTWYPQSYADVVPMTNMNMRPNPATNYPGRTYRFYTGPTVFTFGHGLSYSQFKHHLDKA  680

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VSL L + H CR +KC++VDA  Q+C++   DIHL VKNVG +SG H++ LF+SPP+
Sbjct  681  PQFVSLPLGEKHTCRLSKCKTVDAVGQSCSNMGFDIHLRVKNVGKISGSHTIFLFTSPPS  740

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP+K L+GF+KV L+P  + VV FNVDVCKHLSV DE GNRKVALG HVLHIG LKH
Sbjct  741  VHNAPKKHLLGFEKVHLTPQGEGVVKFNVDVCKHLSVHDELGNRKVALGPHVLHIGDLKH  800

Query  237  SLTVEI  220
            SLTV I
Sbjct  801  SLTVRI  806



>ref|XP_011092407.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   243 bits (620),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 145/186 (78%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS AD V+M DM MRP+P TGYPGRTYRFY GPT+F FG GLSY+ F H++V+A
Sbjct  583  PMTWYPQSYADKVNMTDMHMRPNPDTGYPGRTYRFYKGPTVFSFGDGLSYSTFNHNLVRA  642

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++GH CRS+ C+S+D  + TC +   DIH+ VKNVG +SG H+V LFSSPP 
Sbjct  643  PKLVSVPLEEGHVCRSSMCKSIDVVDHTCKNLGFDIHVRVKNVGHMSGSHTVFLFSSPPQ  702

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP+K L+GFQK+ L P  + +V FNVDVCKHLSVVDE GNRKVALG H+LH+G LKH
Sbjct  703  VHNAPQKHLLGFQKLHLEPQGEGLVRFNVDVCKHLSVVDEKGNRKVALGEHLLHVGSLKH  762

Query  237  SLTVEI  220
            SL + +
Sbjct  763  SLNLRV  768



>ref|XP_009801214.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nicotiana sylvestris]
Length=784

 Score =   243 bits (620),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS AD+V M  M MRPDP T YPGRTYRFYTGPT+F FG+GLSY++F+H + QA
Sbjct  599  PMTWYPQSYADAVPMTIMNMRPDPATNYPGRTYRFYTGPTVFTFGHGLSYSQFKHRLDQA  658

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++ H CRSTKC+S+D  EQ+C++   ++HL VKN+G +SG H++ LF+SPP+
Sbjct  659  PTFVSIPLEEKHTCRSTKCKSIDTVEQSCSNVGFNVHLRVKNMGKISGSHTIFLFNSPPS  718

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP+K L+GF+KV L+  E+ VV FNVDVCKHLSV DE GN+KVALG HVLHIG LKH
Sbjct  719  VHNAPQKHLLGFKKVHLTAQEEGVVKFNVDVCKHLSVHDELGNKKVALGQHVLHIGDLKH  778

Query  237  SLTVEI  220
            S TV I
Sbjct  779  SFTVRI  784



>emb|CDO97479.1| unnamed protein product [Coffea canephora]
Length=706

 Score =   241 bits (616),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 147/188 (78%), Gaps = 2/188 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D VSM DM MRPDP TGYPGRTYRFY G T++ FG GL Y+ F HS+VQA
Sbjct  519  PMTWYPQSYVDKVSMTDMHMRPDPATGYPGRTYRFYKGQTVYSFGDGLGYSTFTHSLVQA  578

Query  597  QDSVSLALDQGHPCRSTK--CESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSP  424
               VS+ L++GH CRS+   C+S+DA EQ+C +   +IHL V+NVGT+SG H+VLLFSSP
Sbjct  579  PKVVSVPLEEGHVCRSSSSTCKSIDAVEQSCKNLGFNIHLRVRNVGTMSGSHTVLLFSSP  638

Query  423  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  244
            P++HNA +K L+GFQK+ L+P  + +V FNVDVCKHLS+VDE GNRKVA+G HVLH G L
Sbjct  639  PSVHNAAQKHLLGFQKLHLAPQTEGLVKFNVDVCKHLSMVDELGNRKVAVGEHVLHAGDL  698

Query  243  KHSLTVEI  220
            KH+LTV I
Sbjct  699  KHTLTVRI  706



>ref|XP_010065529.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63058.1| hypothetical protein EUGRSUZ_G00650 [Eucalyptus grandis]
Length=789

 Score =   241 bits (616),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 147/186 (79%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS AD+V M +M MRPDP TGYPGRTYRFYTGPT++ FG GLSY+ F HS+VQA
Sbjct  591  PMTWYPQSYADAVPMTNMNMRPDPATGYPGRTYRFYTGPTVYSFGDGLSYSNFSHSLVQA  650

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++GH CRS+ C+S++A  + C++ ALD+HLNVKNVG  SG H+V LFSSPP+
Sbjct  651  PQLVSVPLEEGHVCRSSACKSLEATGEMCSNLALDVHLNVKNVGRFSGSHTVFLFSSPPS  710

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +H AP+K L+GF+KV L+   +  V F VDVCK LSVVDE G+ KVALG HVLH+G LKH
Sbjct  711  VHRAPQKHLLGFEKVFLASQSEAQVQFKVDVCKDLSVVDELGHWKVALGTHVLHVGDLKH  770

Query  237  SLTVEI  220
            +L+V+I
Sbjct  771  ALSVQI  776



>gb|EYU35409.1| hypothetical protein MIMGU_mgv1a001738mg [Erythranthe guttata]
Length=767

 Score =   241 bits (614),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 149/187 (80%), Gaps = 1/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V+M DM MR DP  GYPGR+YRFY GPT+F FGYGLSY++F H +V+A
Sbjct  581  PMTWYPQSYVEKVNMTDMNMRADPTRGYPGRSYRFYKGPTVFSFGYGLSYSQFDHKLVKA  640

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCA-SSALDIHLNVKNVGTVSGGHSVLLFSSPP  421
              SVS+ L++ H CRS+ C S+DAA ++C  ++A+++HL+VKNVG + G H+VLLFSSPP
Sbjct  641  PTSVSMDLEEDHVCRSSTCRSIDAAGRSCKNNAAIEVHLSVKNVGRMGGAHTVLLFSSPP  700

Query  420  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
             +H APRKQL+GF+KV L P  + VV FNVDVCKHLS+VDE GNRKVALG HVLH+G+LK
Sbjct  701  EVHGAPRKQLLGFEKVHLVPQGEGVVRFNVDVCKHLSLVDEKGNRKVALGEHVLHVGNLK  760

Query  240  HSLTVEI  220
            HSL V I
Sbjct  761  HSLNVII  767



>ref|XP_002264183.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Vitis vinifera]
Length=774

 Score =   240 bits (613),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 143/186 (77%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPDP +GYPGRTYRFYTG T++ FG GLSYT+F H +VQA
Sbjct  589  PMTWYPQSYVDKVPMTNMNMRPDPASGYPGRTYRFYTGETIYTFGDGLSYTQFNHHLVQA  648

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
              SVS+ +++GH C S+KC+SVDA +++C +   DIHL V N G +SG H+V LFSSPP+
Sbjct  649  PKSVSIPIEEGHSCHSSKCKSVDAVQESCQNLVFDIHLRVNNAGNISGSHTVFLFSSPPS  708

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HN+P+K L+GF+KV ++     +V F VDVCK LS+VDE G RKVALGLHVLH+G+LKH
Sbjct  709  VHNSPQKHLLGFEKVFVTAKAKALVRFKVDVCKDLSIVDELGTRKVALGLHVLHVGNLKH  768

Query  237  SLTVEI  220
            SL V I
Sbjct  769  SLNVRI  774



>ref|XP_011087838.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   240 bits (613),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 145/186 (78%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPDP TGYPGRTYRFYTGPT+FKFG GLSY++F H +V A
Sbjct  583  PMTWYPQSYVEQVDMTNMNMRPDPATGYPGRTYRFYTGPTVFKFGDGLSYSQFDHQLVTA  642

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               +S+ L++GH C+S+ C S+DA E++C ++A+++HL VKNVG  SG H+VLLFSSPP 
Sbjct  643  PKLISIPLEEGHVCKSSTCWSIDAVERSCKNAAVNVHLRVKNVGNYSGSHTVLLFSSPPQ  702

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNA +K L+GF+K+ L+P  +  V F++DVCKHLSVVDE G RKVALG HVLH+G L H
Sbjct  703  VHNAAQKHLLGFEKLHLTPQAEGQVRFDIDVCKHLSVVDENGARKVALGEHVLHVGSLTH  762

Query  237  SLTVEI  220
            SL V I
Sbjct  763  SLNVMI  768



>emb|CAN78858.1| hypothetical protein VITISV_030325 [Vitis vinifera]
Length=699

 Score =   239 bits (609),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 143/186 (77%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPDP +GYPGRTYRFYTG T++ FG GLSYT+F H +VQA
Sbjct  514  PMTWYPQSYVDKVPMTNMNMRPDPASGYPGRTYRFYTGETIYTFGDGLSYTQFNHHLVQA  573

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
              SVS+ +++ H C S+KC+SVDA +++C + A DIHL V N G +SG H+V LFSSPP+
Sbjct  574  PKSVSIPIEEAHSCHSSKCKSVDAVQESCQNLAFDIHLRVNNAGNISGSHTVFLFSSPPS  633

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HN+P+K L+GF+KV ++     +V F VDVCK LS+VDE G RKVALGLHVLH+G+LKH
Sbjct  634  VHNSPQKHLLGFEKVFVTAKAKALVRFKVDVCKDLSIVDELGTRKVALGLHVLHVGNLKH  693

Query  237  SLTVEI  220
            SL V I
Sbjct  694  SLNVRI  699



>ref|XP_002268626.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Vitis 
vinifera]
 emb|CBI39114.3| unnamed protein product [Vitis vinifera]
Length=774

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 144/186 (77%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPDP +GYPGRTYRFYTG T++ FG GLSYT+F H +VQA
Sbjct  589  PMTWYPQSYVDKVPMTNMNMRPDPASGYPGRTYRFYTGETIYTFGDGLSYTQFNHHLVQA  648

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
              SVS+ +++GH C S+KC+SVDA +++C + A DIHL V N G +SG H+V LFSSPP+
Sbjct  649  PKSVSIPIEEGHSCHSSKCKSVDAVQESCQNLAFDIHLRVNNAGNISGSHTVFLFSSPPS  708

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HN+P+K L+GF+KV ++   + +V F VDVCK LS+VDE G +KVALGLHVLH+G LKH
Sbjct  709  VHNSPQKHLLGFEKVFVTAKAEALVRFKVDVCKDLSIVDELGTQKVALGLHVLHVGSLKH  768

Query  237  SLTVEI  220
            SL V I
Sbjct  769  SLNVRI  774



>gb|KDP30704.1| hypothetical protein JCGZ_16402 [Jatropha curcas]
Length=770

 Score =   238 bits (607),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 142/186 (76%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPDP +GYPGR+YRFYTG T++ FG GLSY+KF   +VQA
Sbjct  585  PMTWYPQSYVDKVPMTNMNMRPDPSSGYPGRSYRFYTGETVYSFGDGLSYSKFEQQLVQA  644

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               V++ L++GH C+STKC SVDA ++TC + A DIHL VKN+G + G H+V LFS+PP+
Sbjct  645  PKLVTVPLEEGHACQSTKCISVDAVDRTCQNLAFDIHLKVKNMGRIRGSHTVFLFSTPPS  704

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HN+P+K LV F+KV L       V F VD+CKHLSVVDE GNRK+ALG H+LH+G+LKH
Sbjct  705  VHNSPQKHLVDFEKVSLDAQTHSTVQFKVDICKHLSVVDEFGNRKIALGEHILHVGNLKH  764

Query  237  SLTVEI  220
            S+T+ I
Sbjct  765  SMTLRI  770



>ref|XP_010065527.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63057.1| hypothetical protein EUGRSUZ_G00649 [Eucalyptus grandis]
Length=790

 Score =   238 bits (608),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 142/186 (76%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D+V M +M MRPDP TGYPGRTYRFYTGPT++ FG GLSY+ F H  VQA
Sbjct  592  PMTWYPQSYVDAVPMTNMNMRPDPATGYPGRTYRFYTGPTVYSFGDGLSYSSFSHGQVQA  651

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ LD+GH C S+ CES++A  +TC++   D+HLNVKNVG  SG H+V LFSSPP+
Sbjct  652  PQLVSVPLDEGHICHSSACESLEAKSETCSNLVFDVHLNVKNVGRFSGSHTVFLFSSPPS  711

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +H +P+K L+GF+KV L+   +  V F VDVCK LSVVDE G RKVALG HVLH+G LKH
Sbjct  712  VHRSPQKHLLGFEKVFLASQSEAQVQFKVDVCKDLSVVDELGGRKVALGTHVLHVGDLKH  771

Query  237  SLTVEI  220
            +L+V+I
Sbjct  772  ALSVQI  777



>ref|XP_011087839.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   238 bits (606),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 143/184 (78%), Gaps = 0/184 (0%)
 Frame = -1

Query  771  TWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQD  592
            TWYPQS  + V M DM MRPDP  GYPGRTYRFY GPT+F FG GLSY++F H +V A  
Sbjct  585  TWYPQSYVEKVEMTDMNMRPDPARGYPGRTYRFYNGPTVFNFGDGLSYSQFNHQLVTAPT  644

Query  591  SVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALH  412
             VS+ L++GH C+S+ C S++  EQ+C ++++D+HL VKNVG  SG H+VLLFSSPP +H
Sbjct  645  LVSIPLEEGHVCQSSTCRSINPVEQSCKNASIDVHLRVKNVGNYSGSHTVLLFSSPPQVH  704

Query  411  NAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSL  232
            NAPRK L+G+QK+ L+P  + +V FN+DVCKHLS+VDE GN+KVALG ++LHIG L HSL
Sbjct  705  NAPRKHLIGYQKLHLTPQAEGLVRFNIDVCKHLSIVDENGNQKVALGEYILHIGSLMHSL  764

Query  231  TVEI  220
             V I
Sbjct  765  HVVI  768



>ref|XP_009347830.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score =   236 bits (601),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 141/186 (76%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPD   GYPGRTYRFYTG T++ FG GLSY+ F H +VQA
Sbjct  588  PMTWYPQSYVDKVPMTNMNMRPDASNGYPGRTYRFYTGETVYSFGDGLSYSTFNHKLVQA  647

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++GH C S+ C+S+D  E+ C + A DIHL VKN G++SG H+V+LFSSPPA
Sbjct  648  PKLVSIPLEEGHVCHSSSCKSLDVVEERCENLAFDIHLGVKNAGSMSGSHTVMLFSSPPA  707

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +H +P+K L+GF+KV LS   + +V FNVDVCKHLSVVDE GNRKVALG HVLH+G LKH
Sbjct  708  VHKSPQKHLLGFEKVFLSAQREALVKFNVDVCKHLSVVDELGNRKVALGEHVLHVGSLKH  767

Query  237  SLTVEI  220
            S +V I
Sbjct  768  SFSVRI  773



>ref|XP_009403180.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Musa acuminata subsp. malaccensis]
Length=769

 Score =   235 bits (600),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 139/186 (75%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS ADSV M DMRMRPDP T YPGRTYRFYTG  +++FG GLSYT + H +V+A
Sbjct  584  PVTWYPQSFADSVPMTDMRMRPDPSTDYPGRTYRFYTGDAVYEFGDGLSYTDYTHHLVKA  643

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++GH C S +C SVD A   C   A D+HL V+N G ++G H+V LFSSPPA
Sbjct  644  PKMVSIPLEEGHSCYSQRCNSVDLAGNACDGLAFDVHLRVQNSGGMAGSHTVFLFSSPPA  703

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAPRK L+GF+KV L P     VVF VDVCK LSVVDE GNRK+ALG HVLH G LKH
Sbjct  704  VHNAPRKHLLGFEKVYLGPKAAGDVVFKVDVCKDLSVVDELGNRKLALGSHVLHAGSLKH  763

Query  237  SLTVEI  220
            SL+++I
Sbjct  764  SLSLKI  769



>ref|XP_004301992.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X3 [Fragaria vesca subsp. vesca]
Length=774

 Score =   234 bits (598),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 146/186 (78%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ+  D V M +M MRPDP +GYPGRTYRFYTG T+++FG+GLSY+ F H +VQA
Sbjct  589  PMTWYPQAYVDKVPMNNMNMRPDPASGYPGRTYRFYTGDTVYEFGHGLSYSNFSHRLVQA  648

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L+Q H C S+ C+S+D  E+ C + A DIH+ VKN+G +SG H+V+L+SSPP+
Sbjct  649  PKQVSIPLEQDHVCHSSSCQSLDVVEERCQNLAFDIHVGVKNMGKMSGSHTVILYSSPPS  708

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP+K L+GF+KV LS  ++ +V FNVDVCKHLSVVDE GNRKVALG HVLH+G LK 
Sbjct  709  VHNAPKKHLLGFEKVFLSSQKEALVKFNVDVCKHLSVVDELGNRKVALGDHVLHVGDLKQ  768

Query  237  SLTVEI  220
            +L+V I
Sbjct  769  TLSVRI  774



>ref|XP_011465594.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=799

 Score =   234 bits (598),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 146/186 (78%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ+  D V M +M MRPDP +GYPGRTYRFYTG T+++FG+GLSY+ F H +VQA
Sbjct  614  PMTWYPQAYVDKVPMNNMNMRPDPASGYPGRTYRFYTGDTVYEFGHGLSYSNFSHRLVQA  673

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L+Q H C S+ C+S+D  E+ C + A DIH+ VKN+G +SG H+V+L+SSPP+
Sbjct  674  PKQVSIPLEQDHVCHSSSCQSLDVVEERCQNLAFDIHVGVKNMGKMSGSHTVILYSSPPS  733

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP+K L+GF+KV LS  ++ +V FNVDVCKHLSVVDE GNRKVALG HVLH+G LK 
Sbjct  734  VHNAPKKHLLGFEKVFLSSQKEALVKFNVDVCKHLSVVDELGNRKVALGDHVLHVGDLKQ  793

Query  237  SLTVEI  220
            +L+V I
Sbjct  794  TLSVRI  799



>ref|XP_007225245.1| hypothetical protein PRUPE_ppa001692mg [Prunus persica]
 gb|EMJ26444.1| hypothetical protein PRUPE_ppa001692mg [Prunus persica]
Length=779

 Score =   234 bits (596),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 142/186 (76%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPD   GYPGRTYRFYTG T++ FG GL Y+ F H +V+A
Sbjct  594  PMTWYPQSYVDKVPMTNMNMRPDASNGYPGRTYRFYTGETVYSFGDGLGYSAFNHKLVRA  653

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++GH C S+ C+S+D  ++ C + A DIHL VKN G++SGGH+VLLFSSPP+
Sbjct  654  PKLVSIPLEEGHVCHSSSCKSLDVVQERCENLAFDIHLGVKNTGSMSGGHTVLLFSSPPS  713

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HN+P+K L+GF+KV LS   +E+V F VDVCKHLSVVDE GNRKVALG HVLH+G LKH
Sbjct  714  VHNSPQKHLLGFEKVFLSAQREELVKFKVDVCKHLSVVDELGNRKVALGQHVLHVGSLKH  773

Query  237  SLTVEI  220
            S +V I
Sbjct  774  SFSVGI  779



>ref|XP_011004967.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Populus euphratica]
Length=775

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 142/186 (76%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPDP  GYPGRTYRFYTG T++ FG GLSY++F H ++QA
Sbjct  590  PMTWYPQSYVDKVPMTNMNMRPDPSNGYPGRTYRFYTGETVYSFGDGLSYSQFTHELIQA  649

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++ H C S++C+SV A+EQTC +S  D+ L VKNVGTVSG H+VLLFSSPPA
Sbjct  650  PRLVSVPLEESHVCHSSECQSVVASEQTCQNSTFDMLLRVKNVGTVSGSHTVLLFSSPPA  709

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP+K LVGF+KV L+      V F V++CK LS+VDE G++KVALG HVLH+G LKH
Sbjct  710  VHNAPQKHLVGFKKVFLNAQTGRHVRFKVNICKDLSLVDELGSKKVALGEHVLHVGSLKH  769

Query  237  SLTVEI  220
             L+V I
Sbjct  770  FLSVRI  775



>ref|XP_007043027.1| Beta-D-xylosidase 4 [Theobroma cacao]
 gb|EOX98858.1| Beta-D-xylosidase 4 [Theobroma cacao]
Length=787

 Score =   234 bits (596),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 143/186 (77%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPDP +GYPGRTYRFYTG T++ FG GLSY+KF H +V+A
Sbjct  602  PMTWYPQSYVDKVPMTNMNMRPDPSSGYPGRTYRFYTGETIYTFGDGLSYSKFSHQLVKA  661

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++ H CRS++C+SVDA EQ+C + A DIHL V+N G  SG H+V LFS+PP+
Sbjct  662  PQLVSIPLEEVHVCRSSECKSVDAIEQSCKNLAFDIHLRVQNKGRNSGSHTVFLFSTPPS  721

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HN+PRK L+GF+KV L+   + +V F VDVCK LSVVDE G+RKV+LG HVLH+G LKH
Sbjct  722  VHNSPRKHLLGFEKVLLTGKSESLVRFKVDVCKDLSVVDERGSRKVSLGQHVLHVGSLKH  781

Query  237  SLTVEI  220
            SL V I
Sbjct  782  SLNVRI  787



>ref|XP_008218886.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Prunus 
mume]
Length=779

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 142/186 (76%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPD   GYPGRTYRFYTG T++ FG GL Y+ F H +V+A
Sbjct  594  PMTWYPQSYVDKVPMTNMNMRPDASNGYPGRTYRFYTGETVYSFGDGLGYSAFNHKLVRA  653

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++GH C S+ C+S+D  ++ C + A DIHL VKN G++SGGH+VLLFSSPP+
Sbjct  654  PKLVSIPLEEGHVCHSSSCKSLDVVQERCENLAFDIHLGVKNTGSMSGGHTVLLFSSPPS  713

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HN+P+K L+GF+KV LS   +E+V F VDVCKHLSVVDE GNRKVALG HVLH+G LKH
Sbjct  714  VHNSPQKHLLGFEKVFLSAQREELVKFKVDVCKHLSVVDELGNRKVALGPHVLHVGSLKH  773

Query  237  SLTVEI  220
            S +V I
Sbjct  774  SFSVGI  779



>ref|XP_009379698.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Pyrus x bretschneideri]
Length=773

 Score =   233 bits (594),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 141/186 (76%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPDP  GYPGRTYRFYTG T++ FG GL Y+ F H +V+A
Sbjct  588  PMTWYPQSYVDKVPMTNMNMRPDPSNGYPGRTYRFYTGETVYSFGDGLGYSAFNHKLVRA  647

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++GH C S+ C+S+D  E+ C + A DIHL VKN+G +SG H+V+LFSSPPA
Sbjct  648  PKLVSIPLEEGHVCHSSSCKSLDVVEERCENLAFDIHLGVKNMGRMSGSHTVMLFSSPPA  707

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +H +P+K L+GF+KV +S   + +V FNVDVCKHLSVVDE GNRKVALG HVLH+G LKH
Sbjct  708  VHKSPQKHLLGFEKVFVSAKREALVKFNVDVCKHLSVVDELGNRKVALGKHVLHVGSLKH  767

Query  237  SLTVEI  220
            S +V I
Sbjct  768  SFSVRI  773



>ref|NP_001054038.1| Os04g0640700 [Oryza sativa Japonica Group]
 emb|CAE02971.2| OSJNBb0079B02.3 [Oryza sativa Japonica Group]
 dbj|BAF15952.1| Os04g0640700 [Oryza sativa Japonica Group]
 emb|CAH67823.1| OSIGBa0138H21-OSIGBa0138E01.14 [Oryza sativa Indica Group]
 gb|EEC78109.1| hypothetical protein OsI_17615 [Oryza sativa Indica Group]
Length=765

 Score =   233 bits (594),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 140/186 (75%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYP S AD VSM DMRMRPD  TGYPGRTYRFYTG T++ FG GLSYTKF HS+V A
Sbjct  580  PVTWYPASFADKVSMTDMRMRPDSSTGYPGRTYRFYTGDTVYAFGDGLSYTKFAHSLVSA  639

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
             + V++ L +GH C +  C SV+AA + C S + D+HL V+N G ++GGH+V LFSSPP+
Sbjct  640  PEQVAVQLAEGHACHTEHCFSVEAAGEHCGSLSFDVHLRVRNAGGMAGGHTVFLFSSPPS  699

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +H+AP K L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH
Sbjct  700  VHSAPAKHLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKH  759

Query  237  SLTVEI  220
            +L + +
Sbjct  760  TLNLRV  765



>gb|EYU18509.1| hypothetical protein MIMGU_mgv1a001665mg [Erythranthe guttata]
Length=777

 Score =   233 bits (594),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 144/187 (77%), Gaps = 1/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS A+ V+M DM MRP+P TGYPGRTYRFY GPT++ FGYGLSY++F+H + + 
Sbjct  591  PLTWYPQSYAEKVNMTDMNMRPNPTTGYPGRTYRFYIGPTVYPFGYGLSYSEFKHLLAEP  650

Query  597  QDSV-SLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPP  421
              ++ ++ L++GH C+S+ C+SVDA E  C +    +HL VKNVG ++G H+VL+FS PP
Sbjct  651  LPTIMTVDLEEGHACQSSDCKSVDAVEPMCKNLGFGVHLTVKNVGKLTGSHTVLVFSRPP  710

Query  420  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
             +HNAPRKQLV F+KV L P  +EVV F +DVCK LSVVDE GNRKVALG HVLH+G+LK
Sbjct  711  RVHNAPRKQLVAFRKVHLRPKGEEVVRFEIDVCKDLSVVDELGNRKVALGKHVLHVGNLK  770

Query  240  HSLTVEI  220
            HS  V I
Sbjct  771  HSFNVTI  777



>gb|EEE61783.1| hypothetical protein OsJ_16354 [Oryza sativa Japonica Group]
Length=771

 Score =   233 bits (593),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 140/186 (75%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYP S AD VSM DMRMRPD  TGYPGRTYRFYTG T++ FG GLSYTKF HS+V A
Sbjct  586  PVTWYPASFADKVSMTDMRMRPDSSTGYPGRTYRFYTGDTVYAFGDGLSYTKFAHSLVSA  645

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
             + V++ L +GH C +  C SV+AA + C S + D+HL V+N G ++GGH+V LFSSPP+
Sbjct  646  PEQVAVQLAEGHACHTEHCFSVEAAGEHCGSLSFDVHLRVRNAGGMAGGHTVFLFSSPPS  705

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +H+AP K L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH
Sbjct  706  VHSAPAKHLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKH  765

Query  237  SLTVEI  220
            +L + +
Sbjct  766  TLNLRV  771



>emb|CAE03635.1| OSJNBb0003B01.27 [Oryza sativa Japonica Group]
Length=839

 Score =   233 bits (594),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 140/186 (75%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYP S AD VSM DMRMRPD  TGYPGRTYRFYTG T++ FG GLSYTKF HS+V A
Sbjct  654  PVTWYPASFADKVSMTDMRMRPDSSTGYPGRTYRFYTGDTVYAFGDGLSYTKFAHSLVSA  713

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
             + V++ L +GH C +  C SV+AA + C S + D+HL V+N G ++GGH+V LFSSPP+
Sbjct  714  PEQVAVQLAEGHACHTEHCFSVEAAGEHCGSLSFDVHLRVRNAGGMAGGHTVFLFSSPPS  773

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +H+AP K L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH
Sbjct  774  VHSAPAKHLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKH  833

Query  237  SLTVEI  220
            +L + +
Sbjct  834  TLNLRV  839



>gb|KJB31996.1| hypothetical protein B456_005G218000 [Gossypium raimondii]
 gb|KJB31998.1| hypothetical protein B456_005G218000 [Gossypium raimondii]
Length=507

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 140/186 (75%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPDP  GYPGRTYRFYTG T++ FG GLSY+K  H + +A
Sbjct  322  PMTWYPQSYVDKVPMTNMNMRPDPSNGYPGRTYRFYTGETIYTFGDGLSYSKITHELAKA  381

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++ H CRS++C+SV+A EQ+C + A DIH+ V+N G   G H+V LFSSPP+
Sbjct  382  PRLVSIPLEEDHVCRSSECKSVEAVEQSCKNLAFDIHVRVQNRGKYGGSHTVFLFSSPPS  441

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HN+P+K L+GF+KV L+   + +V F VDVCK LSVVDE G+RKVALG H+LH+G LKH
Sbjct  442  VHNSPQKHLLGFEKVSLTGKSETLVRFKVDVCKDLSVVDELGSRKVALGQHLLHVGSLKH  501

Query  237  SLTVEI  220
            SLTV I
Sbjct  502  SLTVGI  507



>ref|XP_002298197.2| beta-glucosidase family protein [Populus trichocarpa]
 gb|EEE83002.2| beta-glucosidase family protein [Populus trichocarpa]
Length=778

 Score =   231 bits (590),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 139/186 (75%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPDP  GYPGRTYRFYTG T++ FG GLSY++F H + QA
Sbjct  593  PMTWYPQSYVDKVPMTNMNMRPDPSNGYPGRTYRFYTGETVYSFGDGLSYSEFSHELTQA  652

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++ H C S++C+SV AAEQTC +   D+HL +KN GT SG H+V LFS+PP+
Sbjct  653  PGLVSVPLEENHVCYSSECKSVAAAEQTCQNLTFDVHLRIKNTGTTSGSHTVFLFSTPPS  712

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HN+P+K LVGF+KV L    D  V F VDVCK LSVVDE G++KVALG HVLHIG LKH
Sbjct  713  VHNSPQKHLVGFEKVFLHAQTDSHVGFKVDVCKDLSVVDELGSKKVALGEHVLHIGSLKH  772

Query  237  SLTVEI  220
            S+TV I
Sbjct  773  SMTVRI  778



>ref|XP_008344154.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 140/186 (75%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPDP  GYPGRTYRF TG T++ FG GL Y+ F H +V+A
Sbjct  588  PMTWYPQSYVDKVPMTNMNMRPDPSNGYPGRTYRFXTGETVYSFGDGLGYSTFNHKLVRA  647

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++GH C S+ C+S+D  E+ C + A DIHL VKN+G++SG H+V+LFSSPPA
Sbjct  648  PKLVSIPLEEGHVCHSSSCKSLDVVEERCENLAFDIHLGVKNMGSMSGSHTVMLFSSPPA  707

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +H +P+K L+GF+KV +S     +V FNVDVCKHLSVVDE GNRKVALG HVLH+G LKH
Sbjct  708  VHKSPQKHLLGFEKVFVSAQRVALVKFNVDVCKHLSVVDELGNRKVALGEHVLHVGSLKH  767

Query  237  SLTVEI  220
            S +V I
Sbjct  768  SFSVRI  773



>ref|XP_009401393.1| PREDICTED: beta-D-xylosidase 4-like [Musa acuminata subsp. malaccensis]
Length=770

 Score =   229 bits (585),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 138/186 (74%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS ADSV M DMRMR DP TGYPGRTYRFYTG  +++FG GLSYT + H +V+A
Sbjct  585  PVTWYPQSFADSVPMTDMRMRADPSTGYPGRTYRFYTGDIVYEFGDGLSYTDYTHHLVKA  644

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++GH C S +C+SVD A   C     D+HL V+N G  +G H+V LFS+PPA
Sbjct  645  PRLVSIPLEEGHSCDSRQCKSVDLAGTGCNDLGFDVHLRVRNSGNRAGSHTVFLFSTPPA  704

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +H APRK LVGF+KV L P     VVF VDVCK LSVVDE GNRK+ALG HVLH+G LKH
Sbjct  705  VHGAPRKHLVGFEKVFLGPKAVGQVVFKVDVCKDLSVVDELGNRKLALGSHVLHVGSLKH  764

Query  237  SLTVEI  220
            SL++++
Sbjct  765  SLSLKV  770



>ref|XP_008784548.1| PREDICTED: LOW QUALITY PROTEIN: beta-xylosidase/alpha-L-arabinofuranosidase 
2-like [Phoenix dactylifera]
Length=773

 Score =   229 bits (585),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 138/186 (74%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS AD V M DMRMRPDP TGYPGRTYRFYTG  ++ FG GLSY  F H +VQA
Sbjct  588  PVTWYPQSFADKVPMTDMRMRPDPSTGYPGRTYRFYTGDVIYSFGDGLSYNDFTHHLVQA  647

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++GH C S +C+SVD     C ++A DIHL V+N G ++G H+V LFS+PP+
Sbjct  648  PKLVSIPLEEGHSCYSKRCKSVDLVGSRCQNAAFDIHLRVQNPGRMAGSHTVFLFSTPPS  707

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HN+P+K L+GF+K+ L P     VVFNVDVCK LS+VDE GNR VALG HVLH+G LKH
Sbjct  708  VHNSPQKHLLGFEKIYLGPKXVGYVVFNVDVCKDLSLVDELGNRMVALGSHVLHVGSLKH  767

Query  237  SLTVEI  220
            SL V +
Sbjct  768  SLRVRV  773



>ref|XP_008339210.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score =   229 bits (584),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 139/186 (75%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPD   GYPGRTYRFYTG T++ FG GLSY+ F H +V+A
Sbjct  588  PMTWYPQSYVDKVPMTNMNMRPDASKGYPGRTYRFYTGETVYSFGDGLSYSTFNHKLVRA  647

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++GH C S+ C+S+D  E+ C +   DIHL VKN G++SG H+V+LFSSPPA
Sbjct  648  PKLVSIPLEEGHVCHSSSCKSLDVMEERCKNLVFDIHLGVKNAGSMSGSHTVMLFSSPPA  707

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +H +P+K L+GF+KV LS   + +V FNVDVCKHLSVVDE GNRKVALG HVLH+G L H
Sbjct  708  VHKSPQKHLLGFEKVFLSAQREALVKFNVDVCKHLSVVDELGNRKVALGEHVLHVGSLXH  767

Query  237  SLTVEI  220
            S +V I
Sbjct  768  SFSVRI  773



>gb|ACL53913.1| unknown [Zea mays]
 gb|ACN36701.1| unknown [Zea mays]
 gb|AFW59617.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=405

