BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF012L17

Length=672
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EPS59790.1|  splicing factor-like protein                            190   3e-57   Genlisea aurea
emb|CDP12845.1|  unnamed protein product                                193   2e-55   Coffea canephora [robusta coffee]
ref|XP_009608714.1|  PREDICTED: RNA-binding protein 39                  195   9e-55   Nicotiana tomentosiformis
ref|XP_009774937.1|  PREDICTED: RNA-binding protein 39                  195   9e-55   Nicotiana sylvestris
ref|XP_011100931.1|  PREDICTED: RNA-binding protein 39                  193   4e-54   Sesamum indicum [beniseed]
ref|XP_010312457.1|  PREDICTED: RNA-binding protein 39                  192   1e-53   Solanum lycopersicum
ref|XP_006351114.1|  PREDICTED: RNA-binding protein 39-like isofo...    188   2e-53   
ref|XP_006351113.1|  PREDICTED: RNA-binding protein 39-like isofo...    190   6e-53   Solanum tuberosum [potatoes]
gb|EYU31126.1|  hypothetical protein MIMGU_mgv1a0042611mg               186   7e-53   Erythranthe guttata [common monkey flower]
gb|EYU24065.1|  hypothetical protein MIMGU_mgv1a002916mg                186   2e-51   Erythranthe guttata [common monkey flower]
gb|KCW54323.1|  hypothetical protein EUGRSUZ_I00287                     159   3e-45   Eucalyptus grandis [rose gum]
gb|EYU31125.1|  hypothetical protein MIMGU_mgv1a0042611mg               162   7e-44   Erythranthe guttata [common monkey flower]
gb|KDO57144.1|  hypothetical protein CISIN_1g0063801mg                  156   7e-44   Citrus sinensis [apfelsine]
gb|AES72769.2|  CC1-like splicing factor                                165   8e-44   Medicago truncatula
emb|CAN82467.1|  hypothetical protein VITISV_002664                     163   1e-43   Vitis vinifera
ref|XP_010680478.1|  PREDICTED: RNA-binding protein 39                  164   2e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010246267.1|  PREDICTED: RNA-binding protein 39 isoform X2       164   2e-43   Nelumbo nucifera [Indian lotus]
ref|XP_010246266.1|  PREDICTED: RNA-binding protein 39 isoform X1       164   2e-43   Nelumbo nucifera [Indian lotus]
emb|CBI21551.3|  unnamed protein product                                163   2e-43   Vitis vinifera
gb|KJB14931.1|  hypothetical protein B456_002G149800                    164   3e-43   Gossypium raimondii
ref|XP_010652895.1|  PREDICTED: RNA-binding protein 39                  163   4e-43   Vitis vinifera
ref|XP_003602517.1|  Splicing factor-like protein                       164   4e-43   
ref|XP_003602518.1|  Splicing factor-like protein                       164   6e-43   
ref|XP_008351323.1|  PREDICTED: RNA-binding protein 39-like             152   2e-42   
gb|KHG29994.1|  RNA-binding 39                                          161   2e-42   Gossypium arboreum [tree cotton]
ref|XP_007137679.1|  hypothetical protein PHAVU_009G146500g             160   3e-42   Phaseolus vulgaris [French bean]
emb|CAC10207.1|  putative splicing factor                               158   3e-42   Cicer arietinum [garbanzo]
ref|XP_003525097.1|  PREDICTED: RNA-binding protein 39-like isofo...    160   6e-42   Glycine max [soybeans]
ref|XP_004503982.1|  PREDICTED: RNA-binding protein 39-like             159   9e-42   
ref|XP_010027731.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...    159   1e-41   
ref|XP_010546379.1|  PREDICTED: RNA-binding protein 39                  158   2e-41   
ref|XP_003531395.1|  PREDICTED: RNA-binding protein 39-like             158   2e-41   Glycine max [soybeans]
ref|XP_007048198.1|  Splicing factor isoform 1                          158   3e-41   
ref|XP_006427900.1|  hypothetical protein CICLE_v10025229mg             157   4e-41   Citrus clementina [clementine]
ref|XP_004502884.1|  PREDICTED: RNA-binding protein 39-like isofo...    157   5e-41   
ref|XP_004502883.1|  PREDICTED: RNA-binding protein 39-like isofo...    157   5e-41   Cicer arietinum [garbanzo]
gb|KJB18367.1|  hypothetical protein B456_003G049000                    157   7e-41   Gossypium raimondii
gb|KHG26899.1|  RNA-binding 39                                          157   8e-41   Gossypium arboreum [tree cotton]
ref|XP_007159797.1|  hypothetical protein PHAVU_002G268000g             156   9e-41   Phaseolus vulgaris [French bean]
ref|XP_007137677.1|  hypothetical protein PHAVU_009G146500g             156   1e-40   Phaseolus vulgaris [French bean]
gb|KHN09571.1|  RNA-binding protein rsd1                                156   1e-40   Glycine soja [wild soybean]
ref|XP_003526844.1|  PREDICTED: RNA-binding protein 39-like             156   1e-40   Glycine max [soybeans]
ref|XP_010452994.1|  PREDICTED: RNA-binding protein 39-like isofo...    150   6e-40   
ref|XP_008231785.1|  PREDICTED: RNA-binding protein 39                  153   1e-39   
ref|XP_011014283.1|  PREDICTED: RNA-binding protein 39-like isofo...    151   2e-39   Populus euphratica
ref|XP_007212812.1|  hypothetical protein PRUPE_ppa002854mg             153   2e-39   Prunus persica
ref|XP_008781452.1|  PREDICTED: RNA-binding protein 39-like             152   3e-39   Phoenix dactylifera
ref|XP_003630170.1|  RNA-binding protein                                151   5e-39   Medicago truncatula
ref|XP_010491632.1|  PREDICTED: RNA-binding protein 39-like             151   6e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010422929.1|  PREDICTED: RNA-binding protein 39-like             150   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_011021826.1|  PREDICTED: RNA-binding protein 39-like             150   1e-38   Populus euphratica
ref|XP_011014282.1|  PREDICTED: RNA-binding protein 39-like isofo...    150   1e-38   Populus euphratica
dbj|BAD93824.1|  splicing factor-like protein                           146   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010452992.1|  PREDICTED: RNA-binding protein 39-like isofo...    150   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010930948.1|  PREDICTED: RNA-binding protein 39                  149   4e-38   
ref|XP_011466737.1|  PREDICTED: RNA-binding protein 39                  149   7e-38   Fragaria vesca subsp. vesca
ref|XP_002873428.1|  predicted protein                                  148   7e-38   Arabidopsis lyrata subsp. lyrata
ref|XP_004160482.1|  PREDICTED: RNA-binding protein 39-like             148   9e-38   
ref|XP_004141977.1|  PREDICTED: RNA-binding protein 39-like             148   1e-37   Cucumis sativus [cucumbers]
ref|XP_011011956.1|  PREDICTED: RNA-binding protein 39-like             147   1e-37   Populus euphratica
ref|XP_010690339.1|  PREDICTED: RNA-binding protein 39                  148   1e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008440993.1|  PREDICTED: RNA-binding protein 39 isoform X4       147   2e-37   Cucumis melo [Oriental melon]
ref|XP_008440991.1|  PREDICTED: RNA-binding protein 39 isoform X2       147   2e-37   Cucumis melo [Oriental melon]
dbj|BAH57172.1|  AT5G09880                                              145   5e-37   Arabidopsis thaliana [mouse-ear cress]
gb|AES72768.2|  CC1-like splicing factor                                145   5e-37   Medicago truncatula
gb|AAO30095.1|  splicing factor-like protein                            145   6e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002306512.2|  hypothetical protein POPTR_0005s19200g             145   6e-37   Populus trichocarpa [western balsam poplar]
ref|XP_002465838.1|  hypothetical protein SORBIDRAFT_01g046740          145   6e-37   Sorghum bicolor [broomcorn]
ref|NP_568220.1|  splicing factor, CC1-like                             145   7e-37   Arabidopsis thaliana [mouse-ear cress]
gb|AFW68703.1|  hypothetical protein ZEAMMB73_109361                    142   8e-37   
ref|XP_010229190.1|  PREDICTED: RNA-binding protein 39-like isofo...    144   8e-37   Brachypodium distachyon [annual false brome]
ref|NP_001169267.1|  hypothetical protein                               142   8e-37   
ref|NP_001142242.1|  uncharacterized protein LOC100274411               142   1e-36   Zea mays [maize]
ref|XP_007137678.1|  hypothetical protein PHAVU_009G146500g             145   1e-36   Phaseolus vulgaris [French bean]
ref|XP_006649420.1|  PREDICTED: RNA-binding protein 39-like isofo...    143   1e-36   
ref|XP_003558785.1|  PREDICTED: RNA-binding protein 39-like isofo...    144   2e-36   Brachypodium distachyon [annual false brome]
ref|XP_008668579.1|  PREDICTED: uncharacterized protein LOC100274...    141   2e-36   
ref|XP_009399181.1|  PREDICTED: RNA-binding protein 39                  144   3e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004985661.1|  PREDICTED: RNA-binding protein 39-like             143   3e-36   Setaria italica
gb|KHN34036.1|  RNA-binding protein 39                                  143   3e-36   Glycine soja [wild soybean]
gb|EEE58341.1|  hypothetical protein OsJ_09449                          143   4e-36   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74539.1|  hypothetical protein OsI_10059                          143   4e-36   Oryza sativa Indica Group [Indian rice]
gb|ABF94032.1|  transposon protein, putative, CACTA, En/Spm sub-c...    143   6e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006649419.1|  PREDICTED: RNA-binding protein 39-like isofo...    142   8e-36   
ref|XP_010935165.1|  PREDICTED: RNA-binding protein 39-like             142   1e-35   Elaeis guineensis
ref|XP_007048199.1|  Splicing factor isoform 2                          141   1e-35   
gb|ADE76571.1|  unknown                                                 135   1e-35   Picea sitchensis
gb|ACN36244.1|  unknown                                                 140   2e-35   Zea mays [maize]
ref|XP_004983028.1|  PREDICTED: RNA-binding protein 39-like isofo...    140   2e-35   Setaria italica
ref|XP_011045848.1|  PREDICTED: RNA-binding protein 39                  141   2e-35   Populus euphratica