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 133/186 (72%), Gaps = 1/186 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYP+S    V M DMRMRPDP TGYPGRTYRFYTG T++ FG GLSYT F H +V A
Sbjct  221  PVTWYPESFT-KVPMTDMRMRPDPSTGYPGRTYRFYTGDTVYAFGDGLSYTSFAHHLVSA  279

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               ++L L +GH C + +C SV+A    C   A D+HL V+N G  SGGH+V LFSSPPA
Sbjct  280  PKQLALQLAEGHACLTEQCPSVEAEGAHCEGLAFDVHLRVRNAGERSGGHTVFLFSSPPA  339

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP K L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH
Sbjct  340  VHNAPAKHLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKH  399

Query  237  SLTVEI  220
            +L + +
Sbjct  400  TLNLGV  405



>gb|KJB31997.1| hypothetical protein B456_005G218000 [Gossypium raimondii]
Length=631

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 140/186 (75%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPDP  GYPGRTYRFYTG T++ FG GLSY+K  H + +A
Sbjct  446  PMTWYPQSYVDKVPMTNMNMRPDPSNGYPGRTYRFYTGETIYTFGDGLSYSKITHELAKA  505

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++ H CRS++C+SV+A EQ+C + A DIH+ V+N G   G H+V LFSSPP+
Sbjct  506  PRLVSIPLEEDHVCRSSECKSVEAVEQSCKNLAFDIHVRVQNRGKYGGSHTVFLFSSPPS  565

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HN+P+K L+GF+KV L+   + +V F VDVCK LSVVDE G+RKVALG H+LH+G LKH
Sbjct  566  VHNSPQKHLLGFEKVSLTGKSETLVRFKVDVCKDLSVVDELGSRKVALGQHLLHVGSLKH  625

Query  237  SLTVEI  220
            SLTV I
Sbjct  626  SLTVGI  631



>ref|XP_009354080.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 139/186 (75%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPD    YPGRTYRFYTG T++ FG GLSY+ F H +V+A
Sbjct  588  PMTWYPQSYVDKVPMTNMNMRPDASNSYPGRTYRFYTGETVYSFGDGLSYSTFNHKLVRA  647

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++GH C S+ C+S+D  E+ C + A DIHL VKN G++SG H+V+LFSSPPA
Sbjct  648  PKLVSIPLEEGHVCHSSSCKSLDVVEERCENLAFDIHLGVKNAGSMSGSHTVMLFSSPPA  707

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +H +P+K L+GF+KV LS   + +V FNVDVCKHLSVVDE GNRKVALG HVLH+G LK 
Sbjct  708  VHKSPQKHLLGFEKVFLSAQREALVKFNVDVCKHLSVVDELGNRKVALGEHVLHVGSLKR  767

Query  237  SLTVEI  220
            S +V I
Sbjct  768  SFSVRI  773



>emb|CAJ65922.1| xylan 1,4-beta-xylosidase [Populus tremula x Populus alba]
Length=757

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 139/186 (75%), Gaps = 2/186 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPDP  GYPGRTYRFYTG T++ FG GLSY++F H + QA
Sbjct  574  PMTWYPQSYVDKVPMTNMNMRPDPSNGYPGRTYRFYTGETVYSFGDGLSYSEFSHELTQA  633

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++ H C S++C+SV AAEQTC +   D+HL +KN GT SG H+V LFS+PP+
Sbjct  634  PGLVSVPLEENHVCYSSECKSVAAAEQTCQN--FDVHLRIKNTGTTSGSHTVFLFSTPPS  691

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HN+P+K LVGF+KV L    D  V F VDVCK LSVVDE G++KVALG HVLHIG LKH
Sbjct  692  VHNSPQKHLVGFEKVFLHAQTDSHVGFKVDVCKDLSVVDELGSKKVALGEHVLHIGSLKH  751

Query  237  SLTVEI  220
            S+TV I
Sbjct  752  SMTVRI  757



>ref|XP_010937054.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Elaeis guineensis]
Length=772

 Score =   228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 137/186 (74%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYP+S AD V M DMRMRPDP TGYPGRTYRFYTG  ++ FG GLSY  + H +V+A
Sbjct  587  PVTWYPESFADKVPMTDMRMRPDPSTGYPGRTYRFYTGDVVYSFGDGLSYNDYAHHLVRA  646

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++GH C S +C+S+D     C + A DIHL V+N G ++G H+V LFS+PP+
Sbjct  647  PKLVSIPLEEGHSCYSKRCKSIDVVGSGCENVAFDIHLRVQNTGRMAGSHTVFLFSTPPS  706

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HN+P+KQL+GF+KV L P     VVF VDVCK LS+VDE GNRKVALG H+LH+G L H
Sbjct  707  VHNSPQKQLLGFEKVYLGPQGVGNVVFKVDVCKDLSLVDELGNRKVALGSHILHVGSLMH  766

Query  237  SLTVEI  220
            SL V +
Sbjct  767  SLKVRV  772



>ref|XP_002303181.1| beta-glucosidase family protein [Populus trichocarpa]
 gb|EEE78160.1| beta-glucosidase family protein [Populus trichocarpa]
Length=773

 Score =   228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 139/186 (75%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPDP  GYPGRTYRFYTG T++ FG GLSY++F H ++QA
Sbjct  588  PMTWYPQSYVDKVPMTNMNMRPDPSNGYPGRTYRFYTGETVYSFGDGLSYSQFTHELIQA  647

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               V + L++ H C S++C+SV A+EQTC +S  D+ L VKN GT+SG H+V LFSSPPA
Sbjct  648  PQLVYVPLEESHVCHSSECQSVVASEQTCQNSTFDMLLRVKNEGTISGSHTVFLFSSPPA  707

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HN+P+K LVGF+KV L+      V F VD+CK LSVVDE G++KVALG HVLH+G LKH
Sbjct  708  VHNSPQKHLVGFEKVFLNAQTGRHVRFKVDICKDLSVVDELGSKKVALGEHVLHVGSLKH  767

Query  237  SLTVEI  220
             L+V I
Sbjct  768  FLSVRI  773



>dbj|BAK03439.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=694

 Score =   226 bits (576),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 136/187 (73%), Gaps = 1/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYP S AD+V+M DMRMRPD  TGYPGRTYRFYTG T+F FG GLSYTK  HS+V A
Sbjct  508  PVTWYPASYADTVTMTDMRMRPDTSTGYPGRTYRFYTGDTVFAFGDGLSYTKMSHSLVSA  567

Query  597  QDS-VSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPP  421
              S VS+ L + HPCR+ +C SV+AA   C   A D+ L V+N G V+G HSVLLFSSPP
Sbjct  568  PPSYVSMRLAEDHPCRAEECASVEAAGDHCDDLAFDVKLQVRNAGEVAGAHSVLLFSSPP  627

Query  420  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
              HNAP K L+GF+KV L+P E   V F VDVC+ LSVVDE G RKVALG H LH+G LK
Sbjct  628  PAHNAPAKHLLGFEKVSLAPGEAGTVAFRVDVCRDLSVVDELGGRKVALGGHTLHVGDLK  687

Query  240  HSLTVEI  220
            H++ + +
Sbjct  688  HTVELRV  694



>gb|KHG10349.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Gossypium arboreum]
Length=779

 Score =   227 bits (579),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 140/186 (75%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPDP  GYPGRTYRFYTG T++ FG GLSY+K  H + +A
Sbjct  594  PMTWYPQSYVDKVPMTNMNMRPDPSNGYPGRTYRFYTGETIYTFGDGLSYSKITHELAKA  653

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++ H CRS++C+SV+A EQ+C + A DIH+ V+N G   G H+V LFSSPP+
Sbjct  654  PRLVSIPLEEDHVCRSSECKSVEAVEQSCKNLAFDIHVRVQNRGKYGGSHTVFLFSSPPS  713

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HN+P+K L+GF+KV L+   + +V F VDVCK LSVVDE G+RKVALG H+LH+G LKH
Sbjct  714  VHNSPQKHLLGFEKVSLTGKSETLVRFKVDVCKDLSVVDELGSRKVALGQHLLHVGSLKH  773

Query  237  SLTVEI  220
            SLTV I
Sbjct  774  SLTVRI  779



>gb|EYU18507.1| hypothetical protein MIMGU_mgv1a001685mg [Erythranthe guttata]
Length=773

 Score =   227 bits (579),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 143/187 (76%), Gaps = 1/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS A+ V+M DM MR + KTGYPGRTYRFYTGPT+++FG+GLSY+ F+H + + 
Sbjct  587  PMTWYPQSYAEKVNMTDMNMRHNSKTGYPGRTYRFYTGPTIYQFGFGLSYSGFKHRLAEP  646

Query  597  QDSV-SLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPP  421
              ++ +++L+ GH C+S+ C+SVDA E  C +    +HL VKNVG ++G H+VL+FS PP
Sbjct  647  LPTIMTVSLETGHACQSSDCKSVDAVEPMCKNLGFGVHLTVKNVGKLAGSHTVLVFSRPP  706

Query  420  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
             +HNAPRKQLV F+KV L P  +EVV F +DVCK LSVVDE GNRKVALG HVLH+G+LK
Sbjct  707  RVHNAPRKQLVAFRKVHLRPKGEEVVRFEIDVCKDLSVVDELGNRKVALGKHVLHVGNLK  766

Query  240  HSLTVEI  220
            H   V I
Sbjct  767  HFFNVTI  773



>gb|EYU18508.1| hypothetical protein MIMGU_mgv1a001685mg [Erythranthe guttata]
Length=770

 Score =   227 bits (579),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 143/187 (76%), Gaps = 1/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS A+ V+M DM MR + KTGYPGRTYRFYTGPT+++FG+GLSY+ F+H + + 
Sbjct  584  PMTWYPQSYAEKVNMTDMNMRHNSKTGYPGRTYRFYTGPTIYQFGFGLSYSGFKHRLAEP  643

Query  597  QDSV-SLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPP  421
              ++ +++L+ GH C+S+ C+SVDA E  C +    +HL VKNVG ++G H+VL+FS PP
Sbjct  644  LPTIMTVSLETGHACQSSDCKSVDAVEPMCKNLGFGVHLTVKNVGKLAGSHTVLVFSRPP  703

Query  420  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
             +HNAPRKQLV F+KV L P  +EVV F +DVCK LSVVDE GNRKVALG HVLH+G+LK
Sbjct  704  RVHNAPRKQLVAFRKVHLRPKGEEVVRFEIDVCKDLSVVDELGNRKVALGKHVLHVGNLK  763

Query  240  HSLTVEI  220
            H   V I
Sbjct  764  HFFNVTI  770



>gb|AFW59618.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=475

 Score =   221 bits (563),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 133/186 (72%), Gaps = 1/186 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYP+S    V M DMRMRPDP TGYPGRTYRFYTG T++ FG GLSYT F H +V A
Sbjct  291  PVTWYPESFT-KVPMTDMRMRPDPSTGYPGRTYRFYTGDTVYAFGDGLSYTSFAHHLVSA  349

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               ++L L +GH C + +C SV+A    C   A D+HL V+N G  SGGH+V LFSSPPA
Sbjct  350  PKQLALQLAEGHACLTEQCPSVEAEGAHCEGLAFDVHLRVRNAGERSGGHTVFLFSSPPA  409

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP K L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH
Sbjct  410  VHNAPAKHLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKH  469

Query  237  SLTVEI  220
            +L + +
Sbjct  470  TLNLGV  475



>gb|KJB31995.1| hypothetical protein B456_005G218000 [Gossypium raimondii]
Length=779

 Score =   226 bits (577),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 140/186 (75%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPDP  GYPGRTYRFYTG T++ FG GLSY+K  H + +A
Sbjct  594  PMTWYPQSYVDKVPMTNMNMRPDPSNGYPGRTYRFYTGETIYTFGDGLSYSKITHELAKA  653

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++ H CRS++C+SV+A EQ+C + A DIH+ V+N G   G H+V LFSSPP+
Sbjct  654  PRLVSIPLEEDHVCRSSECKSVEAVEQSCKNLAFDIHVRVQNRGKYGGSHTVFLFSSPPS  713

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HN+P+K L+GF+KV L+   + +V F VDVCK LSVVDE G+RKVALG H+LH+G LKH
Sbjct  714  VHNSPQKHLLGFEKVSLTGKSETLVRFKVDVCKDLSVVDELGSRKVALGQHLLHVGSLKH  773

Query  237  SLTVEI  220
            SLTV I
Sbjct  774  SLTVGI  779



>ref|NP_001146416.1| uncharacterized protein LOC100279996 [Zea mays]
 gb|ACN32073.1| unknown [Zea mays]
Length=507

 Score =   221 bits (564),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 133/186 (72%), Gaps = 1/186 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYP+S    V M DMRMRPDP TGYPGRTYRFYTG T++ FG GLSYT F H +V A
Sbjct  323  PVTWYPESFT-KVPMTDMRMRPDPSTGYPGRTYRFYTGDTVYAFGDGLSYTSFAHHLVSA  381

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               ++L L +GH C + +C SV+A    C   A D+HL V+N G  SGGH+V LFSSPPA
Sbjct  382  PKQLALQLAEGHACLTEQCPSVEAEGAHCEGLAFDVHLRVRNAGERSGGHTVFLFSSPPA  441

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP K L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH
Sbjct  442  VHNAPAKHLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKH  501

Query  237  SLTVEI  220
            +L + +
Sbjct  502  TLNLGV  507



>dbj|BAK01582.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=709

 Score =   225 bits (574),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 136/187 (73%), Gaps = 1/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYP S AD+V+M DMRMRPD  TGYPGRTYRFYTG T+F FG GLSYTK  HS+V A
Sbjct  523  PVTWYPASYADTVTMTDMRMRPDTSTGYPGRTYRFYTGDTVFAFGDGLSYTKMSHSLVSA  582

Query  597  QDS-VSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPP  421
              S VS+ L + HPCR+ +C SV+AA   C   A D+ L V+N G V+G HSVLLFSSPP
Sbjct  583  PPSYVSMRLAEDHPCRAEECASVEAAGDHCDDLAFDVKLQVRNAGEVAGAHSVLLFSSPP  642

Query  420  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
              HNAP K L+GF+KV L+P E   V F VDVC+ LSVVDE G RKVALG H LH+G LK
Sbjct  643  PAHNAPAKHLLGFEKVSLAPGEAGTVAFRVDVCRDLSVVDELGGRKVALGGHTLHVGDLK  702

Query  240  HSLTVEI  220
            H++ + +
Sbjct  703  HTVELRV  709



>ref|XP_004300692.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=799

 Score =   226 bits (577),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 142/186 (76%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ+  D V M +M MR DP +GYPGRTYRFYTG T++ FG G+SY+ F H +V+A
Sbjct  614  PMTWYPQAYVDKVPMTNMNMRADPASGYPGRTYRFYTGDTVYAFGDGISYSTFNHRLVRA  673

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
             + VS+ L++ H C S+ C+S+D  E+ C + A DIHL VKN+G + G H+VLL+SSPP+
Sbjct  674  PNQVSIPLEEDHVCYSSSCQSLDVVEERCQNLAFDIHLGVKNMGKMCGSHTVLLYSSPPS  733

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP+K L+GF+KV LS   + +V FNVDVCKHLSVVDE GNRKVALG HVLH+G L+ 
Sbjct  734  VHNAPKKHLLGFEKVFLSSQGEALVKFNVDVCKHLSVVDELGNRKVALGDHVLHVGDLRQ  793

Query  237  SLTVEI  220
            +L+V I
Sbjct  794  TLSVRI  799



>dbj|BAJ90420.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96778.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08165.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score =   226 bits (576),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 136/187 (73%), Gaps = 1/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYP S AD+V+M DMRMRPD  TGYPGRTYRFYTG T+F FG GLSYTK  HS+V A
Sbjct  589  PVTWYPASYADTVTMTDMRMRPDTSTGYPGRTYRFYTGDTVFAFGDGLSYTKMSHSLVSA  648

Query  597  QDS-VSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPP  421
              S VS+ L + HPCR+ +C SV+AA   C   A D+ L V+N G V+G HSVLLFSSPP
Sbjct  649  PPSYVSMRLAEDHPCRAEECASVEAAGDHCDDLAFDVKLQVRNAGEVAGAHSVLLFSSPP  708

Query  420  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
              HNAP K L+GF+KV L+P E   V F VDVC+ LSVVDE G RKVALG H LH+G LK
Sbjct  709  PAHNAPAKHLLGFEKVSLAPGEAGTVAFRVDVCRDLSVVDELGGRKVALGGHTLHVGDLK  768

Query  240  HSLTVEI  220
            H++ + +
Sbjct  769  HTVELRV  775



>dbj|BAJ90315.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score =   226 bits (576),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 136/187 (73%), Gaps = 1/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYP S AD+V+M DMRMRPD  TGYPGRTYRFYTG T+F FG GLSYTK  HS+V A
Sbjct  589  PVTWYPASYADTVTMTDMRMRPDTSTGYPGRTYRFYTGDTVFAFGDGLSYTKMSHSLVSA  648

Query  597  QDS-VSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPP  421
              S VS+ L + HPCR+ +C SV+AA   C   A D+ L V+N G V+G HSVLLFSSPP
Sbjct  649  PPSYVSMRLAEDHPCRAEECASVEAAGDHCDDLAFDVKLQVRNAGEVAGAHSVLLFSSPP  708

Query  420  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
              HNAP K L+GF+KV L+P E   V F VDVC+ LSVVDE G RKVALG H LH+G LK
Sbjct  709  PAHNAPAKHLLGFEKVSLAPGEAGTVAFRVDVCRDLSVVDELGGRKVALGGHTLHVGDLK  768

Query  240  HSLTVEI  220
            H++ + +
Sbjct  769  HTVELRV  775



>ref|XP_010068199.1| PREDICTED: LOW QUALITY PROTEIN: beta-xylosidase/alpha-L-arabinofuranosidase 
2, partial [Eucalyptus grandis]
Length=531

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 142/186 (76%), Gaps = 2/186 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D+V M +M MRPDP TGYPGRTYRFY GPT++ FG GLSY+   HS+VQA
Sbjct  329  PMTWYPQSYVDAVPMTNMNMRPDPATGYPGRTYRFYIGPTVYLFGEGLSYSD-SHSLVQA  387

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
                 + L++GH CRS   +S++A  +TC++ ALD+HLNVKNVG  SG H+V LFSSPP+
Sbjct  388  PQLAYMPLEEGHVCRSL-AKSLEAIGKTCSNLALDVHLNVKNVGRFSGSHTVFLFSSPPS  446

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +H AP+K L+GF+KV L+   +  + F V+VCK LS+VDE G+RKVALG HVLHIG LKH
Sbjct  447  VHRAPQKHLLGFEKVFLASQSEAQLQFKVNVCKDLSLVDELGHRKVALGTHVLHIGDLKH  506

Query  237  SLTVEI  220
            +L+++I
Sbjct  507  ALSMQI  512



>ref|XP_002513707.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF48654.1| Beta-glucosidase, putative [Ricinus communis]
Length=777

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 139/187 (74%), Gaps = 1/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ+  D V M +M MRPDP +GYPGRTYRFYTG T++ FG GLSY++++H +VQA
Sbjct  591  PMTWYPQAYVDKVPMTNMNMRPDPSSGYPGRTYRFYTGETVYSFGDGLSYSEYKHQLVQA  650

Query  597  QDSVSLALDQGHPCRST-KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPP  421
               VS+ L+  H CRS+ KC SVDA EQ C   A +I L V+N+G V G H+V LF +PP
Sbjct  651  PQLVSIPLEDDHVCRSSSKCISVDAGEQNCQGLAFNIDLKVRNIGKVRGTHTVFLFFTPP  710

Query  420  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
            ++HN+P+K LV F+KV L      +V F VDVCKHLSVVDE G+RKVALG HVLH+G+L+
Sbjct  711  SVHNSPQKHLVDFEKVSLDAKTYGMVSFKVDVCKHLSVVDEFGSRKVALGGHVLHVGNLE  770

Query  240  HSLTVEI  220
            HSLTV I
Sbjct  771  HSLTVRI  777



>gb|EMT32951.1| Beta-D-xylosidase 4 [Aegilops tauschii]
Length=970

 Score =   226 bits (577),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 135/187 (72%), Gaps = 1/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYP S AD+V M DMRMRPD  TGYPGRTYRFYTG T+F FG GLSYTK  H +V A
Sbjct  784  PVTWYPASYADTVKMTDMRMRPDTSTGYPGRTYRFYTGDTVFAFGDGLSYTKMSHQLVSA  843

Query  597  QDS-VSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPP  421
              S VS+ L + HPCR+ +C SV+AA   C   A D+ L V+N G V+G HSVLLFSSPP
Sbjct  844  PPSYVSMQLAEDHPCRAEECASVEAASDHCEDLAFDVKLRVRNAGEVAGAHSVLLFSSPP  903

Query  420  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
            + HNAP K L+GF+KV L+P E   V F VDVC+ LSVVDE G RKVALG H LH+G LK
Sbjct  904  SAHNAPAKHLLGFEKVSLAPGEAGTVAFRVDVCRDLSVVDELGGRKVALGGHTLHVGDLK  963

Query  240  HSLTVEI  220
            H++ + +
Sbjct  964  HTVELRV  970



>ref|XP_006653810.1| PREDICTED: beta-D-xylosidase 4-like [Oryza brachyantha]
Length=776

 Score =   225 bits (573),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 136/186 (73%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYP S AD VSM DMRMRPD  TGYPGRTYRFYTG T++ FG GLSYT F H +V A
Sbjct  591  PVTWYPASFADKVSMTDMRMRPDSSTGYPGRTYRFYTGDTVYAFGDGLSYTNFAHHLVSA  650

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               V++ L +GH C +  C SV+AA + C + + D+HL V+N G V+G H+V LF+SPP+
Sbjct  651  PKQVAVQLAEGHACYTEHCLSVEAAGEHCENLSFDVHLRVRNAGDVAGRHTVFLFTSPPS  710

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP K L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH
Sbjct  711  VHNAPAKHLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKH  770

Query  237  SLTVEI  220
            +L + +
Sbjct  771  TLNLRV  776



>ref|XP_008455235.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Cucumis melo]
Length=791

 Score =   225 bits (573),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 139/186 (75%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M DMRMRP P  GYPGRTYRFYTG T++ FG GLSY+ F+H +V+A
Sbjct  606  PMTWYPQSYVEKVPMTDMRMRPSPSNGYPGRTYRFYTGETVYSFGDGLSYSDFKHHLVKA  665

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++GH C S+KC S++  +++C +   D+HL VKNVG  SG H+V L+S+PP+
Sbjct  666  PKLVSIPLEEGHICHSSKCHSLEVVQESCQNLGFDVHLRVKNVGQRSGSHTVFLYSTPPS  725

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HN+P+K L+GF+KV L    + VV F VDVCK LSV DE G+RKVALGLH+LH+G LKH
Sbjct  726  VHNSPQKHLLGFEKVSLGRGREMVVRFKVDVCKDLSVTDEVGSRKVALGLHILHVGTLKH  785

Query  237  SLTVEI  220
            SL V +
Sbjct  786  SLNVRV  791



>ref|XP_010261102.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nelumbo nucifera]
Length=773

 Score =   224 bits (572),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 141/186 (76%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ+ AD V M +M MRP+P TGYPGRTYRFY G T++ FG G+SY++F H +V+A
Sbjct  588  PMTWYPQAFADKVPMTNMNMRPNPATGYPGRTYRFYRGETIYSFGDGMSYSQFSHHLVRA  647

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++GH CRS KC+S+   E+ C + A +IHL V+N+G +SG H+V LFS+PP+
Sbjct  648  PKLVSVPLEEGHICRSQKCKSIHLEEEGCRNLAFEIHLRVRNMGRMSGSHTVFLFSTPPS  707

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP K L+GF+KV L+   + +V FNVDVCK LSVVDE G RKVALG HVLH+G LKH
Sbjct  708  VHNAPNKHLLGFEKVFLTSQNEALVKFNVDVCKDLSVVDELGRRKVALGSHVLHVGSLKH  767

Query  237  SLTVEI  220
            SL + I
Sbjct  768  SLNIRI  773



>ref|XP_011015574.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Populus euphratica]
Length=776

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 137/186 (74%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPDP  GYPGRTYRFYTG T++ FG GLSY++  H + QA
Sbjct  591  PMTWYPQSYVDKVPMTNMNMRPDPSNGYPGRTYRFYTGETVYSFGDGLSYSEVSHELTQA  650

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++ H C S++C+SV AAEQTC +    + L +KN GT+SG H+V LFS+PP+
Sbjct  651  PGLVSVPLEENHVCYSSECKSVAAAEQTCQNLTFGVQLRIKNTGTMSGSHTVFLFSTPPS  710

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HN+P+K L+GF+KV L    D  V F VDVCK LSVVDE G++KVALG HVLHIG LKH
Sbjct  711  VHNSPQKHLLGFEKVFLHAQTDSHVGFKVDVCKDLSVVDELGSKKVALGEHVLHIGSLKH  770

Query  237  SLTVEI  220
            SLTV I
Sbjct  771  SLTVRI  776



>ref|XP_011046123.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Populus euphratica]
Length=776

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 137/186 (74%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPDP  GYPGRTYRFYTG T++ FG GLSY++  H + QA
Sbjct  591  PMTWYPQSYVDKVPMTNMNMRPDPSNGYPGRTYRFYTGETVYSFGDGLSYSEVSHELTQA  650

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++ H C S++C+SV AAEQTC +    + L +KN GT+SG H+V LFS+PP+
Sbjct  651  PGLVSVPLEENHVCYSSECKSVAAAEQTCQNLTFGVQLRIKNTGTMSGSHTVFLFSTPPS  710

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HN+P+K L+GF+KV L    D  V F VDVCK LSVVDE G++KVALG HVLHIG LKH
Sbjct  711  VHNSPQKHLLGFEKVFLHAQTDSHVGFKVDVCKDLSVVDELGSKKVALGEHVLHIGSLKH  770

Query  237  SLTVEI  220
            SLTV I
Sbjct  771  SLTVRI  776



>ref|XP_009407358.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Musa acuminata subsp. malaccensis]
Length=623

 Score =   221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 137/187 (73%), Gaps = 1/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWY Q   + V M DMRMRPDP + YPGRTYRFYTG   + FGYGLSYT++ H++VQA
Sbjct  437  PFTWYDQEYVEQVPMTDMRMRPDPASNYPGRTYRFYTGNPTYAFGYGLSYTRYDHNLVQA  496

Query  597  QDSVSLALDQGHPCRSTKCESVD-AAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPP  421
             + +S+ L++GHPC S  C S+D A    C+    D+HL V+N G ++G H+VLLF++PP
Sbjct  497  PEKLSITLEEGHPCYSEGCNSLDLAGSAHCSGLQFDVHLKVQNSGGMAGSHTVLLFNTPP  556

Query  420  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
            A+HNAPRKQLVGF+KV L PNE + V F VD C+ LSV DE+GN KV LG HVLH+G + 
Sbjct  557  AVHNAPRKQLVGFEKVFLEPNESKNVAFQVDACRDLSVADESGNWKVPLGSHVLHVGDVT  616

Query  240  HSLTVEI  220
            H+LT+ I
Sbjct  617  HTLTLSI  623



>ref|XP_008661823.1| PREDICTED: uncharacterized protein LOC100279996 isoform X2 [Zea 
mays]
Length=653

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 133/186 (72%), Gaps = 1/186 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYP+S    V M DMRMRPDP TGYPGRTYRFYTG T++ FG GLSYT F H +V A
Sbjct  469  PVTWYPESFT-KVPMTDMRMRPDPSTGYPGRTYRFYTGDTVYAFGDGLSYTSFAHHLVSA  527

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               ++L L +GH C + +C SV+A    C   A D+HL V+N G  SGGH+V LFSSPPA
Sbjct  528  PKQLALQLAEGHACLTEQCPSVEAEGAHCEGLAFDVHLRVRNAGERSGGHTVFLFSSPPA  587

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP K L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH
Sbjct  588  VHNAPAKHLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKH  647

Query  237  SLTVEI  220
            +L + +
Sbjct  648  TLNLGV  653



>ref|XP_006493288.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Citrus sinensis]
Length=773

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 139/186 (75%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD   GYPGRTYRFYTG T++ FG GLSY+   H +V+A
Sbjct  588  PMTWYPQSYVEKVPMTNMNMRPDASNGYPGRTYRFYTGETVYAFGDGLSYSTMNHELVRA  647

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               V++ L++GH C S+ C+SVDA EQ+C +  LDIHL VKN  ++SGGH++ LFS+PP+
Sbjct  648  PKIVAIPLEEGHVCYSSNCKSVDAVEQSCQNLNLDIHLRVKNNASISGGHTIFLFSTPPS  707

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +H +P+K L+ F+KV L   E+ +V F VD CK LSVVDE GNRK+ALG H+LH+G+LKH
Sbjct  708  VHKSPQKHLLAFEKVFLKGQEEALVSFKVDACKDLSVVDELGNRKLALGDHLLHVGNLKH  767

Query  237  SLTVEI  220
            SLTV I
Sbjct  768  SLTVRI  773



>gb|AAK38481.1| alpha-L-arabinofuranosidase/beta-D-xylosidase isoenzyme ARA-I 
[Hordeum vulgare]
Length=777

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 135/187 (72%), Gaps = 1/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYP S AD+V+M DMRMRPD  TGYPGRTYRFYTG T+F FG GLSYTK  HS+V A
Sbjct  591  PVTWYPASYADTVTMTDMRMRPDTSTGYPGRTYRFYTGDTVFAFGDGLSYTKMSHSLVSA  650

Query  597  QDS-VSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPP  421
              S VS+ L + H CR+ +C SV+AA   C   ALD+ L V+N G V+G HSVLLFSSPP
Sbjct  651  PPSYVSMRLAEDHLCRAEECASVEAAGDHCDDLALDVKLQVRNAGEVAGAHSVLLFSSPP  710

Query  420  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
              HNAP K LVGF+KV L+P E   V F VDVC+ LSVVDE G RKVALG H LH G LK
Sbjct  711  PAHNAPAKHLVGFEKVSLAPGEAGTVAFRVDVCRDLSVVDELGGRKVALGGHTLHDGDLK  770

Query  240  HSLTVEI  220
            H++ + +
Sbjct  771  HTVELRV  777



>ref|XP_006432467.1| hypothetical protein CICLE_v10000355mg [Citrus clementina]
 gb|ESR45707.1| hypothetical protein CICLE_v10000355mg [Citrus clementina]
Length=773

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 139/186 (75%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD   GYPGRTYRFYTG T++ FG GLSY+   H +V+A
Sbjct  588  PMTWYPQSYVEKVPMTNMNMRPDASNGYPGRTYRFYTGETVYAFGDGLSYSTMNHELVRA  647

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               V++ L++GH C S+ C+SVDA EQ+C +  LDIHL VKN  ++SGGH++ LFS+PP+
Sbjct  648  PKIVAIPLEEGHVCYSSNCKSVDAVEQSCQNLNLDIHLRVKNNASISGGHTIFLFSTPPS  707

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +H +P+K L+ F+KV L   E+ +V F VD CK LSVVDE GNRK+ALG H+LH+G+LKH
Sbjct  708  VHKSPQKHLLAFEKVFLKGQEEALVSFKVDACKDLSVVDELGNRKLALGDHLLHVGNLKH  767

Query  237  SLTVEI  220
            SLT+ I
Sbjct  768  SLTIRI  773



>ref|XP_008661822.1| PREDICTED: uncharacterized protein LOC100279996 isoform X1 [Zea 
mays]
 gb|AFW59620.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=773

 Score =   221 bits (563),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 133/186 (72%), Gaps = 1/186 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYP+S    V M DMRMRPDP TGYPGRTYRFYTG T++ FG GLSYT F H +V A
Sbjct  589  PVTWYPESFT-KVPMTDMRMRPDPSTGYPGRTYRFYTGDTVYAFGDGLSYTSFAHHLVSA  647

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               ++L L +GH C + +C SV+A    C   A D+HL V+N G  SGGH+V LFSSPPA
Sbjct  648  PKQLALQLAEGHACLTEQCPSVEAEGAHCEGLAFDVHLRVRNAGERSGGHTVFLFSSPPA  707

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP K L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH
Sbjct  708  VHNAPAKHLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGSHTLHVGDLKH  767

Query  237  SLTVEI  220
            +L + +
Sbjct  768  TLNLGV  773



>ref|XP_004136861.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cucumis sativus]
 gb|KGN43688.1| hypothetical protein Csa_7G058620 [Cucumis sativus]
Length=782

 Score =   221 bits (563),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 139/186 (75%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M DMRMRP    G+PGRTYRFYTG T++ FG GLSY+ F+H +V+A
Sbjct  597  PMTWYPQSYVEKVPMTDMRMRPSASNGFPGRTYRFYTGETIYSFGDGLSYSDFKHHLVKA  656

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++GH C S+KC S++  +++C +   D+HL VKNVG  SG H+V L+S+PP+
Sbjct  657  PKLVSIPLEEGHICHSSKCHSLEVVQESCQNLGFDVHLRVKNVGQRSGSHTVFLYSTPPS  716

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HN+P+K L+GF+KV L    + VV F VDVCK LSV DE G+RKVALGLH+LH+G LKH
Sbjct  717  VHNSPQKHLLGFEKVSLGRGGETVVRFKVDVCKDLSVADEVGSRKVALGLHILHVGTLKH  776

Query  237  SLTVEI  220
            SL V++
Sbjct  777  SLNVKV  782



>gb|KHN39204.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Glycine soja]
Length=648

 Score =   219 bits (558),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 134/186 (72%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPDP TGYPGRTYRFY G T+F FG GLSY+   H +V+A
Sbjct  463  PMTWYPQSYVDKVPMTNMNMRPDPATGYPGRTYRFYKGETVFAFGDGLSYSSMVHKLVKA  522

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L + H CRS++C+S+D   + C +   DIHL +KN G +S  H+V LFS+PPA
Sbjct  523  PQLVSVQLAEDHVCRSSECKSIDVVGEHCQNLVFDIHLRIKNKGKMSSAHTVFLFSTPPA  582