ref|XP_002467180.1|  hypothetical protein SORBIDRAFT_01g021020          140   3e-35   Sorghum bicolor [broomcorn]
ref|XP_008338762.1|  PREDICTED: RNA-binding protein 39 isoform X2       141   3e-35   Malus domestica [apple tree]
ref|XP_008338761.1|  PREDICTED: RNA-binding protein 39 isoform X1       141   3e-35   Malus domestica [apple tree]
ref|XP_009384003.1|  PREDICTED: RNA-binding protein 39 isoform X2       139   4e-35   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS53612.1|  RNA-binding protein 39                                  140   4e-35   Triticum urartu
ref|XP_008377726.1|  PREDICTED: RNA-binding protein 39-like             135   4e-35   
emb|CBI37850.3|  unnamed protein product                                139   5e-35   Vitis vinifera
ref|XP_009384002.1|  PREDICTED: RNA-binding protein 39 isoform X1       140   5e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002312948.2|  hypothetical protein POPTR_0009s13940g             140   5e-35   
ref|XP_008809443.1|  PREDICTED: RNA-binding protein 39-like isofo...    140   5e-35   
ref|XP_008809442.1|  PREDICTED: RNA-binding protein 39-like isofo...    140   6e-35   
ref|XP_006661796.1|  PREDICTED: RNA-binding protein 39-like isofo...    137   7e-35   
gb|EMT10841.1|  RNA-binding protein 39                                  139   8e-35   
ref|XP_008644042.1|  PREDICTED: hypothetical protein isoform X1         139   1e-34   
ref|XP_004983027.1|  PREDICTED: RNA-binding protein 39-like isofo...    139   1e-34   Setaria italica
ref|XP_010266038.1|  PREDICTED: RNA-binding protein 39                  139   1e-34   Nelumbo nucifera [Indian lotus]
ref|XP_010920083.1|  PREDICTED: RNA-binding protein 39-like             139   1e-34   Elaeis guineensis
gb|KDP33302.1|  hypothetical protein JCGZ_13089                         139   1e-34   Jatropha curcas
ref|XP_008668576.1|  PREDICTED: uncharacterized protein LOC100274...    139   1e-34   
ref|XP_006589727.1|  PREDICTED: RNA-binding protein 39-like isofo...    138   1e-34   
ref|XP_002279887.2|  PREDICTED: RNA-binding protein 39                  139   1e-34   Vitis vinifera
ref|XP_006661795.1|  PREDICTED: RNA-binding protein 39-like isofo...    137   2e-34   
ref|XP_008806137.1|  PREDICTED: RNA-binding protein 39-like             139   2e-34   
gb|KFK25283.1|  hypothetical protein AALP_AA8G092000                    138   2e-34   Arabis alpina [alpine rockcress]
gb|KHN37392.1|  RNA-binding protein 39                                  136   2e-34   Glycine soja [wild soybean]
gb|KJB12136.1|  hypothetical protein B456_002G002300                    138   2e-34   Gossypium raimondii
gb|KHF98937.1|  RNA-binding 39                                          139   3e-34   Gossypium arboreum [tree cotton]
ref|XP_008382102.1|  PREDICTED: RNA-binding protein 39-like             138   4e-34   
ref|XP_003536719.1|  PREDICTED: RNA-binding protein 39-like isofo...    137   5e-34   Glycine max [soybeans]
ref|XP_010912455.1|  PREDICTED: RNA-binding protein 39-like             137   6e-34   Elaeis guineensis
gb|KFK40079.1|  hypothetical protein AALP_AA3G327700                    136   6e-34   Arabis alpina [alpine rockcress]
emb|CDY40065.1|  BnaC02g00650D                                          136   8e-34   Brassica napus [oilseed rape]
ref|XP_006847132.1|  hypothetical protein AMTR_s00017p00234440          138   9e-34   
gb|AFK46942.1|  unknown                                                 130   1e-33   Lotus japonicus
ref|XP_007041785.1|  Splicing factor isoform 4                          135   1e-33   
gb|KJB32668.1|  hypothetical protein B456_005G254800                    136   1e-33   Gossypium raimondii
ref|XP_009355642.1|  PREDICTED: RNA-binding protein 39 isoform X1       136   2e-33   Pyrus x bretschneideri [bai li]
ref|XP_010530926.1|  PREDICTED: RNA-binding protein 39                  136   2e-33   Tarenaya hassleriana [spider flower]
ref|XP_008236127.1|  PREDICTED: RNA-binding protein 39-like             132   2e-33   
ref|XP_010548117.1|  PREDICTED: RNA-binding protein 39-like             135   2e-33   Tarenaya hassleriana [spider flower]
ref|XP_009355643.1|  PREDICTED: RNA-binding protein 39 isoform X2       136   2e-33   Pyrus x bretschneideri [bai li]
gb|KHG01335.1|  RNA-binding 39                                          136   2e-33   Gossypium arboreum [tree cotton]
ref|XP_006580322.1|  PREDICTED: RNA-binding protein 39-like isofo...    135   3e-33   Glycine max [soybeans]
ref|XP_007201184.1|  hypothetical protein PRUPE_ppa003064mg             135   3e-33   Prunus persica
ref|XP_007041782.1|  Splicing factor isoform 1                          135   4e-33   
ref|XP_008236128.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...    135   5e-33   
ref|XP_011046657.1|  PREDICTED: RNA-binding protein 39-like             135   5e-33   Populus euphratica
ref|XP_002306193.2|  hypothetical protein POPTR_0004s18320g             135   6e-33   Populus trichocarpa [western balsam poplar]
ref|XP_010107642.1|  RNA-binding protein 39                             136   6e-33   
dbj|BAJ92968.1|  predicted protein                                      134   7e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94512.1|  predicted protein                                      134   7e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK06658.1|  predicted protein                                      134   7e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010028763.1|  PREDICTED: RNA-binding protein 39                  134   7e-33   Eucalyptus grandis [rose gum]
gb|KHN29140.1|  RNA-binding protein 39                                  134   1e-32   Glycine soja [wild soybean]
ref|XP_008784182.1|  PREDICTED: RNA-binding protein 39-like             134   1e-32   Phoenix dactylifera
emb|CDY21612.1|  BnaC09g46800D                                          133   1e-32   Brassica napus [oilseed rape]
ref|XP_011088626.1|  PREDICTED: RNA-binding protein 39 isoform X2       133   1e-32   Sesamum indicum [beniseed]
dbj|BAB09409.1|  splicing factor-like protein                           133   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003573971.1|  PREDICTED: RNA-binding protein 39-like             133   2e-32   Brachypodium distachyon [annual false brome]
ref|XP_001782480.1|  predicted protein                                  131   2e-32   
ref|XP_004144853.1|  PREDICTED: RNA-binding protein 39-like             133   2e-32   
ref|XP_011088625.1|  PREDICTED: RNA-binding protein 39 isoform X1       133   2e-32   Sesamum indicum [beniseed]
ref|XP_006409370.1|  hypothetical protein EUTSA_v10022624mg             133   2e-32   Eutrema salsugineum [saltwater cress]
emb|CDX85791.1|  BnaA02g00220D                                          132   2e-32   
gb|KGN43267.1|  hypothetical protein Csa_7G014530                       133   2e-32   Cucumis sativus [cucumbers]
gb|ABB47696.1|  splicing factor, CC1-like family protein, expressed     130   2e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009122113.1|  PREDICTED: RNA-binding protein 39                  132   2e-32   Brassica rapa
ref|XP_009125340.1|  PREDICTED: RNA-binding protein 39-like             132   3e-32   Brassica rapa
ref|XP_008447937.1|  PREDICTED: RNA-binding protein 39 isoform X2       132   3e-32   Cucumis melo [Oriental melon]
ref|XP_008447936.1|  PREDICTED: RNA-binding protein 39 isoform X1       132   3e-32   Cucumis melo [Oriental melon]
ref|XP_006829172.1|  hypothetical protein AMTR_s00001p00270600          133   3e-32   Amborella trichopoda
gb|EMT08795.1|  RNA-binding protein 39                                  133   3e-32   
gb|EMS55916.1|  RNA-binding protein 39                                  133   3e-32   Triticum urartu
ref|XP_002516388.1|  splicing factor, putative                          132   4e-32   Ricinus communis
gb|ABB47695.1|  splicing factor, CC1-like family protein, expressed     130   4e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006299838.1|  hypothetical protein CARUB_v10016041mg             130   1e-31   Capsella rubella
gb|KJB12137.1|  hypothetical protein B456_002G002300                    130   2e-31   Gossypium raimondii
ref|XP_007142808.1|  hypothetical protein PHAVU_007G018500g             130   2e-31   Phaseolus vulgaris [French bean]
ref|XP_008338763.1|  PREDICTED: RNA-binding protein 39 isoform X3       130   2e-31   Malus domestica [apple tree]
gb|AAM20703.1|  putative splicing factor                                128   5e-31   Arabidopsis thaliana [mouse-ear cress]
gb|EYU37971.1|  hypothetical protein MIMGU_mgv1a003198mg                129   6e-31   Erythranthe guttata [common monkey flower]
gb|KDO68180.1|  hypothetical protein CISIN_1g006398mg                   129   6e-31   Citrus sinensis [apfelsine]
ref|XP_010467428.1|  PREDICTED: RNA-binding protein 39-like isofo...    127   6e-31   Camelina sativa [gold-of-pleasure]
gb|EAY78664.1|  hypothetical protein OsI_33765                          128   6e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_006486689.1|  PREDICTED: RNA-binding protein 39-like isofo...    129   7e-31   
ref|XP_010489301.1|  PREDICTED: RNA-binding protein 39-like isofo...    127   7e-31   
ref|XP_006422532.1|  hypothetical protein CICLE_v10027985mg             129   7e-31   Citrus clementina [clementine]
gb|KDO68179.1|  hypothetical protein CISIN_1g006398mg                   129   7e-31   Citrus sinensis [apfelsine]
ref|XP_006486688.1|  PREDICTED: RNA-binding protein 39-like isofo...    129   8e-31   
ref|XP_006422531.1|  hypothetical protein CICLE_v10027985mg             129   8e-31   
ref|XP_006486687.1|  PREDICTED: RNA-binding protein 39-like isofo...    129   8e-31   
ref|XP_006486686.1|  PREDICTED: RNA-binding protein 39-like isofo...    129   8e-31   Citrus sinensis [apfelsine]