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP+K L+GF+KV L    + +V F VDVCK LS+VDE GNRKVALG H+LH+G LKH
Sbjct  583  VHNAPQKHLLGFEKVHLIGKSEALVSFKVDVCKDLSIVDELGNRKVALGQHLLHVGDLKH  642

Query  237  SLTVEI  220
             L+V I
Sbjct  643  PLSVMI  648



>ref|XP_002448619.1| hypothetical protein SORBIDRAFT_06g030270 [Sorghum bicolor]
 gb|EES12947.1| hypothetical protein SORBIDRAFT_06g030270 [Sorghum bicolor]
Length=767

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 134/186 (72%), Gaps = 1/186 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYP+S    V MIDMRMRPD  TGYPGRTYRFYTG T++ FG GLSYT F H +V A
Sbjct  583  PVTWYPESFT-KVPMIDMRMRPDASTGYPGRTYRFYTGDTVYAFGDGLSYTSFAHHLVSA  641

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               V+L L +GH C + +C SV+A    C   A D+HL V+N G +SG H+V LFSSPPA
Sbjct  642  PKQVALQLAEGHTCLTEQCPSVEAEGAHCEGLAFDVHLRVRNAGDMSGAHTVFLFSSPPA  701

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP K L+GF+KV L P +  VV F VDVCK LSVVDE GNRKVALG H LH+G LKH
Sbjct  702  VHNAPAKHLLGFEKVSLEPGQAGVVAFKVDVCKDLSVVDELGNRKVALGNHTLHVGDLKH  761

Query  237  SLTVEI  220
            +L++ +
Sbjct  762  TLSLGV  767



>ref|XP_004155509.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cucumis sativus]
Length=809

 Score =   221 bits (562),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 139/186 (75%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M DMRMRP    G+PGRTYRFYTG T++ FG GLSY+ F+H +V+A
Sbjct  624  PMTWYPQSYVEKVPMTDMRMRPSASNGFPGRTYRFYTGETIYSFGDGLSYSDFKHHLVKA  683

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++GH C S+KC S++  +++C +   D+HL VKNVG  SG H+V L+S+PP+
Sbjct  684  PKLVSIPLEEGHICHSSKCHSLEVVQESCQNLGFDVHLRVKNVGQRSGSHTVFLYSTPPS  743

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HN+P+K L+GF+KV L    + VV F VDVCK LSV DE G+RKVALGLH+LH+G LKH
Sbjct  744  VHNSPQKHLLGFEKVSLGRGGETVVRFKVDVCKDLSVADEVGSRKVALGLHILHVGTLKH  803

Query  237  SLTVEI  220
            SL V++
Sbjct  804  SLNVKV  809



>ref|XP_010103839.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Morus notabilis]
 gb|EXB97280.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Morus notabilis]
Length=778

 Score =   219 bits (559),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 136/188 (72%), Gaps = 2/188 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS    V M +M MRPD   GYPGRTYRFYTG T++ FG GLSYT+F H +V+A
Sbjct  591  PITWYPQSYVGKVPMTNMNMRPDASNGYPGRTYRFYTGETVYSFGDGLSYTQFHHHLVRA  650

Query  597  QDSVSLALDQGHPCRSTKCESVDAA--EQTCASSALDIHLNVKNVGTVSGGHSVLLFSSP  424
               VS  LD+ + CR+++C +++    E TC + A DIHL VKNVGT  G H+V LFSSP
Sbjct  651  PKLVSFPLDEANACRTSRCTTLNVGDHEHTCQNLAFDIHLRVKNVGTSGGTHTVFLFSSP  710

Query  423  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  244
            P++HN+PRK L+GF+KV L    + +V F V++CK LSVVDE G RKVALG H+LH+G L
Sbjct  711  PSVHNSPRKHLLGFEKVSLKAQSESLVKFTVNICKDLSVVDEVGTRKVALGHHLLHVGDL  770

Query  243  KHSLTVEI  220
            KHSL+V I
Sbjct  771  KHSLSVRI  778



>dbj|BAD94522.1| beta-xylosidase - like protein [Arabidopsis thaliana]
Length=287

 Score =   209 bits (531),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 138/191 (72%), Gaps = 5/191 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD   GYPGR+YRFYTG T++ F   L+YTKF H +++A
Sbjct  97   PMTWYPQSYVEKVPMSNMNMRPDKSKGYPGRSYRFYTGETVYAFADALTYTKFDHQLIKA  156

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCAS-----SALDIHLNVKNVGTVSGGHSVLLF  433
               VSL+LD+ HPCRS++C+S+DA    C +     S  ++HLNVKN G  +G H+V LF
Sbjct  157  PRLVSLSLDENHPCRSSECQSLDAIGPHCENAVEGGSDFEVHLNVKNTGDRAGSHTVFLF  216

Query  432  SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHI  253
            ++ P +H +P KQL+GF+K+RL  +E+ VV FNV+VCK LSVVDE G RK+ALG H+LH+
Sbjct  217  TTSPQVHGSPIKQLLGFEKIRLGKSEEAVVRFNVNVCKDLSVVDETGKRKIALGHHLLHV  276

Query  252  GHLKHSLTVEI  220
            G LKHSL + +
Sbjct  277  GSLKHSLNISV  287



>ref|XP_003580652.1| PREDICTED: beta-D-xylosidase 4-like [Brachypodium distachyon]
Length=774

 Score =   219 bits (558),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 133/187 (71%), Gaps = 1/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYP S AD V M DMRMRPD  TGYPGRTYRFYTG T+F FG GLSYT   H++V A
Sbjct  588  PVTWYPASFADKVPMTDMRMRPDNSTGYPGRTYRFYTGETVFAFGDGLSYTTMSHNLVAA  647

Query  597  QDS-VSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPP  421
              S VS+ L +GH C + +C SV+AA   C   A ++ L V N G ++G H+VLLFSSPP
Sbjct  648  PPSEVSMQLAEGHACHTKECASVEAAGDHCEGMAFEVRLRVHNTGEMAGAHTVLLFSSPP  707

Query  420  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
            A+HNAP K L+GF+K+ L P +  V  F VDVCK LSVVDE GNRKVALG H LH+G LK
Sbjct  708  AVHNAPAKHLLGFEKLNLEPGQAGVAAFKVDVCKDLSVVDELGNRKVALGGHTLHVGDLK  767

Query  240  HSLTVEI  220
            H+L + +
Sbjct  768  HTLNLGV  774



>ref|XP_003531047.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Glycine max]
Length=765

 Score =   219 bits (557),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 134/186 (72%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPDP TGYPGRTYRFY G T+F FG GLSY+   H +V+A
Sbjct  580  PMTWYPQSYVDKVPMTNMNMRPDPATGYPGRTYRFYKGETVFAFGDGLSYSSIVHKLVKA  639

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L + H CRS++C+S+D   + C +   DIHL +KN G +S  H+V LFS+PPA
Sbjct  640  PQLVSVQLAEDHVCRSSECKSIDVVGEHCQNLVFDIHLRIKNKGKMSSAHTVFLFSTPPA  699

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP+K L+GF+KV L    + +V F VDVCK LS+VDE GNRKVALG H+LH+G LKH
Sbjct  700  VHNAPQKHLLGFEKVHLIGKSEALVSFKVDVCKDLSIVDELGNRKVALGQHLLHVGDLKH  759

Query  237  SLTVEI  220
             L+V I
Sbjct  760  PLSVMI  765



>ref|XP_010243340.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nelumbo nucifera]
Length=771

 Score =   219 bits (557),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 141/186 (76%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ  AD V M +M MR D  TGYPGRTYRFYTG T++ FG GLSY++F H IV+A
Sbjct  586  PMTWYPQEFADKVPMTNMNMRSDLATGYPGRTYRFYTGETIYSFGDGLSYSQFNHHIVRA  645

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L++GH C S +C+S+D  E +C + A  IHL V+N+G  SG H+VLLF++PP+
Sbjct  646  PKLVSVPLEEGHICHSQRCKSIDLFEGSCQNLAFKIHLRVRNMGRRSGSHTVLLFNTPPS  705

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP+K L+GF+KV L+   +E+V FNVDVCK LSVVDE G+RKVALG HVL +G LKH
Sbjct  706  VHNAPKKHLLGFKKVFLTAQSEELVKFNVDVCKDLSVVDELGSRKVALGSHVLQVGSLKH  765

Query  237  SLTVEI  220
            SL ++I
Sbjct  766  SLNIKI  771



>dbj|BAD94481.1| beta-xylosidase [Arabidopsis thaliana]
Length=523

 Score =   214 bits (545),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 137/192 (71%), Gaps = 6/192 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M  M MRPD  +GYPGRTYRFYTG T++ FG GLSYTKF H++V+A
Sbjct  332  PMTWYPQSYVEKVPMTIMNMRPDKASGYPGRTYRFYTGETVYAFGDGLSYTKFSHTLVKA  391

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTC------ASSALDIHLNVKNVGTVSGGHSVLL  436
               VSL L++ H CRS++C+S+DA    C        SA ++H+ V+N G   G H+V L
Sbjct  392  PSLVSLGLEENHVCRSSECQSLDAIGPHCENAVSGGGSAFEVHIKVRNGGDREGIHTVFL  451

Query  435  FSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLH  256
            F++PPA+H +PRK LVGF+K+RL   E+ VV F V++CK LSVVDE G RK+ LG H+LH
Sbjct  452  FTTPPAIHGSPRKHLVGFEKIRLGKREEAVVRFKVEICKDLSVVDEIGKRKIGLGKHLLH  511

Query  255  IGHLKHSLTVEI  220
            +G LKHSL++ I
Sbjct  512  VGDLKHSLSIRI  523



>gb|KEH31243.1| beta-xylosidase/alpha-L-arabinofuranosidase-like protein [Medicago 
truncatula]
Length=774

 Score =   218 bits (554),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 133/186 (72%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPDP TGYPGRTYRFY G T+F FG G+SY+ F H +V+A
Sbjct  589  PMTWYPQSYVDKVPMTNMNMRPDPATGYPGRTYRFYKGETVFSFGDGISYSTFEHKLVKA  648

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L + H CRS+KC+S+D   + C +   DIHL +KN G +S   +V LFS+PPA
Sbjct  649  PQLVSVPLAEDHVCRSSKCKSLDVVGEHCQNLVFDIHLRIKNKGKMSSSQTVFLFSTPPA  708

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP+K L+ F+KV  +   + +V F VDVCK LSVVDE GNRKVALG H+LH+G LKH
Sbjct  709  VHNAPQKHLLAFEKVHFTGKSEALVSFKVDVCKDLSVVDELGNRKVALGKHMLHVGDLKH  768

Query  237  SLTVEI  220
             L+V I
Sbjct  769  PLSVMI  774



>sp|A5JTQ3.1|XYL2_MEDSV RecName: Full=Beta-xylosidase/alpha-L-arabinofuranosidase 2; 
AltName: Full=Xylan 1,4-beta-xylosidase/Alpha-L-arabinofuranosidase 
2; Short=MsXyl2; Includes: RecName: Full=Beta-xylosidase; 
AltName: Full=1,4-beta-D-xylan xylohydrolase; AltName: 
Full=Xylan 1,4-beta-xylosidase; Includes: RecName: Full=Alpha-L-arabinofuranosidase; 
Short=Arabinosidase; Flags: Precursor 
[Medicago sativa subsp. x varia]
 gb|ABQ45228.1| beta-xylosidase/alpha-L-arabinosidase [Medicago sativa subsp. 
x varia]
Length=774

 Score =   218 bits (554),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 134/186 (72%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPDP TGYPGRTYRFY G T+F FG G+SY+ F H +V+A
Sbjct  589  PMTWYPQSYVDKVPMTNMNMRPDPATGYPGRTYRFYKGETVFSFGDGISYSTFEHKLVKA  648

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L + H CRS+KC+S+D   + C + A DIHL +KN G +S   +V LFS+PPA
Sbjct  649  PQLVSVPLAEDHVCRSSKCKSLDVVGEHCQNLAFDIHLRIKNKGKMSSSQTVFLFSTPPA  708

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP+K L+ F+KV L+   + +V F VDVCK L +VDE GNRKVALG H+LH+G LKH
Sbjct  709  VHNAPQKHLLAFEKVLLTGKSEALVSFKVDVCKDLGLVDELGNRKVALGKHMLHVGDLKH  768

Query  237  SLTVEI  220
             L+V I
Sbjct  769  PLSVMI  774



>ref|XP_010687471.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Beta vulgaris subsp. vulgaris]
Length=777

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 135/186 (73%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS A+ V M +M MRP+P TGYPGR+YRFYTG T++ FG GLSY+ F H +V+A
Sbjct  592  PMTWYPQSYAEKVPMTNMNMRPNPTTGYPGRSYRFYTGETVYNFGDGLSYSDFTHHLVKA  651

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L + H C ++ C+S+DA  + C +   D+HL V+N G + G H+V LFSSPP+
Sbjct  652  PTEVSVPLQEEHVCHTSTCKSIDALGEHCKNLGFDVHLKVRNNGAMEGRHTVFLFSSPPS  711

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HN+P+K L+ F+KV L    + + VF VD C+HLSVVDE GNRKVALG+H LHIG++KH
Sbjct  712  VHNSPKKNLIAFEKVFLHGKTEGMTVFKVDACEHLSVVDEEGNRKVALGVHQLHIGNMKH  771

Query  237  SLTVEI  220
            S  V I
Sbjct  772  SFNVRI  777



>gb|KJB77499.1| hypothetical protein B456_012G140300 [Gossypium raimondii]
Length=776

 Score =   216 bits (551),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 134/188 (71%), Gaps = 2/188 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPDP  GYPGRTYRFYTG T++ FG+GLSY+KF H IV+A
Sbjct  589  PMTWYPQSYLDKVPMTNMNMRPDPPKGYPGRTYRFYTGETIYSFGHGLSYSKFSHKIVKA  648

Query  597  QDSVSLALDQGHPCR-STKCESVDAAEQTCASSA-LDIHLNVKNVGTVSGGHSVLLFSSP  424
              +VS+ LD  H CR S  C SV+A EQ C  S   DIHL V+N     G HSVLLF +P
Sbjct  649  PQTVSIPLDDDHVCRHSLDCNSVEAVEQLCKKSVTFDIHLRVQNKARHGGSHSVLLFVTP  708

Query  423  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  244
            P++HN+PRK L+GF+K+ L      ++ F VDVCK LSVVDE G RK+ALG +VLH+G+ 
Sbjct  709  PSVHNSPRKHLIGFEKISLKGKSGTLMRFKVDVCKDLSVVDELGRRKIALGQYVLHVGNF  768

Query  243  KHSLTVEI  220
            KH+L++ I
Sbjct  769  KHTLSLRI  776



>ref|XP_003593145.1| Beta-xylosidase/alpha-L-arabinofuranosidase [Medicago truncatula]
 gb|AES63396.1| beta-xylosidase/alpha-L-arabinofuranosidase-like protein [Medicago 
truncatula]
Length=775

 Score =   216 bits (551),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 137/186 (74%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + + M +M MR DP TGYPGRTYRFY G T+F FG G+S+    H IV+A
Sbjct  590  PMTWYPQSYVEKIPMTNMNMRSDPATGYPGRTYRFYKGETVFSFGDGMSFGTVEHKIVKA  649

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L + H CRS +C+S+D A++ C + A DIHL+VKN+G +S  HSVLLF +PP 
Sbjct  650  PQLVSVPLAEDHECRSLECKSLDVADEHCQNLAFDIHLSVKNMGKMSSSHSVLLFFTPPN  709

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP+K L+GF+KV+L+   + +V F VDVC  LSVVDE GNRKV LG H+LH+G+LKH
Sbjct  710  VHNAPQKHLLGFEKVQLAGKSEGMVRFKVDVCNDLSVVDELGNRKVPLGDHMLHVGNLKH  769

Query  237  SLTVEI  220
            SL+V I
Sbjct  770  SLSVRI  775



>sp|A5JTQ2.1|XYL1_MEDSV RecName: Full=Beta-xylosidase/alpha-L-arabinofuranosidase 1; 
AltName: Full=Xylan 1,4-beta-xylosidase/Alpha-L-arabinofuranosidase 
1; Short=MsXyl1; Includes: RecName: Full=Beta-xylosidase; 
AltName: Full=1,4-beta-D-xylan xylohydrolase; AltName: 
Full=Xylan 1,4-beta-xylosidase; Includes: RecName: Full=Alpha-L-arabinofuranosidase; 
Short=Arabinosidase; Flags: Precursor, 
partial [Medicago sativa subsp. x varia]
 gb|ABQ45227.1| beta-xylosidase/alpha-L-arabinosidase [Medicago sativa subsp. 
x varia]
Length=774

 Score =   216 bits (551),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 137/186 (74%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MR DP TGYPGRTYRFY G T+F FG G+S+    H IV+A
Sbjct  589  PMTWYPQSYVEKVPMTNMNMRADPATGYPGRTYRFYKGETVFSFGDGMSFGTVEHKIVKA  648

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L + H CRS +C+S+D A++ C + A DIHL+VKN+G +S  HSVLLF +PP 
Sbjct  649  PQLVSVPLAEDHECRSLECKSLDVADKHCQNLAFDIHLSVKNMGKMSSSHSVLLFFTPPN  708

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP+K L+GF+KV+L+   + +V F VDVC  LSVVDE GNRKV LG H+LH+G+LKH
Sbjct  709  VHNAPQKHLLGFEKVQLAGKSEGMVRFKVDVCNDLSVVDELGNRKVPLGDHMLHVGNLKH  768

Query  237  SLTVEI  220
            SL+V I
Sbjct  769  SLSVRI  774



>gb|KHN26728.1| Beta-xylosidase/alpha-L-arabinofuranosidase 1 [Glycine soja]
Length=648

 Score =   214 bits (546),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 133/186 (72%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MR DP TGYPGRTYRFY G T+F FG G+S++   H IV+A
Sbjct  463  PMTWYPQSYVNKVPMTNMNMRADPATGYPGRTYRFYKGETVFSFGDGISFSNIEHKIVKA  522

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L + H CRS++C S+D A++ C + A DIHL VKN+G +S  H VLLF +PP 
Sbjct  523  PQLVSVPLAEDHECRSSECMSLDVADEHCQNLAFDIHLGVKNMGKMSSSHVVLLFFTPPD  582

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP+K L+GF+KV L    +  V F VD+CK LSVVDE GNRKV LG H+LH+G+LKH
Sbjct  583  VHNAPQKHLLGFEKVHLPGKSEAQVRFKVDICKDLSVVDELGNRKVPLGQHLLHVGNLKH  642

Query  237  SLTVEI  220
             L+V +
Sbjct  643  QLSVSV  648



>ref|XP_007159080.1| hypothetical protein PHAVU_002G206800g [Phaseolus vulgaris]
 gb|ESW31074.1| hypothetical protein PHAVU_002G206800g [Phaseolus vulgaris]
Length=773

 Score =   216 bits (550),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 136/186 (73%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPDP TGYPGRTYRFY G T+F FG GLSY+   H +++A
Sbjct  588  PMTWYPQSYVDKVPMTNMNMRPDPATGYPGRTYRFYKGETVFSFGDGLSYSSIVHKLIKA  647

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L + H CRS++C+S+    + C +  +DI+L VKN G +S GH+V LFS+PPA
Sbjct  648  PQMVSVPLAEDHVCRSSECKSLVIDGELCQNLVIDINLKVKNKGNLSSGHTVFLFSTPPA  707

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP+K L+GF+KV L    + +V F VDVCK LS+VDE GNRKVALG H+LH+G+LKH
Sbjct  708  VHNAPQKHLLGFEKVHLIGKSEALVRFKVDVCKDLSIVDELGNRKVALGQHLLHVGNLKH  767

Query  237  SLTVEI  220
             L+V I
Sbjct  768  PLSVMI  773



>gb|KHG02719.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Gossypium arboreum]
Length=776

 Score =   215 bits (548),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 134/188 (71%), Gaps = 2/188 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPDP  GYPGRTYRFYTG T++ FG+GLSY+KF H IV+A
Sbjct  589  PMTWYPQSYLEKVPMTNMNMRPDPSKGYPGRTYRFYTGETIYSFGHGLSYSKFSHKIVKA  648

Query  597  QDSVSLALDQGHPCR-STKCESVDAAEQTCASSA-LDIHLNVKNVGTVSGGHSVLLFSSP  424
              +VS+ LD  H CR S  C SV+A EQ C  S   DIHL V+N     G HSVLLF +P
Sbjct  649  PQTVSIPLDNDHVCRHSLDCNSVEAVEQLCKKSVTFDIHLRVQNKARHGGSHSVLLFVTP  708

Query  423  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  244
            P++HN+PRK L+GF+K+ L      ++ F VDVCK LSVVDE G RK+ALG +VLH+G+ 
Sbjct  709  PSVHNSPRKHLIGFEKISLKGKSGTLMRFKVDVCKDLSVVDELGRRKIALGQYVLHVGNF  768

Query  243  KHSLTVEI  220
            KH+L++ I
Sbjct  769  KHTLSLRI  776



>ref|XP_006394136.1| hypothetical protein EUTSA_v10003678mg [Eutrema salsugineum]
 gb|ESQ31422.1| hypothetical protein EUTSA_v10003678mg [Eutrema salsugineum]
Length=780

 Score =   215 bits (548),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 138/191 (72%), Gaps = 5/191 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD   GYPGRTYRFYTG T++ FG GLSYTKF HS+V+A
Sbjct  590  PMTWYPQSYVEKVPMTNMNMRPDKSNGYPGRTYRFYTGETVYAFGDGLSYTKFSHSLVKA  649

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTC-----ASSALDIHLNVKNVGTVSGGHSVLLF  433
               VSL L++ H CRS++C+S+DA    C       SA ++H+ V+N G   G H+V LF
Sbjct  650  PRLVSLRLEENHVCRSSECQSLDAIGPHCENAVSGGSAFEVHIKVRNGGDREGIHTVFLF  709

Query  432  SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHI  253
            ++PPA+H +PRK L+GF+K+RL   E+ VV F V++CK LSVVDE G RK+ALG H+LH+
Sbjct  710  TTPPAVHGSPRKHLLGFEKIRLGKMEEAVVKFKVEICKDLSVVDEIGKRKIALGQHLLHV  769

Query  252  GHLKHSLTVEI  220
            G LKHSL++ I
Sbjct  770  GDLKHSLSIRI  780



>ref|XP_003531557.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 133/186 (72%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MR DP TGYPGRTYRFY G T+F FG G+S++   H IV+A
Sbjct  591  PMTWYPQSYVNKVPMTNMNMRADPATGYPGRTYRFYKGETVFSFGDGISFSNIEHKIVKA  650

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L + H CRS++C S+D A++ C + A DIHL VKN+G +S  H VLLF +PP 
Sbjct  651  PQLVSVPLAEDHECRSSECMSLDVADEHCQNLAFDIHLGVKNMGKMSSSHVVLLFFTPPD  710

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP+K L+GF+KV L    +  V F VD+CK LSVVDE GNRKV LG H+LH+G+LKH
Sbjct  711  VHNAPQKHLLGFEKVHLPGKSEAQVRFKVDICKDLSVVDELGNRKVPLGQHLLHVGNLKH  770

Query  237  SLTVEI  220
             L+V +
Sbjct  771  QLSVSV  776



>ref|XP_006399455.1| hypothetical protein EUTSA_v10012739mg [Eutrema salsugineum]
 gb|ESQ40908.1| hypothetical protein EUTSA_v10012739mg [Eutrema salsugineum]
Length=779

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 138/191 (72%), Gaps = 5/191 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD  TGYPGRTYRFY G T++ FG G+SYT+F H +++A
Sbjct  589  PMTWYPQSYVEKVPMTNMNMRPDESTGYPGRTYRFYAGETVYAFGDGISYTQFTHRLIKA  648

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCAS-----SALDIHLNVKNVGTVSGGHSVLLF  433
               VSL LDQ HPCRS++C+SVD+    C +     S  ++HLNV+N G   G H+V LF
Sbjct  649  PGLVSLRLDQSHPCRSSECQSVDSIGPHCENAVKGRSDFEVHLNVRNAGDREGSHTVFLF  708

Query  432  SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHI  253
            ++PPA+H +P K L+GF+KVRL  NE+ VV F VDVC+ LSVVDE G RK+ALG H+LH+
Sbjct  709  TTPPAIHRSPIKHLLGFEKVRLGKNEEAVVRFKVDVCQDLSVVDEIGKRKIALGQHLLHV  768

Query  252  GHLKHSLTVEI  220
            G LKH+L + +
Sbjct  769  GSLKHTLNIRV  779



>ref|XP_004504774.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cicer arietinum]
Length=774

 Score =   214 bits (544),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 132/186 (71%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPDP TGYPGRTYRFY G T+F FG G+SY+   H +V+A
Sbjct  589  PMTWYPQSYVDKVPMTNMNMRPDPATGYPGRTYRFYKGETVFSFGDGISYSTCEHKLVKA  648

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L + H CRS +C+S+D A Q C + A DI L++KN G +S   +V LFS+PPA
Sbjct  649  PQLVSVPLSEDHVCRSLECKSLDVAGQHCQNLAFDIQLSIKNNGKMSISQTVFLFSTPPA  708

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP+K L+ F+KV L    + VV F VDVCK LSVVDE GNRKVALG H+LH+G LKH
Sbjct  709  VHNAPQKHLLAFEKVHLMGKSEAVVSFKVDVCKDLSVVDEVGNRKVALGQHMLHVGDLKH  768

Query  237  SLTVEI  220
             L V I
Sbjct  769  PLGVRI  774



>ref|NP_201262.1| beta-D-xylosidase 4 [Arabidopsis thaliana]
 sp|Q9FLG1.1|BXL4_ARATH RecName: Full=Beta-D-xylosidase 4; Short=AtBXL4; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB11424.1| beta-xylosidase [Arabidopsis thaliana]
 gb|AED97922.1| beta-D-xylosidase 4 [Arabidopsis thaliana]
Length=784

 Score =   214 bits (544),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 137/192 (71%), Gaps = 6/192 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M  M MRPD  +GYPGRTYRFYTG T++ FG GLSYTKF H++V+A
Sbjct  593  PMTWYPQSYVEKVPMTIMNMRPDKASGYPGRTYRFYTGETVYAFGDGLSYTKFSHTLVKA  652

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTC------ASSALDIHLNVKNVGTVSGGHSVLL  436
               VSL L++ H CRS++C+S+DA    C        SA ++H+ V+N G   G H+V L
Sbjct  653  PSLVSLGLEENHVCRSSECQSLDAIGPHCENAVSGGGSAFEVHIKVRNGGDREGIHTVFL  712

Query  435  FSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLH  256
            F++PPA+H +PRK LVGF+K+RL   E+ VV F V++CK LSVVDE G RK+ LG H+LH
Sbjct  713  FTTPPAIHGSPRKHLVGFEKIRLGKREEAVVRFKVEICKDLSVVDEIGKRKIGLGKHLLH  772

Query  255  IGHLKHSLTVEI  220
            +G LKHSL++ I
Sbjct  773  VGDLKHSLSIRI  784



>ref|XP_006827121.1| hypothetical protein AMTR_s00010p00246460 [Amborella trichopoda]
 gb|ERM94358.1| hypothetical protein AMTR_s00010p00246460 [Amborella trichopoda]
Length=769

 Score =   213 bits (541),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 133/184 (72%), Gaps = 0/184 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     V M +M MRPD  TGYPGRTYRFYTG T++ FG GLSYT+F H +++A
Sbjct  584  PVTWYPQDFVTKVPMTNMNMRPDTSTGYPGRTYRFYTGDTVYSFGDGLSYTEFSHHLIRA  643

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
              +VS+ L++GHPC ST CESV+     C +    +H+ VKNVG   GG++VLLFS+PP 
Sbjct  644  PTTVSIPLEEGHPCLSTACESVELHSSKCPNLTFSLHVKVKNVGDRHGGNTVLLFSTPPR  703

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAPRK+L+GF+KV + P  +  V F V+VC+ L VVDE G++KVALG H  H+G+L H
Sbjct  704  VHNAPRKRLLGFEKVHVEPRSERAVEFRVEVCEGLGVVDEFGSKKVALGSHTFHVGNLVH  763

Query  237  SLTV  226
            SL+V
Sbjct  764  SLSV  767



>ref|XP_009150540.1| PREDICTED: beta-D-xylosidase 4 [Brassica rapa]
Length=791

 Score =   212 bits (540),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 138/193 (72%), Gaps = 7/193 (4%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD   GYPGRTYRFYTG T++ FG GLSYTKFRHS+V+A
Sbjct  599  PMTWYPQSYVEKVPMTNMNMRPDKSNGYPGRTYRFYTGETVYAFGDGLSYTKFRHSLVKA  658

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTC-------ASSALDIHLNVKNVGTVSGGHSVL  439
               VSL+L++ H CRS++C+S+DA    C         +A ++ + V+N G   G H+V 
Sbjct  659  PRLVSLSLEENHVCRSSECQSLDAIGPHCDNVVSGKGGTAFEVQIKVQNGGDREGIHTVF  718

Query  438  LFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVL  259
            LF++PPA+H +PRK L+GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H+L
Sbjct  719  LFTTPPAVHGSPRKHLLGFEKIRLGKMEEAVVKFKVDVCKDLSVVDEVGKRKIGLGRHLL  778

Query  258  HIGHLKHSLTVEI  220
            H+G +KHSL++ I
Sbjct  779  HVGDVKHSLSIRI  791



>emb|CDY51290.1| BnaA06g23560D [Brassica napus]
Length=780

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 138/193 (72%), Gaps = 7/193 (4%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD   GYPGRTYRFYTG T++ FG GLSYTKFRHS+V+A
Sbjct  588  PMTWYPQSYVEKVPMTNMNMRPDKSNGYPGRTYRFYTGETVYAFGDGLSYTKFRHSLVKA  647

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTC-------ASSALDIHLNVKNVGTVSGGHSVL  439
               VSL+L++ H CRS++C+S+DA    C         +A ++ + V+N G   G H+V 
Sbjct  648  PRLVSLSLEENHVCRSSECQSLDAIGPHCDNVVSGKGGTAFEVQIKVQNGGDREGIHTVF  707

Query  438  LFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVL  259
            LF++PPA+H +PRK L+GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H+L
Sbjct  708  LFTTPPAVHGSPRKHLLGFEKIRLGKMEEAVVKFKVDVCKDLSVVDEVGKRKIGLGRHLL  767

Query  258  HIGHLKHSLTVEI  220
            H+G +KHSL++ I
Sbjct  768  HVGDVKHSLSIRI  780



>ref|XP_004976989.1| PREDICTED: beta-D-xylosidase 4-like isoform X2 [Setaria italica]
Length=770

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 131/186 (70%), Gaps = 1/186 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYP+S    + M DMRMRPD  TGYPGRTYRFYTG T++ FG GLSYT F H +V A
Sbjct  586  PVTWYPESFT-KIPMTDMRMRPDKSTGYPGRTYRFYTGDTVYAFGDGLSYTSFAHHLVSA  644

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               V++ L +GH C +  C SV+A    C   A D+HL V+N G V+G H+V LFSSPPA
Sbjct  645  PTHVAVVLAEGHACLTEHCLSVEAEGGHCDKLAFDVHLRVRNAGEVAGRHTVFLFSSPPA  704

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP K L+GF+KV L P +  VV F VDVC+ LSVVDE GNRKVALG H LH+G LKH
Sbjct  705  VHNAPAKHLLGFEKVSLEPGQAGVVAFKVDVCRDLSVVDELGNRKVALGSHTLHVGDLKH  764

Query  237  SLTVEI  220
            ++ + +
Sbjct  765  TINLRV  770



>ref|XP_002866623.1| beta-xylosidase 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42882.1| beta-xylosidase 4 [Arabidopsis lyrata subsp. lyrata]
Length=784

 Score =   211 bits (536),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 136/192 (71%), Gaps = 6/192 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M  M MRPD   GYPGRTYRFYTG T++ FG GLSYTKF HS+V+A
Sbjct  593  PMTWYPQSYVEKVPMTIMNMRPDKSKGYPGRTYRFYTGETVYAFGDGLSYTKFSHSLVKA  652

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTC------ASSALDIHLNVKNVGTVSGGHSVLL  436
               VSL+L++ H CRS++C+S+DA    C        SA ++ + V+N G   G H+V L
Sbjct  653  PSLVSLSLEENHVCRSSECQSLDAIGPHCENAVSGGGSAFEVQIKVRNGGDREGIHTVFL  712

Query  435  FSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLH  256
            F++PPA+H +PRK L+GF+K+RL   E+ VV F V+VCK LSVVDE G RK+ LG H+LH
Sbjct  713  FTTPPAIHGSPRKHLLGFEKIRLGKMEEAVVRFKVEVCKDLSVVDEIGKRKIGLGKHLLH  772

Query  255  IGHLKHSLTVEI  220
            +G LKHSL++ I
Sbjct  773  VGDLKHSLSIRI  784



>ref|XP_004485551.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Cicer arietinum]
Length=775

 Score =   210 bits (535),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 134/186 (72%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M  M MR DP TGYPGRTYRFY G T+F FG G+S+    H IV+A
Sbjct  590  PMTWYPQSYVEKVPMTIMNMRADPATGYPGRTYRFYKGDTVFSFGDGMSFGTVEHKIVKA  649

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L + H CRS +C+S+D A++ C + A DIHL+ KN+G +S  H+VLLF SPP 
Sbjct  650  PQLVSVPLAENHECRSLECKSLDVADEHCQNLAFDIHLSAKNMGKMSSSHTVLLFFSPPN  709

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP+K L+GF+KV+L+   + +V F VDVCK LSVVDE G RKV LG H+LH+G+LK+
Sbjct  710  VHNAPQKHLLGFEKVQLAGKSEALVKFKVDVCKDLSVVDEVGKRKVPLGEHMLHVGNLKY  769

Query  237  SLTVEI  220
             L+V I
Sbjct  770  PLSVRI  775



>ref|XP_003547598.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score =   210 bits (535),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 132/186 (71%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ+  + V M +M MR DP TGYPGRTYRFY G T+F FG G+S++   H IV+A
Sbjct  591  PMTWYPQAYVNKVPMTNMNMRADPATGYPGRTYRFYKGETVFSFGDGISFSSIEHKIVKA  650

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L + H CRS++C S+D A++ C + A DIHL VKN G +S  H VLLF +PP 
Sbjct  651  PQLVSVPLAEDHECRSSECMSLDIADEHCQNLAFDIHLGVKNTGKMSTSHVVLLFFTPPD  710

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP+K L+GF+KV L    +  V F VDVCK LSVVDE GNRKV LG H+LH+G+LKH
Sbjct  711  VHNAPQKHLLGFEKVHLPGKSEAQVRFKVDVCKDLSVVDELGNRKVPLGQHLLHVGNLKH  770

Query  237  SLTVEI  220
             L++ +
Sbjct  771  PLSLRV  776



>ref|XP_002873418.1| beta-xylosidase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49677.1| beta-xylosidase 3 [Arabidopsis lyrata subsp. lyrata]
Length=780

 Score =   210 bits (534),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 135/191 (71%), Gaps = 5/191 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD   GYPGRTYRFYTG T++ FG GLSYT F H I++A
Sbjct  589  PMTWYPQSYVEKVPMTNMNMRPDKSNGYPGRTYRFYTGETVYAFGDGLSYTNFNHQILKA  648

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSA-----LDIHLNVKNVGTVSGGHSVLLF  433
               VSL LD+ H CRS++C+SVDA    C ++       ++ L V+NVG   G H+V LF
Sbjct  649  PKLVSLDLDENHACRSSECQSVDAIGPHCDNAVGGGLNFEVQLKVRNVGDREGSHTVFLF  708

Query  432  SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHI  253
            ++PP +H +PRK L+GF+K+RL   E+ V+ FNVDVCK LSVVDE G RK+ALG ++LH+
Sbjct  709  TTPPEVHGSPRKHLLGFEKIRLGEKEETVIRFNVDVCKDLSVVDEIGKRKIALGHYLLHV  768

Query  252  GHLKHSLTVEI  220
            G  KHSLT+ +
Sbjct  769  GSFKHSLTISV  779



>gb|KHN33504.1| Beta-xylosidase/alpha-L-arabinofuranosidase 1 [Glycine soja]
Length=648

 Score =   208 bits (530),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 131/186 (70%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MR DP TGYPGRTYRFY G T+F FG G+S++   H IV+A
Sbjct  463  PMTWYPQSYVNKVPMTNMNMRADPATGYPGRTYRFYKGETVFSFGDGISFSSIEHKIVKA  522

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L + H CRS++C S+  A++ C + A DIHL VKN G +S  H VLLF +PP 
Sbjct  523  PQLVSVPLAEDHECRSSECMSLGVADEHCQNLAFDIHLGVKNTGKMSTSHVVLLFFTPPD  582

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP+K L+GF+KV L    +  V F VDVCK LSVVDE GNRKV LG H+LH+G+LKH
Sbjct  583  VHNAPQKHLLGFEKVHLPGKSEAQVRFKVDVCKDLSVVDELGNRKVPLGQHLLHVGNLKH  642

Query  237  SLTVEI  220
             L++ +
Sbjct  643  PLSLRV  648



>ref|XP_009112141.1| PREDICTED: beta-D-xylosidase 4-like [Brassica rapa]
Length=776

 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 134/188 (71%), Gaps = 2/188 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD   GYPGRTYRFYTG T++ FG GLSYTKF HS+V+A
Sbjct  589  PMTWYPQSYVEKVPMTNMNMRPDTSNGYPGRTYRFYTGETVYSFGDGLSYTKFSHSLVKA  648

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCAS--SALDIHLNVKNVGTVSGGHSVLLFSSP  424
               VSL L++ H CRS++C+S+DA    C +  S  ++ + V+N G   G H+V LF++P
Sbjct  649  PRVVSLRLEENHVCRSSECQSLDAVGPHCENTVSGFEVQVKVRNGGEREGVHTVFLFTTP  708

Query  423  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  244
            P +H APRK L+GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H LH+G L
Sbjct  709  PEVHGAPRKHLLGFEKIRLGKMEEAVVKFKVDVCKDLSVVDEIGKRKIGLGQHRLHVGDL  768

Query  243  KHSLTVEI  220
            KHSL++ I
Sbjct  769  KHSLSIRI  776



>emb|CDY18705.1| BnaA09g06900D [Brassica napus]
Length=776

 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 134/188 (71%), Gaps = 2/188 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD   GYPGRTYRFYTG T++ FG GLSYTKF HS+V+A
Sbjct  589  PMTWYPQSYVEKVPMTNMNMRPDTSNGYPGRTYRFYTGETVYSFGDGLSYTKFSHSLVKA  648

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCAS--SALDIHLNVKNVGTVSGGHSVLLFSSP  424
               VSL L++ H CRS++C+S+DA    C +  S  ++ + V+N G   G H+V LF++P
Sbjct  649  PRVVSLRLEENHVCRSSECQSLDAVGPHCENTVSGFEVQVKVRNGGEREGVHTVFLFTTP  708

Query  423  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  244
            P +H APRK L+GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H LH+G L
Sbjct  709  PEVHGAPRKHLLGFEKIRLGKMEEAVVKFKVDVCKDLSVVDEIGKRKIGLGQHRLHVGDL  768

Query  243  KHSLTVEI  220
            KHSL++ I
Sbjct  769  KHSLSIRI  776



>gb|KFK28148.1| hypothetical protein AALP_AA8G478800 [Arabis alpina]
Length=779

 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 137/192 (71%), Gaps = 6/192 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD   GYPGRTYRFYTG T++ FG GLSYTKF HS+++A
Sbjct  588  PMTWYPQSYVEKVPMTNMNMRPDKSNGYPGRTYRFYTGETVYAFGDGLSYTKFSHSLIKA  647

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCAS------SALDIHLNVKNVGTVSGGHSVLL  436
               VSL L++ H CRS++C+S+DA    C +      SA ++ + V+N G   G H+V L
Sbjct  648  PKLVSLRLEENHVCRSSECQSLDAIGPHCENADSGNGSAFEVEVKVQNGGEREGIHTVFL  707

Query  435  FSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLH  256
            F++PP +H +PRK L+GF+K+RL   E+ VV F V++CK LSVVDE G RK+ALG H+LH
Sbjct  708  FTTPPDVHGSPRKHLLGFEKIRLGKMEEAVVRFKVEICKDLSVVDEIGKRKIALGKHLLH  767

Query  255  IGHLKHSLTVEI  220
            +G LKHSL++ I
Sbjct  768  VGDLKHSLSIRI  779



>dbj|BAE44362.1| alpha-L-arabinofuranosidase [Raphanus sativus]
Length=780

 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 139/193 (72%), Gaps = 7/193 (4%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD   GYPGRTYRFYTG T++ FG GLSYTKF HS+V+A
Sbjct  588  PMTWYPQSYVEKVPMTNMNMRPDKSNGYPGRTYRFYTGETVYAFGDGLSYTKFSHSLVKA  647

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASS-------ALDIHLNVKNVGTVSGGHSVL  439
               VSL+L++ H CRS++C+S++A    C ++       A ++H+ V+N G   G H+V 
Sbjct  648  PRLVSLSLEENHVCRSSECQSLNAIGPHCDNAVSGTGGKAFEVHIKVQNGGDREGIHTVF  707

Query  438  LFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVL  259
            LF++PPA+H +PRK L+GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H+L
Sbjct  708  LFTTPPAVHGSPRKHLLGFEKIRLGKMEEAVVKFKVDVCKDLSVVDEVGKRKIGLGQHLL  767

Query  258  HIGHLKHSLTVEI  220
            H+G +KHSL++ I
Sbjct  768  HVGDVKHSLSIRI  780



>ref|XP_007148433.1| hypothetical protein PHAVU_006G208200g [Phaseolus vulgaris]
 gb|ESW20427.1| hypothetical protein PHAVU_006G208200g [Phaseolus vulgaris]
Length=775

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 131/186 (70%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MR DP TGYPGRTYRFY G T+F FG GLS++   H IV+A
Sbjct  590  PMTWYPQSYVNKVPMTNMNMRADPATGYPGRTYRFYKGETVFSFGDGLSFSSIDHKIVKA  649

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ L + H CRS++C S+D A++ C + A DIHL VKN+G +S  H VLLF +PP 
Sbjct  650  PQLVSVPLAEDHECRSSECTSLDVADEHCQNLAFDIHLGVKNLGQMSSNHVVLLFFTPPH  709

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HNAP+K L+ F+KV L    +  V F VDVCK LSVVDE GNRKV LG H+LH+G+ KH
Sbjct  710  VHNAPQKHLLAFEKVHLPGKSETQVRFKVDVCKDLSVVDELGNRKVPLGQHLLHVGNFKH  769

Query  237  SLTVEI  220
             ++V +
Sbjct  770  PISVRV  775



>ref|XP_010422951.1| PREDICTED: beta-D-xylosidase 3 isoform X2 [Camelina sativa]
Length=752

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 134/191 (70%), Gaps = 5/191 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD   GYPGRTYRFY G T++ FG  LSYTKF H +++A
Sbjct  562  PMTWYPQSYVEKVPMSNMNMRPDKPNGYPGRTYRFYAGETVYAFGDTLSYTKFDHRLIKA  621

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTC-----ASSALDIHLNVKNVGTVSGGHSVLLF  433
               VSL+LD+ HPCRS++C+S+DA    C       S  ++ LNVKN G   G H+V LF
Sbjct  622  PRLVSLSLDESHPCRSSECQSLDAIGPHCENAVEGGSGFEVQLNVKNAGDREGSHTVFLF  681

Query  432  SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHI  253
            ++PPA+H +P K L+GF+KVRL  NE+ VV F VDVCK LSVVDE G RK+ALG H LH+
Sbjct  682  TTPPAIHGSPIKHLLGFEKVRLGKNEEAVVSFKVDVCKDLSVVDEIGTRKIALGHHHLHV  741

Query  252  GHLKHSLTVEI  220
            G LKHSL + +
Sbjct  742  GSLKHSLNITV  752



>ref|XP_010491611.1| PREDICTED: beta-D-xylosidase 3-like isoform X2 [Camelina sativa]
Length=765

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 136/191 (71%), Gaps = 5/191 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD   GYPGRTYRFY G T++ FG  LSYTKF H +++A
Sbjct  575  PMTWYPQSYVEKVPMSNMNMRPDKPNGYPGRTYRFYAGETVYAFGDTLSYTKFDHRLIKA  634

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTC-----ASSALDIHLNVKNVGTVSGGHSVLLF  433
               VSL+LD+ HPCRS++C+S+DA    C       S +++ LNVKN G   G H+V LF
Sbjct  635  PRLVSLSLDESHPCRSSECQSLDAIGPHCENAVEGESGIEVKLNVKNAGDREGSHTVFLF  694

Query  432  SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHI  253
            ++PPA+H +P K L+GF+KVRL  NE+ VV F VDVCK LSVVDE G RK+ALG ++LH+
Sbjct  695  TTPPAIHGSPIKHLLGFEKVRLRKNEEAVVRFKVDVCKDLSVVDEIGTRKIALGHYLLHV  754

Query  252  GHLKHSLTVEI  220
            G LKHSL + +
Sbjct  755  GSLKHSLNITV  765



>ref|XP_010422950.1| PREDICTED: beta-D-xylosidase 3 isoform X1 [Camelina sativa]
Length=794

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 135/191 (71%), Gaps = 5/191 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD   GYPGRTYRFY G T++ FG  LSYTKF H +++A
Sbjct  604  PMTWYPQSYVEKVPMSNMNMRPDKPNGYPGRTYRFYAGETVYAFGDTLSYTKFDHRLIKA  663

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCAS-----SALDIHLNVKNVGTVSGGHSVLLF  433
               VSL+LD+ HPCRS++C+S+DA    C +     S  ++ LNVKN G   G H+V LF
Sbjct  664  PRLVSLSLDESHPCRSSECQSLDAIGPHCENAVEGGSGFEVQLNVKNAGDREGSHTVFLF  723

Query  432  SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHI  253
            ++PPA+H +P K L+GF+KVRL  NE+ VV F VDVCK LSVVDE G RK+ALG H LH+
Sbjct  724  TTPPAIHGSPIKHLLGFEKVRLGKNEEAVVSFKVDVCKDLSVVDEIGTRKIALGHHHLHV  783

Query  252  GHLKHSLTVEI  220
            G LKHSL + +
Sbjct  784  GSLKHSLNITV  794



>ref|NP_196535.1| beta-xylosidase 3 [Arabidopsis thaliana]
 sp|Q9LXD6.1|BXL3_ARATH RecName: Full=Beta-D-xylosidase 3; Short=AtBXL3; AltName: Full=Alpha-L-arabinofuranosidase; 
Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB89357.1| beta-xylosidase-like protein [Arabidopsis thaliana]
 dbj|BAB09531.1| beta-xylosidase [Arabidopsis thaliana]
 gb|AAK96639.1| AT5g09730/F17I14_80 [Arabidopsis thaliana]
 gb|AED91439.1| beta-xylosidase 3 [Arabidopsis thaliana]
Length=773

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 137/191 (72%), Gaps = 5/191 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD   GYPGR+YRFYTG T++ F   L+YTKF H +++A
Sbjct  583  PMTWYPQSYVEKVPMSNMNMRPDKSKGYPGRSYRFYTGETVYAFADALTYTKFDHQLIKA  642

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTC-----ASSALDIHLNVKNVGTVSGGHSVLLF  433
               VSL+LD+ HPCRS++C+S+DA    C       S  ++HLNVKN G  +G H+V LF
Sbjct  643  PRLVSLSLDENHPCRSSECQSLDAIGPHCENAVEGGSDFEVHLNVKNTGDRAGSHTVFLF  702

Query  432  SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHI  253
            ++ P +H +P KQL+GF+K+RL  +E+ VV FNV+VCK LSVVDE G RK+ALG H+LH+
Sbjct  703  TTSPQVHGSPIKQLLGFEKIRLGKSEEAVVRFNVNVCKDLSVVDETGKRKIALGHHLLHV  762

Query  252  GHLKHSLTVEI  220
            G LKHSL + +
Sbjct  763  GSLKHSLNISV  773



>ref|XP_010491610.1| PREDICTED: beta-D-xylosidase 3-like isoform X1 [Camelina sativa]
Length=779

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 136/191 (71%), Gaps = 5/191 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD   GYPGRTYRFY G T++ FG  LSYTKF H +++A
Sbjct  589  PMTWYPQSYVEKVPMSNMNMRPDKPNGYPGRTYRFYAGETVYAFGDTLSYTKFDHRLIKA  648

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTC-----ASSALDIHLNVKNVGTVSGGHSVLLF  433
               VSL+LD+ HPCRS++C+S+DA    C       S +++ LNVKN G   G H+V LF
Sbjct  649  PRLVSLSLDESHPCRSSECQSLDAIGPHCENAVEGESGIEVKLNVKNAGDREGSHTVFLF  708

Query  432  SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHI  253
            ++PPA+H +P K L+GF+KVRL  NE+ VV F VDVCK LSVVDE G RK+ALG ++LH+
Sbjct  709  TTPPAIHGSPIKHLLGFEKVRLRKNEEAVVRFKVDVCKDLSVVDEIGTRKIALGHYLLHV  768

Query  252  GHLKHSLTVEI  220
            G LKHSL + +
Sbjct  769  GSLKHSLNITV  779



>ref|XP_010452969.1| PREDICTED: beta-D-xylosidase 3-like [Camelina sativa]
Length=779

 Score =   208 bits (530),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 136/191 (71%), Gaps = 5/191 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD   GYPGRTYRFY G T++ FG  LSYT F H +++A
Sbjct  589  PMTWYPQSYVEKVPMSNMNMRPDKPNGYPGRTYRFYAGETVYAFGDTLSYTTFDHRLIKA  648

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCAS-----SALDIHLNVKNVGTVSGGHSVLLF  433
               VSL+LD+ HPCRS++C+S+DA    C +     S  ++ LNVKN G   G H+V LF
Sbjct  649  PRLVSLSLDKSHPCRSSECQSLDAIGPHCENADEGGSGFEVQLNVKNAGDREGSHTVFLF  708

Query  432  SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHI  253
            ++PPA+H +P K L+GF+KVRL  NE+ VV FNVDVCK LSVVDE G RK+ALG H+LH+
Sbjct  709  TTPPAIHGSPIKHLLGFEKVRLGKNEEAVVRFNVDVCKDLSVVDEIGTRKIALGHHLLHV  768

Query  252  GHLKHSLTVEI  220
            G LKHSL + +
Sbjct  769  GSLKHSLNITV  779



>ref|XP_010484241.1| PREDICTED: beta-D-xylosidase 4 [Camelina sativa]
Length=785

 Score =   208 bits (530),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 136/192 (71%), Gaps = 6/192 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD    YPGR+YRFY G T++ FG GLSYTKF HS+V+A
Sbjct  594  PMTWYPQSYVEKVPMTNMNMRPDKANDYPGRSYRFYAGETVYAFGDGLSYTKFSHSLVKA  653

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTC------ASSALDIHLNVKNVGTVSGGHSVLL  436
               VSL L++ H CRS++C+S+DA    C        SA ++H+ V+N G   G H+V L
Sbjct  654  PHLVSLRLEENHVCRSSECQSLDAIGPHCENAVSGGGSAFEVHIKVRNGGDREGIHTVFL  713

Query  435  FSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLH  256
            F++PPA+H +PRK L+GF+KVRL   E+ VV F V+VCK LSVVDE GNRK++LG H+LH
Sbjct  714  FTTPPAVHGSPRKHLLGFEKVRLGKMEEAVVRFKVEVCKDLSVVDEVGNRKISLGKHLLH  773

Query  255  IGHLKHSLTVEI  220
            +G LKH L++ I
Sbjct  774  VGDLKHYLSIRI  785



>gb|KCW63060.1| hypothetical protein EUGRSUZ_G00652 [Eucalyptus grandis]
Length=460

 Score =   202 bits (515),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 133/186 (72%), Gaps = 14/186 (8%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D+V M +M MRPDP TGYPGRTYRFY GPT++ FG GLSY+   HS+VQA
Sbjct  284  PMTWYPQSYVDAVPMTNMNMRPDPATGYPGRTYRFYIGPTVYLFGEGLSYSD-SHSLVQA  342

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
                 + L++             A  +TC++ ALD+HLNVKNVG  SG H+V LFSSPP+
Sbjct  343  PQLAYMPLEE-------------AIGKTCSNLALDVHLNVKNVGRFSGSHTVFLFSSPPS  389

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +H AP+K L+GF+KV L+   +  + F V+VCK LS+VDE G+RKVALG HVLHIG LKH
Sbjct  390  VHRAPQKHLLGFEKVFLASQSEAQLQFKVNVCKDLSLVDELGHRKVALGTHVLHIGDLKH  449

Query  237  SLTVEI  220
            +L+++I
Sbjct  450  ALSMQI  455



>emb|CDX81229.1| BnaC09g06400D [Brassica napus]
Length=776

 Score =   207 bits (527),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 134/188 (71%), Gaps = 2/188 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD   GYPGRTYRFYTG T++ FG GLSYTKF HS+V+A
Sbjct  589  PMTWYPQSYVEKVPMTNMNMRPDTSNGYPGRTYRFYTGETVYAFGDGLSYTKFSHSLVKA  648

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCAS--SALDIHLNVKNVGTVSGGHSVLLFSSP  424
               VSL L + H CRS++C+S+DA    C +  S  ++ + V+N G   G H+V LF++P
Sbjct  649  PRVVSLRLGENHVCRSSECQSLDAVGPHCENTVSGFEVQVKVRNGGDREGIHTVFLFTTP  708

Query  423  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  244
            P +H +PRK L+GF+K+RL   E+ VV F VDVCK L+VVDE G RK+ LG H+LH+G L
Sbjct  709  PEVHGSPRKHLLGFEKIRLGKMEEAVVKFKVDVCKDLNVVDEIGKRKIGLGQHLLHVGDL  768

Query  243  KHSLTVEI  220
            KHSL++ I
Sbjct  769  KHSLSIRI  776



>emb|CDY31313.1| BnaA02g34280D [Brassica napus]
Length=778

 Score =   206 bits (525),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 136/191 (71%), Gaps = 5/191 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD   GYPGRTYRFYTG T++ FG GLSYTKF HS+V+A
Sbjct  588  PMTWYPQSYVEKVPMTNMNMRPDTSNGYPGRTYRFYTGETVYAFGDGLSYTKFSHSLVKA  647

Query  597  QDSV-SLALDQGHPCRSTKCESVDA----AEQTCASSALDIHLNVKNVGTVSGGHSVLLF  433
               V  L L++ H CRS++C+S+DA     E+    +A ++H+ V+N G   G H+V LF
Sbjct  648  PPRVVPLRLEENHVCRSSECQSLDALGPHCEKNAVGTAFEVHVKVRNGGDREGIHTVFLF  707

Query  432  SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHI  253
            ++PP +H +PRK L+GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H+LH+
Sbjct  708  TTPPTVHGSPRKHLLGFEKIRLGKREEAVVKFKVDVCKDLSVVDEVGKRKIGLGQHLLHV  767

Query  252  GHLKHSLTVEI  220
            G LKHSL++ I
Sbjct  768  GDLKHSLSIRI  778



>ref|XP_006280038.1| hypothetical protein CARUB_v10025915mg [Capsella rubella]
 gb|EOA12936.1| hypothetical protein CARUB_v10025915mg [Capsella rubella]
Length=784

 Score =   207 bits (526),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 134/192 (70%), Gaps = 6/192 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD   GYPGR+YRFYTG T++ FG GLSYTKF HS+V+A
Sbjct  593  PMTWYPQSYVEKVPMTNMNMRPDKSNGYPGRSYRFYTGETVYAFGDGLSYTKFSHSLVKA  652

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTC------ASSALDIHLNVKNVGTVSGGHSVLL  436
               VSL L+  H CRS++C+S++A    C        SA ++ + V+N G   G H+V L
Sbjct  653  PRLVSLGLEDNHVCRSSECQSLEATGPHCENAVSGGGSAFEVQIKVRNGGDREGIHTVFL  712

Query  435  FSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLH  256
            F++PPA+H +P+K L+GF+K+RL   E+ VV F V VCK LSVVDE G RK+ LG H+LH
Sbjct  713  FTTPPAVHGSPKKHLLGFEKIRLGKMEEAVVRFKVKVCKDLSVVDEIGKRKIGLGKHLLH  772

Query  255  IGHLKHSLTVEI  220
            +G LKHSL++ I
Sbjct  773  VGDLKHSLSIRI  784



>ref|XP_009130462.1| PREDICTED: beta-D-xylosidase 4-like [Brassica rapa]
Length=778

 Score =   206 bits (525),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 137/191 (72%), Gaps = 5/191 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD   GYPGRTYRFYTG T++ FG G+SYTKF HS+V+ 
Sbjct  588  PMTWYPQSYVEKVPMTNMNMRPDTSNGYPGRTYRFYTGETVYAFGDGISYTKFSHSLVKV  647

Query  597  QDSV-SLALDQGHPCRSTKCESVDA----AEQTCASSALDIHLNVKNVGTVSGGHSVLLF  433
               V  L+L++ H CRS++C+S+DA     E+    +A ++H+ V+N G   G H+V LF
Sbjct  648  PPRVVPLSLEENHVCRSSECQSLDAFGPHCEKKAVGTAFEVHVKVRNGGDREGIHTVFLF  707

Query  432  SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHI  253
            ++PPA+H +PRK L+GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H+LH+
Sbjct  708  TTPPAVHGSPRKHLLGFEKIRLGKREEAVVKFKVDVCKDLSVVDEVGKRKIGLGQHLLHV  767

Query  252  GHLKHSLTVEI  220
            G LKHSL++ I
Sbjct  768  GDLKHSLSIRI  778



>emb|CDY56487.1| BnaCnng30450D [Brassica napus]
Length=791

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 136/193 (70%), Gaps = 7/193 (4%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD   GYPGRTYRFYTG T++ FG GLSYTKF HS+V+A
Sbjct  599  PMTWYPQSYVEKVPMTNMNMRPDNSNGYPGRTYRFYTGETVYAFGDGLSYTKFSHSLVKA  658

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTC-------ASSALDIHLNVKNVGTVSGGHSVL  439
               VSL+L++ H CRS++C+S+ A    C         +A ++ + V+N G   G H+V 
Sbjct  659  PRLVSLSLEENHVCRSSECQSLKAIGPHCDNVVSGTGRTAFEVQIKVQNGGDREGIHTVF  718

Query  438  LFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVL  259
            LF++PPA+H +PRK L+GF+K+RL   E+ VV F VDVCK LSVVDE G RK+ LG H+L
Sbjct  719  LFTTPPAVHGSPRKHLLGFEKIRLGKMEEAVVKFKVDVCKDLSVVDEVGKRKIGLGQHLL  778

Query  258  HIGHLKHSLTVEI  220
            H+G +KHSL++ I
Sbjct  779  HVGDVKHSLSIRI  791



>gb|KFK25272.1| hypothetical protein AALP_AA8G090500 [Arabis alpina]
Length=772

 Score =   206 bits (523),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 132/187 (71%), Gaps = 1/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD   GYPGRTYRFY G T++ FG G+SYT+F H ++++
Sbjct  586  PMTWYPQSYVEKVPMSNMNMRPDESNGYPGRTYRFYAGETVYTFGDGISYTQFHHKLIKS  645

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTC-ASSALDIHLNVKNVGTVSGGHSVLLFSSPP  421
             + VSL LD  H CRS++C+S+DA    C   S  +I L V N G   G H+V LF++PP
Sbjct  646  PNLVSLRLDDNHRCRSSECQSLDAIGSHCEGGSDFEIQLKVANAGDREGSHTVFLFTTPP  705

Query  420  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
            A+H +P K L+GF+K+RL  NE+ VV F V+VCK LSVVDE G RK+ LG HVLH+G+LK
Sbjct  706  AIHRSPIKHLLGFEKIRLVKNEETVVRFKVNVCKDLSVVDETGKRKIGLGEHVLHVGNLK  765

Query  240  HSLTVEI  220
            HSL + +
Sbjct  766  HSLNIRV  772



>emb|CDY46812.1| BnaC02g43200D [Brassica napus]
Length=778

 Score =   206 bits (523),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 136/191 (71%), Gaps = 5/191 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD   GYPGRTYRFYTG T++ FG GLSYTKF HS+V+A
Sbjct  588  PMTWYPQSYVEKVPMTNMNMRPDTSNGYPGRTYRFYTGETVYAFGDGLSYTKFSHSLVKA  647

Query  597  QDSV-SLALDQGHPCRSTKCESVDA----AEQTCASSALDIHLNVKNVGTVSGGHSVLLF  433
               V  L L++ H CRS++C+S+DA     E+    +A ++H+ V+N G   G H+V LF
Sbjct  648  PPRVVPLRLEENHVCRSSECQSLDALGPHCEKNAVGTAFEVHVKVRNGGDREGIHTVFLF  707

Query  432  SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHI  253
            ++PPA+H +PRK L+GF+K+ L   E+ VV F VDVCK LSVVDE G RK+ LG H+LH+
Sbjct  708  TTPPAVHGSPRKHLLGFEKISLGKREEAVVKFKVDVCKDLSVVDEVGKRKIGLGQHLLHV  767

Query  252  GHLKHSLTVEI  220
            G LKHSL++ I
Sbjct  768  GDLKHSLSIRI  778



>ref|XP_009122535.1| PREDICTED: beta-D-xylosidase 3-like [Brassica rapa]
Length=774

 Score =   205 bits (522),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 132/186 (71%), Gaps = 1/186 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  +++ M +M MRPD  TGYPGR+YRFYTG T++ FG G+SYT F H +++ 
Sbjct  590  PMTWYPQSYVENLPMSNMNMRPDNSTGYPGRSYRFYTGETVYAFGDGISYTHFNHRLIKP  649

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VSL L + HPCR++KC+SVDA    C   A+++ L V+N G   G  +V LF++PPA
Sbjct  650  PRLVSLGLAKSHPCRTSKCQSVDATGPYCG-KAIEVELRVRNAGEREGTETVFLFTTPPA  708

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +H +P K LV F+KVRL   E   V FNVDVCK LSVVDE G RK+ALG+HVLH+G LK+
Sbjct  709  VHRSPVKHLVAFEKVRLGKKEKAAVRFNVDVCKDLSVVDENGKRKIALGVHVLHVGSLKY  768

Query  237  SLTVEI  220
            SL V I
Sbjct  769  SLIVRI  774



>emb|CDY01780.1| BnaC06g28200D [Brassica napus]
Length=776

 Score =   205 bits (521),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 129/186 (69%), Gaps = 1/186 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + + M +M MRPD  TGYPGRTYRFYTG T++ FG G+SYT+F H  ++A
Sbjct  592  PTTWYPQSYVEKLPMSNMNMRPDNSTGYPGRTYRFYTGETVYAFGDGISYTQFNHRHIKA  651

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VSL LD  HPCRS+KC+S+DA    C   A ++ L V+N G   G H+V +F SPPA
Sbjct  652  PRLVSLGLDASHPCRSSKCQSLDAVGPYCG-KAFEVQLRVRNAGNREGSHTVFMFMSPPA  710

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +H +P K L+ F+KVR    E  VV F VDVCK LSVVDE G RK+ALG HVLH+G LK+
Sbjct  711  VHRSPVKHLLAFEKVRPGMKEKTVVRFEVDVCKDLSVVDETGKRKIALGKHVLHVGSLKY  770

Query  237  SLTVEI  220
            SL + I
Sbjct  771  SLYITI  776



>emb|CDX69892.1| BnaA10g22410D [Brassica napus]
Length=774

 Score =   204 bits (519),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 131/184 (71%), Gaps = 1/184 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  +++ M +M MRPD  TGYPGR+YRFYTG T++ FG G+SYT F H +++ 
Sbjct  590  PMTWYPQSYVENLPMSNMNMRPDNSTGYPGRSYRFYTGETVYAFGDGISYTHFNHRLIKP  649

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VSL L + HPCR++KC+SVDA    C   A+++ L V+N G   G  +V LF++PPA
Sbjct  650  PRLVSLGLAKSHPCRTSKCQSVDATGPYCG-KAIEVQLRVRNAGEREGTETVFLFTTPPA  708

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +H +P K LV F+KVRL   E   V FNVDVCK LSVVDE G RK+ALG+HVLH+G LK+
Sbjct  709  VHRSPVKHLVAFEKVRLGKKEKAAVRFNVDVCKDLSVVDETGKRKIALGVHVLHVGSLKY  768

Query  237  SLTV  226
            SL V
Sbjct  769  SLIV  772



>gb|EPS65933.1| hypothetical protein M569_08842, partial [Genlisea aurea]
Length=763

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 131/192 (68%), Gaps = 6/192 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS AD+VSM +M MRP     +PGRTYRFYTGPT++ FGYGLSYT+F H I+QA
Sbjct  572  PMTWYPQSYADAVSMTNMNMRPSRSNNFPGRTYRFYTGPTVYPFGYGLSYTQFSHKIIQA  631

Query  597  QDS---VSLALDQGHPCR---STKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLL  436
                  +S+ LDQ HPCR   S+ C S+D+AE    +   D+ L V+N G + G H+VLL
Sbjct  632  PPPPTLISIPLDQKHPCRRRSSSNCTSIDSAEVCNLNLGFDLQLKVRNEGGMGGSHTVLL  691

Query  435  FSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLH  256
            F S P +H+AP K+L+GF K+ L    + V  F +DVC+HLSVVDE G RK+ LG HVLH
Sbjct  692  FVSTPRVHDAPEKRLLGFDKLHLGGWGEGVARFRIDVCEHLSVVDEFGKRKLGLGEHVLH  751

Query  255  IGHLKHSLTVEI  220
            +G  KHS  V I
Sbjct  752  VGGSKHSFNVAI  763



>ref|XP_010444394.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=776

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 134/192 (70%), Gaps = 6/192 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD    YPGR+YRFY G T++ FG GLSYTKF H++V+A
Sbjct  585  PMTWYPQSYVEKVPMTNMNMRPDKSNDYPGRSYRFYAGETVYAFGDGLSYTKFSHTLVKA  644

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTC------ASSALDIHLNVKNVGTVSGGHSVLL  436
               V+L L++ H CRS++C+S+DA    C        SA ++ + V+N G   G H+V L
Sbjct  645  PRLVTLGLEENHVCRSSECQSLDAIGPHCENAVSGGGSAFEVQIKVRNGGDREGIHTVFL  704

Query  435  FSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLH  256
            +++PPA+H +PRK L+GF+KVRL   E+ VV F V+VCK LSVVDE G RK+ LG H+LH
Sbjct  705  YTTPPAVHGSPRKHLLGFEKVRLGKMEEAVVRFRVEVCKDLSVVDEVGKRKIGLGKHLLH  764

Query  255  IGHLKHSLTVEI  220
            +G LKHSL++ I
Sbjct  765  VGDLKHSLSIRI  776



>emb|CAB89360.1| beta-glucosidase-like protein [Arabidopsis thaliana]
 dbj|BAB09525.1| unnamed protein product [Arabidopsis thaliana]
Length=411

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 127/191 (66%), Gaps = 5/191 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD   GY GRTYRFY G T++ FG GLSYT F H +++A
Sbjct  221  PMTWYPQSYVEKVPMTNMNMRPDKSNGYLGRTYRFYIGETVYAFGDGLSYTNFSHQLIKA  280

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCAS-----SALDIHLNVKNVGTVSGGHSVLLF  433
               VSL LD+   CRS +C+S+DA    C       S  ++ L V+NVG   G  +V LF
Sbjct  281  PKFVSLNLDESQSCRSPECQSLDAIGPHCEKAVGERSDFEVQLKVRNVGDREGTETVFLF  340