gb|EEE51022.1|  hypothetical protein OsJ_31660                          128   8e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006486685.1|  PREDICTED: RNA-binding protein 39-like isofo...    129   8e-31   Citrus sinensis [apfelsine]
ref|NP_565399.1|  splicing factor, CC1-like protein                     127   2e-30   Arabidopsis thaliana [mouse-ear cress]
gb|AAM62839.1|  putative splicing factor                                127   2e-30   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ85781.1|  unknown                                                 125   2e-30   Medicago truncatula
ref|XP_002976923.1|  hypothetical protein SELMODRAFT_151471             127   2e-30   Selaginella moellendorffii
ref|XP_004290736.1|  PREDICTED: RNA-binding protein 39                  127   3e-30   Fragaria vesca subsp. vesca
ref|XP_010467427.1|  PREDICTED: RNA-binding protein 39-like isofo...    127   3e-30   Camelina sativa [gold-of-pleasure]
ref|XP_002886087.1|  hypothetical protein ARALYDRAFT_480573             127   3e-30   
ref|XP_010489300.1|  PREDICTED: RNA-binding protein 39-like isofo...    126   3e-30   
ref|NP_001189538.1|  splicing factor, CC1-like protein                  127   4e-30   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189537.1|  splicing factor, CC1-like protein                  127   4e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003555861.1|  PREDICTED: RNA-binding protein 39-like             126   6e-30   Glycine max [soybeans]
ref|XP_010515902.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...    125   8e-30   Camelina sativa [gold-of-pleasure]
ref|XP_001776557.1|  predicted protein                                  123   2e-29   
gb|KCW55580.1|  hypothetical protein EUGRSUZ_I01450                     124   3e-29   Eucalyptus grandis [rose gum]
tpg|DAA49863.1|  TPA: hypothetical protein ZEAMMB73_656561              122   4e-29   
emb|CDX89762.1|  BnaC03g46760D                                          117   1e-28   
ref|XP_004497188.1|  PREDICTED: RNA-binding protein 39-like             122   1e-28   Cicer arietinum [garbanzo]
emb|CDP19575.1|  unnamed protein product                                121   4e-28   Coffea canephora [robusta coffee]
emb|CDX71317.1|  BnaC07g05960D                                          123   5e-28   
ref|XP_010088741.1|  RNA-binding protein 39                             120   3e-27   
ref|XP_009121181.1|  PREDICTED: RNA-binding protein 39 isoform X1       118   3e-27   Brassica rapa
ref|XP_009121183.1|  PREDICTED: RNA-binding protein 39 isoform X2       118   4e-27   Brassica rapa
ref|XP_006399474.1|  hypothetical protein EUTSA_v100130050mg            115   4e-26   
emb|CDY31398.1|  BnaA07g03330D                                          117   5e-26   Brassica napus [oilseed rape]
ref|XP_005650141.1|  splicing factor, CC1-like protein                  112   3e-25   Coccomyxa subellipsoidea C-169
ref|XP_002508355.1|  predicted protein                                  112   4e-25   Micromonas commoda
ref|XP_010515913.1|  PREDICTED: RNA-binding protein 39-like           99.0    9e-23   Camelina sativa [gold-of-pleasure]
gb|KJE89116.1|  RNA binding domain-containing protein 39, variant       103   2e-22   Capsaspora owczarzaki ATCC 30864
ref|XP_007199063.1|  hypothetical protein PRUPE_ppa018661mg             103   2e-22   
ref|XP_010495125.1|  PREDICTED: RNA-binding protein 39-like           96.7    8e-22   
ref|XP_004365528.1|  RNA binding domain-containing protein 39           103   1e-21   Capsaspora owczarzaki ATCC 30864
ref|XP_005850115.1|  hypothetical protein CHLNCDRAFT_57088              102   1e-21   Chlorella variabilis
ref|XP_005703854.1|  RNA-binding protein                                103   1e-21   Galdieria sulphuraria
ref|XP_003080863.1|  RNA recognition motif (ISS)                      99.4    5e-21   
emb|CEG01539.1|  Nucleotide-binding, alpha-beta plait                 99.4    2e-20   Ostreococcus tauri
ref|XP_003059052.1|  predicted protein                                98.6    4e-20   Micromonas pusilla CCMP1545
gb|EFA79920.1|  putative RNA splicing factor                          99.0    4e-20   Heterostelium album PN500
gb|KDR08287.1|  RNA-binding protein 39                                95.9    8e-20   Zootermopsis nevadensis
ref|XP_001419396.1|  predicted protein                                97.4    9e-20   Ostreococcus lucimarinus CCE9901
ref|XP_002108274.1|  hypothetical protein TRIADDRAFT_37071            95.1    1e-19   Trichoplax adhaerens
ref|XP_008475058.1|  PREDICTED: RNA-binding protein 39 isoform X3     93.6    3e-19   
ref|XP_002018768.1|  GL25979                                          93.6    3e-19   
gb|KJB14937.1|  hypothetical protein B456_002G149800                  95.5    5e-19   Gossypium raimondii
ref|XP_317010.3|  AGAP008433-PA                                       95.5    5e-19   Anopheles gambiae str. PEST
gb|KFB39087.1|  AGAP008433-PA-like protein                            95.5    5e-19   Anopheles sinensis
ref|XP_001869868.1|  splicing factor                                  95.1    6e-19   Culex quinquefasciatus
ref|XP_004334854.1|  splicing factor, CC1like subfamily protein       95.1    7e-19   Acanthamoeba castellanii str. Neff
ref|XP_002428613.1|  RNA-binding region-containing protein, putative  95.1    7e-19   Pediculus humanus corporis [human body lice]
emb|CDH60258.1|  splicing factor cc1-like protein                     94.4    7e-19   Lichtheimia corymbifera JMRC:FSU:9682
emb|CDH60257.1|  splicing factor cc1-like protein                     94.4    7e-19   Lichtheimia corymbifera JMRC:FSU:9682
dbj|GAM16879.1|  hypothetical protein SAMD00019534_000540             95.1    7e-19   Acytostelium subglobosum LB1
ref|XP_001865056.1|  splicing factor                                  94.4    1e-18   Culex quinquefasciatus
ref|XP_008475057.1|  PREDICTED: RNA-binding protein 39 isoform X2     92.8    1e-18   
emb|CBJ30774.1|  conserved unknown protein                            94.4    1e-18   Ectocarpus siliculosus
ref|XP_002078467.1|  GD23448                                          94.4    1e-18   
ref|XP_001626026.1|  predicted protein                                93.2    2e-18   Nematostella vectensis
ref|XP_002036031.1|  GM16278                                          93.6    2e-18   Drosophila sechellia
gb|EXX55443.1|  Pab1p                                                 92.8    3e-18   Rhizophagus irregularis DAOM 197198w
emb|CDS08376.1|  hypothetical protein LRAMOSA02324                    92.4    3e-18   Lichtheimia ramosa
emb|CBK24895.2|  unnamed protein product                              92.4    3e-18   Blastocystis hominis
gb|ENN76275.1|  hypothetical protein YQE_07239                        93.2    3e-18   Dendroctonus ponderosae
ref|XP_004929275.1|  PREDICTED: RNA-binding protein 39-like isofo...  91.3    3e-18   
ref|XP_001650224.1|  AAEL005046-PA                                    92.8    3e-18   
gb|ESA21112.1|  hypothetical protein GLOINDRAFT_92051                 92.4    3e-18   
ref|XP_008475056.1|  PREDICTED: RNA-binding protein 39 isoform X1     92.4    4e-18   
ref|XP_003283761.1|  hypothetical protein DICPUDRAFT_74732            92.8    5e-18   Dictyostelium purpureum
ref|XP_001357388.2|  GA10876                                          92.4    7e-18   Drosophila pseudoobscura pseudoobscura
ref|XP_001970115.1|  GG10454                                          92.4    7e-18   
ref|NP_609095.1|  CG11266, isoform B                                  92.4    7e-18   Drosophila melanogaster
ref|XP_005167281.1|  PREDICTED: RNA binding motif protein 39b iso...  90.9    9e-18   Danio rerio [leopard danio]
ref|XP_002065089.1|  GK15272                                          92.0    1e-17   Drosophila willistoni
ref|XP_007515160.1|  predicted protein                                91.7    1e-17   Bathycoccus prasinos
ref|XP_004351712.1|  putative RNA splicing factor                     91.3    2e-17   Cavenderia fasciculata
ref|XP_001992854.1|  GH13506                                          91.3    2e-17   Drosophila grimshawi
ref|XP_002088083.1|  GE14328                                          90.9    2e-17   Drosophila yakuba
ref|XP_001961412.1|  GF14957                                          90.9    2e-17   Drosophila ananassae
ref|XP_002957532.1|  hypothetical protein VOLCADRAFT_84128            89.0    3e-17   Volvox carteri f. nagariensis
ref|XP_004533936.1|  PREDICTED: RNA-binding protein 39-like isofo...  90.5    3e-17   Ceratitis capitata [medfly]
ref|XP_011401211.1|  RNA-binding protein 39                           88.6    3e-17   Auxenochlorella protothecoides
ref|XP_004533937.1|  PREDICTED: RNA-binding protein 39-like isofo...  90.5    3e-17   
ref|NP_001014392.1|  RNA binding motif protein 39b                    90.1    3e-17   Danio rerio [leopard danio]
ref|XP_011199818.1|  PREDICTED: RNA-binding protein 39                90.1    3e-17   Bactrocera dorsalis [papaya fruit fly]
ref|XP_004929274.1|  PREDICTED: RNA-binding protein 39-like isofo...  89.7    4e-17   Bombyx mori [silk moth]
ref|XP_002057597.1|  GJ18017                                          89.7    5e-17   Drosophila virilis
ref|XP_005762142.1|  hypothetical protein EMIHUDRAFT_124866           84.3    6e-17   Emiliania huxleyi CCMP1516
emb|CDQ85498.1|  unnamed protein product                              84.0    7e-17   Oncorhynchus mykiss
ref|XP_007874255.1|  hypothetical protein PNEG_02266                  87.8    8e-17   Pneumocystis murina B123
ref|XP_005189704.2|  PREDICTED: RNA-binding protein 39                89.0    8e-17   Musca domestica
gb|ETN62863.1|  splicing factor                                       88.6    1e-16   Anopheles darlingi [American malaria mosquito]
ref|XP_003054955.1|  predicted protein                                89.0    1e-16   Micromonas pusilla CCMP1545