Query  432  SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHI  253
            ++PP +H +PRKQL+GF+K+RL   E+ VV F VDVCK L VVDE G RK+ALG H+LH+
Sbjct  341  TTPPEVHGSPRKQLLGFEKIRLGKKEETVVRFKVDVCKDLGVVDEIGKRKLALGHHLLHV  400

Query  252  GHLKHSLTVEI  220
            G LKHS  + +
Sbjct  401  GSLKHSFNISV  411



>ref|XP_010461983.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=776

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 132/192 (69%), Gaps = 6/192 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD    YPGR+YRFY G T++ FG GLSYTKF H++V+A
Sbjct  585  PMTWYPQSYVEKVPMTNMNMRPDKANDYPGRSYRFYAGETIYAFGDGLSYTKFSHTLVKA  644

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTC------ASSALDIHLNVKNVGTVSGGHSVLL  436
               VSL L++ H CRS++C+S+DA    C        SA ++ + V+N G   G H+V L
Sbjct  645  PHLVSLRLEENHVCRSSECQSLDAIGPHCENAVSGGGSAFEVQIKVRNGGEREGIHTVFL  704

Query  435  FSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLH  256
            F++PP +H +PRK L+GF+KVRL   E+ VV F V VCK LSVVDE G RK+ LG H+LH
Sbjct  705  FTTPPDVHGSPRKHLLGFEKVRLGKMEEAVVRFKVAVCKDLSVVDEVGKRKIGLGKHLLH  764

Query  255  IGHLKHSLTVEI  220
            +G LKHSL++ I
Sbjct  765  VGDLKHSLSIRI  776



>emb|CDY35825.1| BnaC09g37570D [Brassica napus]
Length=774

 Score =   202 bits (514),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 132/186 (71%), Gaps = 1/186 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ   +S+ M +M MRPD  TGYPGRTYRFYTG T++ FG G+SYT F H +++ 
Sbjct  590  PMTWYPQLYVESLPMSNMNMRPDNSTGYPGRTYRFYTGETIYAFGDGISYTHFNHRLIKP  649

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               V L+L + HPCR++KC+SVDA    C   A+++ L V+N G   G  +V LF++PPA
Sbjct  650  PRLVFLSLAKSHPCRTSKCQSVDAIGPYCG-KAIEVQLRVRNAGEREGTDTVFLFTTPPA  708

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +H +P K L+ F+KVRL   E  VV FNVDVCK LSVVDE G RK+ALG+HVLH+G LK+
Sbjct  709  VHRSPVKHLLAFEKVRLGKKEKAVVRFNVDVCKDLSVVDETGKRKIALGVHVLHVGSLKY  768

Query  237  SLTVEI  220
            SL V I
Sbjct  769  SLIVRI  774



>emb|CBI40687.3| unnamed protein product [Vitis vinifera]
Length=751

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 125/186 (67%), Gaps = 23/186 (12%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPDP +GYPGRTYRFYTG T++ FG GLSYT+F H +   
Sbjct  589  PMTWYPQSYVDKVPMTNMNMRPDPASGYPGRTYRFYTGETIYTFGDGLSYTQFNHHL---  645

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
                                SVDA +++C +   DIHL V N G +SG H+V LFSSPP+
Sbjct  646  --------------------SVDAVQESCQNLVFDIHLRVNNAGNISGSHTVFLFSSPPS  685

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +HN+P+K L+GF+KV ++     +V F VDVCK LS+VDE G RKVALGLHVLH+G+LKH
Sbjct  686  VHNSPQKHLLGFEKVFVTAKAKALVRFKVDVCKDLSIVDELGTRKVALGLHVLHVGNLKH  745

Query  237  SLTVEI  220
            SL V I
Sbjct  746  SLNVRI  751



>ref|XP_010546362.1| PREDICTED: beta-D-xylosidase 4 [Tarenaya hassleriana]
Length=781

 Score =   201 bits (510),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 136/200 (68%), Gaps = 14/200 (7%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD   GYPGRTYRFYTG T++ FG GLS++ F H +V+A
Sbjct  582  PMTWYPQSYVEKVPMTNMNMRPDTSNGYPGRTYRFYTGETVYAFGDGLSFSHFAHQLVKA  641

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCA------------SSALDIHLNVKNVGTVSG  454
               VSL LDQ H CRS+ C+S+DA    C+            S+A ++H+ VKN G   G
Sbjct  642  PRLVSLPLDQTHVCRSSDCQSLDAVGPHCSNAVADPNANASGSAAFEVHMKVKNSGEAEG  701

Query  453  GHSVLLFSSPP--ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKV  280
             H+V LF++PP  ++  +PRK L+GF+KVRL   E++VV F ++VCK LS+VDE G RKV
Sbjct  702  THTVFLFTTPPQSSVRGSPRKHLLGFEKVRLGKEEEKVVRFRIEVCKDLSLVDEFGTRKV  761

Query  279  ALGLHVLHIGHLKHSLTVEI  220
             LG HVLH+G LKHSL+V +
Sbjct  762  VLGEHVLHVGSLKHSLSVRV  781



>emb|CDX97115.1| BnaC09g45100D [Brassica napus]
Length=695

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 132/186 (71%), Gaps = 1/186 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  +++ M +M MR D  TGYPGRTYRFYTG T++ FG G+SY  F H +++ 
Sbjct  511  PMTWYPQSYVENLPMSNMNMRADNSTGYPGRTYRFYTGETVYAFGDGISYIHFNHRLIKP  570

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VSL+L + HPCR++KC+SVDA    C   A+++ L V+N G   G  +V LF++PPA
Sbjct  571  PRLVSLSLAKSHPCRTSKCQSVDAIGPYCG-KAIEVQLRVRNAGEREGTDTVFLFTTPPA  629

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +H +P K L+ F+KVRL   E  VV FNVDVCK LSVVDE G RK+ALG+HVLH+G LK+
Sbjct  630  VHRSPVKHLLAFEKVRLGKEEKAVVRFNVDVCKDLSVVDETGKRKIALGVHVLHVGSLKY  689

Query  237  SLTVEI  220
            SL V I
Sbjct  690  SLIVRI  695



>ref|NP_196532.2| Glycosyl hydrolase family protein [Arabidopsis thaliana]
 gb|AED91435.1| Glycosyl hydrolase family protein [Arabidopsis thaliana]
Length=526

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 127/191 (66%), Gaps = 5/191 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD   GY GRTYRFY G T++ FG GLSYT F H +++A
Sbjct  336  PMTWYPQSYVEKVPMTNMNMRPDKSNGYLGRTYRFYIGETVYAFGDGLSYTNFSHQLIKA  395

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCAS-----SALDIHLNVKNVGTVSGGHSVLLF  433
               VSL LD+   CRS +C+S+DA    C       S  ++ L V+NVG   G  +V LF
Sbjct  396  PKFVSLNLDESQSCRSPECQSLDAIGPHCEKAVGERSDFEVQLKVRNVGDREGTETVFLF  455

Query  432  SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHI  253
            ++PP +H +PRKQL+GF+K+RL   E+ VV F VDVCK L VVDE G RK+ALG H+LH+
Sbjct  456  TTPPEVHGSPRKQLLGFEKIRLGKKEETVVRFKVDVCKDLGVVDEIGKRKLALGHHLLHV  515

Query  252  GHLKHSLTVEI  220
            G LKHS  + +
Sbjct  516  GSLKHSFNISV  526



>ref|XP_009105246.1| PREDICTED: beta-D-xylosidase 3-like [Brassica rapa]
Length=774

 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 130/186 (70%), Gaps = 1/186 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  +++ M +M MRPD  TGYPGR+YRFYTG T++ FG G+SYT+F H +++A
Sbjct  590  PMTWYPQSYVENLPMSNMNMRPDNSTGYPGRSYRFYTGETVYSFGDGISYTQFHHWLIRA  649

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VSL LD  HPCRS+KC SVDA    C  + +++ L V N GT  G H+V LF +PPA
Sbjct  650  PGFVSLGLDPSHPCRSSKCLSVDATGTYCGKT-VEVQLEVINAGTREGSHTVFLFMTPPA  708

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
            +H +P K LV F+K+ L   E  VV F +DVCK LSVVDE G R++ALG +VLH+G L +
Sbjct  709  VHRSPVKHLVTFEKLLLGRTEMAVVRFELDVCKDLSVVDETGKRQIALGEYVLHVGSLTY  768

Query  237  SLTVEI  220
            SL + I
Sbjct  769  SLYITI  774



>emb|CDX96113.1| BnaA07g26180D [Brassica napus]
Length=1013

 Score =   199 bits (506),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 132/186 (71%), Gaps = 1/186 (1%)
 Frame = -1

Query  777   PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
             P TWYPQS  +++ M +M MRPD  TGYPGR+YRFYTG T++ FG G+SYT+F H +++A
Sbjct  829   PMTWYPQSYVENLPMSNMNMRPDNSTGYPGRSYRFYTGETVYSFGDGISYTQFHHWLIRA  888

Query  597   QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
                VSL LD  HPCRS+KC SVDA    C  + +++ L V N GT  G H+V LF +PPA
Sbjct  889   PGFVSLGLDPSHPCRSSKCLSVDATGTYCGKT-VEVQLEVINAGTREGSHTVFLFMTPPA  947

Query  417   LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
             +H +P K LV F+K+ L   E  VV F++DVCK LSVVDE G R++ALG +VLH+G LK+
Sbjct  948   VHRSPVKHLVTFEKLLLGRTEIAVVRFDLDVCKDLSVVDETGKRQIALGEYVLHVGSLKY  1007

Query  237   SLTVEI  220
             SL + I
Sbjct  1008  SLYITI  1013



>ref|XP_010424711.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=780

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 133/190 (70%), Gaps = 6/190 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ   + V M +M MRPD   GYPGRTYRFY G T++ FG+GLSY+ FRH +++A
Sbjct  588  PMTWYPQFYVEKVPMTNMNMRPDKLRGYPGRTYRFYAGETVYAFGHGLSYSNFRHQLLKA  647

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSAL------DIHLNVKNVGTVSGGHSVLL  436
               VSL L++ H C S++C+S+DA    C ++A+      ++ L V N G   G H+V L
Sbjct  648  PKLVSLNLEESHACLSSECQSLDAFGPHCDNNAVGGRLDFEVQLKVTNAGDREGTHTVFL  707

Query  435  FSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLH  256
            F++PP +H +P K L+GF+KVRL  +E+ +V FNVDVCK LSVVDE G RK+ALG H+LH
Sbjct  708  FTTPPEVHGSPVKHLLGFEKVRLGKSEEAMVRFNVDVCKDLSVVDEIGTRKIALGHHLLH  767

Query  255  IGHLKHSLTV  226
            +G LKHSL +
Sbjct  768  VGSLKHSLNI  777



>ref|XP_010491609.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=780

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 135/193 (70%), Gaps = 7/193 (4%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  + V M +M MRPD  +GYPGRTYRFYTG T++ FG+GLSY+ F H +++A
Sbjct  588  PMTWYPQSYVEKVPMTNMNMRPDKLSGYPGRTYRFYTGETVYAFGHGLSYSNFSHQLLKA  647

Query  597  QDSVSLALDQGHPC-RSTKCESVDAAEQTCASSAL------DIHLNVKNVGTVSGGHSVL  439
               VSL L++ H C  S++C+S+DA    C ++A+      ++ L V N G   G H+V 
Sbjct  648  PKLVSLNLEESHACLSSSECQSLDAFGPHCDNNAVGGRLDFEVQLKVTNAGDREGSHTVF  707

Query  438  LFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVL  259
            LF++PP +H +P K L+GF+KVRL  +E+ +V F V+VCK LSVVDE G RK+ALG H+L
Sbjct  708  LFTTPPEVHGSPVKHLLGFEKVRLRKSEEAMVRFKVNVCKDLSVVDEIGTRKIALGHHLL  767

Query  258  HIGHLKHSLTVEI  220
            H+G LKHSL + +
Sbjct  768  HVGSLKHSLNITV  780



>emb|CDP17082.1| unnamed protein product [Coffea canephora]
Length=195

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 121/186 (65%), Gaps = 4/186 (2%)
 Frame = -1

Query  771  TWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQD  592
            TWYPQ    S+ M  M MR DP+ GYPGRTYRFY GP ++ FG+GLSYT F H+I  A  
Sbjct  2    TWYPQDYLSSLPMTTMDMRSDPRKGYPGRTYRFYKGPVVYPFGHGLSYTSFVHTIADAPT  61

Query  591  SVSLALDQGHPCRSTKCES--VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
             VS+ +D GH   +T   S  +      C+  ++ +H++VKNVG + G H++L+FSSPP 
Sbjct  62   VVSIPVD-GHRRWNTSVSSKAIKVTHARCSRLSIGVHVDVKNVGGMDGSHTLLVFSSPPG  120

Query  417  L-HNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
              H AP KQLV F+KV +     + V   + VCK+LSVVD AG R++ +GLH LHIG + 
Sbjct  121  SGHWAPHKQLVAFEKVHVPARAQQRVFLKIHVCKYLSVVDRAGIRRIPMGLHSLHIGPIT  180

Query  240  HSLTVE  223
            HS++++
Sbjct  181  HSISLQ  186



>emb|CDY21595.1| BnaC09g46970D [Brassica napus]
Length=942

 Score =   182 bits (462),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 122/172 (71%), Gaps = 1/172 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  +++ M +M MR D  TGYPGR+YRFYTG T++ FG G+SYT F H +++ 
Sbjct  590  PMTWYPQSYVENLPMSNMNMRADNSTGYPGRSYRFYTGETVYAFGDGISYTHFNHRLIKP  649

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
            Q  VSL L + HPCR++KC+SVDA    C  + +++ L V+N G   G  +V LF++PPA
Sbjct  650  QRLVSLGLAKSHPCRTSKCQSVDATGPYCGKT-IEVELRVRNAGEREGTDTVFLFTTPPA  708

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHV  262
            +H +P K L+ F+KVRL   E  VV FNVDVCK LSVVDE G RK+ALGL++
Sbjct  709  VHRSPVKHLLAFEKVRLGKKEKAVVRFNVDVCKDLSVVDETGKRKIALGLNM  760



>gb|ABK96385.1| unknown [Populus trichocarpa x Populus deltoides]
Length=343

 Score =   173 bits (439),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 120/187 (64%), Gaps = 2/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYP      V M +M MR DP  GYPGRTYRFY GP +F FG+G+SYT F HS+VQA
Sbjct  149  PMTWYPHDYLAKVPMTNMGMRADPSRGYPGRTYRFYKGPVVFPFGHGMSYTTFAHSLVQA  208

Query  597  QDSVSLALDQGHPCRSTKCES--VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSP  424
               VS+ L   H  R+T   S  +  +   C + AL +H++VKN G + G H++L+FSSP
Sbjct  209  PREVSVPLASLHVSRNTTGASNAIRVSHANCEALALGVHIDVKNTGDMDGTHTLLVFSSP  268

Query  423  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  244
            P    + +KQL+GF+KV L     + V  ++ VCKHLSVVD  G R++  G H L+IG L
Sbjct  269  PGGKWSTQKQLIGFEKVHLVTGSQKRVKIDIHVCKHLSVVDRFGIRRIPNGEHYLYIGDL  328

Query  243  KHSLTVE  223
            KHS++++
Sbjct  329  KHSISLQ  335



>ref|XP_010024778.1| PREDICTED: putative beta-D-xylosidase [Eucalyptus grandis]
 gb|KCW61273.1| hypothetical protein EUGRSUZ_H04033 [Eucalyptus grandis]
Length=788

 Score =   177 bits (449),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 125/188 (66%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     V M +M MR +P  GYPGRTYRFY GP ++ FGYG+SYT +RHS+V+A
Sbjct  597  PVTWYPQEYVAKVPMTNMNMRANPAKGYPGRTYRFYKGPVVYPFGYGMSYTSYRHSLVKA  656

Query  597  QDSVSL---ALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS+   +L   +   S     + AA   C +++L IH+N++N G++ G H++L+FS+
Sbjct  657  PTQVSVPVASLSAAYRNSSLLSAGIRAAHVNCNAASLGIHVNIENTGSMDGTHTLLVFSA  716

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PP    +P +QL+GF+KV +S      V  +V VC+HLSVVDE G R++ +G H LH+G 
Sbjct  717  PPEGKWSPARQLIGFEKVHVSAGSQRRVRIDVRVCEHLSVVDEFGIRRIPIGEHKLHVGD  776

Query  246  LKHSLTVE  223
            ++HS+T++
Sbjct  777  VEHSMTLQ  784



>ref|XP_009348894.1| PREDICTED: putative beta-D-xylosidase [Pyrus x bretschneideri]
Length=776

 Score =   176 bits (446),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 119/188 (63%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ+    + M DM MR +P  GYPGRTYRFY GP +F FG GLSYT+F H++ Q 
Sbjct  581  PMTWYPQNYVAKLPMTDMAMRANPARGYPGRTYRFYKGPVVFPFGLGLSYTRFSHTLAQG  640

Query  597  QDSVSLALDQGHPCRSTKC---ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS+ L      ++T       V  +   C S +LDIH++VKN GT+ G H++L+F++
Sbjct  641  PTLVSVPLTSLIATKNTTMLNNNGVRVSHTNCDSLSLDIHVDVKNTGTMDGTHTLLVFAT  700

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PPA   AP KQLVGF KV +    +  V   V VCKHLSVVD+ G R++ LG H L IG 
Sbjct  701  PPAEKWAPNKQLVGFHKVHIVAGSERRVRVGVHVCKHLSVVDKFGIRRIPLGEHKLEIGD  760

Query  246  LKHSLTVE  223
            LKH ++VE
Sbjct  761  LKHHVSVE  768



>ref|XP_009369955.1| PREDICTED: putative beta-D-xylosidase [Pyrus x bretschneideri]
Length=776

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 119/188 (63%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ+    + M DM MR +P  GYPGRTYRFY GP +F FG GLSYT+F H++ Q 
Sbjct  581  PMTWYPQNYVAKLPMTDMAMRANPARGYPGRTYRFYKGPVVFPFGLGLSYTRFSHTLAQG  640

Query  597  QDSVSLALDQGHPCRSTKC---ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS+ L      ++T       V  +   C S +LDIH+++KN GT+ G H++L+F++
Sbjct  641  PTLVSVPLTSLVAAKNTTMLNNNGVRVSYTNCDSLSLDIHVDIKNTGTMDGTHTLLVFAT  700

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PPA   AP KQLVGF KV +    +  V   V VCKHLSVVD+ G R++ LG H L IG 
Sbjct  701  PPAEKWAPNKQLVGFHKVHIVAGLERRVRVGVHVCKHLSVVDKFGIRRIPLGEHKLEIGD  760

Query  246  LKHSLTVE  223
            LKH ++VE
Sbjct  761  LKHHVSVE  768



>ref|XP_002316021.1| beta-D-xylosidase family protein [Populus trichocarpa]
 gb|EEF02192.1| beta-D-xylosidase family protein [Populus trichocarpa]
Length=768

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 122/187 (65%), Gaps = 2/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYP +    V M +M MR DP  GYPGRTYRFY GP +F FG+G+SYT F HS+VQA
Sbjct  574  PMTWYPHNYLAKVPMTNMGMRADPSRGYPGRTYRFYKGPVVFPFGHGMSYTTFAHSLVQA  633

Query  597  QDSVSLALDQGHPCRSTKCES--VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSP  424
               VS+ L   H  R+T   S  +  +   C + AL +H++VKN G + G H++L+FSSP
Sbjct  634  PREVSVPLASLHVSRNTTGASNAIRVSHANCEALALGVHIDVKNTGDMDGTHTLLVFSSP  693

Query  423  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  244
            P    + +KQL+GF+KV L     + V  ++ VCKHLSVVD  G R++ +G H L+IG L
Sbjct  694  PGGKWSTQKQLIGFEKVHLVTGSQKRVKIDIHVCKHLSVVDRFGIRRIPIGEHDLYIGDL  753

Query  243  KHSLTVE  223
            KHS++++
Sbjct  754  KHSISLQ  760



>ref|NP_001280797.1| putative beta-D-xylosidase precursor [Malus domestica]
 gb|ADI79208.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Malus domestica]
Length=774

 Score =   174 bits (442),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 118/188 (63%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ+   ++ M DM MR DP  GYPGRTYRFY GP +F FG GLSYT+F HS+ Q 
Sbjct  579  PMTWYPQNYVANLPMTDMAMRADPARGYPGRTYRFYKGPVVFPFGLGLSYTRFSHSLAQG  638

Query  597  QDSVSLALDQGHPCRSTKC---ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS+        ++T       +  +   C S +LD+H+++KN GT+ G H++L+F++
Sbjct  639  PTLVSVPFTSLVASKNTTMLGNHDIRVSHTNCDSLSLDVHIDIKNSGTMDGTHTLLVFAT  698

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PP    AP KQLVGF KV +    +  V   V VCKHLSVVDE G R++ LG H L IG 
Sbjct  699  PPTGKWAPNKQLVGFHKVHIVAGSERRVRVGVQVCKHLSVVDELGIRRIPLGQHKLEIGD  758

Query  246  LKHSLTVE  223
            L+H ++VE
Sbjct  759  LQHHVSVE  766



>ref|XP_006855294.1| hypothetical protein AMTR_s00057p00049120 [Amborella trichopoda]
 gb|ERN16761.1| hypothetical protein AMTR_s00057p00049120 [Amborella trichopoda]
Length=768

 Score =   174 bits (442),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 122/189 (65%), Gaps = 3/189 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     + M  M MRPDP  GYPGRTYRFYTG T++ FG+G SYTKF  SI QA
Sbjct  577  PMTWYPQEYVTKLPMTSMNMRPDPSKGYPGRTYRFYTGNTVYPFGHGSSYTKFTESIAQA  636

Query  597  QDSVSLALDQGHPC---RSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS+ LD  H C    +  C++V  +   C+   + +H++V N+G + G H V ++S+
Sbjct  637  PSMVSVPLDGKHGCFRNDTVSCQAVRVSHTRCSGLFMSLHIDVNNIGPMDGSHVVFVYST  696

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PP  H AP KQLVGF+++ L  N  +   F++DVC+ LS+VD+ G +K+ +G H+  +G 
Sbjct  697  PPQGHGAPSKQLVGFRRIHLPSNSQQQARFDIDVCRDLSIVDQFGLKKLPIGSHLFQVGE  756

Query  246  LKHSLTVEI  220
            L HS+++++
Sbjct  757  LTHSVSLQL  765



>dbj|BAF79669.1| beta-D-xylosidase [Pyrus pyrifolia]
Length=774

 Score =   174 bits (441),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 119/188 (63%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ+   ++ M DM MR DP  GYPGRTYRFY GP +F FG GLSYT+F HS+ Q 
Sbjct  579  PMTWYPQNYVANLPMTDMAMRADPARGYPGRTYRFYKGPVVFPFGMGLSYTRFSHSLAQG  638

Query  597  QDSVSLALDQGHPCRSTKCES---VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS+ L      ++T   S   V  +   C S +LD H+++KN GT+ G H++L+F++
Sbjct  639  PTLVSVPLTSLVAAKNTTMLSNHGVRVSHTNCDSLSLDFHIDIKNTGTMDGTHTLLVFAT  698

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
             PA   AP KQLVGF KV +    +  V   V VCKHLS+VD+ G R++ LG H L IG 
Sbjct  699  QPAGKWAPNKQLVGFHKVHIVAGSERRVRVGVHVCKHLSIVDKLGIRRIPLGQHKLEIGD  758

Query  246  LKHSLTVE  223
            LKH +++E
Sbjct  759  LKHYVSIE  766



>dbj|BAD98523.1| alpha-L-arabinofuranosidase / beta-D-xylosidase [Pyrus pyrifolia]
Length=774

 Score =   174 bits (440),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 119/188 (63%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ+   ++ M DM MR DP  GYPGRTYRFY GP +F FG GLSYT+F HS+ Q 
Sbjct  579  PMTWYPQNYVANLPMTDMAMRADPARGYPGRTYRFYKGPVVFPFGMGLSYTRFSHSLAQG  638

Query  597  QDSVSLALDQGHPCRSTKCES---VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS+ L      ++T   S   V  +   C S +LD H+++KN GT+ G H++L+F++
Sbjct  639  PTLVSVPLTSLVAAKNTTMLSNHGVRVSHTNCDSLSLDFHIDIKNTGTMDGTHTLLVFAT  698

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
             PA   AP KQLVGF KV +    +  V   V VCKHLS+VD+ G R++ LG H L IG 
Sbjct  699  QPAGKWAPNKQLVGFHKVHIVAGSERRVRVGVHVCKHLSIVDKLGIRRIPLGQHKLEIGD  758

Query  246  LKHSLTVE  223
            LKH +++E
Sbjct  759  LKHYVSIE  766



>gb|AGR44452.1| alpha-L-arabinofuranosidase/beta-D-xylosidase 2 [Pyrus x bretschneideri]
Length=774

 Score =   174 bits (440),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 119/188 (63%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ+   ++ M DM MR DP  GYPGRTYRFY GP +F FG GLSYT+F HS+ Q 
Sbjct  579  PMTWYPQNYVANLPMTDMAMRADPARGYPGRTYRFYKGPVVFPFGLGLSYTRFSHSLAQG  638

Query  597  QDSVSLALDQGHPCRSTKCES---VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS+ L      ++T   S   V  +   C S +LD H+++KN GT+ G H++L+F++
Sbjct  639  PTLVSVPLTSLVAAKNTTMLSNHGVRVSHTNCDSLSLDFHIDIKNTGTMDGTHTLLVFAT  698

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
             PA   AP KQLVGF KV +    +  V   V VCKHLS+VD+ G R++ LG H L IG 
Sbjct  699  QPAGKWAPNKQLVGFHKVHIVAGSERRVRVGVHVCKHLSIVDKLGIRRIPLGQHKLEIGD  758

Query  246  LKHSLTVE  223
            LKH +++E
Sbjct  759  LKHYVSIE  766



>ref|XP_008353169.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=774

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 117/188 (62%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ+   ++ M DM MR DP  GYPGRTYRFY GP +F FG GLSYT+F HS+ Q 
Sbjct  579  PMTWYPQNYVANLPMTDMAMRADPARGYPGRTYRFYKGPVVFPFGLGLSYTRFSHSLAQG  638

Query  597  QDSVSLALDQGHPCRSTKCE---SVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS+        ++T       +  +   C S +LD+H+++KN GT+ G H++L+F++
Sbjct  639  PTLVSVXFTSLVASKNTTMXGNHDIRVSHTNCDSLSLDVHIDIKNSGTMDGTHTLLVFAT  698

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PP    AP KQLVGF KV +    +  V   V VCKHLSVVD  G R++ LG H L IG 
Sbjct  699  PPTGKWAPNKQLVGFHKVHIVAGSERRVRVGVQVCKHLSVVDXXGIRRIPLGQHKLEIGD  758

Query  246  LKHSLTVE  223
            L+H ++VE
Sbjct  759  LQHHVSVE  766



>ref|XP_008390557.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=776

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 118/188 (63%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ+    + M DM MR +P  GYPGRTYRFY GP +F FG GLSYT+F +++ Q 
Sbjct  581  PMTWYPQNYVAKLPMTDMAMRANPARGYPGRTYRFYKGPVVFPFGLGLSYTRFSYTLAQG  640

Query  597  QDSVSLALDQGHPCRSTKC---ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS+ L      ++T       V  +   C S +LDIH++VKN GT+ G H++L+F +
Sbjct  641  PTLVSVPLTSLVAAKNTTMLNNNGVRVSHINCDSLSLDIHVDVKNTGTMDGTHTLLVFVT  700

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PPA   AP KQLVGF KV +    +  V   V VCKHLSVVD+ G R++ LG H L IG 
Sbjct  701  PPAEKWAPNKQLVGFHKVHIVAGSERRVRVGVHVCKHLSVVDKFGIRRIPLGEHKLEIGD  760

Query  246  LKHSLTVE  223
            LKH ++VE
Sbjct  761  LKHHVSVE  768



>ref|XP_011009934.1| PREDICTED: putative beta-D-xylosidase [Populus euphratica]
Length=767

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 120/187 (64%), Gaps = 2/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYP      V M +M +R DP  GYPGRTYRFY GP +F FG+G+SYT F HS+VQA
Sbjct  573  PMTWYPHDYLAKVPMTNMGLRADPSRGYPGRTYRFYKGPVVFPFGHGMSYTTFAHSLVQA  632

Query  597  QDSVSLALDQGHPCRSTKCES--VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSP  424
               VS+ L   H  R+T   S  +  +   C + AL +H++VKN G + G H++L+FSSP
Sbjct  633  PREVSVPLASLHVSRNTTGASNAIRVSHANCEALALGVHIDVKNTGDMDGTHTLLVFSSP  692

Query  423  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  244
            P    + +KQL+GF+KV L     + V  ++ VCKHLSVVD  G R++ +G H L+IG L
Sbjct  693  PGGKWSTQKQLIGFEKVHLVTGSQKRVKIDIHVCKHLSVVDRFGIRRIPIGEHDLYIGDL  752

Query  243  KHSLTVE  223
            KHS+++ 
Sbjct  753  KHSISLR  759



>emb|CDO98788.1| unnamed protein product [Coffea canephora]
Length=770

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 118/187 (63%), Gaps = 2/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     V M DM MRPDP  GYPGRTYRFY GP +F FG+GLSYT F+ ++  A
Sbjct  576  PMTWYPQDYVVKVPMTDMGMRPDPSRGYPGRTYRFYKGPVVFPFGFGLSYTAFKVALAHA  635

Query  597  QDSVSLALDQGHPCRSTKC--ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSP  424
              +V + L   +  ++     ++V  +   C +  L +H +V+NVG   G HS+L+FS+P
Sbjct  636  PTTVPVTLASNYAFKNVTLLKDAVRVSHSNCDAMKLGMHFDVQNVGERDGSHSLLVFSTP  695

Query  423  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  244
            PA   AP KQLV F+KV +     + +  + D CKHLSVVD  G R++ +G+H L IG L
Sbjct  696  PAGKWAPAKQLVAFEKVHVLAGAQQRISVHFDACKHLSVVDRFGIRRIPMGVHSLQIGDL  755

Query  243  KHSLTVE  223
            +H++T++
Sbjct  756  EHAITLQ  762



>ref|XP_008341125.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=776

 Score =   171 bits (433),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 119/188 (63%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ+    + M DM MR +P  GYPGRTYRFY GP +F FG GLSYT+F +++ Q 
Sbjct  581  PMTWYPQNYVAKLPMTDMAMRANPARGYPGRTYRFYKGPVVFPFGLGLSYTRFSYTLAQG  640

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQT---CASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS+ L      ++T   + +    +   C S +LDIH++VKN GT+ G H++L+F +
Sbjct  641  PTLVSVPLTSLVAAKNTTMLNNNGXRVSHINCDSLSLDIHVDVKNTGTMDGTHTLLVFVT  700

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PPA   AP KQLVGF KV +    +  V   V VCKHLSVVD+ G R++ LG H L IG 
Sbjct  701  PPAEKWAPNKQLVGFHKVHIVAGSERRVRVGVHVCKHLSVVDKFGIRRIPLGEHKLEIGD  760

Query  246  LKHSLTVE  223
            LKH ++VE
Sbjct  761  LKHHVSVE  768



>ref|XP_011020382.1| PREDICTED: putative beta-D-xylosidase [Populus euphratica]
Length=768

 Score =   170 bits (431),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 118/187 (63%), Gaps = 2/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     V M +M MR DP  GYPGRTYRFY GP LF FG+G+SYT F HS+VQA
Sbjct  574  PMTWYPQGYLAKVPMTNMGMRADPSRGYPGRTYRFYKGPVLFPFGHGMSYTTFAHSLVQA  633

Query  597  QDSVSLALDQGHPCRSTKC--ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSP  424
               V++     +  ++T     S+  +   C    L +H++VKN G + G H++L+FSSP
Sbjct  634  PQEVAVPFTSLYALQNTTAARNSIRVSHANCEPLVLGVHIDVKNAGDMDGTHTLLVFSSP  693

Query  423  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  244
            P    +  K+L+GF+KV L     + V  ++ VCKHLSVVD  G R++ +G H LHIG L
Sbjct  694  PEGKWSTNKKLIGFEKVHLVAGSKKRVKIDIPVCKHLSVVDRFGIRRLPIGKHDLHIGDL  753

Query  243  KHSLTVE  223
            KHS++++
Sbjct  754  KHSISLQ  760



>gb|KDP27887.1| hypothetical protein JCGZ_18967 [Jatropha curcas]
Length=775

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 119/187 (64%), Gaps = 2/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS    V M +M MR DP TGYPGRTYRFY GP +F FG+G+SYT F HS+ QA
Sbjct  581  PMTWYPQSYIAKVPMTNMGMRADPSTGYPGRTYRFYKGPVVFPFGHGMSYTSFSHSLSQA  640

Query  597  QDSVSLALDQGHPCRSTKC--ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSP  424
               +SL +      ++T     ++  +   C S  L + L+VKN G+V G  ++L+FSSP
Sbjct  641  PKQLSLPITSLSALKNTTGLNNAIRVSHTNCESLLLGLDLDVKNTGSVDGTQTLLVFSSP  700

Query  423  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  244
            P    +  KQL+GF+K+ L     + V  N+ VCKHLSVVD  G R++ +G H LHIG L
Sbjct  701  PEGKWSSNKQLIGFEKIHLVAGSQKQVRINIHVCKHLSVVDRFGIRRIPIGKHHLHIGDL  760

Query  243  KHSLTVE  223
            KHS++++
Sbjct  761  KHSISLQ  767



>ref|XP_010652235.1| PREDICTED: probable beta-D-xylosidase 2 isoform X2 [Vitis vinifera]
Length=626

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 118/185 (64%), Gaps = 1/185 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     V M  M MR  P   YPGRTYRFY GP +++FG+GLSYT F H+I QA
Sbjct  434  PMTWYPQEYLSKVPMTTMAMRAIPSKAYPGRTYRFYKGPVVYRFGHGLSYTNFVHTIAQA  493

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
              +V++ L  GH   +   +++      C   ++ +HL+VKNVG   G H++L+FS PPA
Sbjct  494  PTAVAIPL-HGHHNTTVSGKAIRVTHAKCNRLSIALHLDVKNVGNKDGSHTLLVFSKPPA  552

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
             H AP KQLV F+KV ++    + V  N+ VCK+LSVVD +G R++ +G H LHIG  KH
Sbjct  553  GHWAPHKQLVAFEKVHVAARTQQRVQINIHVCKYLSVVDRSGIRRIPMGQHGLHIGDTKH  612

Query  237  SLTVE  223
             ++++
Sbjct  613  LVSLQ  617



>ref|XP_010094323.1| Beta-D-xylosidase 1 [Morus notabilis]
 gb|EXB55743.1| Beta-D-xylosidase 1 [Morus notabilis]
Length=783

 Score =   169 bits (427),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 90/189 (48%), Positives = 119/189 (63%), Gaps = 4/189 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS   +V M  M MR +P  GYPGRTYRFY GP +F FGYGLSYT F H + QA
Sbjct  587  PMTWYPQSYLANVPMTSMDMRANPTRGYPGRTYRFYKGPVVFPFGYGLSYTTFVHKLAQA  646

Query  597  QDSVSLALDQGHPCRSTKC---ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS+ + + H   +      ++V      C S +L IH++V+N G   G H++L+FS+
Sbjct  647  PTQVSIPIARLHASSANSTSLSKAVRVTHTDCNSLSLRIHIDVENNGPTDGTHTLLIFST  706

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIG-  250
            PP    A  KQLVGFQKV L+    + V+  V VCKHLS+VD+ G R++ +G H LHIG 
Sbjct  707  PPTHKWAAHKQLVGFQKVHLAAGSRQRVILGVHVCKHLSIVDQFGIRRIPMGEHTLHIGD  766

Query  249  HLKHSLTVE  223
             LKHS++ +
Sbjct  767  DLKHSISFQ  775



>ref|XP_002270249.1| PREDICTED: probable beta-D-xylosidase 2 isoform X1 [Vitis vinifera]
 emb|CBI36935.3| unnamed protein product [Vitis vinifera]
Length=768

 Score =   168 bits (426),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 118/185 (64%), Gaps = 1/185 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     V M  M MR  P   YPGRTYRFY GP +++FG+GLSYT F H+I QA
Sbjct  576  PMTWYPQEYLSKVPMTTMAMRAIPSKAYPGRTYRFYKGPVVYRFGHGLSYTNFVHTIAQA  635

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
              +V++ L  GH   +   +++      C   ++ +HL+VKNVG   G H++L+FS PPA
Sbjct  636  PTAVAIPL-HGHHNTTVSGKAIRVTHAKCNRLSIALHLDVKNVGNKDGSHTLLVFSKPPA  694

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
             H AP KQLV F+KV ++    + V  N+ VCK+LSVVD +G R++ +G H LHIG  KH
Sbjct  695  GHWAPHKQLVAFEKVHVAARTQQRVQINIHVCKYLSVVDRSGIRRIPMGQHGLHIGDTKH  754

Query  237  SLTVE  223
             ++++
Sbjct  755  LVSLQ  759



>ref|XP_010520456.1| PREDICTED: LOW QUALITY PROTEIN: beta-D-xylosidase 4 [Tarenaya 
hassleriana]
Length=750

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 119/187 (64%), Gaps = 8/187 (4%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS  D V M +M MRPD   GYPGRTYRFY+G T++ FG GLS+T F H +V+A
Sbjct  571  PMTWYPQSYVDKVPMNNMNMRPDGANGYPGRTYRFYSGETVYAFGDGLSFTNFIHQLVEA  630

Query  597  QDSVSLALDQGHPC-RSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPP  421
               VSL L   H C  S  C+++DA    CA++  D +       T SG   V     P 
Sbjct  631  PRLVSLPLPPTHSCVSSADCQTLDAVGPHCANTNADAN------ATCSGAFDVXT-PPPS  683

Query  420  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
            A+  +PRK L+GF+KVRL   E+ VV F V+VCK LSVVDEAG RK+ LG HVL +G+LK
Sbjct  684  AVKGSPRKHLLGFEKVRLGKGEEAVVRFRVEVCKDLSVVDEAGKRKIVLGDHVLRVGNLK  743

Query  240  HSLTVEI  220
            HSL + +
Sbjct  744  HSLKIRV  750



>ref|XP_007035744.1| Periplasmic beta-glucosidase, putative [Theobroma cacao]
 gb|EOY06670.1| Periplasmic beta-glucosidase, putative [Theobroma cacao]
Length=776

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 119/188 (63%), Gaps = 5/188 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     V M +M MRP    GYPGRTYRFY GP +F FG+G+SYT F+HS+ QA
Sbjct  583  PMTWYPQDYVAKVPMTNMGMRP--SRGYPGRTYRFYKGPVVFPFGHGMSYTTFKHSLAQA  640

Query  597  QDSVSLALDQGHPCRSTKCESVDAAE---QTCASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               +S+ L+      +    S +A       C S +L  H++V+N GT+ G H++L+FS+
Sbjct  641  PTELSVPLNTNLYATTNSTFSSNAVRVKHANCDSLSLPFHIDVQNTGTIDGTHTLLVFST  700

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PPA   +P KQL+GF +V +     + V  N+  CKHLS+VDE G R++ +G H LHIG 
Sbjct  701  PPAGKWSPNKQLIGFHRVHVLAGSQQRVEINIHACKHLSIVDELGIRRIPMGAHSLHIGD  760

Query  246  LKHSLTVE  223
            L+HS++++
Sbjct  761  LEHSISLQ  768



>dbj|BAJ51947.1| putative beta-D-xylosidase [Glycyrrhiza uralensis]
Length=285

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 118/191 (62%), Gaps = 3/191 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ+    V M +M MRP+P TGYPGRTYRFY GP +F FG+GLSYT+F HS+  A
Sbjct  91   PMTWYPQNYLAKVPMTNMDMRPNPATGYPGRTYRFYKGPVVFPFGHGLSYTRFTHSLAIA  150

Query  597  --QDSVSLALDQGHPCRS-TKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS  427
              Q SV  A  Q     + +  ++V  +   C +  +  H++VKN G++ G +++L+FS 
Sbjct  151  PKQVSVPFATLQAFTNSTVSTSKAVRVSHANCDAMEVGFHVDVKNEGSMDGTNTLLVFSK  210

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PP    +  KQLV F K  +     + V   V VCKHLSVVDE G R++ +G H L IG 
Sbjct  211  PPPGKWSATKQLVSFHKTYVPAGSKQRVKVGVHVCKHLSVVDEFGIRRIPMGEHELQIGD  270

Query  246  LKHSLTVEI*E  214
            LKHS++V+  E
Sbjct  271  LKHSISVQTQE  281



>ref|XP_002519194.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
 gb|EEF43058.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
Length=782

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 115/186 (62%), Gaps = 1/186 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     V M +M MRPDP TGYPGRTYRFY G  +F FG+G+SYT F HS+ QA
Sbjct  589  PMTWYPQGYLAKVPMTNMGMRPDPATGYPGRTYRFYKGNVVFPFGHGMSYTSFSHSLTQA  648

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VSL +   +   +T              ++L I +NVKN GT+ G H++L+FSSPP+
Sbjct  649  PKEVSLPITNLYALNTTISSKAIRVSHINCQTSLGIDINVKNTGTMDGTHTLLVFSSPPS  708

Query  417  LH-NAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
                +  KQL+GF+KV L       V  ++ VCKHLS VD  G R++ +G H ++IG LK
Sbjct  709  GEKESSNKQLIGFEKVDLVAGSQIQVKIDIHVCKHLSAVDRFGIRRIPIGDHHIYIGDLK  768

Query  240  HSLTVE  223
            HS++++
Sbjct  769  HSISLQ  774



>ref|XP_011082425.1| PREDICTED: probable beta-D-xylosidase 2 [Sesamum indicum]
Length=791

 Score =   166 bits (420),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 117/187 (63%), Gaps = 2/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ   D++ M  M MR DP   YPGRTYRFY GP ++ FG+G+SYT F H+I  A
Sbjct  596  PMTWYPQEYLDNLPMTTMDMRADPSRNYPGRTYRFYKGPVVYPFGHGMSYTSFVHTIADA  655

Query  597  QDSVSLALDQGHPCRSTKCE--SVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSP  424
              + S+ +D  H   +T     S+      C   AL +H++VKN G+  G H++L+FSSP
Sbjct  656  PKAFSVPVDGRHHSNTTTVSSMSIRVNHAKCERLALRVHVDVKNTGSRDGSHTLLVFSSP  715

Query  423  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  244
            P    AP+KQLV F+KV +     + +  ++ VCK+LSVVD  G R++ +G H LHIG  
Sbjct  716  PGGDWAPQKQLVAFEKVSVRAGGQQRIGVSIRVCKYLSVVDRFGVRRIPMGEHGLHIGDA  775

Query  243  KHSLTVE  223
            +H++++E
Sbjct  776  RHAVSLE  782



>ref|XP_002311398.2| beta-D-xylosidase family protein [Populus trichocarpa]
 gb|EEE88765.2| beta-D-xylosidase family protein [Populus trichocarpa]
Length=771

 Score =   165 bits (418),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 117/187 (63%), Gaps = 2/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     V M +M MR DP  GYPGRTYRFY GP +F FG+G+SYT F HS+VQA
Sbjct  577  PMTWYPQDYLAKVPMTNMGMRADPSRGYPGRTYRFYKGPVVFPFGHGMSYTTFAHSLVQA  636

Query  597  QDSVSLALDQGHPCRSTKC--ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSP  424
               V++     +  ++T     S+  +   C    L +H++VKN G + G  ++L+FSSP
Sbjct  637  PQEVAVPFTSLYALQNTTAARNSIRVSHANCEPLVLGVHIDVKNTGDMDGIQTLLVFSSP  696

Query  423  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  244
            P    +  K+L+GF+KV +     + V  ++ VCKHLSVVD  G R++ +G H LHIG L
Sbjct  697  PEGKWSANKKLIGFEKVHIVAGSKKRVKIDIPVCKHLSVVDRFGIRRLPIGKHDLHIGDL  756

Query  243  KHSLTVE  223
            KHS++++
Sbjct  757  KHSISLQ  763



>gb|KCW61272.1| hypothetical protein EUGRSUZ_H04033 [Eucalyptus grandis]
Length=749

 Score =   165 bits (417),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 121/183 (66%), Gaps = 3/183 (2%)
 Frame = -1

Query  762  PQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQAQDSVS  583
            P+     V M +M MR +P  GYPGRTYRFY GP ++ FGYG+SYT +RHS+V+A   VS
Sbjct  563  PREYVAKVPMTNMNMRANPAKGYPGRTYRFYKGPVVYPFGYGMSYTSYRHSLVKAPTQVS  622

Query  582  L---ALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPALH  412
            +   +L   +   S     + AA   C +++L IH+N++N G++ G H++L+FS+PP   
Sbjct  623  VPVASLSAAYRNSSLLSAGIRAAHVNCNAASLGIHVNIENTGSMDGTHTLLVFSAPPEGK  682

Query  411  NAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKHSL  232
             +P +QL+GF+KV +S      V  +V VC+HLSVVDE G R++ +G H LH+G ++HS+
Sbjct  683  WSPARQLIGFEKVHVSAGSQRRVRIDVRVCEHLSVVDEFGIRRIPIGEHKLHVGDVEHSM  742

Query  231  TVE  223
            T++
Sbjct  743  TLQ  745



>ref|XP_010914548.1| PREDICTED: probable beta-D-xylosidase 2 [Elaeis guineensis]
Length=772

 Score =   165 bits (417),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 116/187 (62%), Gaps = 3/187 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ   D V M +M MR DP  GYPGR+YRFYTGP +F +G+GLSYTKF HS+  A
Sbjct  579  PVTWYPQQFVDKVPMTNMAMRADPARGYPGRSYRFYTGPVVFPYGHGLSYTKFTHSLAHA  638

Query  597  QDSVSLALDQGHPCRSTKCE---SVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               +S+ LD          E   +V  +   C   A+ +H++VKNVG   G H+VL++S+
Sbjct  639  PAQISVQLDGRRASAHNSTEPGRAVRVSHARCDGLAIPVHVDVKNVGDQDGSHTVLVYST  698

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PP    AP+KQLV F+KV ++      V F VDVC+ LS  DE G R++ +G H L IG 
Sbjct  699  PPGTRWAPQKQLVAFEKVHVAVGGQVRVKFGVDVCRDLSFADEYGIRRIPIGEHSLQIGD  758

Query  246  LKHSLTV  226
            L H++++
Sbjct  759  LIHTISL  765



>ref|XP_008458374.1| PREDICTED: LOW QUALITY PROTEIN: beta-D-xylosidase 1-like [Cucumis 
melo]
Length=768

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 115/185 (62%), Gaps = 3/185 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS    V M +M +RPDP TGYPGRTYRFY GP +F FG+GLSY+KF HSI +A
Sbjct  577  PMTWYPQSYLAKVPMTNMGLRPDPSTGYPGRTYRFYKGPVVFPFGFGLSYSKFSHSIAEA  636

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCAS-SALDIHLNVKNVGTVSGGHSVLLFSSPP  421
               +SL L            +V  +   CAS S L I ++VKN GTV G H++L+FS+ P
Sbjct  637  PTKISLPLSSLS--XPNSSAAVKVSHTDCASVSDLPIQVDVKNTGTVDGSHTILVFSTAP  694

Query  420  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
                +P K L+GF+KV L     + V   + VC HLS VDE G R++  G H LHIG L 
Sbjct  695  NPIWSPEKHLIGFEKVHLMAGSQKRVRIGIHVCDHLSRVDEFGTRRIPTGEHKLHIGDLT  754

Query  240  HSLTV  226
            HS+++
Sbjct  755  HSISL  759



>ref|XP_010087253.1| putative beta-D-xylosidase 2 [Morus notabilis]
 gb|EXB28603.1| putative beta-D-xylosidase 2 [Morus notabilis]
Length=779

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 121/190 (64%), Gaps = 5/190 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ    ++ M  M MR  P   YPGRTYRFY GP ++ FGYGLSY+KF HSI +A
Sbjct  581  PMTWYPQDYISNLPMTAMDMRSSPSKNYPGRTYRFYKGPVVYPFGYGLSYSKFVHSIAEA  640

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQT---CASSALDIHLNVKNVGTVSGGHSVLLFSS  427
                S+ +D     ++T   S  A   T   C   +L +H++VKNVG+  G H++L+FS+
Sbjct  641  PTVFSVPIDGHRKAQNTSTISNKAIRVTHTRCNRLSLGLHVDVKNVGSRDGSHTLLVFST  700

Query  426  PPAL--HNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHI  253
            PP    H AP KQLV FQKVR++    + V  ++ VCK+LSVVD +G R++ +G H +HI
Sbjct  701  PPTENGHWAPLKQLVAFQKVRVAAGSQQRVRISIHVCKYLSVVDRSGIRRLPMGEHNIHI  760

Query  252  GHLKHSLTVE  223
            G  +HS++++
Sbjct  761  GDARHSVSLQ  770



>ref|XP_004172482.1| PREDICTED: beta-D-xylosidase 1-like, partial [Cucumis sativus]
Length=534

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 115/186 (62%), Gaps = 4/186 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS    V M +M +RPDP TGYPGRTYRFY GP +F FG+GLSY+KF  S  +A
Sbjct  344  PMTWYPQSYLAKVPMTNMGLRPDPSTGYPGRTYRFYKGPVVFPFGFGLSYSKFSQSFAEA  403

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCAS-SALDIHLNVKNVGTVSGGHSVLLFSSPP  421
               +SL L            +V  +   CAS S L I ++VKN GTV G H++L+FS+ P
Sbjct  404  PTKISLPLSS---LSPNSSATVKVSHTDCASVSDLPIMIDVKNTGTVDGSHTILVFSTVP  460

Query  420  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
                +P K L+GF+KV L     + V   + VC HLS VDE G R++ +G H LHIG L 
Sbjct  461  NQTWSPEKHLIGFEKVHLIAGSQKRVRIGIHVCDHLSRVDEFGTRRIPMGEHKLHIGDLT  520

Query  240  HSLTVE  223
            HS++++
Sbjct  521  HSISLQ  526



>gb|KDO71842.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
Length=369

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 124/189 (66%), Gaps = 6/189 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     + M DMRMR     GYPGRTYRFY GP +F FG+G+SYT F H++ +A
Sbjct  175  PMTWYPQDYVSRLPMTDMRMRA--ARGYPGRTYRFYKGPVVFPFGHGMSYTTFAHTLSKA  232

Query  597  QDSVSLALDQG-HPCRSTKCES--VDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFS  430
             +  S+ +    +  ++T   S  +  A   C  + +L +H+++KN G ++G H++L+F+
Sbjct  233  PNQFSVPIATSLYAFKNTTISSNAIRVAHTNCNDAMSLGLHVDIKNTGDMAGTHTLLVFA  292

Query  429  SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIG  250
             PPA + +P KQL+GF+KV ++    + V  ++ VCKHLSVVD+ G R++ +G H LHIG
Sbjct  293  KPPAGNWSPNKQLIGFKKVHVTAGALQSVRLDIHVCKHLSVVDKFGIRRIPMGEHSLHIG  352

Query  249  HLKHSLTVE  223
             LKHS++++
Sbjct  353  DLKHSISLQ  361



>dbj|BAO45878.1| beta-D-xylosidase [Acacia mangium]
Length=763

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 114/186 (61%), Gaps = 1/186 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYP      V M  M MRP+P TGYPGRTYRFY GP +F FGYGLSYT+F H++ QA
Sbjct  575  PMTWYPHEYVTKVPMTTMDMRPNPATGYPGRTYRFYKGPVVFPFGYGLSYTRFTHTLAQA  634

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFSSPP  421
               VSL+  Q     +   +++  +   C  +  L  H++VKN G + G H++L++S PP
Sbjct  635  PKEVSLSRLQALTNSTISNQAMRLSHVDCNKAPELGFHIDVKNEGPMDGAHTLLVYSKPP  694

Query  420  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
            +   +  K+LVGF +V +     + V   +  C+HLSVVD  G R++  G H LHIG +K
Sbjct  695  SGRWSETKRLVGFHRVHVPSGSKQRVKIGIHACEHLSVVDMFGIRRIPFGEHELHIGDIK  754

Query  240  HSLTVE  223
            HSL+V+
Sbjct  755  HSLSVQ  760



>ref|XP_006349198.1| PREDICTED: probable beta-D-xylosidase 2-like [Solanum tuberosum]
Length=774

 Score =   163 bits (412),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 120/187 (64%), Gaps = 2/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ    ++ M  M MR +   GYPGRTYRFY GP ++ FG+GLSYTKF  +I +A
Sbjct  579  PMTWYPQEYLKNLPMTTMDMRSNLAKGYPGRTYRFYKGPLVYPFGHGLSYTKFITTIFEA  638

Query  597  QDSVSLALDQGHPCRSTKC--ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSP  424
              ++++ +D  H   S+    +S+      C+  ++ IH++VKNVG   G H++L+FS P
Sbjct  639  PKTLAIPIDGRHTSNSSTITNKSIRVTHTKCSKLSIQIHIDVKNVGPKDGSHTLLVFSKP  698

Query  423  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  244
            P     P KQLV FQKV +     + V  N+ VCK+LSVVD+AG R++++G H +HIG  
Sbjct  699  PVDVWVPHKQLVAFQKVYVPARSKQRVAINIHVCKYLSVVDKAGVRRISIGEHSIHIGDA  758

Query  243  KHSLTVE  223
            KHSL+++
Sbjct  759  KHSLSLQ  765



>gb|KHN08645.1| Putative beta-D-xylosidase 2 [Glycine soja]
Length=749

 Score =   162 bits (411),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 120/189 (63%), Gaps = 4/189 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ    ++ M +M MR     GYPGRTYRFY GP ++ FGYGLSYT F H++  A
Sbjct  552  PMTWYPQGYIKNLPMTNMAMRASRSKGYPGRTYRFYNGPVVYPFGYGLSYTHFVHTLTSA  611

Query  597  QDSVSLALDQGHPCRSTKC--ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSP  424
               VS+ +D      S+    +++      C   ++++H++VKNVG+  G H++L+FS+P
Sbjct  612  PKLVSIPVDGHRHGNSSNIANKAIKVTHARCGKLSINLHVDVKNVGSKDGIHTLLVFSAP  671

Query  423  PA--LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIG  250
            PA   H AP KQLV F+KV +     + V   + VCK LSVVD +G R++ +GLH LHIG
Sbjct  672  PAGNGHWAPHKQLVAFEKVHIPAKAQQRVRVKIHVCKLLSVVDRSGTRRIPMGLHSLHIG  731

Query  249  HLKHSLTVE  223
             +KHS++++
Sbjct  732  DVKHSVSLQ  740



>ref|XP_003519750.1| PREDICTED: probable beta-D-xylosidase 2-like [Glycine max]
Length=772

 Score =   162 bits (411),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 120/189 (63%), Gaps = 4/189 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ    ++ M +M MR     GYPGRTYRFY GP ++ FGYGLSYT F H++  A
Sbjct  575  PMTWYPQGYIKNLPMTNMAMRASRSKGYPGRTYRFYNGPVVYPFGYGLSYTHFVHTLTSA  634

Query  597  QDSVSLALDQGHPCRSTKC--ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSP  424
               VS+ +D      S+    +++      C   ++++H++VKNVG+  G H++L+FS+P
Sbjct  635  PKLVSIPVDGHRHGNSSNIANKAIKVTHARCGKLSINLHVDVKNVGSKDGIHTLLVFSAP  694

Query  423  PA--LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIG  250
            PA   H AP KQLV F+KV +     + V   + VCK LSVVD +G R++ +GLH LHIG
Sbjct  695  PAGNGHWAPHKQLVAFEKVHIPAKAQQRVRVKIHVCKLLSVVDRSGTRRIPMGLHSLHIG  754

Query  249  HLKHSLTVE  223
             +KHS++++
Sbjct  755  DVKHSVSLQ  763



>gb|KDO87030.1| hypothetical protein CISIN_1g0041901mg, partial [Citrus sinensis]
 gb|KDO87031.1| hypothetical protein CISIN_1g0041901mg, partial [Citrus sinensis]
Length=544

 Score =   160 bits (406),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 116/186 (62%), Gaps = 2/186 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ    ++ M +M MRP     YPGRTYRFY GP ++ FG+G+SYT F H++  A
Sbjct  349  PMTWYPQEYITNLPMTEMAMRPSQSKRYPGRTYRFYKGPVVYPFGHGMSYTNFVHTVANA  408

Query  597  QDSVSLALDQGHPC--RSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSP  424
               V++ LD  H     +   +++      C    L + ++VKNVG+  G H++L+FS+P
Sbjct  409  PTVVAVPLDGRHGSINATISGKAIKVTHAKCNRLTLGVQVDVKNVGSKDGAHTLLVFSTP  468

Query  423  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  244
            PA H AP KQLV F+KV +     + V  N+ VCK+LSVVD +G R++ LG H +HIG  
Sbjct  469  PAGHWAPHKQLVAFEKVHVPAGAQQRVGINIHVCKYLSVVDRSGTRRIPLGEHNIHIGGT  528

Query  243  KHSLTV  226
            KHS+++
Sbjct  529  KHSVSL  534



>ref|XP_010313018.1| PREDICTED: slArf/Xyl1 protein isoform X1 [Solanum lycopersicum]
Length=633

 Score =   161 bits (408),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 117/193 (61%), Gaps = 10/193 (5%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     VSM +M MR +P  GYPGRTYRFY GPT+F FG G+SYT F   +V A
Sbjct  435  PMTWYPQDYVAKVSMANMDMRANPSKGYPGRTYRFYKGPTVFPFGAGISYTTFSQHLVSA  494

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQT-------CASSALDIHLNVKNVGTVSGGHSVL  439
              +VS+     H   S    ++  A+ T       C S  +D+H++VKN G + G H+VL
Sbjct  495  PITVSVPTLHSHDLVSNNTTTLMKAKATVRTIHTNCESLDIDMHIDVKNTGDMDGTHAVL  554

Query  438  LFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVL  259
            +FS+PP       KQLV F+KV +     + V  N++ CKHLSV DE G R++ +G H +
Sbjct  555  IFSTPP--DPTETKQLVAFEKVHVVAGAKQRVKINMNACKHLSVADEYGVRRIYMGEHKI  612

Query  258  HIG-HLKHSLTVE  223
            H+G HLKHS+T +
Sbjct  613  HVGDHLKHSITFQ  625



>dbj|BAF43576.1| arabinofuranosidase/xylosidase homolog [Prunus persica]
Length=349

 Score =   157 bits (397),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 116/188 (62%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ+    + M DM MR DP  GYPGRTYRFY GP +F FG GLSYT F H++   
Sbjct  154  PMTWYPQNYVTHLPMTDMAMRADPARGYPGRTYRFYRGPVVFPFGLGLSYTTFAHNLAHG  213

Query  597  QDSVSLALD--QGHPCRSTKCESVDAAEQTC-ASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS+ L   +     +   ++V  +   C A S LD+H++VKN G++ G H++L+F+S
Sbjct  214  PTLVSVPLTSLKATANSTMLSKAVRVSHADCNALSPLDVHVDVKNTGSMDGTHTLLVFTS  273

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PP    A  KQL+GF K+ ++   ++ V   V VCKHLSVVD  G R++ LG H L IG 
Sbjct  274  PPDGKWASSKQLMGFHKIHIAAGSEKRVRIAVHVCKHLSVVDRFGIRRIPLGEHKLQIGD  333

Query  246  LKHSLTVE  223
            L H ++++
Sbjct  334  LSHHVSLQ  341



>gb|KHG28205.1| putative beta-D-xylosidase 2 -like protein [Gossypium arboreum]
Length=529

 Score =   160 bits (405),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 120/189 (63%), Gaps = 6/189 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ    +++M DM MR      YPGRTYRFY GP ++ FG+GLSYT F H+IV A
Sbjct  334  PMTWYPQDYVSNLAMTDMAMRSSTHRNYPGRTYRFYKGPVVYPFGHGLSYTNFVHTIVNA  393

Query  597  QDSVSLALDQGHPCRSTKC----ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFS  430
               V++ LD GH  RS       +++      C   ++ + +NVKN G+  G H++L+FS
Sbjct  394  PLVVTVPLD-GHR-RSGNATVLGKAIKVNHARCNKLSVGLQVNVKNTGSKDGTHTILVFS  451

Query  429  SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIG  250
             PPA H AP KQLV F KV +    ++ V  ++ VCK LSVVD +G R++ +GLH +HIG
Sbjct  452  IPPAGHWAPSKQLVAFAKVYVLARSEQQVGISIHVCKFLSVVDRSGVRRIPIGLHHIHIG  511

Query  249  HLKHSLTVE  223
             +KHS+++E
Sbjct  512  DVKHSVSLE  520



>gb|KDO71849.1| hypothetical protein CISIN_1g0062242mg [Citrus sinensis]
Length=415

 Score =   159 bits (401),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 124/189 (66%), Gaps = 6/189 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     + M DMRMR     GYPGRTYRFY GP +F FG+G+SYT F H++ +A
Sbjct  221  PMTWYPQDYVSRLPMTDMRMRA--ARGYPGRTYRFYKGPVVFPFGHGMSYTTFAHTLSKA  278

Query  597  QDSVSLALDQG-HPCRSTKCES--VDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFS  430
             +  S+ +    +  ++T   S  +  A   C  + +L +H+++KN G ++G H++L+F+
Sbjct  279  PNQFSVPIATSLYAFKNTTISSNAIRVAHTNCNDAMSLGLHVDIKNTGDMAGTHTLLVFA  338

Query  429  SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIG  250
             PPA + +P KQL+GF+KV ++    + V  ++ VCKHLSVVD+ G R++ +G H LHIG
Sbjct  339  KPPAGNWSPNKQLIGFKKVHVTAGALQSVRLDIHVCKHLSVVDKFGIRRIPMGEHSLHIG  398

Query  249  HLKHSLTVE  223
             LKHS++++
Sbjct  399  DLKHSISLQ  407



>ref|XP_010268028.1| PREDICTED: probable beta-D-xylosidase 2 [Nelumbo nucifera]
Length=767

 Score =   162 bits (409),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 115/186 (62%), Gaps = 1/186 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     + M  M MR DP  GYPGRTYRFY GP ++ FG+G+SYT F ++I  A
Sbjct  580  PMTWYPQDYVARLPMTTMDMRSDPWRGYPGRTYRFYKGPVVYPFGHGMSYTNFVYTIADA  639

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS-PP  421
               V++ L       ST  +++      C   ++ +H++VKN G+  G HS+L+FSS PP
Sbjct  640  PAMVTVPLRGHQGNSSTSGKAIKVTHAKCDGLSVVLHVDVKNAGSKDGSHSLLVFSSPPP  699

Query  420  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
            A H  P+KQLV F+KV L     + V   + +CK LSVVD+ G R++ LG HVLHIG++ 
Sbjct  700  AEHWVPQKQLVAFEKVHLPAGSQQRVQITIHLCKFLSVVDKLGIRRIPLGQHVLHIGNIH  759

Query  240  HSLTVE  223
            HS+ + 
Sbjct  760  HSIVLR  765



>ref|XP_011079568.1| PREDICTED: probable beta-D-xylosidase 2 [Sesamum indicum]
Length=771

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 119/187 (64%), Gaps = 2/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ   +++ M  M MR DP   YPGRTYRFY GP ++ FG+G+SYT F H+I  A
Sbjct  576  PMTWYPQEYLNNLPMTTMDMRADPSRNYPGRTYRFYKGPVVYPFGHGMSYTSFVHTIADA  635

Query  597  QDSVSLALDQGHPCRST--KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSP  424
               VS+ +D  H   +T    +S+      C   +L + ++V+N G+  G H++L+FS+P
Sbjct  636  PKVVSVPVDGRHHSNTTVVSSKSIRVTHARCNRLSLVVSVDVRNTGSKDGSHTLLVFSTP  695

Query  423  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  244
            P    AP KQL+ F+KV+++    E V   + VCK+LSVVD AG R++ +G H LHIG +
Sbjct  696  PRGLGAPHKQLITFEKVKVAAGGQERVPIKIHVCKYLSVVDGAGVRRIPMGEHALHIGDI  755

Query  243  KHSLTVE  223
            +H++++E
Sbjct  756  RHAISLE  762



>ref|XP_004151112.1| PREDICTED: beta-D-xylosidase 1-like [Cucumis sativus]
 gb|KGN47391.1| hypothetical protein Csa_6G309980 [Cucumis sativus]
Length=770

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 115/186 (62%), Gaps = 4/186 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS    V M +M +RPDP TGYPGRTYRFY GP +F FG+GLSY+KF  S  +A
Sbjct  580  PMTWYPQSYLAKVPMTNMGLRPDPSTGYPGRTYRFYKGPVVFPFGFGLSYSKFSQSFAEA  639

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCAS-SALDIHLNVKNVGTVSGGHSVLLFSSPP  421
               +SL L            +V  +   CAS S L I ++VKN GTV G H++L+FS+ P
Sbjct  640  PTKISLPLSS---LSPNSSATVKVSHTDCASVSDLPIMIDVKNTGTVDGSHTILVFSTVP  696

Query  420  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
                +P K L+GF+KV L     + V   + VC HLS VDE G R++ +G H LHIG L 
Sbjct  697  NQTWSPEKHLIGFEKVHLIAGSQKRVRIGIHVCDHLSRVDEFGTRRIPMGEHKLHIGDLT  756

Query  240  HSLTVE  223
            HS++++
Sbjct  757  HSISLQ  762



>ref|NP_001266104.1| SlArf/Xyl1 protein precursor [Solanum lycopersicum]
 dbj|BAL44716.1| SlArf/Xyl1 [Solanum lycopersicum]
Length=771

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 117/193 (61%), Gaps = 10/193 (5%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     VSM +M MR +P  GYPGRTYRFY GPT+F FG G+SYT F   +V A
Sbjct  573  PMTWYPQDYVAKVSMANMDMRANPSKGYPGRTYRFYKGPTVFPFGAGISYTTFSQHLVSA  632

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQT-------CASSALDIHLNVKNVGTVSGGHSVL  439
              +VS+     H   S    ++  A+ T       C S  +D+H++VKN G + G H+VL
Sbjct  633  PITVSVPTLHSHDLVSNNTTTLMKAKATVRTIHTNCESLDIDMHIDVKNTGDMDGTHAVL  692

Query  438  LFSSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVL  259
            +FS+PP       KQLV F+KV +     + V  N++ CKHLSV DE G R++ +G H +
Sbjct  693  IFSTPP--DPTETKQLVAFEKVHVVAGAKQRVKINMNACKHLSVADEYGVRRIYMGEHKI  750

Query  258  HIG-HLKHSLTVE  223
            H+G HLKHS+T +
Sbjct  751  HVGDHLKHSITFQ  763



>ref|XP_007051080.1| Beta-xylosidase 2 [Theobroma cacao]
 gb|EOX95237.1| Beta-xylosidase 2 [Theobroma cacao]
Length=818

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 119/187 (64%), Gaps = 2/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ    ++ M DM MR  P   YPGRTYRFY GP ++ FG+GLSYT F H+I  A
Sbjct  623  PMTWYPQEYVSNLPMTDMAMRSRPLKNYPGRTYRFYKGPLVYPFGHGLSYTNFVHTIASA  682

Query  597  QDSVSLALDQGHPCRSTKC--ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSP  424
               V++ LD  H   +T    +++      C    + + ++VKN G+  G H++L+FS+ 
Sbjct  683  PKVVTVPLDGRHHSGNTTVSGKAIKVNHAKCNKLTIGLQVDVKNTGSKDGTHTMLVFSTT  742

Query  423  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  244
            PA H AP+KQLV F KVR+     + +  N+ VCK LSVVD +G R++ +G+H LHIG++
Sbjct  743  PAGHWAPQKQLVAFAKVRVPAGAQQRIGINIHVCKFLSVVDGSGVRRIPIGVHNLHIGNV  802

Query  243  KHSLTVE  223
            KHS++++
Sbjct  803  KHSVSLQ  809



>gb|KJB49844.1| hypothetical protein B456_008G140600 [Gossypium raimondii]
Length=774