ref|XP_002002944.1|  GI10246                                          88.6    1e-16   Drosophila mojavensis
gb|KIL70866.1|  hypothetical protein M378DRAFT_183435                 88.2    1e-16   Amanita muscaria Koide BX008
ref|XP_011190768.1|  PREDICTED: RNA-binding protein 39 isoform X2     88.2    2e-16   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011190766.1|  PREDICTED: RNA-binding protein 39 isoform X1     88.2    2e-16   
gb|AEG78359.1|  RNA binding motif protein 39                          85.1    2e-16   Epinephelus coioides [estuary cod]
gb|KFH68543.1|  hypothetical protein MVEG_05356                       86.3    2e-16   
ref|XP_002395467.1|  hypothetical protein MPER_04477                  84.0    2e-16   
ref|XP_008193890.1|  PREDICTED: RNA-binding protein 39                87.8    2e-16   
ref|XP_638966.1|  hypothetical protein DDB_G0283687                   87.8    3e-16   
gb|KFM61555.1|  RNA-binding protein 39                                87.0    3e-16   
gb|EFN77277.1|  RNA-binding protein 39                                85.5    3e-16   
ref|XP_006561781.1|  PREDICTED: RNA-binding protein 39-like isofo...  85.9    4e-16   
ref|XP_006454314.1|  hypothetical protein AGABI2DRAFT_189584          87.0    4e-16   
ref|XP_007325678.1|  hypothetical protein AGABI1DRAFT_110515          87.0    4e-16   
gb|EHJ67964.1|  putative RNA-binding region-containing protein        86.7    4e-16   
gb|ETO31048.1|  RNA splicing factor                                   87.0    5e-16   
tpg|DAA49862.1|  TPA: hypothetical protein ZEAMMB73_656561            86.3    6e-16   
ref|XP_005784360.1|  hypothetical protein EMIHUDRAFT_231170           84.0    6e-16   
ref|XP_002503985.1|  predicted protein                                87.0    6e-16   
ref|XP_001198098.2|  PREDICTED: RNA-binding protein 39-like           86.7    6e-16   
ref|XP_003037450.1|  hypothetical protein SCHCODRAFT_80935            85.5    7e-16   
gb|KIK70947.1|  hypothetical protein GYMLUDRAFT_66156                 86.3    7e-16   
gb|KFM62488.1|  RNA-binding protein 39                                85.9    8e-16   
ref|XP_008440990.1|  PREDICTED: RNA-binding protein 39 isoform X1     86.3    8e-16   
gb|EGT33870.1|  hypothetical protein CAEBREN_20987                    85.9    8e-16   
ref|XP_008440992.1|  PREDICTED: RNA-binding protein 39 isoform X3     86.3    8e-16   
ref|XP_003707644.1|  PREDICTED: RNA-binding protein 39-like isofo...  85.9    9e-16   
ref|XP_011302429.1|  PREDICTED: RNA-binding protein 39 isoform X2     85.9    9e-16   
ref|XP_003488967.1|  PREDICTED: RNA-binding protein 39-like isofo...  85.9    9e-16   
ref|XP_003397900.1|  PREDICTED: RNA-binding protein 39-like isofo...  85.9    9e-16   
ref|XP_003707643.1|  PREDICTED: RNA-binding protein 39-like isofo...  85.9    9e-16   
ref|XP_011302428.1|  PREDICTED: RNA-binding protein 39 isoform X1     85.9    9e-16   
ref|XP_011338563.1|  PREDICTED: RNA-binding protein 39 isoform X3     85.5    9e-16   
ref|XP_011063536.1|  PREDICTED: RNA-binding protein 39                85.9    9e-16   
ref|XP_011255735.1|  PREDICTED: RNA-binding protein 39 isoform X2     85.5    9e-16   
ref|XP_011338561.1|  PREDICTED: RNA-binding protein 39 isoform X1     85.9    9e-16   
ref|XP_011150397.1|  PREDICTED: RNA-binding protein 39 isoform X1     85.9    9e-16   
ref|XP_003488966.1|  PREDICTED: RNA-binding protein 39-like isofo...  85.9    9e-16   
ref|XP_011150398.1|  PREDICTED: RNA-binding protein 39 isoform X2     85.5    9e-16   
ref|XP_011255734.1|  PREDICTED: RNA-binding protein 39 isoform X1     85.9    1e-15   
ref|XP_011158188.1|  PREDICTED: RNA-binding protein 39                85.9    1e-15   
ref|XP_011338562.1|  PREDICTED: RNA-binding protein 39 isoform X2     85.5    1e-15   
ref|XP_003397899.1|  PREDICTED: RNA-binding protein 39-like isofo...  85.5    1e-15   
ref|XP_003690330.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...  85.5    1e-15   
ref|XP_624668.3|  PREDICTED: RNA-binding protein 39-like isoform X6   85.5    1e-15   
ref|XP_006561778.1|  PREDICTED: RNA-binding protein 39-like isofo...  85.5    1e-15   
ref|XP_006561779.1|  PREDICTED: RNA-binding protein 39-like isofo...  85.5    1e-15   
ref|XP_006561777.1|  PREDICTED: RNA-binding protein 39-like isofo...  85.5    1e-15   
emb|CCJ30702.1|  unnamed protein product                              85.1    1e-15   
ref|XP_007265705.1|  splicing factor, CC1-like protein                84.7    2e-15   
ref|XP_002634852.1|  Hypothetical protein CBG13969                    85.1    2e-15   
emb|CAP32600.2|  Protein CBG13969                                     85.1    2e-15   
ref|XP_011475547.1|  PREDICTED: RNA-binding protein 39-like isofo...  84.7    2e-15   
emb|CDY02226.1|  BnaA03g39410D                                        85.9    2e-15   
gb|KDQ16749.1|  hypothetical protein BOTBODRAFT_106812                84.3    2e-15   
ref|XP_010864905.1|  PREDICTED: RNA-binding protein 39-like isofo...  84.7    2e-15   
ref|XP_003099004.1|  hypothetical protein CRE_26746                   85.1    2e-15   
ref|XP_004070573.1|  PREDICTED: RNA-binding protein 39-like isofo...  84.7    2e-15   
ref|XP_010864907.1|  PREDICTED: RNA-binding protein 39-like isofo...  84.7    2e-15   
ref|XP_010864906.1|  PREDICTED: RNA-binding protein 39-like isofo...  84.7    2e-15   
gb|EPT03834.1|  splicing factor CC1-like protein                      84.3    2e-15   
gb|ACI33760.1|  RNA-binding protein 39                                84.7    2e-15   
ref|XP_001873182.1|  predicted protein                                84.0    3e-15   
emb|CAG11305.1|  unnamed protein product                              84.3    3e-15   
ref|XP_007842790.1|  rna-binding protein 39-like isoform 1            84.3    3e-15   
ref|XP_002159647.1|  PREDICTED: RNA-binding protein 39-like           84.3    3e-15   
gb|KFW08762.1|  RNA-binding protein 39                                84.3    3e-15   
gb|KII93760.1|  hypothetical protein PLICRDRAFT_171473                83.6    3e-15   
emb|CDQ68309.1|  unnamed protein product                              84.3    3e-15   
gb|ETI44919.1|  hypothetical protein, variant 1                       84.3    3e-15   
gb|ETI44918.1|  hypothetical protein F443_10365                       84.3    3e-15   
ref|XP_010749473.1|  PREDICTED: RNA-binding protein 39 isoform X1     84.0    4e-15   
ref|XP_010749479.1|  PREDICTED: RNA-binding protein 39 isoform X2     84.0    4e-15   
ref|XP_010153670.1|  PREDICTED: RNA-binding protein 39                84.0    4e-15   
gb|KIK07027.1|  hypothetical protein K443DRAFT_673923                 84.0    4e-15   
gb|KJA29462.1|  hypothetical protein HYPSUDRAFT_32927                 84.0    5e-15   
ref|XP_007234799.1|  PREDICTED: RNA-binding protein 39-like isofo...  83.6    5e-15   
ref|XP_011386110.1|  hypothetical protein UMAG_00164                  84.0    6e-15   
ref|XP_007234801.1|  PREDICTED: RNA-binding protein 39-like isofo...  83.2    6e-15   
ref|XP_002903307.1|  conserved hypothetical protein                   83.6    6e-15   
ref|XP_007234797.1|  PREDICTED: RNA-binding protein 39-like isofo...  83.2    7e-15   
gb|KIJ45270.1|  hypothetical protein M422DRAFT_251452                 83.2    8e-15   
gb|KDR84953.1|  hypothetical protein GALMADRAFT_131717                83.2    8e-15   
ref|XP_008031849.1|  splicing factor CC1-like protein                 81.3    8e-15   
ref|XP_003963398.1|  PREDICTED: RNA-binding protein 39-like           82.8    9e-15   
gb|KDQ30832.1|  hypothetical protein PLEOSDRAFT_49497                 82.4    9e-15   
ref|XP_008301948.1|  PREDICTED: RNA-binding protein 39-like           82.8    9e-15   
gb|KDQ63590.1|  hypothetical protein JAAARDRAFT_120563                83.2    9e-15   
emb|CCA22234.1|  conserved hypothetical protein                       82.0    9e-15   
ref|XP_008547303.1|  PREDICTED: RNA-binding protein 39 isoform X1     82.8    9e-15   
ref|XP_008547304.1|  PREDICTED: RNA-binding protein 39 isoform X2     82.8    9e-15   
ref|XP_007378704.1|  splicing factor CC1-like protein                 82.4    9e-15   
ref|XP_008317639.1|  PREDICTED: RNA-binding protein 39                82.8    9e-15   
emb|CDO71619.1|  hypothetical protein BN946_scf184911.g89             83.2    1e-14   
ref|XP_002742404.1|  PREDICTED: RNA-binding protein 39-like isofo...  82.4    1e-14   
ref|NP_741301.1|  Protein Y55F3AM.3, isoform c                        81.6    1e-14   
pdb|4OZ0|A  Chain A, Crystal Structure Of Human Caperalpha U2af H...  77.4    1e-14   
ref|XP_006639711.1|  PREDICTED: LOW QUALITY PROTEIN: RNA-binding ...  82.0    1e-14   
emb|CAM34544.1|  RNA binding motif protein 39                         77.8    2e-14   
gb|KIM48235.1|  hypothetical protein M413DRAFT_63161                  82.4    2e-14   
gb|EFX83536.1|  hypothetical protein DAPPUDRAFT_194972                80.9    2e-14   
pdb|2LQ5|A  Chain A, Nmr Structure Of The Rna Binding Motif 39 (R...  77.4    2e-14   
pdb|4J5O|A  Chain A, Room Temperature Crystal Structure Of A Rna ...  77.0    2e-14   
emb|CDQ00335.1|  Protein Bm6851, isoform a                            81.3    2e-14   
ref|XP_009066578.1|  hypothetical protein LOTGIDRAFT_184582           81.3    2e-14   
emb|CCI48613.1|  unnamed protein product                              82.0    2e-14   
ref|XP_002912089.1|  hypothetical protein CC1G_13622                  81.6    2e-14   
ref|NP_500025.1|  Protein Y55F3AM.3, isoform a                        81.6    2e-14   
gb|KIJ68490.1|  hypothetical protein HYDPIDRAFT_24760                 81.6    2e-14   
dbj|BAE22009.1|  unnamed protein product                              77.8    2e-14   
emb|CCF53883.1|  related to RNA-binding region containing protein 2   81.6    3e-14   
ref|NP_594422.2|  RNA-binding protein Rsd1 (predicted)                81.6    3e-14   