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 121/189 (64%), Gaps = 6/189 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ    +++M DM MR      YPGRTYRFY GP ++ FG+GLSYT F H+IV A
Sbjct  579  PMTWYPQDYVSNLAMTDMAMRSSRHRNYPGRTYRFYKGPVVYPFGHGLSYTNFVHTIVNA  638

Query  597  QDSVSLALDQGHPCRSTKC----ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFS  430
               V++ LD GH  RS       +++      C   ++ + +NVKN G+  G H++L+FS
Sbjct  639  PHVVTVPLD-GHR-RSGNATVLGKAIKVNHARCNKLSVGLQVNVKNTGSKDGTHTMLVFS  696

Query  429  SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIG  250
            +PPA H AP KQLV F KV +    ++ V  ++ VCK LSVVD +G R++ +GLH +HIG
Sbjct  697  TPPAGHWAPSKQLVAFAKVYVPARSEQQVGISIHVCKFLSVVDRSGVRRIPIGLHRIHIG  756

Query  249  HLKHSLTVE  223
             +KHS+++E
Sbjct  757  DVKHSVSLE  765



>ref|NP_001266107.1| SlArf/Xyl2 protein precursor [Solanum lycopersicum]
 dbj|BAL44717.1| SlArf/Xyl2 [Solanum lycopersicum]
Length=774

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 119/187 (64%), Gaps = 2/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ   +++ M  M MR +   GYPGRTYRFY GP ++ FG+GLSYTKF  +I +A
Sbjct  579  PMTWYPQEYLNNLPMTTMDMRSNLAKGYPGRTYRFYKGPLVYPFGHGLSYTKFITTIFEA  638

Query  597  QDSVSLALDQGHPCRSTKC--ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSP  424
              ++++ +D  H   S+    +S+      C+  ++ IH++VKNVG   G H++L+FS P
Sbjct  639  PKTLAIPIDGRHTYNSSTISNKSIRVTHAKCSKISVQIHVDVKNVGPKDGSHTLLVFSKP  698

Query  423  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  244
            P     P KQLV FQKV +     + V  N+ VCK+LSVVD AG R++ +G H +HIG  
Sbjct  699  PVDIWVPHKQLVAFQKVYVPARSKQRVAINIHVCKYLSVVDRAGVRRIPIGEHSIHIGDA  758

Query  243  KHSLTVE  223
            KHSL+++
Sbjct  759  KHSLSLQ  765



>ref|XP_002276351.1| PREDICTED: putative beta-D-xylosidase [Vitis vinifera]
Length=770

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 118/188 (63%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS      M +M MR  P  GYPGRTYRFY GP +F FG+GLSY+ F HS+ QA
Sbjct  574  PVTWYPQSYLRKAPMTNMAMRAIPSRGYPGRTYRFYNGPVVFPFGHGLSYSTFAHSLAQA  633

Query  597  QDSVSLALDQGHPCRSTKCESVDA---AEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS  427
              +VS++L      +++   S  A   +   C +  L  H++VKN GT+ G H++LLFS+
Sbjct  634  PTTVSVSLASLQTIKNSTIVSSGAIRISHANCNTQPLGFHIDVKNTGTMDGSHTLLLFST  693

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PP    +P K+L+ F+KV +     E V F+V VCKHLSVVD  G  ++ +G H  HIG 
Sbjct  694  PPPGTWSPNKRLLAFEKVHVGAGSQERVRFDVHVCKHLSVVDHFGIHRIPMGEHHFHIGD  753

Query  246  LKHSLTVE  223
            LKHS++++
Sbjct  754  LKHSISLQ  761



>gb|KDO71843.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
Length=476

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 124/189 (66%), Gaps = 6/189 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     + M DMRMR     GYPGRTYRFY GP +F FG+G+SYT F H++ +A
Sbjct  282  PMTWYPQDYVSRLPMTDMRMRA--ARGYPGRTYRFYKGPVVFPFGHGMSYTTFAHTLSKA  339

Query  597  QDSVSLALDQG-HPCRSTKCES--VDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFS  430
             +  S+ +    +  ++T   S  +  A   C  + +L +H+++KN G ++G H++L+F+
Sbjct  340  PNQFSVPIATSLYAFKNTTISSNAIRVAHTNCNDAMSLGLHVDIKNTGDMAGTHTLLVFA  399

Query  429  SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIG  250
             PPA + +P KQL+GF+KV ++    + V  ++ VCKHLSVVD+ G R++ +G H LHIG
Sbjct  400  KPPAGNWSPNKQLIGFKKVHVTAGALQSVRLDIHVCKHLSVVDKFGIRRIPMGEHSLHIG  459

Query  249  HLKHSLTVE  223
             LKHS++++
Sbjct  460  DLKHSISLQ  468



>gb|KDO71845.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
 gb|KDO71846.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
 gb|KDO71847.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
 gb|KDO71848.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
Length=486

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 124/189 (66%), Gaps = 6/189 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     + M DMRMR     GYPGRTYRFY GP +F FG+G+SYT F H++ +A
Sbjct  292  PMTWYPQDYVSRLPMTDMRMRA--ARGYPGRTYRFYKGPVVFPFGHGMSYTTFAHTLSKA  349

Query  597  QDSVSLALDQG-HPCRSTKCES--VDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFS  430
             +  S+ +    +  ++T   S  +  A   C  + +L +H+++KN G ++G H++L+F+
Sbjct  350  PNQFSVPIATSLYAFKNTTISSNAIRVAHTNCNDAMSLGLHVDIKNTGDMAGTHTLLVFA  409

Query  429  SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIG  250
             PPA + +P KQL+GF+KV ++    + V  ++ VCKHLSVVD+ G R++ +G H LHIG
Sbjct  410  KPPAGNWSPNKQLIGFKKVHVTAGALQSVRLDIHVCKHLSVVDKFGIRRIPMGEHSLHIG  469

Query  249  HLKHSLTVE  223
             LKHS++++
Sbjct  470  DLKHSISLQ  478



>ref|XP_006444470.1| hypothetical protein CICLE_v10018959mg [Citrus clementina]
 ref|XP_006492318.1| PREDICTED: probable beta-D-xylosidase 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006492319.1| PREDICTED: probable beta-D-xylosidase 2-like isoform X2 [Citrus 
sinensis]
 gb|ESR57710.1| hypothetical protein CICLE_v10018959mg [Citrus clementina]
Length=770

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 116/186 (62%), Gaps = 2/186 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ    ++ M +M MRP     YPGRTYRFY GP ++ FG+G+SYT F H++  A
Sbjct  575  PMTWYPQEYITNLPMTEMAMRPSQSKRYPGRTYRFYKGPVVYPFGHGMSYTNFVHTVANA  634

Query  597  QDSVSLALDQGHPC--RSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSP  424
               V++ LD  H     +   +++      C    L + ++VKNVG+  G H++L+FS+P
Sbjct  635  PTVVAVPLDGRHGSINATISGKAIKVTHAKCNRLTLGVQVDVKNVGSKDGAHTLLVFSTP  694

Query  423  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  244
            PA H AP KQLV F+KV +     + V  N+ VCK+LSVVD +G R++ LG H +HIG  
Sbjct  695  PAGHWAPHKQLVAFEKVHVPAGAQQRVGINIHVCKYLSVVDRSGTRRIPLGEHNIHIGGT  754

Query  243  KHSLTV  226
            KHS+++
Sbjct  755  KHSVSL  760



>gb|KDO71844.1| hypothetical protein CISIN_1g0062242mg, partial [Citrus sinensis]
Length=485

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 124/189 (66%), Gaps = 6/189 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     + M DMRMR     GYPGRTYRFY GP +F FG+G+SYT F H++ +A
Sbjct  291  PMTWYPQDYVSRLPMTDMRMRA--ARGYPGRTYRFYKGPVVFPFGHGMSYTTFAHTLSKA  348

Query  597  QDSVSLALDQG-HPCRSTKCES--VDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFS  430
             +  S+ +    +  ++T   S  +  A   C  + +L +H+++KN G ++G H++L+F+
Sbjct  349  PNQFSVPIATSLYAFKNTTISSNAIRVAHTNCNDAMSLGLHVDIKNTGDMAGTHTLLVFA  408

Query  429  SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIG  250
             PPA + +P KQL+GF+KV ++    + V  ++ VCKHLSVVD+ G R++ +G H LHIG
Sbjct  409  KPPAGNWSPNKQLIGFKKVHVTAGALQSVRLDIHVCKHLSVVDKFGIRRIPMGEHSLHIG  468

Query  249  HLKHSLTVE  223
             LKHS++++
Sbjct  469  DLKHSISLQ  477



>gb|KHN14659.1| Beta-D-xylosidase 1 [Glycine soja]
Length=655

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 117/188 (62%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     V M +M MRP+P TGYPGRTYRFY GP +F FG+GLSY++F HS+  A
Sbjct  465  PMTWYPQGYLAKVPMTNMDMRPNPTTGYPGRTYRFYKGPVVFPFGHGLSYSRFSHSLALA  524

Query  597  QDSVSLALD--QGHPCRSTKCESVDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS+ +   Q     +   ++V  +   C  S  ++ H++VKN G++ G H++L+FS 
Sbjct  525  PKQVSVPIMSLQALTNSTLSSKAVKVSHANCDDSLEMEFHVDVKNEGSMDGTHTLLIFSQ  584

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PP    +  KQLVGF K  +     + V   V VCKHLSVVD+ G R++  G H LHIG 
Sbjct  585  PPHGKWSQIKQLVGFHKTHVLAGSKQRVKVGVHVCKHLSVVDQFGVRRIPTGEHELHIGD  644

Query  246  LKHSLTVE  223
            +KHS++V+
Sbjct  645  VKHSISVQ  652



>ref|XP_008223305.1| PREDICTED: putative beta-D-xylosidase [Prunus mume]
Length=775

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 116/188 (62%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ+    + M DM MR DP  GYPGRTYRFY GP +F FG GLSYT F H++   
Sbjct  580  PMTWYPQNYVTHLPMTDMAMRADPARGYPGRTYRFYRGPVVFPFGLGLSYTAFAHNLAHG  639

Query  597  QDSVSLALD--QGHPCRSTKCESVDAAEQTC-ASSALDIHLNVKNVGTVSGGHSVLLFSS  427
              SVS+ L   +     +   ++V  +   C A S LD+H++VKN G++ G H++L+F+S
Sbjct  640  PTSVSVPLTSLKATANSTMLSKAVRVSHADCNALSPLDVHVDVKNTGSMDGTHTLLVFTS  699

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PP    A  KQLVGF K+ ++   ++ V   V  CKHLSVVD  G R++ LG H L IG 
Sbjct  700  PPDGKWAASKQLVGFHKIHIAAGSEKRVRIAVHACKHLSVVDRFGIRRIPLGEHKLQIGD  759

Query  246  LKHSLTVE  223
            L H ++++
Sbjct  760  LSHHVSLQ  767



>gb|AFU54451.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Prunus salicina]
Length=775

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 116/188 (62%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ+    + M DM MR DP  GYPGRTYRFY GP +F FG GLSYT F H++   
Sbjct  580  PMTWYPQNYVTHLPMTDMAMRADPARGYPGRTYRFYRGPVVFPFGLGLSYTTFAHNLAHG  639

Query  597  QDSVSLALD--QGHPCRSTKCESVDAAEQTC-ASSALDIHLNVKNVGTVSGGHSVLLFSS  427
              SVS+ L   +     +   ++V  +   C A S LD+H++VKN G++ G H++L+F+S
Sbjct  640  PTSVSVPLTSLKATANSTMLSKAVRVSHADCNALSPLDVHVDVKNTGSMDGTHTLLVFTS  699

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PP    A  KQLVGF K+ ++   +  V   V VCKHLSVVD  G R++ LG H L IG 
Sbjct  700  PPDGKWAASKQLVGFHKIHIAAGSETRVRIAVHVCKHLSVVDRFGIRRIPLGEHKLQIGD  759

Query  246  LKHSLTVE  223
            L H ++++
Sbjct  760  LSHHVSLQ  767



>gb|AFU54452.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Prunus salicina]
Length=775

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 116/188 (62%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ+    + M DM MR DP  GYPGRTYRFY GP +F FG GLSYT F H++   
Sbjct  580  PMTWYPQNYVTHLPMTDMAMRADPARGYPGRTYRFYRGPVVFPFGLGLSYTTFAHNLAHG  639

Query  597  QDSVSLALD--QGHPCRSTKCESVDAAEQTC-ASSALDIHLNVKNVGTVSGGHSVLLFSS  427
              SVS+ L   +     +   ++V  +   C A S LD+H++VKN G++ G H++L+F+S
Sbjct  640  PTSVSVPLTSLKATANSTMLSKAVRVSHADCNALSPLDVHVDVKNTGSMDGTHTLLVFTS  699

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PP    A  KQLVGF K+ ++   +  V   V VCKHLSVVD  G R++ LG H L IG 
Sbjct  700  PPDGKWAASKQLVGFHKIHIAAGSETRVRIAVHVCKHLSVVDRFGIRRIPLGEHKLQIGD  759

Query  246  LKHSLTVE  223
            L H ++++
Sbjct  760  LSHHVSLQ  767



>ref|XP_003591420.1| Beta xylosidase [Medicago truncatula]
 gb|AES61671.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Medicago truncatula]
Length=765

 Score =   160 bits (405),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 119/187 (64%), Gaps = 2/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ    +++M +M MRP   TGYPGRTYRFY GP ++ FGYGLSYT F H++  A
Sbjct  570  PMTWYPQGYLKNLAMTNMAMRPSSSTGYPGRTYRFYNGPVVYPFGYGLSYTNFVHTLASA  629

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ +D      S+   ++      C   ++ + ++VKNVG+  G +++L+FS PP 
Sbjct  630  PKVVSVPVDGHRRGNSSNKAAIRVTHARCGKLSIRLDIDVKNVGSKDGTNTLLVFSVPPT  689

Query  417  --LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  244
               H AP+KQLV F+KV +     + V  N+ VCK LSVVD++G R++ +G H +HIG +
Sbjct  690  GNGHWAPQKQLVAFEKVYVPAKAQQRVRINIHVCKLLSVVDKSGTRRIPMGAHSIHIGDV  749

Query  243  KHSLTVE  223
            KH ++++
Sbjct  750  KHFVSLQ  756



>sp|P83344.1|XYNB_PRUPE RecName: Full=Putative beta-D-xylosidase; AltName: Full=PpAz152, 
partial [Prunus persica]
 gb|AAM00218.1|AF362990_1 beta-D-xylosidase, partial [Prunus persica]
Length=461

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 116/188 (62%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ+    + M DM MR DP  GYPGRTYRFY GP +F FG GLSYT F H++   
Sbjct  266  PMTWYPQNYVTHLPMTDMAMRADPARGYPGRTYRFYIGPVVFPFGLGLSYTTFAHNLAHG  325

Query  597  QDSVSLALD--QGHPCRSTKCESVDAAEQTC-ASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS+ L   +     +   ++V  +   C A S LD+H++VKN G++ G H++L+F+S
Sbjct  326  PTLVSVPLTSLKATANSTMLSKTVRVSHPDCNALSPLDVHVDVKNTGSMDGTHTLLVFTS  385

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PP    A  KQL+GF K+ ++   ++ V   V VCKHLSVVD  G R++ LG H L IG 
Sbjct  386  PPDGKWASSKQLMGFHKIHIATGSEKRVRIAVHVCKHLSVVDRFGIRRIPLGEHKLQIGD  445

Query  246  LKHSLTVE  223
            L H ++++
Sbjct  446  LSHHVSLQ  453



>ref|XP_011041424.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   160 bits (404),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 118/188 (63%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ    ++ M DM MR     GYPGRTYRFY G  ++ FG+G+SYT F H+I  A
Sbjct  574  PMTWYPQDYITNLPMTDMAMRSSKSKGYPGRTYRFYKGKVVYPFGHGISYTNFVHTIASA  633

Query  597  QDSVSLALD---QGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS+ LD    G    +   +++      C   +L + ++VKN+G++ G H++L++S 
Sbjct  634  PTMVSVPLDGHRHGSGNATISRKAIRVTHARCNKLSLGVQVDVKNIGSMDGTHTLLVYSR  693

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PPA H AP KQLV F+KV ++    + V  N+ VCK LSVVD +G R++ +G H LHIG 
Sbjct  694  PPARHWAPHKQLVAFEKVHVAAGTQQRVGINIHVCKSLSVVDASGIRRIPMGEHSLHIGD  753

Query  246  LKHSLTVE  223
            +KHS++++
Sbjct  754  VKHSVSLQ  761



>gb|ACD93208.1| beta xylosidase [Camellia sinensis]
Length=767

 Score =   160 bits (404),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 114/188 (61%), Gaps = 2/188 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ       M +M MR +P +GYPGRTYRFY GP +F FG+G+SYT F H +  A
Sbjct  573  PMTWYPQDYLAKAPMTNMAMRANPSSGYPGRTYRFYKGPVVFPFGHGMSYTTFAHELAHA  632

Query  597  QDSVSLALDQ--GHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSP  424
              +VS+ L    G    +T    +      C +  L IH++VKN G + G H+VL+FS+P
Sbjct  633  PTTVSVPLTSLYGLQNSTTFNNGIRVTHTNCDTLILGIHIDVKNTGDMDGTHTVLVFSTP  692

Query  423  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  244
            P       KQL+GF+KV +     + V  +V VC  LSVVD+ G R++ +G H LHIG +
Sbjct  693  PVGKWGANKQLIGFKKVHVVARGRQRVKIHVHVCNQLSVVDQFGIRRIPIGEHSLHIGDI  752

Query  243  KHSLTVEI  220
            KHS+++++
Sbjct  753  KHSISLQV  760



>ref|XP_010671663.1| PREDICTED: beta-D-xylosidase 1 [Beta vulgaris subsp. vulgaris]
Length=768

 Score =   160 bits (404),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 85/191 (45%), Positives = 119/191 (62%), Gaps = 5/191 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            PNTWYPQ     ++M D+ MR +P  GYPGRTYRFY GP +F FG+GLSYT+F  S+ QA
Sbjct  574  PNTWYPQDYVAKIAMTDLAMRANPVRGYPGRTYRFYRGPVVFPFGFGLSYTRFSQSLAQA  633

Query  597  QDSVSLALDQGHPCRSTKCESVDAAE----QTCASSALDIHLNVKNVGTVSGGHSVLLFS  430
               V + L + +   +T   S +A      +   +++L +H++VKN G   G H+VL+FS
Sbjct  634  PTKVMVPLSKHYTSTNTTTLSNNAVRVLHTKCDTTTSLSLHIDVKNTGEADGSHTVLVFS  693

Query  429  SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIG  250
            SPP    A  K L+GF+KV +     E V  N+ VCKHLS  DE G R++ +G H LHIG
Sbjct  694  SPPRGAQASEKHLIGFKKVHVLAGSLERVRMNIHVCKHLSTADEFGIRRIQMGEHTLHIG  753

Query  249  -HLKHSLTVEI  220
              +KH L++++
Sbjct  754  DDIKHQLSLQV  764



>ref|XP_003546334.1| PREDICTED: beta-D-xylosidase 1-like [Glycine max]
Length=775

 Score =   160 bits (404),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 117/188 (62%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     V M +M MRP+P TGYPGRTYRFY GP +F FG+GLSY++F HS+  A
Sbjct  585  PMTWYPQGYLAKVPMTNMDMRPNPTTGYPGRTYRFYKGPVVFPFGHGLSYSRFSHSLALA  644

Query  597  QDSVSLALD--QGHPCRSTKCESVDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS+ +   Q     +   ++V  +   C  S  ++ H++VKN G++ G H++L+FS 
Sbjct  645  PKQVSVPIMSLQALTNSTLSSKAVKVSHANCDDSLEMEFHVDVKNEGSMDGTHTLLIFSQ  704

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PP    +  KQLVGF K  +     + V   V VCKHLSVVD+ G R++  G H LHIG 
Sbjct  705  PPHGKWSQIKQLVGFHKTHVLAGSKQRVKVGVHVCKHLSVVDQFGVRRIPTGEHELHIGD  764

Query  246  LKHSLTVE  223
            +KHS++V+
Sbjct  765  VKHSISVQ  772



>ref|XP_003535953.1| PREDICTED: probable beta-D-xylosidase 2 [Glycine max]
Length=771

 Score =   159 bits (403),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 85/190 (45%), Positives = 119/190 (63%), Gaps = 6/190 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ    ++ M +M MR     GYPGRTYRFY GP ++ FGYGLSYT F H++  A
Sbjct  574  PMTWYPQGYIKNLPMTNMAMRASRSKGYPGRTYRFYNGPVVYPFGYGLSYTHFVHTLASA  633

Query  597  QDSVSLALDQGH---PCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS+ +D GH      S   +++      C   ++ + ++VKNVG+  G H++L+FS+
Sbjct  634  PKLVSIPVD-GHRHGNSSSIANKAIKVTHARCGKLSISLQVDVKNVGSKDGTHTLLVFSA  692

Query  426  PPA--LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHI  253
            PPA   H AP KQLV FQK+ +     + V  N+ VCK LSVVD +G R+V +GLH LHI
Sbjct  693  PPAGNGHWAPHKQLVAFQKLHIPSKAQQRVNVNIHVCKLLSVVDRSGTRRVPMGLHSLHI  752

Query  252  GHLKHSLTVE  223
            G +KH ++++
Sbjct  753  GDVKHYVSLQ  762



>gb|ADV41671.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Actinidia deliciosa 
var. deliciosa]
Length=634

 Score =   158 bits (400),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 115/188 (61%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ+    + M DM MR DP  GYPGRTYRFY GP +F FG GLSYT F H++   
Sbjct  439  PMTWYPQNYVTHLPMTDMAMRADPARGYPGRTYRFYRGPVVFPFGLGLSYTTFAHNLAHG  498

Query  597  QDSVSLALD--QGHPCRSTKCESVDAAEQTC-ASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS+ L   +     +   ++V  +   C A S LD+H++VKN G++ G H++L+F+S
Sbjct  499  PTLVSVPLTSLKATANSTMLSKAVRVSHADCNALSPLDVHVDVKNTGSMDGTHTLLVFTS  558

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PP    A  KQLVGF K+ ++   +  V   V VCKHLSVVD  G R++ LG H L IG 
Sbjct  559  PPDGKWAASKQLVGFHKIHIAAGSETRVRIAVHVCKHLSVVDRFGIRRIPLGEHKLQIGD  618

Query  246  LKHSLTVE  223
            L H ++++
Sbjct  619  LSHHVSLQ  626



>ref|XP_011042236.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   159 bits (403),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 116/188 (62%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ    ++ M +M MRP    GYPGRTYRFY G  ++ FG+G+SYT F H+I  A
Sbjct  574  PMTWYPQDYVTNLPMTNMAMRPSTSNGYPGRTYRFYKGKVVYPFGHGISYTNFVHTIASA  633

Query  597  QDSVSLALD---QGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS+ LD   Q     +   +++      C   +  + ++VKN G++ G H++L++S 
Sbjct  634  PTMVSVPLDGHRQASRNATISGKAIRVTHARCNRLSFGVQVDVKNTGSMDGTHTLLVYSK  693

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PPA H AP KQLV F+KV ++      V  NV VCK LSVVD +G R++ +G H LHIG 
Sbjct  694  PPAGHWAPLKQLVAFEKVHVTAGTQRRVGINVHVCKFLSVVDRSGIRRIPMGAHSLHIGD  753

Query  246  LKHSLTVE  223
            +KHS++++
Sbjct  754  VKHSVSLQ  761



>ref|XP_009593976.1| PREDICTED: probable beta-D-xylosidase 2 [Nicotiana tomentosiformis]
Length=773

 Score =   159 bits (403),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 121/187 (65%), Gaps = 2/187 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ   +++ M  M MR +   GYPGRTYRFY GP ++ FG+GLSYTKF ++I +A
Sbjct  578  PMTWYPQEYLNNLPMTTMDMRANLAKGYPGRTYRFYKGPLVYPFGHGLSYTKFINTIAEA  637

Query  597  QDSVSLALDQGHPCRST--KCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSP  424
             + +++ +   H   +T    +++      C+  ++ +H++VKNVG+  G  ++L+FS P
Sbjct  638  PNMLAIPIFGRHASNTTITTSKAIRVTHAKCSKLSIQVHIDVKNVGSKDGTQTLLVFSKP  697

Query  423  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  244
            P    AP KQLV FQKV +     + V  N+ VCK+LSVVD+AG R++ +G H LHIG  
Sbjct  698  PIGLWAPHKQLVAFQKVHVPAGSLQRVAINIHVCKYLSVVDKAGVRRIPIGEHSLHIGDA  757

Query  243  KHSLTVE  223
            KHSL+++
Sbjct  758  KHSLSLQ  764



>ref|XP_009383731.1| PREDICTED: probable beta-D-xylosidase 2 [Musa acuminata subsp. 
malaccensis]
Length=781

 Score =   159 bits (403),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 115/189 (61%), Gaps = 4/189 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ   + V+M +M MR DP TGYPGRTYRFY GP ++ FG+GLSYTKF H++   
Sbjct  587  PVTWYPQEYVEKVTMTNMAMRADPSTGYPGRTYRFYDGPVVYSFGHGLSYTKFTHALADT  646

Query  597  QDSVSLALD--QGHPC--RSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFS  430
               VS+  D  +  P    S    +V      C   ++ +H++V N G   G H+VL++ 
Sbjct  647  PAQVSVPFDGLRAEPLFNASEPGRTVPVTHARCDGLSVPVHVDVTNAGDRDGSHTVLVYW  706

Query  429  SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIG  250
             PPA   AP KQLV F+KV L+  E   V+  VDVC+ L+V D  G R++ LG H LH+G
Sbjct  707  RPPAADGAPSKQLVAFEKVHLAAGEQVRVLLGVDVCRDLTVADGDGIRRIPLGEHSLHVG  766

Query  249  HLKHSLTVE  223
             L H+++++
Sbjct  767  DLTHTISLQ  775



>ref|XP_011015623.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   159 bits (402),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 118/188 (63%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ    ++ M DM MR     GYPGRTYRFY G  ++ FG+G+SYT F H+I  A
Sbjct  574  PMTWYPQDYITNLPMTDMAMRSSKSKGYPGRTYRFYKGKVVYPFGHGISYTNFVHTIASA  633

Query  597  QDSVSLALD---QGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS+ LD    G    +   +++      C   +L + ++VKN+G++ G H++L++S 
Sbjct  634  PTMVSVPLDGRRHGSGNATISRKAIRVTHARCNKLSLGMQVDVKNIGSMDGTHTLLVYSR  693

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PPA H AP KQLV F+KV ++    + V  N+ VCK LSVVD +G R++ +G H LHIG 
Sbjct  694  PPARHWAPHKQLVAFEKVHVAAGTQQRVGINIHVCKSLSVVDASGIRRIPMGEHSLHIGD  753

Query  246  LKHSLTVE  223
            +KHS++++
Sbjct  754  VKHSVSLQ  761



>ref|XP_008451490.1| PREDICTED: probable beta-D-xylosidase 2 [Cucumis melo]
Length=773

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 126/190 (66%), Gaps = 7/190 (4%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS   ++ M +M MR +  + YPGRTYRFY+GP +++FG+GLSYT F H+IV+A
Sbjct  577  PMTWYPQSYLSNLPMTNMAMRSN--SSYPGRTYRFYSGPVVYEFGHGLSYTNFIHTIVKA  634

Query  597  QDSVSLALD---QGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS++L    Q H   +   +++      C   +L IH++V+N G   G H++L+FS+
Sbjct  635  PTIVSVSLSGHRQTHSASTLSGKAIRVTHAKCQKLSLVIHVDVENKGDRDGFHTMLVFST  694

Query  426  PPA--LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHI  253
            PPA      PRKQLV F+K+ LS  E   +  +V +CK+LSVVD+ G R++ LG HV+HI
Sbjct  695  PPANGATWVPRKQLVAFEKLHLSSKEKRRLQVHVHICKYLSVVDKLGVRRIPLGDHVIHI  754

Query  252  GHLKHSLTVE  223
            G +KH+++++
Sbjct  755  GDVKHTISLQ  764



>ref|XP_006418321.1| hypothetical protein EUTSA_v10006876mg [Eutrema salsugineum]
 gb|ESQ36674.1| hypothetical protein EUTSA_v10006876mg [Eutrema salsugineum]
Length=766

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 120/185 (65%), Gaps = 2/185 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ    ++ M +M MRP    G+PGRTYRFY GP ++ FG+GLSYT+F HSI  A
Sbjct  575  PMTWYPQDYLTNLPMTEMSMRPIRSKGFPGRTYRFYDGPVVYPFGHGLSYTRFTHSIADA  634

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               + +A+   +   S K  SV      C   +L +H+++KNVG+  G H++L+FS+PP 
Sbjct  635  PKMIPIAVRGRNGTVSGK--SVRVTHARCNRLSLGVHVDIKNVGSRDGTHTMLVFSAPPG  692

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
               AP+KQLV F++V ++  E + V  N+ VCK+LSVVD AG R++ +G H +HIG   H
Sbjct  693  GEWAPKKQLVAFERVHVAAGEMKRVQVNIHVCKYLSVVDRAGIRRIPIGDHGIHIGDETH  752

Query  237  SLTVE  223
            +++++
Sbjct  753  TVSLQ  757



>gb|KHG05051.1| putative beta-D-xylosidase 2 -like protein [Gossypium arboreum]
Length=776

 Score =   159 bits (401),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 115/189 (61%), Gaps = 6/189 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ    ++ M DM MR  P   YPGRTY+FY GP ++ FG+GLSYT F H+I  A
Sbjct  581  PMTWYPQEYVSNLPMTDMAMRSSPNRNYPGRTYKFYKGPVVYPFGHGLSYTNFVHTIASA  640

Query  597  QDSVSLALD----QGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFS  430
               V++ LD     G+   S K   V+     C   ++ + ++VKN G+  G H++L+FS
Sbjct  641  PKVVTVPLDGHRHSGNATISGKAIKVNHVR--CNKLSVGLQVDVKNTGSKEGTHTMLVFS  698

Query  429  SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIG  250
             PPA H AP+KQLV F KV +       V  N+ VCK LSVVD +G R++  G+H LHIG
Sbjct  699  KPPAGHWAPQKQLVAFAKVHVPARSQRRVGINIHVCKFLSVVDRSGVRRIPTGVHNLHIG  758

Query  249  HLKHSLTVE  223
              KHSL+++
Sbjct  759  GAKHSLSLQ  767



>ref|XP_010259348.1| PREDICTED: putative beta-D-xylosidase [Nelumbo nucifera]
Length=775

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 114/190 (60%), Gaps = 7/190 (4%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     V M  M MRP    GYPGRTYRFY GP ++ FG+G+SYT F H++ QA
Sbjct  580  PMTWYPQDYVAKVPMTSMGMRP--SGGYPGRTYRFYRGPVVYPFGHGMSYTNFAHTVAQA  637

Query  597  QDSVSLALDQGHPCRSTKC-----ESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLF  433
               VS+ LD      ++       ++V      C   ++ +H++VKN G + G HS+L+F
Sbjct  638  PTLVSVPLDGRRAVGNSTTVSFSGKAVRVTHAKCDGLSVVVHVDVKNTGPMDGAHSLLVF  697

Query  432  SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHI  253
            S PP    AP KQLV F+KV +    ++ V   +  CKHLSVVD  G R++ +G H LHI
Sbjct  698  SEPPTGQWAPSKQLVAFEKVHVPAGTEQRVEVKIHACKHLSVVDRFGIRRIPMGEHSLHI  757

Query  252  GHLKHSLTVE  223
            G +KHS++++
Sbjct  758  GDVKHSVSLQ  767



>ref|XP_006419427.1| hypothetical protein CICLE_v10004369mg [Citrus clementina]
 gb|ESR32667.1| hypothetical protein CICLE_v10004369mg [Citrus clementina]
Length=777

 Score =   158 bits (399),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 124/189 (66%), Gaps = 6/189 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     + M DMRMR     GYPGRTYRFY GP +F FG+G+SYT F H++ +A
Sbjct  575  PMTWYPQDYVARLPMTDMRMRAG--RGYPGRTYRFYKGPVVFPFGHGMSYTTFAHTLSKA  632

Query  597  QDSVSLALDQG-HPCRSTKCES--VDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFS  430
             +  S+ +    +  ++T   S  +  A   C  + +L +H++VKN G ++G H++L+F+
Sbjct  633  PNQFSVPIATSLYAFKNTTISSNAIRVAHTNCNDAMSLGLHVDVKNTGDMAGTHTLLVFA  692

Query  429  SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIG  250
             PPA + +P KQL+GF+KV ++    + V  ++ VCKHLSVVD+ G R++ +G H LHIG
Sbjct  693  KPPAGNWSPNKQLIGFKKVHVTAGALQSVRLDIHVCKHLSVVDKFGIRRIPMGEHSLHIG  752

Query  249  HLKHSLTVE  223
             LKHS++++
Sbjct  753  DLKHSISLQ  761



>ref|XP_006306830.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
 gb|EOA39728.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
Length=625

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 119/185 (64%), Gaps = 2/185 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ    ++ M +M MRP      PGRTYRFY GP ++ FG+GLSYT+F HSI  A
Sbjct  434  PMTWYPQDYLTNLPMTEMSMRPVHSKQIPGRTYRFYDGPVVYPFGHGLSYTRFTHSIADA  493

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               +++A+   +   S K  SV      C   +L +H++V NVG+  G H++L+FS+PP 
Sbjct  494  PKVIAIAVRGRNSTVSGK--SVRVTHARCNGLSLGVHVDVTNVGSRDGTHTMLVFSAPPG  551

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
               AP+KQLV F++V ++  E + V  N+ VCK+LSVVD AGNR++ +G H +HIG   H
Sbjct  552  GEWAPKKQLVAFERVHVAVGEKKRVQVNIHVCKYLSVVDRAGNRRIPIGDHGIHIGDESH  611

Query  237  SLTVE  223
            +++++
Sbjct  612  TVSLQ  616



>ref|XP_010679361.1| PREDICTED: probable beta-D-xylosidase 2 [Beta vulgaris subsp. 
vulgaris]
Length=765

 Score =   157 bits (397),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 122/188 (65%), Gaps = 7/188 (4%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ   + + M +M MR  P  GYPGRTYRFY GP ++ FG+GLSYT F H+I  A
Sbjct  573  PMTWYPQEYLNKLPMTNMGMRSGP--GYPGRTYRFYQGPVVYPFGHGLSYTHFTHTIADA  630

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQT---CASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               V++ LD GH  RS    S  A   T   C   +L +H++VKN G+  G H++L+FS 
Sbjct  631  PMEVTVPLD-GHR-RSNASASGKAIRVTHARCGQLSLMVHVDVKNEGSKDGAHTLLVFSR  688

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PPA   AP+KQLV F++V L     + V  ++ VCK+LSVVD++G R++ LG H +HIG+
Sbjct  689  PPAGKWAPQKQLVAFERVHLPAGSQQRVRVHIHVCKYLSVVDKSGIRRIPLGDHHIHIGN  748

Query  246  LKHSLTVE  223
             +HS++++
Sbjct  749  ARHSISLK  756



>ref|XP_010457247.1| PREDICTED: probable beta-D-xylosidase 2 [Camelina sativa]
Length=769

 Score =   157 bits (396),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 120/185 (65%), Gaps = 2/185 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ    ++ M +M MRP      PGRTYRFY GP ++ FG+GLSYT+F HSI  A
Sbjct  578  PMTWYPQDYLTNLPMTEMSMRPVHSKRIPGRTYRFYDGPVVYPFGHGLSYTRFTHSIADA  637

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               +++A+   +   S K  SV      C   +L +H++V NVG+  G H++L+FS+PP 
Sbjct  638  PKVIAIAVRGRNSTVSGK--SVRVTHARCDRLSLGVHVDVTNVGSRDGTHTMLVFSAPPG  695

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
               AP+KQLV F++V ++  E + V  N+ VCK+LSVVD AGNR++ +G H +HIG  +H
Sbjct  696  GEWAPKKQLVAFERVHVAVGEKKRVQVNIHVCKYLSVVDRAGNRRIPIGDHGIHIGDERH  755

Query  237  SLTVE  223
            +++++
Sbjct  756  TVSLQ  760



>ref|XP_007225668.1| hypothetical protein PRUPE_ppa001718mg [Prunus persica]
 gb|EMJ26867.1| hypothetical protein PRUPE_ppa001718mg [Prunus persica]
Length=775

 Score =   157 bits (396),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 116/188 (62%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ+    + M DM MR DP  GYPGRTYRFY GP +F FG GLSYT F H++   
Sbjct  580  PMTWYPQNYVTHLPMTDMAMRADPARGYPGRTYRFYRGPVVFPFGLGLSYTTFAHNLAHG  639

Query  597  QDSVSLALD--QGHPCRSTKCESVDAAEQTC-ASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS+ L   +     +   ++V  +   C A S LD+H++VKN G++ G H++L+F+S
Sbjct  640  PTLVSVPLTSLKATANSTMLSKAVRVSHADCNALSPLDVHVDVKNTGSMDGTHTLLVFTS  699

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PP    A  KQL+GF K+ ++   ++ V   V VCKHLSVVD  G R++ LG H L IG 
Sbjct  700  PPDGKWASSKQLMGFHKIHIAAGSEKRVRIAVHVCKHLSVVDRFGIRRIPLGEHKLQIGD  759

Query  246  LKHSLTVE  223
            L H ++++
Sbjct  760  LSHHVSLQ  767



>ref|XP_010481135.1| PREDICTED: probable beta-D-xylosidase 2 [Camelina sativa]
Length=769

 Score =   157 bits (396),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 120/185 (65%), Gaps = 2/185 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ    ++ M +M MRP      PGRTYRFY GP ++ FG+GLSYT+F HSI  A
Sbjct  578  PMTWYPQDYLTNLPMTEMSMRPVHSKRIPGRTYRFYDGPVVYPFGHGLSYTRFTHSIADA  637

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               +++A+   +   S K  SV      C   +L +H++V NVG+  G H++L+FS+PP 
Sbjct  638  PKVIAIAVRGRNSTVSGK--SVRVTHARCDRLSLGVHVDVTNVGSRDGTHTMLVFSAPPG  695

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
               AP+KQLV F++V ++  E + V  N+ VCK+LSVVD AGNR++ +G H +HIG  +H
Sbjct  696  GEWAPKKQLVAFERVHVAVGEKKRVQVNIHVCKYLSVVDRAGNRRIPIGDHGIHIGDERH  755

Query  237  SLTVE  223
            +++++
Sbjct  756  TVSLQ  760



>gb|AAP83934.1| auxin-induced beta-glucosidase [Oxybasis rubra]
Length=767

 Score =   156 bits (395),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 113/190 (59%), Gaps = 4/190 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            PNTWYPQS    V M D+ MR +P  GYPGRTYRFY GP +F FG+GLSYT+F  S+  A
Sbjct  574  PNTWYPQSYVAKVPMTDLAMRANPSNGYPGRTYRFYKGPVVFPFGFGLSYTRFTQSLAHA  633

Query  597  QDSVSLALDQGHPCRSTKCESVDAAE---QTCASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               V + L       +    + DA +     C +  L +H++VKN G V G H++L+FS+
Sbjct  634  PTKVMVPLANQFTNSNITSFNKDALKVLHTNCDNIPLSLHIDVKNKGKVDGSHTILVFST  693

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PP    +  KQL+GF++V +     + V  N+ VC HLS  DE G R++ +G H LHIG 
Sbjct  694  PPKGTKSSEKQLIGFKRVHVFAGSKQRVRMNIHVCNHLSRADEFGVRRIPIGEHTLHIGD  753

Query  246  L-KHSLTVEI  220
              KH L++ I
Sbjct  754  DHKHKLSLHI  763



>gb|KHG14371.1| Beta-D-xylosidase 1 -like protein [Gossypium arboreum]
Length=772

 Score =   156 bits (395),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 115/190 (61%), Gaps = 7/190 (4%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     V M +M MRP    GYPGRTYRFY GP +F FG+GLSYT F+HS+  A
Sbjct  577  PMTWYPQDYVAKVPMTNMGMRP--SRGYPGRTYRFYKGPVVFPFGHGLSYTSFKHSLALA  634

Query  597  QDSVSLALDQG----HPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFS  430
               +S+ LD          +    ++      C S +   H++V+N G + G H++L+FS
Sbjct  635  PTDLSVLLDTNLFATKNYSTLSSNAIRVKHAKCDSLSSLFHIDVENTGNMDGTHTLLVFS  694

Query  429  SPPALHN-APRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHI  253
            +PPA    +P KQL+GF +V +     + V  N+  CKHLSVVDE G R++ +G H LHI
Sbjct  695  TPPAGQKWSPNKQLIGFHRVHVVAGSKQRVKINIHACKHLSVVDEFGIRRIPMGSHSLHI  754

Query  252  GHLKHSLTVE  223
            G LKHS++++
Sbjct  755  GDLKHSISLQ  764



>ref|XP_009609889.1| PREDICTED: putative beta-D-xylosidase, partial [Nicotiana tomentosiformis]
Length=496

 Score =   154 bits (390),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 110/184 (60%), Gaps = 10/184 (5%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     V+M +M MR DP  GYPGRTYRFY GP +F FG G SYT+F  SIV A
Sbjct  312  PMTWYPQDYVAKVAMTNMDMRADPARGYPGRTYRFYKGPVVFPFGAGFSYTRFSQSIVSA  371

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+      P    +  +V      C S  L +H++VKN G + G H++L+FS PP 
Sbjct  372  PAIVSV------PTLDMRKTAVRTTHTNCDSLNLHLHIHVKNTGDMDGTHTLLIFSKPPP  425

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH-LK  241
               A  KQLV FQKV ++    + V  N++ CKHL+V D+ G R++ +G H +H+G  + 
Sbjct  426  ---AATKQLVAFQKVHVAAGAQQRVNININACKHLTVADQFGIRRIFMGEHKIHVGEDIN  482

Query  240  HSLT  229
            HS+T
Sbjct  483  HSIT  486



>ref|XP_006306829.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
 gb|EOA39727.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
Length=768

 Score =   156 bits (395),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 119/185 (64%), Gaps = 2/185 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ    ++ M +M MRP      PGRTYRFY GP ++ FG+GLSYT+F HSI  A
Sbjct  577  PMTWYPQDYLTNLPMTEMSMRPVHSKQIPGRTYRFYDGPVVYPFGHGLSYTRFTHSIADA  636

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               +++A+   +   S K  SV      C   +L +H++V NVG+  G H++L+FS+PP 
Sbjct  637  PKVIAIAVRGRNSTVSGK--SVRVTHARCNGLSLGVHVDVTNVGSRDGTHTMLVFSAPPG  694

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
               AP+KQLV F++V ++  E + V  N+ VCK+LSVVD AGNR++ +G H +HIG   H
Sbjct  695  GEWAPKKQLVAFERVHVAVGEKKRVQVNIHVCKYLSVVDRAGNRRIPIGDHGIHIGDESH  754

Query  237  SLTVE  223
            +++++
Sbjct  755  TVSLQ  759



>ref|XP_007138975.1| hypothetical protein PHAVU_009G254300g [Phaseolus vulgaris]
 gb|ESW10969.1| hypothetical protein PHAVU_009G254300g [Phaseolus vulgaris]
Length=772

 Score =   156 bits (395),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 116/186 (62%), Gaps = 1/186 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYP+     V M +M MRP+P TGYPGRTYRFY GP +F FG+GLSY+ F H++  A
Sbjct  580  PMTWYPEGYLSKVPMTNMDMRPNPGTGYPGRTYRFYKGPVVFPFGHGLSYSTFTHALAIA  639

Query  597  QDSVSLALDQ-GHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPP  421
               +SL L    +   ST+   +  A     +  ++ H++VKN G++ G H++L+FS PP
Sbjct  640  PKHLSLPLTTFTNSTLSTQAPRLSHANCDHDTLDMEFHVDVKNDGSMDGTHTLLVFSKPP  699

Query  420  ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLK  241
                +  KQLV FQK+ +     + V   V VCKHLSVVD+ G R++  G H LHIG LK
Sbjct  700  PGKWSQIKQLVNFQKIHVPAGSTQRVTVGVHVCKHLSVVDQFGIRRIPSGEHELHIGDLK  759

Query  240  HSLTVE  223
            HS++V+
Sbjct  760  HSISVQ  765



>ref|XP_002302758.2| hypothetical protein POPTR_0002s19830g [Populus trichocarpa]
 gb|EEE82031.2| hypothetical protein POPTR_0002s19830g [Populus trichocarpa]
Length=770

 Score =   156 bits (395),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 116/188 (62%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ    ++ M +M MRP    GYPGRTYRFY G  ++ FG+G+SYT F H+I  A
Sbjct  574  PMTWYPQDYVTNLPMTNMAMRPSKSNGYPGRTYRFYKGKVVYPFGHGISYTNFVHTIASA  633

Query  597  QDSVSLAL---DQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS+ L    Q     +   +++      C   +  + ++VKN G++ G H++L++S 
Sbjct  634  PTMVSVPLVGHRQASRNATISGKAIRVTHARCNRLSFGVQVDVKNTGSMDGTHTLLVYSK  693

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PPA H AP KQLV F+KV ++    + V  NV VCK LSVVD +G R++ +G H LHIG 
Sbjct  694  PPAGHWAPLKQLVAFEKVHVAAGTQQRVGINVHVCKFLSVVDRSGIRRIPMGAHSLHIGD  753

Query  246  LKHSLTVE  223
            +KHS++++
Sbjct  754  VKHSVSLQ  761



>ref|XP_002515300.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF47284.1| Beta-glucosidase, putative [Ricinus communis]
Length=768

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 117/185 (63%), Gaps = 0/185 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ    ++ M +M MR     GYPGRTYRFY G  ++ FG+G+SYT F H+I  A
Sbjct  575  PMTWYPQEYITNLPMTEMAMRSSQSKGYPGRTYRFYQGKVVYPFGHGMSYTHFVHNIASA  634

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               VS+ LD      S   +++      C   +L I ++VKNVG+  G H++L++S+PPA
Sbjct  635  PTMVSVPLDGHRGNTSISGKAIRVTHTKCNKLSLGIQVDVKNVGSKDGTHTLLVYSAPPA  694

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
               +P KQLV F++V +S    E V  ++ VCK LSVVD +G R++ +G H +HIG++KH
Sbjct  695  GRWSPHKQLVAFERVHVSAGTQERVGISIHVCKLLSVVDRSGIRRIPIGEHSIHIGNVKH  754

Query  237  SLTVE  223
            S++++
Sbjct  755  SVSLQ  759



>gb|KJB38535.1| hypothetical protein B456_006G259500 [Gossypium raimondii]
Length=774

 Score =   156 bits (394),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/192 (44%), Positives = 121/192 (63%), Gaps = 11/192 (6%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS    V M +M MRP    GYPGRTYRFY GP +F FG+GLSYT F+ S+  A
Sbjct  579  PMTWYPQSYVAKVPMTNMGMRP--SRGYPGRTYRFYKGPVVFPFGHGLSYTNFKQSLALA  636

Query  597  QDSVSLALD------QGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLL  436
               +S+ ++      + +   S+K  ++      C S +L +H++V+N+G + G H++LL
Sbjct  637  PTDLSVLINTNLFATKNYSTLSSK--AIRVKHTNCDSLSLPLHIDVENIGNMDGTHTLLL  694

Query  435  FSSPP-ALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVL  259
            FS PP A+  +P KQL+ F +V +     + V  NV  CKHLSVVDE G R++ +G H L
Sbjct  695  FSEPPAAVKWSPNKQLISFHRVHVIAGSKQRVKINVHACKHLSVVDEFGIRRIPMGQHSL  754

Query  258  HIGHLKHSLTVE  223
            +IG LKHS++++
Sbjct  755  YIGDLKHSISLQ  766



>ref|XP_002320310.2| hypothetical protein POPTR_0014s11730g [Populus trichocarpa]
 gb|EEE98625.2| hypothetical protein POPTR_0014s11730g [Populus trichocarpa]
Length=765

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 117/188 (62%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ    ++ M +M MR     GYPGRTYRFY G  ++ FG+G+SYT F H+I  A
Sbjct  569  PMTWYPQDYITNLPMTNMAMRSSKSKGYPGRTYRFYKGKVVYPFGHGISYTNFVHTIASA  628

Query  597  QDSVSLALD---QGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS+ LD    G    +   +++      C   +L + ++VKN G++ G H++L++S 
Sbjct  629  PTMVSVPLDGHRHGSGNATISGKAIRVTHARCNRLSLGMQVDVKNTGSMDGTHTLLVYSR  688

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PPA H AP KQLV F+KV ++    + V  N+ VCK LSVVD +G R++ +G H LHIG 
Sbjct  689  PPARHWAPHKQLVAFEKVHVAAGTQQRVGINIHVCKSLSVVDGSGIRRIPMGEHSLHIGD  748

Query  246  LKHSLTVE  223
            +KHS++++
Sbjct  749  VKHSVSLQ  756



>ref|XP_009757165.1| PREDICTED: probable beta-D-xylosidase 2 [Nicotiana sylvestris]
Length=770

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 118/185 (64%), Gaps = 1/185 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ   +++ M  M MR +   GYPGRTYRFY GP ++ FG+GLSYTKF ++I + 
Sbjct  578  PMTWYPQEYLNNLPMTTMDMRANLAKGYPGRTYRFYKGPLVYPFGHGLSYTKFINTIAEV  637

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
             + +++ +   H   +T  +++      C+  ++ +H++VKNVG+  G  ++L+FS PP 
Sbjct  638  PNMLAIPIFGRHASNTTS-KAIRVTHAKCSKLSIQVHIDVKNVGSKDGTQTLLVFSKPPV  696

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
                P KQLV FQKV +     + V  N+ VCK+LSVVD AG R++ +G H LHIG  KH
Sbjct  697  GLWVPHKQLVAFQKVYVPAGSLQRVTINIHVCKYLSVVDRAGVRRIPIGEHSLHIGDAKH  756

Query  237  SLTVE  223
            +L+++
Sbjct  757  TLSLQ  761



>ref|XP_004136155.1| PREDICTED: probable beta-D-xylosidase 2-like [Cucumis sativus]
 gb|KGN45007.1| hypothetical protein Csa_7G407600 [Cucumis sativus]
Length=772

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 124/190 (65%), Gaps = 7/190 (4%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS   ++ M +M MR    + YPGRTYRFY GP +++FG+GLSYT F H+IV+A
Sbjct  576  PMTWYPQSYLSNLPMTNMAMRS--TSSYPGRTYRFYAGPVVYEFGHGLSYTNFIHTIVKA  633

Query  597  QDSVSLALD---QGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS++L    Q H   +   +++      C   +L IH++V+N G   G H++L+FS+
Sbjct  634  PTIVSISLSGHRQTHSASTLSSKAIRVTHAKCQKLSLVIHVDVENKGDRDGFHTMLVFST  693

Query  426  PPA--LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHI  253
            PPA      PRKQLV F+K+ L+  E   +  +V VCK+LSVVD+ G R++ LG H +HI
Sbjct  694  PPANGATWVPRKQLVAFEKLHLASREKRRLQVHVHVCKYLSVVDKLGVRRIPLGDHYIHI  753

Query  252  GHLKHSLTVE  223
            G++KH+++++
Sbjct  754  GNVKHTVSLQ  763



>ref|XP_007145157.1| hypothetical protein PHAVU_007G215100g [Phaseolus vulgaris]
 gb|ESW17151.1| hypothetical protein PHAVU_007G215100g [Phaseolus vulgaris]
Length=767

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 117/189 (62%), Gaps = 6/189 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYP+   + ++M +M MR     GYPGRTYRFY+GP ++ FGYGL YT F H++V A
Sbjct  574  PMTWYPEGYVEKLAMTNMAMRSKRSKGYPGRTYRFYSGPVVYSFGYGLYYTHFVHTLVSA  633

Query  597  QDSVSLALDQGH---PCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS+ +D GH      +    +V      CA  ++ + ++VKNVG+    H++L+FS+
Sbjct  634  PKVVSIPVD-GHRHNNSSNIANNAVKVTHARCAKLSISLQVDVKNVGSRDATHTLLVFSA  692

Query  426  PPA--LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHI  253
            PPA     AP KQLV F K+ L     + V  N+ VCK LSVVD +G R+V +GLH LHI
Sbjct  693  PPAGNAQWAPHKQLVAFHKLHLPAKAQDRVRINIHVCKLLSVVDRSGTRRVPMGLHTLHI  752

Query  252  GHLKHSLTV  226
              +KH+LT+
Sbjct  753  ADIKHTLTL  761



>ref|XP_010522822.1| PREDICTED: probable beta-D-xylosidase 2 [Tarenaya hassleriana]
Length=767

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 119/185 (64%), Gaps = 0/185 (0%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ    ++ M +M MRP     +PGRTYRFY GP ++ FG+GLSYT+F H+I  A
Sbjct  574  PMTWYPQEYLANLPMTEMSMRPSQSKRFPGRTYRFYKGPVVYPFGHGLSYTRFTHTIADA  633

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               + +AL       +   ++V      C+  +L +H++VKNVG+  G H++L+FS+PPA
Sbjct  634  PRVLPIALHGRGRNGTVSGKAVRVTHAKCSRLSLGVHVDVKNVGSRDGTHTMLVFSAPPA  693

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
               AP +QLV F++V ++  E + V  N+ VCK+LSVVD AG R++ +G H +HIG   H
Sbjct  694  GRWAPHRQLVAFERVHVAAGEKKRVPINIHVCKYLSVVDRAGVRRIPIGDHNIHIGDATH  753

Query  237  SLTVE  223
            +++++
Sbjct  754  TVSLQ  758



>ref|XP_004162442.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-D-xylosidase 2-like 
[Cucumis sativus]
Length=772

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 124/190 (65%), Gaps = 7/190 (4%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQS   ++ M +M MR    + YPGRTYRFY GP +++FG+GLSYT F H+IV+A
Sbjct  576  PMTWYPQSYLSNLPMTNMAMRS--TSSYPGRTYRFYAGPVVYEFGHGLSYTNFIHTIVKA  633

Query  597  QDSVSLALD---QGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               VS++L    Q H   +   +++      C   +L IH++V+N G   G H++L+FS+
Sbjct  634  PTIVSISLSGHRQTHSASTLSSKAIRVTHAKCQKLSLVIHVDVENKGDRDGFHTMLVFST  693

Query  426  PPA--LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHI  253
            PPA      PRKQLV F+K+ L+  E   +  +V VCK+LSVVD+ G R++ LG H +HI
Sbjct  694  PPANGATWVPRKQLVAFEKLHLASREKRRLQVHVHVCKYLSVVDKLGVRRIPLGDHYIHI  753

Query  252  GHLKHSLTVE  223
            G++KH+++++
Sbjct  754  GNVKHTVSLQ  763



>ref|XP_008808663.1| PREDICTED: beta-D-xylosidase 1-like [Phoenix dactylifera]
Length=772

 Score =   155 bits (392),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 117/188 (62%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ   + VSM +M MR D   GYPGR+YRFY GP ++ +G+GLSYTKF HS+  A
Sbjct  579  PVTWYPQEFVEKVSMANMAMRADGDRGYPGRSYRFYNGPVVYPYGHGLSYTKFTHSLAHA  638

Query  597  QDSVSLALD--QGHPCRSTK-CESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSS  427
               +++ LD  +     ST+   +V  +   C   ++ +H++V+NVG   G H+VL++S+
Sbjct  639  PAQIAVQLDGRRAPAYNSTEPARAVRVSHARCDGLSIPVHVDVENVGDRDGSHTVLVYST  698

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PP    AP+KQLV F+KV ++      V   VDVC  +S  DE G R++ +G H L IG 
Sbjct  699  PPGTRWAPQKQLVAFEKVHVAAGGQVRVELGVDVCGQMSFADEYGIRRIPIGEHNLQIGD  758

Query  246  LKHSLTVE  223
            L HS++++
Sbjct  759  LIHSISLD  766



>gb|KHN12900.1| Beta-D-xylosidase 1 [Glycine soja]
Length=774

 Score =   155 bits (391),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 113/188 (60%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     V M +M MRP+P TGYPGRTYRFY GP +F FG+GLSY++F  S+  A
Sbjct  584  PMTWYPQGYLAKVPMTNMDMRPNPATGYPGRTYRFYKGPVVFPFGHGLSYSRFSQSLALA  643

Query  597  --QDSVSLALDQGHPCRSTKCESVDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFSS  427
              Q SV +   Q     +   ++V  +   C  S   + H++VKN G++ G H++L+FS 
Sbjct  644  PKQVSVQILSLQALTNSTLSSKAVKVSHANCDDSLETEFHVDVKNEGSMDGTHTLLIFSK  703

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PP    +  KQLV F K  +     + +  NV  CKHLSVVD+ G R++  G H LHIG 
Sbjct  704  PPPGKWSQIKQLVTFHKTHVPAGSKQRLKVNVHSCKHLSVVDQFGVRRIPTGEHELHIGD  763

Query  246  LKHSLTVE  223
            LKHS+ V+
Sbjct  764  LKHSINVQ  771



>ref|XP_004295104.1| PREDICTED: putative beta-D-xylosidase [Fragaria vesca subsp. 
vesca]
Length=772

 Score =   155 bits (391),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 114/187 (61%), Gaps = 4/187 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     V M +M MR     GYPGRTYRFY GP +F FG GLSYT FRHS+ Q 
Sbjct  580  PMTWYPQDYVSKVPMTNMAMRAG--RGYPGRTYRFYKGPVVFPFGLGLSYTTFRHSLAQV  637

Query  597  QDSVSLALDQ-GHPCRSTKCES-VDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSP  424
              SVS+ L        ST   S V  +   C   +L +H++VKN G   G H++L+FSSP
Sbjct  638  PTSVSVPLTSLSATTNSTMLSSAVRVSHTNCNPLSLALHVDVKNTGARDGTHTLLVFSSP  697

Query  423  PALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHL  244
            P+   A  KQLVGF KV +     + V F+V VCKHLSVVD+ G +++ +G H L IG L
Sbjct  698  PSGKWAVNKQLVGFHKVHIVAGSQKRVKFDVHVCKHLSVVDQFGIQRIPIGEHKLQIGDL  757

Query  243  KHSLTVE  223
            +H ++VE
Sbjct  758  EHHISVE  764



>dbj|BAC41913.1| putative beta-xylosidase [Arabidopsis thaliana]
Length=732

 Score =   154 bits (389),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 116/199 (58%), Gaps = 16/199 (8%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYP+S  D V+M DM MR +   GYPGRTYRFYTGP ++ FG GLSYTKF + I+ A
Sbjct  537  PTTWYPESFTD-VAMSDMHMRANSSRGYPGRTYRFYTGPQVYSFGTGLSYTKFEYKILSA  595

Query  597  QDSVSLA------------LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSG  454
               +SL+            L  G   R  + +  D    +C S   ++ ++V N G + G
Sbjct  596  PIRLSLSELLPQQSSHKKQLQHGEELRYLQLD--DVIVNSCESLRFNVRVHVSNTGEIDG  653

Query  453  GHSVLLFSS-PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVA  277
             H V+LFS  PP L   P KQL+G+ +V +  NE    VF +D CK LSV ++ G R + 
Sbjct  654  SHVVMLFSKMPPVLSGVPEKQLIGYDRVHVRSNEMMETVFVIDPCKQLSVANDVGKRVIP  713

Query  276  LGLHVLHIGHLKHSLTVEI  220
            LG HVL +G L+HSL+VE 
Sbjct  714  LGSHVLFLGDLQHSLSVEF  732



>ref|XP_002889410.1| hypothetical protein ARALYDRAFT_470222 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65669.1| hypothetical protein ARALYDRAFT_470222 [Arabidopsis lyrata subsp. 
lyrata]
Length=763

 Score =   154 bits (390),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 118/185 (64%), Gaps = 2/185 (1%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ    ++ M +M MRP      PGRTYRFY GP ++ FG+GLSYT+F HSI  A
Sbjct  572  PMTWYPQDYLTNLPMTEMSMRPIHSKRIPGRTYRFYDGPVVYPFGHGLSYTRFTHSIADA  631

Query  597  QDSVSLALDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFSSPPA  418
               + +A+   +   S K  S+      C   +L +H++V NVG+  G H++L+FS+PP 
Sbjct  632  PKVIPIAVRGRNGTVSGK--SIRVTHARCNRLSLGVHVDVTNVGSRDGTHTMLVFSAPPG  689

Query  417  LHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGHLKH  238
               AP+KQLV F++V ++  E + V  N+ VCK+LSVVD AGNR++ +G H +HIG   H
Sbjct  690  GEWAPKKQLVAFERVHVAVGEKKRVQVNIHVCKYLSVVDRAGNRRIPIGDHGIHIGDESH  749

Query  237  SLTVE  223
            +++++
Sbjct  750  TVSLQ  754



>ref|XP_003533205.2| PREDICTED: beta-D-xylosidase 1-like [Glycine max]
Length=823

 Score =   155 bits (391),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 113/188 (60%), Gaps = 3/188 (2%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     V M +M MRP+P TGYPGRTYRFY GP +F FG+GLSY++F  S+  A
Sbjct  633  PMTWYPQGYLAKVPMTNMDMRPNPATGYPGRTYRFYKGPVVFPFGHGLSYSRFSQSLALA  692

Query  597  --QDSVSLALDQGHPCRSTKCESVDAAEQTCASS-ALDIHLNVKNVGTVSGGHSVLLFSS  427
              Q SV +   Q     +   ++V  +   C  S   + H++VKN G++ G H++L+FS 
Sbjct  693  PKQVSVQILSLQALTNSTLSSKAVKVSHANCDDSLETEFHVDVKNEGSMDGTHTLLIFSK  752

Query  426  PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIGH  247
            PP    +  KQLV F K  +     + +  NV  CKHLSVVD+ G R++  G H LHIG 
Sbjct  753  PPPGKWSQIKQLVTFHKTHVPAGSKQRLKVNVHSCKHLSVVDQFGVRRIPTGEHELHIGD  812

Query  246  LKHSLTVE  223
            LKHS+ V+
Sbjct  813  LKHSINVQ  820



>gb|EYU46800.1| hypothetical protein MIMGU_mgv1a018473mg [Erythranthe guttata]
Length=757

 Score =   154 bits (389),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 117/190 (62%), Gaps = 5/190 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSI-VQ  601
            P TWYPQ   +++ M  M MR +P   YPGRTYRFY GP ++ FG+G+SYT F H++   
Sbjct  559  PMTWYPQEYLNNLPMTTMDMRSNPSRNYPGRTYRFYKGPVVYPFGHGMSYTSFAHAVSAD  618

Query  600  AQDSVSLALDQGH----PCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLF  433
            A   VS+ +D  H       +    +V      C   +L + ++VKN G+  G H++L+F
Sbjct  619  APTVVSVPVDGRHHHLYNDTAFSGGAVRVTHARCKGLSLSVGMDVKNTGSRDGSHTLLVF  678

Query  432  SSPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHI  253
            +SPP    AP KQLV F+KVR++    E V   + VCK LSVVD AG R++ +G+H LHI
Sbjct  679  ASPPGGGWAPHKQLVAFEKVRVAAGGQERVAVRIHVCKFLSVVDGAGIRRIPMGVHALHI  738

Query  252  GHLKHSLTVE  223
            G +KHS++++
Sbjct  739  GGVKHSVSLQ  748



>ref|NP_196618.1| putative beta-D-xylosidase 6 [Arabidopsis thaliana]
 sp|Q9LXA8.1|BXL6_ARATH RecName: Full=Probable beta-D-xylosidase 6; Short=AtBXL6; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB89387.1| beta-xylosidase-like protein [Arabidopsis thaliana]
 gb|AAL09717.1| AT5g10560/F12B17_90 [Arabidopsis thaliana]
 gb|AED91563.1| putative beta-D-xylosidase 6 [Arabidopsis thaliana]
Length=792

 Score =   154 bits (390),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 116/199 (58%), Gaps = 16/199 (8%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYP+S  D V+M DM MR +   GYPGRTYRFYTGP ++ FG GLSYTKF + I+ A
Sbjct  597  PTTWYPESFTD-VAMSDMHMRANSSRGYPGRTYRFYTGPQVYSFGTGLSYTKFEYKILSA  655

Query  597  QDSVSLA------------LDQGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSG  454
               +SL+            L  G   R  + +  D    +C S   ++ ++V N G + G
Sbjct  656  PIRLSLSELLPQQSSHKKQLQHGEELRYLQLD--DVIVNSCESLRFNVRVHVSNTGEIDG  713

Query  453  GHSVLLFSS-PPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVA  277
             H V+LFS  PP L   P KQL+G+ +V +  NE    VF +D CK LSV ++ G R + 
Sbjct  714  SHVVMLFSKMPPVLSGVPEKQLIGYDRVHVRSNEMMETVFVIDPCKQLSVANDVGKRVIP  773

Query  276  LGLHVLHIGHLKHSLTVEI  220
            LG HVL +G L+HSL+VE 
Sbjct  774  LGSHVLFLGDLQHSLSVEF  792



>gb|KJB09457.1| hypothetical protein B456_001G143600 [Gossypium raimondii]
Length=797

 Score =   154 bits (389),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 114/189 (60%), Gaps = 6/189 (3%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ    ++ M DM MR      YPGRTY+FY GP ++ FG+GLSYT F H+I  A
Sbjct  602  PMTWYPQEYVSNLPMTDMAMRSSANRNYPGRTYKFYKGPVVYPFGHGLSYTNFVHTIASA  661

Query  597  QDSVSLALD----QGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLLFS  430
               V++ LD     G+   S K   V+     C   ++ + ++VKN G+  G H++L+FS
Sbjct  662  PKVVTVPLDGHRHSGNATISGKAIKVNHVR--CNKLSVGLQVDVKNTGSKDGTHTMLVFS  719

Query  429  SPPALHNAPRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVLHIG  250
             PPA H AP+KQLV F KV +       V  N+ VCK LSVVD +G R++  G+H LHIG
Sbjct  720  KPPAGHWAPQKQLVAFAKVLVPARSQRRVGINIHVCKFLSVVDRSGVRRIPTGVHNLHIG  779

Query  249  HLKHSLTVE  223
             +KH L+++
Sbjct  780  GIKHPLSLQ  788



>gb|KJB72795.1| hypothetical protein B456_011G198200 [Gossypium raimondii]
Length=772

 Score =   154 bits (388),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 118/192 (61%), Gaps = 11/192 (6%)
 Frame = -1

Query  777  PNTWYPQSXADSVSMIDMRMRPDPKTGYPGRTYRFYTGPTLFKFGYGLSYTKFRHSIVQA  598
            P TWYPQ     V M +M +RP    GYPGRTYRFY GP +F FG+GLSYT F+HS+  A
Sbjct  577  PMTWYPQDYVAKVPMTNMGIRP--SRGYPGRTYRFYKGPVVFPFGHGLSYTSFKHSLALA  634

Query  597  QDSVSLALD------QGHPCRSTKCESVDAAEQTCASSALDIHLNVKNVGTVSGGHSVLL  436
               +S+ LD      + +   S+    V  A+    SS    H++V+N G + G H++L+
Sbjct  635  PTDLSVLLDTNLFATKNYSTLSSNAIRVKHAKCDLLSSLF--HIDVENTGNMDGTHTLLV  692

Query  435  FSSPPALHN-APRKQLVGFQKVRLSPnedevvvfnvdVCKHLSVVDEAGNRKVALGLHVL  259
            FS+PPA    +P KQL+GF +V +     + V  N+  CKHLSVVDE G R++ +G H L
Sbjct  693  FSTPPAGQKWSPNKQLIGFHRVHVIAGSKQRVKINIHACKHLSVVDEFGIRRIPMGSHSL  752

Query  258  HIGHLKHSLTVE  223
            HIG LKHS++++
Sbjct  753  HIGDLKHSISLQ  764



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1507754616730