emb|CAM35485.1|  RNA binding motif protein 39                         75.9    3e-14   
gb|EJW82425.1|  splicing factor                                       80.9    3e-14   
gb|KIJ21787.1|  hypothetical protein PAXINDRAFT_165177                81.3    3e-14   
gb|EST09793.1|  transcriptional coactivator CAPER                     80.9    3e-14   
ref|XP_005091304.1|  PREDICTED: RNA-binding protein 39-like isofo...  81.3    3e-14   
gb|EMD42070.1|  hypothetical protein CERSUDRAFT_90674                 81.3    4e-14   
ref|XP_007336725.1|  splicing factor, CC1-like protein                80.9    4e-14   
emb|CBQ67560.1|  related to RNA-binding region containing protein 2   81.3    4e-14   
ref|XP_007762617.1|  splicing factor CC1-like protein                 79.7    4e-14   
ref|XP_003439056.1|  PREDICTED: RNA-binding protein 39-like isofo...  80.5    4e-14   
gb|KIO08312.1|  hypothetical protein M404DRAFT_937265                 80.9    4e-14   
ref|XP_005740561.1|  PREDICTED: RNA-binding protein 39-like           80.5    5e-14   
gb|KDN53001.1|  splicing factor, CC1-like protein                     80.9    5e-14   
emb|CCL99044.1|  predicted protein                                    80.9    5e-14   
gb|EYB89537.1|  hypothetical protein Y032_0230g2943                   77.8    5e-14   
gb|ETP42816.1|  hypothetical protein, variant 1                       80.9    5e-14   
gb|ETK84921.1|  hypothetical protein, variant 1                       80.9    5e-14   
ref|XP_005448808.1|  PREDICTED: RNA-binding protein 39-like isofo...  80.5    5e-14   
ref|XP_008893451.1|  hypothetical protein, variant 1                  80.5    5e-14   
gb|KDN40378.1|  hypothetical protein RSAG8_08141                      80.1    5e-14   
gb|EUC61967.1|  splicing factor CC1-like protein                      80.5    5e-14   
gb|ETP42815.1|  hypothetical protein F442_10283                       80.9    5e-14   
gb|ETK84920.1|  hypothetical protein L915_10141                       80.9    5e-14   
ref|XP_008893450.1|  hypothetical protein PPTG_01815                  80.9    5e-14   
emb|CDQ00334.1|  Protein Bm6851, isoform b                            80.9    5e-14   
ref|XP_007390520.1|  hypothetical protein PHACADRAFT_247456           80.9    5e-14   
gb|ETL91469.1|  hypothetical protein, variant 1                       80.5    6e-14   
gb|ETL91468.1|  hypothetical protein L917_09977                       80.5    6e-14   
ref|XP_004546125.1|  PREDICTED: RNA-binding protein 39-like           80.5    6e-14   
ref|XP_007906874.1|  PREDICTED: RNA-binding protein 39 isoform X3     80.1    7e-14   
ref|XP_007906872.1|  PREDICTED: RNA-binding protein 39 isoform X2     80.1    7e-14   
emb|CDQ00333.1|  Protein Bm6851, isoform d                            80.5    7e-14   
ref|XP_011503671.1|  PREDICTED: RNA-binding protein 39                80.1    7e-14   
ref|XP_007906870.1|  PREDICTED: RNA-binding protein 39 isoform X1     80.1    7e-14   
gb|ELU40879.1|  splicing factor, CC1-like family protein              79.3    7e-14   
ref|XP_001893221.1|  splicing factor, CC1-like family protein         80.5    8e-14   
emb|CDQ86615.1|  unnamed protein product                              80.1    8e-14   
emb|CDQ00332.1|  Protein Bm6851, isoform c                            80.5    8e-14   
pdb|3S6E|A  Chain A, Crystal Structure Of A Rna Binding Motif Pro...  75.5    8e-14   
gb|EFO25730.2|  hypothetical protein LOAG_02757                       80.1    8e-14   
gb|KIK47836.1|  hypothetical protein CY34DRAFT_798916                 80.1    9e-14   
gb|KIY50466.1|  splicing factor, CC1-like protein                     79.7    9e-14   
ref|XP_003138342.1|  hypothetical protein LOAG_02757                  80.1    1e-13   
gb|ERG84172.1|  rna-binding protein 39                                80.1    1e-13   
ref|XP_009304299.1|  PREDICTED: RNA-binding protein 39 isoform X4     77.4    1e-13   
ref|XP_009541101.1|  hypothetical protein HETIRDRAFT_99556            79.3    1e-13   
gb|ACI33514.1|  RNA-binding protein 39                                79.3    1e-13   
emb|CCA69965.1|  related to splicing factor HCC1                      79.3    1e-13   
emb|CDW54948.1|  RNA binding protein 39                               79.0    1e-13   
ref|XP_005830691.1|  hypothetical protein GUITHDRAFT_163728           79.3    1e-13   
gb|KFP45750.1|  RNA-binding protein 39                                78.6    1e-13   
ref|XP_010126667.1|  PREDICTED: RNA-binding protein 39                78.6    1e-13   
ref|XP_010082280.1|  PREDICTED: RNA-binding protein 39                78.6    2e-13   
ref|XP_005719036.1|  RNA splicing factor (Pad-1), putative            79.3    2e-13   
gb|KHN88755.1|  RNA-binding protein 39                                79.3    2e-13   
ref|XP_005805707.1|  PREDICTED: RNA-binding protein 39-like           79.0    2e-13   
gb|EOB02393.1|  RNA-binding protein 39                                78.2    2e-13   
gb|KFW91694.1|  RNA-binding protein 39                                78.6    2e-13   
gb|KFV15753.1|  RNA-binding protein 39                                78.6    2e-13   
ref|XP_004946950.1|  PREDICTED: RNA-binding protein 39-like isofo...  78.6    2e-13   
ref|NP_001086950.1|  RNA binding motif protein 39                     79.0    2e-13   
ref|XP_009504205.1|  PREDICTED: RNA-binding protein 39                78.6    2e-13   
ref|NP_001135964.1|  RNA binding motif protein 39                     79.0    2e-13   
ref|XP_009922371.1|  PREDICTED: RNA-binding protein 39 isoform X5     78.6    2e-13   
ref|XP_009922370.1|  PREDICTED: RNA-binding protein 39 isoform X4     78.6    2e-13   
emb|CDI51110.1|  related to splicing factor HCC1                      79.0    2e-13   
ref|NP_001135965.1|  RNA binding motif protein 39                     78.6    2e-13   
ref|XP_005056983.1|  PREDICTED: RNA-binding protein 39 isoform X3     78.6    2e-13   
gb|ELT96187.1|  hypothetical protein CAPTEDRAFT_148377                76.3    2e-13   
ref|XP_004014586.1|  PREDICTED: RNA-binding protein 39 isoform 7      77.4    2e-13   
ref|XP_004062119.1|  PREDICTED: RNA-binding protein 39 isoform 6      77.4    3e-13   
ref|XP_009304298.1|  PREDICTED: RNA-binding protein 39 isoform X3     77.4    3e-13   
pdb|4RU2|A  Chain A, Crystal Structure Of A Rna-binding Protein 3...  73.9    3e-13   
gb|KFP69473.1|  RNA-binding protein 39                                78.2    3e-13   
ref|XP_007562369.1|  PREDICTED: RNA-binding protein 39-like           78.2    3e-13   
emb|CAD97833.1|  hypothetical protein                                 77.4    3e-13   
ref|XP_009485299.1|  PREDICTED: RNA-binding protein 39                78.2    3e-13   
gb|KFQ63281.1|  RNA-binding protein 39                                78.2    3e-13   
ref|XP_004014585.1|  PREDICTED: RNA-binding protein 39 isoform 6      77.4    3e-13   
gb|ETN82727.1|  splicing factor, CC1-like family                      77.4    3e-13   
ref|XP_004062118.1|  PREDICTED: RNA-binding protein 39 isoform 5      77.4    3e-13   
ref|XP_006801953.1|  PREDICTED: RNA-binding protein 39-like           77.4    3e-13   
emb|CDQ67762.1|  unnamed protein product                              78.2    3e-13   
ref|XP_008319473.1|  PREDICTED: RNA-binding protein 39-like isofo...  78.2    3e-13   
ref|XP_005056981.1|  PREDICTED: RNA-binding protein 39 isoform X1     78.2    3e-13   
emb|CAE45890.1|  hypothetical protein                                 77.4    3e-13   
ref|XP_010720539.1|  PREDICTED: RNA-binding protein 39 isoform X3     78.2    3e-13   
gb|KGL94351.1|  RNA-binding protein 39                                78.2    3e-13   
gb|KFM10187.1|  RNA-binding protein 39                                78.2    3e-13   
ref|XP_009860969.1|  PREDICTED: RNA-binding protein 39-like           78.2    3e-13   
ref|XP_008401686.1|  PREDICTED: RNA-binding protein 39-like           78.2    3e-13   
ref|XP_010141968.1|  PREDICTED: RNA-binding protein 39                78.2    3e-13   
gb|KFV90289.1|  RNA-binding protein 39                                78.2    3e-13   
ref|XP_008319470.1|  PREDICTED: RNA-binding protein 39-like isofo...  78.2    3e-13   
ref|XP_005056982.1|  PREDICTED: RNA-binding protein 39 isoform X2     77.8    3e-13   
emb|CCX04394.1|  Similar to RNA-binding protein rsd1; acc. no. O1...  78.2    4e-13   
gb|KFP31531.1|  RNA-binding protein 39                                77.8    4e-13   
ref|XP_005091305.1|  PREDICTED: RNA-binding protein 39-like isofo...  78.2    4e-13   
ref|NP_001016788.1|  RNA binding motif protein 39                     78.2    4e-13   
ref|XP_010010132.1|  PREDICTED: RNA-binding protein 39 isoform X2     77.8    4e-13   
gb|KFV45653.1|  RNA-binding protein 39                                77.8    4e-13   
ref|XP_008319472.1|  PREDICTED: RNA-binding protein 39-like isofo...  77.8    4e-13   
ref|XP_008641705.1|  PREDICTED: RNA-binding protein 39 isoform X1     77.8    4e-13   
ref|XP_009571583.1|  PREDICTED: RNA-binding protein 39 isoform X1     77.8    4e-13   
ref|XP_010010131.1|  PREDICTED: RNA-binding protein 39 isoform X1     77.8    4e-13   
ref|XP_009995344.1|  PREDICTED: RNA-binding protein 39                77.4    4e-13   
ref|XP_009973767.1|  PREDICTED: RNA-binding protein 39 isoform X1     77.8    4e-13   
ref|XP_009559298.1|  PREDICTED: RNA-binding protein 39 isoform X1     77.8    4e-13   
ref|XP_008932672.1|  PREDICTED: RNA-binding protein 39 isoform X1     77.8    4e-13   
gb|KIK96278.1|  hypothetical protein PAXRUDRAFT_320094                78.2    4e-13   
ref|XP_009900193.1|  PREDICTED: RNA-binding protein 39 isoform X2     77.8    4e-13   
ref|XP_010214992.1|  PREDICTED: RNA-binding protein 39 isoform X1     77.8    4e-13   
ref|XP_009900192.1|  PREDICTED: RNA-binding protein 39 isoform X1     77.8    4e-13   
ref|XP_010199779.1|  PREDICTED: RNA-binding protein 39 isoform X1     77.8    4e-13   



>gb|EPS59790.1| splicing factor-like protein, partial [Genlisea aurea]
Length=161

 Score =   190 bits (483),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  607  AMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGY  428
            AM PEP+G PSECLLLKNMFDP  E DPEFDLDIRDDVHEECS+YG VKHIHVDKNS GY
Sbjct  57   AMAPEPIGTPSECLLLKNMFDPTTEMDPEFDLDIRDDVHEECSKYGRVKHIHVDKNSCGY  116

Query  427  VYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGA  293
            VY  F+S+E A  AQQAMHKRWFARR +SA FLQPYEYDAKFKGA
Sbjct  117  VYLRFESIEAASRAQQAMHKRWFARRLISAIFLQPYEYDAKFKGA  161



>emb|CDP12845.1| unnamed protein product [Coffea canephora]
Length=409

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  604  MVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYV  425
            M PEP+GNPSECLLLKNMFDPA ETDPEFDLDIRDDV EECS YG VKHIHVDKNSAGYV
Sbjct  305  MPPEPIGNPSECLLLKNMFDPATETDPEFDLDIRDDVREECSNYGPVKHIHVDKNSAGYV  364

Query  424  YXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
            Y  F++VE A  AQQAMHKRWFARR +SA FLQPYEYDAKFKGAA
Sbjct  365  YLRFENVEAAARAQQAMHKRWFARRLISAIFLQPYEYDAKFKGAA  409



>ref|XP_009608714.1| PREDICTED: RNA-binding protein 39 [Nicotiana tomentosiformis]
Length=587

 Score =   195 bits (496),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            QV+ AM PEP+G PSECLLLKNMFDPA ETDPEFDLDI+DDV EECS+YG VKHIHVDKN
Sbjct  478  QVIAAMAPEPIGIPSECLLLKNMFDPATETDPEFDLDIKDDVKEECSKYGRVKHIHVDKN  537

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
            S+GYVY  FDSVE A  AQQAMHKRWFA RS+SA FLQPYEYDAKFKG  
Sbjct  538  SSGYVYLRFDSVEGASRAQQAMHKRWFAGRSISAIFLQPYEYDAKFKGTG  587



>ref|XP_009774937.1| PREDICTED: RNA-binding protein 39 [Nicotiana sylvestris]
 ref|XP_009774938.1| PREDICTED: RNA-binding protein 39 [Nicotiana sylvestris]
 ref|XP_009774939.1| PREDICTED: RNA-binding protein 39 [Nicotiana sylvestris]
Length=582

 Score =   195 bits (495),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            QV+ AM PEP+G PSECLLLKNMFDPA ETDPEFDLDI+DDV EECS+YG VKHIHVDKN
Sbjct  473  QVIAAMAPEPIGIPSECLLLKNMFDPATETDPEFDLDIKDDVKEECSKYGRVKHIHVDKN  532

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
            S+GYVY  FDSVE A  AQQAMHKRWFA RS+SA FLQPYEYDAKFKG  
Sbjct  533  SSGYVYLRFDSVEGASRAQQAMHKRWFAGRSISAIFLQPYEYDAKFKGTG  582



>ref|XP_011100931.1| PREDICTED: RNA-binding protein 39 [Sesamum indicum]
Length=587

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  613  VXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSA  434
            V +M PEP+G PSECLLLKNMFDP  ETDPEFDLDIRDDV EECS+YG VKHIHVDKNSA
Sbjct  480  VVSMAPEPIGTPSECLLLKNMFDPTTETDPEFDLDIRDDVQEECSKYGRVKHIHVDKNSA  539

Query  433  GYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
            GYVY  F+SVE A  AQQAMHKRWFARR +SA FLQPYEYDAKFKG A
Sbjct  540  GYVYLRFESVEAASRAQQAMHKRWFARRLISAIFLQPYEYDAKFKGTA  587



>ref|XP_010312457.1| PREDICTED: RNA-binding protein 39 [Solanum lycopersicum]
Length=576

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            Q++ +M PEP+G PSECLLLKNMFDPA ETDPEFDLDI+DDV EECS+YG VKHIHVDKN
Sbjct  467  QLIASMAPEPIGIPSECLLLKNMFDPATETDPEFDLDIKDDVKEECSKYGRVKHIHVDKN  526

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
            ++GYVY  FDSVE A  AQQAMHKRWFA RS+SA +LQPYEYDAKFKG  
Sbjct  527  TSGYVYLRFDSVEAASRAQQAMHKRWFAGRSISAIYLQPYEYDAKFKGTG  576



>ref|XP_006351114.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Solanum tuberosum]
Length=412

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            Q++ +M PEP+G PSECLLLKNMFDPA ET+PEFDLDI+DDV EECS+YG VKHIHVDKN
Sbjct  303  QLIASMAPEPIGIPSECLLLKNMFDPATETEPEFDLDIKDDVKEECSKYGRVKHIHVDKN  362

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
            ++GYVY  FDSVE A  AQQAMHKRWFA RS+SA +LQPYEYDAKFKG  
Sbjct  363  TSGYVYLRFDSVEAASRAQQAMHKRWFAGRSISAIYLQPYEYDAKFKGTG  412



>ref|XP_006351113.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Solanum tuberosum]
Length=578

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            Q++ +M PEP+G PSECLLLKNMFDPA ET+PEFDLDI+DDV EECS+YG VKHIHVDKN
Sbjct  469  QLIASMAPEPIGIPSECLLLKNMFDPATETEPEFDLDIKDDVKEECSKYGRVKHIHVDKN  528

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
            ++GYVY  FDSVE A  AQQAMHKRWFA RS+SA +LQPYEYDAKFKG  
Sbjct  529  TSGYVYLRFDSVEAASRAQQAMHKRWFAGRSISAIYLQPYEYDAKFKGTG  578



>gb|EYU31126.1| hypothetical protein MIMGU_mgv1a0042611mg, partial [Erythranthe 
guttata]
Length=375

 Score =   186 bits (471),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -3

Query  607  AMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGY  428
            +M+PEP+G PSECLLLKNMFDPA E DPEFDLDI+DDVHEECS+YG VKHI+VDKNSAGY
Sbjct  270  SMLPEPIGIPSECLLLKNMFDPATEADPEFDLDIKDDVHEECSKYGRVKHIYVDKNSAGY  329

Query  427  VYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
            VY  F+S+E A  AQQAMHKRWFAR+ +SA FLQ YEYDAKFKGAA
Sbjct  330  VYLRFESIEAASGAQQAMHKRWFARKMISAIFLQAYEYDAKFKGAA  375



>gb|EYU24065.1| hypothetical protein MIMGU_mgv1a002916mg [Erythranthe guttata]
Length=626

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  613  VXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSA  434
            V AM PEP+G PSECLLLKNMFDPA E DPEFDLDI+DDV EECS+YG VKHI+VDKN+A
Sbjct  519  VIAMAPEPIGTPSECLLLKNMFDPATEEDPEFDLDIKDDVEEECSKYGRVKHIYVDKNTA  578

Query  433  GYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGA  293
            GYVY  F+SVE A  AQQAMHKRWFAR+ +SA FLQPYEYDAKFKGA
Sbjct  579  GYVYLRFESVEGAARAQQAMHKRWFARKLISAIFLQPYEYDAKFKGA  625



>gb|KCW54323.1| hypothetical protein EUGRSUZ_I00287 [Eucalyptus grandis]
Length=159

 Score =   159 bits (403),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            QV+ A   EPVG+P+ECLLLKN+FDPA ET+P+FDLDI+DDV EECS++G VKHI+VDKN
Sbjct  51   QVISAAT-EPVGSPTECLLLKNLFDPATETEPDFDLDIKDDVGEECSKFGQVKHIYVDKN  109

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
            +AG+VY  F++V  A  AQ+AMH RWFA RS+SA F+ P+EY+AKF+G A
Sbjct  110  TAGWVYLRFENVPAAMNAQRAMHLRWFAGRSISAIFMPPHEYEAKFQGVA  159



>gb|EYU31125.1| hypothetical protein MIMGU_mgv1a0042611mg, partial [Erythranthe 
guttata]
Length=379

 Score =   162 bits (410),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  607  AMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGY  428
            +M+PEP+G PSECLLLKNMFDPA E DPEFDLDI+DDVHEECS+YG VKHI+VDKNSAGY
Sbjct  270  SMLPEPIGIPSECLLLKNMFDPATEADPEFDLDIKDDVHEECSKYGRVKHIYVDKNSAGY  329

Query  427  VYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFL  329
            VY  F+S+E A  AQQAMHKRWFAR+ +SA FL
Sbjct  330  VYLRFESIEAASGAQQAMHKRWFARKMISAIFL  362



>gb|KDO57144.1| hypothetical protein CISIN_1g0063801mg, partial [Citrus sinensis]
 gb|KDO57145.1| hypothetical protein CISIN_1g0063801mg, partial [Citrus sinensis]
Length=168

 Score =   156 bits (394),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = -3

Query  616  VVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS  437
            V+  M  E +G+PSECLLLKNMFDPAMETDP+FDL+I+ DV EECS+YG VKHI+VDK S
Sbjct  62   VIPNMAAEFIGSPSECLLLKNMFDPAMETDPDFDLEIQGDVEEECSKYGRVKHIYVDKRS  121

Query  436  AGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFK  299
            AG+VY  F+S E A  AQ+AMH RWFARR +SA F++P +Y+AKFK
Sbjct  122  AGFVYLRFESTEAAASAQRAMHMRWFARRLISAIFMKPEDYEAKFK  167



>gb|AES72769.2| CC1-like splicing factor [Medicago truncatula]
Length=587

 Score =   165 bits (418),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            Q++   V EPVG PS CLLLKNMFDP  ET+P+FDLDI++DV EECS+YG VKHI+VDKN
Sbjct  478  QIMPTQVAEPVGTPSNCLLLKNMFDPTTETEPDFDLDIKEDVEEECSKYGRVKHIYVDKN  537

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKG  296
            SAG+VY  F++VE A  AQ+AMH RWFAR+ +SA ++QP+EY+AKFKG
Sbjct  538  SAGFVYLMFETVEAASAAQRAMHMRWFARKMISAIYMQPHEYEAKFKG  585



>emb|CAN82467.1| hypothetical protein VITISV_002664 [Vitis vinifera]
Length=461

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            QVV +   EPVG P+ECLLLKNMFDPA E DP+FDLDI+++V EECS +G VKHI+V+K+
Sbjct  352  QVVTSPASEPVGTPTECLLLKNMFDPATEIDPDFDLDIKEEVQEECSNFGRVKHIYVEKH  411

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKG  296
            SAGYVY  F++VE A  AQ+AMH RWFARR +SA FLQP +Y+AKFKG
Sbjct  412  SAGYVYLRFETVEAAVTAQRAMHMRWFARRLISAIFLQPRDYEAKFKG  459



>ref|XP_010680478.1| PREDICTED: RNA-binding protein 39 [Beta vulgaris subsp. vulgaris]
Length=553

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            QV+ +   EPVGNPSECLLLKN+FDPA ETDPEFDLDI++DV EECS++G VKHI+VDK+
Sbjct  444  QVLSSPASEPVGNPSECLLLKNLFDPATETDPEFDLDIKEDVEEECSKFGPVKHIYVDKH  503

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
            SAG+VY  FD+ E A  AQ+ MH RWFARR +SA F+QP +Y+AKF  AA
Sbjct  504  SAGHVYLRFDNKEGAMNAQRGMHMRWFARRLISAIFMQPQDYEAKFGAAA  553



>ref|XP_010246267.1| PREDICTED: RNA-binding protein 39 isoform X2 [Nelumbo nucifera]
Length=603

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -3

Query  616  VVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS  437
            VV + V EP+GNPSECLLLKNMFDPA ETDP+FDLDI+++V EECS+ G VKHI+VDKNS
Sbjct  495  VVTSPVTEPIGNPSECLLLKNMFDPATETDPDFDLDIKEEVQEECSKLGPVKHIYVDKNS  554

Query  436  AGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGA  293
            AGYVY  F++V  A   Q+AMH RWFARR +SA F+ P+EY+AKF+G+
Sbjct  555  AGYVYLRFETVAAAASTQRAMHMRWFARRLISAVFMPPHEYEAKFRGS  602



>ref|XP_010246266.1| PREDICTED: RNA-binding protein 39 isoform X1 [Nelumbo nucifera]
Length=604

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -3

Query  616  VVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS  437
            VV + V EP+GNPSECLLLKNMFDPA ETDP+FDLDI+++V EECS+ G VKHI+VDKNS
Sbjct  496  VVTSPVTEPIGNPSECLLLKNMFDPATETDPDFDLDIKEEVQEECSKLGPVKHIYVDKNS  555

Query  436  AGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGA  293
            AGYVY  F++V  A   Q+AMH RWFARR +SA F+ P+EY+AKF+G+
Sbjct  556  AGYVYLRFETVAAAASTQRAMHMRWFARRLISAVFMPPHEYEAKFRGS  603



>emb|CBI21551.3| unnamed protein product [Vitis vinifera]
Length=504

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            QVV +   EPVG P+ECLLLKNMFDPA E DP+FDLDI+++V EECS +G VKHI+V+K+
Sbjct  395  QVVTSPASEPVGTPTECLLLKNMFDPATEIDPDFDLDIKEEVQEECSNFGRVKHIYVEKH  454

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKG  296
            SAGYVY  F++VE A  AQ+AMH RWFARR +SA FLQP +Y+AKFKG
Sbjct  455  SAGYVYLRFETVEAAVTAQRAMHMRWFARRLISAIFLQPRDYEAKFKG  502



>gb|KJB14931.1| hypothetical protein B456_002G149800 [Gossypium raimondii]
 gb|KJB14932.1| hypothetical protein B456_002G149800 [Gossypium raimondii]
 gb|KJB14933.1| hypothetical protein B456_002G149800 [Gossypium raimondii]
 gb|KJB14934.1| hypothetical protein B456_002G149800 [Gossypium raimondii]
Length=618

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = -3

Query  616  VVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS  437
            ++     EP+G PSECLLLKNMFDPA ET+P+FDLDI++DV EECS+YG VKHI+VDKNS
Sbjct  512  IMSTTALEPIGQPSECLLLKNMFDPATETEPDFDLDIKEDVEEECSKYGRVKHIYVDKNS  571

Query  436  AGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKG  296
             G VY  FDS E A  AQ+AMH RWFA RS+SA F+QP+EY+A+FKG
Sbjct  572  GGCVYLRFDSTEAAGKAQRAMHMRWFAGRSISALFMQPHEYEARFKG  618



>ref|XP_010652895.1| PREDICTED: RNA-binding protein 39 [Vitis vinifera]
Length=608

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            QVV +   EPVG P+ECLLLKNMFDPA E DP+FDLDI+++V EECS +G VKHI+V+K+
Sbjct  499  QVVTSPASEPVGTPTECLLLKNMFDPATEIDPDFDLDIKEEVQEECSNFGRVKHIYVEKH  558

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKG  296
            SAGYVY  F++VE A  AQ+AMH RWFARR +SA FLQP +Y+AKFKG
Sbjct  559  SAGYVYLRFETVEAAVTAQRAMHMRWFARRLISAIFLQPRDYEAKFKG  606



>ref|XP_003602517.1| Splicing factor-like protein [Medicago truncatula]
Length=731

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            Q++   V EPVG PS CLLLKNMFDP  ET+P+FDLDI++DV EECS+YG VKHI+VDKN
Sbjct  622  QIMPTQVAEPVGTPSNCLLLKNMFDPTTETEPDFDLDIKEDVEEECSKYGRVKHIYVDKN  681

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKG  296
            SAG+VY  F++VE A  AQ+AMH RWFAR+ +SA ++QP+EY+AKFKG
Sbjct  682  SAGFVYLMFETVEAASAAQRAMHMRWFARKMISAIYMQPHEYEAKFKG  729



>ref|XP_003602518.1| Splicing factor-like protein [Medicago truncatula]
Length=766

 Score =   164 bits (414),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            Q++   V EPVG PS CLLLKNMFDP  ET+P+FDLDI++DV EECS+YG VKHI+VDKN
Sbjct  657  QIMPTQVAEPVGTPSNCLLLKNMFDPTTETEPDFDLDIKEDVEEECSKYGRVKHIYVDKN  716

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKG  296
            SAG+VY  F++VE A  AQ+AMH RWFAR+ +SA ++QP+EY+AKFKG
Sbjct  717  SAGFVYLMFETVEAASAAQRAMHMRWFARKMISAIYMQPHEYEAKFKG  764



>ref|XP_008351323.1| PREDICTED: RNA-binding protein 39-like [Malus domestica]
Length=154

 Score =   152 bits (384),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            V EPVGNPSECLLLKNMFDPA E +P+FD+DI++DV EECS+YG VKHI+VDKNSAG+VY
Sbjct  53   VNEPVGNPSECLLLKNMFDPATEREPDFDIDIKEDVEEECSKYGHVKHIYVDKNSAGFVY  112

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              F++VE A  AQ+AMH RWFA R +SA F+QP  Y+AKF
Sbjct  113  LWFETVEAAAGAQRAMHWRWFAGRLISALFMQPQVYEAKF  152



>gb|KHG29994.1| RNA-binding 39 [Gossypium arboreum]
Length=613

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = -3

Query  616  VVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS  437
            ++     EP+G PSECLLLKNMFDP  ET+P+FDLDI++DV EECS+YG VKHI+VDKNS
Sbjct  507  IMSTTALEPIGQPSECLLLKNMFDPTTETEPDFDLDIKEDVEEECSKYGRVKHIYVDKNS  566

Query  436  AGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKG  296
             G VY  F+S E A  AQ+AMH RWFA RS+SA F+QP+EY+AKFKG
Sbjct  567  GGCVYLRFESTEAAGKAQRAMHMRWFAGRSISALFMQPHEYEAKFKG  613



>ref|XP_007137679.1| hypothetical protein PHAVU_009G146500g [Phaseolus vulgaris]
 gb|ESW09673.1| hypothetical protein PHAVU_009G146500g [Phaseolus vulgaris]
Length=592

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            QVV   V EPVGNPSECLLLKNMFDP  ET+P+FDLDI++DV EECS+YG VKHI+VDK 
Sbjct  482  QVVPTPVIEPVGNPSECLLLKNMFDPNTETEPDFDLDIKEDVEEECSKYGRVKHIYVDKR  541

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKG  296
            S G+VY  F++VE A  AQ+AMH RWFA R +SA ++QP  YDAKFKG
Sbjct  542  STGFVYLQFETVEAASAAQRAMHTRWFAGRMISAIYMQPQIYDAKFKG  589



>emb|CAC10207.1| putative splicing factor [Cicer arietinum]
Length=392

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            QV+   V EPVG PSECLLLKNMFDP+ ET+P+FDLDI++DV EECS+YG VKHI+VDK 
Sbjct  283  QVMPTPVVEPVGVPSECLLLKNMFDPSTETEPDFDLDIKEDVEEECSKYGRVKHIYVDKR  342

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKG  296
            SAG+VY  F++VE +  AQ+AMH RWFARR ++A F+QP+ Y+AKFKG
Sbjct  343  SAGFVYLRFETVEASSAAQRAMHMRWFARRLITAIFMQPHLYEAKFKG  390



>ref|XP_003525097.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Glycine max]
Length=554

 Score =   160 bits (404),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            V EPVGNPSECLLLKNMFDP+ ET+P+FD+DI++DV EECS+YG VKHI VDK SAG+VY
Sbjct  451  VVEPVGNPSECLLLKNMFDPSTETEPDFDIDIKEDVEEECSKYGRVKHIFVDKKSAGFVY  510

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKG  296
              FD+VE A  AQ AMH RWFARR +SA F+QP  Y+AKFKG
Sbjct  511  LRFDTVEAASAAQHAMHLRWFARRLISAVFMQPELYEAKFKG  552



>ref|XP_004503982.1| PREDICTED: RNA-binding protein 39-like [Cicer arietinum]
Length=583

 Score =   159 bits (403),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            QV+   V EPVG PSECLLLKNMFDP+ ET+P+FDLDI++DV EECS+YG VKHI+VDK 
Sbjct  474  QVMPTPVVEPVGVPSECLLLKNMFDPSTETEPDFDLDIKEDVEEECSKYGRVKHIYVDKR  533

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKG  296
            SAG+VY  F++VE +  AQ+AMH RWFARR ++A F+QP+ Y+AKFKG
Sbjct  534  SAGFVYLRFETVEASSAAQRAMHMRWFARRLITAIFMQPHLYEAKFKG  581



>ref|XP_010027731.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein 39 [Eucalyptus 
grandis]
Length=576

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            QV+ A   EPVG+P+ECLLLKN+FDPA ET+P+FDLDI+DDV EECS++G VKHI+VDKN
Sbjct  468  QVISAAT-EPVGSPTECLLLKNLFDPATETEPDFDLDIKDDVGEECSKFGQVKHIYVDKN  526

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
            +AG+VY  F++V  A  AQ+AMH RWFA RS+SA F+ P+EY+AKF+G A
Sbjct  527  TAGWVYLRFENVPAAMNAQRAMHLRWFAGRSISAIFMPPHEYEAKFQGVA  576



>ref|XP_010546379.1| PREDICTED: RNA-binding protein 39 [Tarenaya hassleriana]
Length=568

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -3

Query  595  EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXX  416
            EPVG PSECLLLKNMFDPA ET+P+FDLDI++DV EECS+YG VKHI+VDKNSAG+VY  
Sbjct  469  EPVGQPSECLLLKNMFDPATETEPDFDLDIKEDVEEECSKYGRVKHIYVDKNSAGFVYLR  528

Query  415  FDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            F++V+ A  AQ+AMH RWFARR +SA F+ P EY+AKF
Sbjct  529  FETVQGAAGAQRAMHTRWFARRMISAIFMSPDEYEAKF  566



>ref|XP_003531395.1| PREDICTED: RNA-binding protein 39-like [Glycine max]
Length=550

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            QV+     EPVGNPS+CLLLKNMFDP+ ET+P+FD+DI++DV EECS+YG VKHI VDK 
Sbjct  441  QVMPNPAVEPVGNPSDCLLLKNMFDPSTETEPDFDIDIKEDVEEECSKYGRVKHIFVDKK  500

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKG  296
            S+G+VY  FD+VE A  AQ+AMH RWFARR +SA F+QP  Y+AKFKG
Sbjct  501  SSGFVYLRFDTVEAASGAQRAMHMRWFARRLISAVFMQPELYEAKFKG  548



>ref|XP_007048198.1| Splicing factor isoform 1 [Theobroma cacao]
 gb|EOX92355.1| Splicing factor isoform 1 [Theobroma cacao]
Length=568

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = -3

Query  616  VVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS  437
            ++     +P G PSECLLLKNMFDPA E +P+FDL+I++DV EECS+YG VKHIHVDKNS
Sbjct  462  IMSTTAVDPTGQPSECLLLKNMFDPATEMEPDFDLEIKEDVEEECSKYGRVKHIHVDKNS  521

Query  436  AGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKG  296
            AG VY  FDS E A  AQ+AMH RWFA RS+SA F+QP+EY+A+F G
Sbjct  522  AGCVYLRFDSAEAAGKAQRAMHMRWFAGRSISALFMQPHEYEARFNG  568



>ref|XP_006427900.1| hypothetical protein CICLE_v10025229mg [Citrus clementina]
 ref|XP_006464535.1| PREDICTED: RNA-binding protein 39-like [Citrus sinensis]
 gb|ESR41140.1| hypothetical protein CICLE_v10025229mg [Citrus clementina]
Length=589

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = -3

Query  616  VVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS  437
            V+  M  E +G+PSECLLLKNMFDPAMETDP+FDL+I+ DV EECS+YG VKHI+VDK S
Sbjct  483  VIPNMAAEFIGSPSECLLLKNMFDPAMETDPDFDLEIQGDVEEECSKYGRVKHIYVDKRS  542

Query  436  AGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFK  299
            AG+VY  F+S E A  AQ+AMH RWFARR +SA F++P +Y+AKFK
Sbjct  543  AGFVYLRFESTEAAASAQRAMHMRWFARRLISAIFMKPEDYEAKFK  588



>ref|XP_004502884.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Cicer arietinum]
Length=567

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            Q++   V EPVG PSECLLLKNMFDP  ET+P+FDLDI++DV EECS+YG VKHI+VDK 
Sbjct  458  QIMPTQVAEPVGTPSECLLLKNMFDPTTETEPDFDLDIKEDVEEECSKYGRVKHIYVDKK  517

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKG  296
            SAG+VY  F++VE A  AQ+AMH RWFARR ++A ++QP  Y+AKFKG
Sbjct  518  SAGFVYLMFETVEAAAAAQRAMHMRWFARRLIAAIYMQPQVYEAKFKG  565



>ref|XP_004502883.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Cicer arietinum]
Length=583

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            Q++   V EPVG PSECLLLKNMFDP  ET+P+FDLDI++DV EECS+YG VKHI+VDK 
Sbjct  474  QIMPTQVAEPVGTPSECLLLKNMFDPTTETEPDFDLDIKEDVEEECSKYGRVKHIYVDKK  533

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKG  296
            SAG+VY  F++VE A  AQ+AMH RWFARR ++A ++QP  Y+AKFKG
Sbjct  534  SAGFVYLMFETVEAAAAAQRAMHMRWFARRLIAAIYMQPQVYEAKFKG  581



>gb|KJB18367.1| hypothetical protein B456_003G049000 [Gossypium raimondii]
Length=579

 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = -3

Query  616  VVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS  437
            ++     + VG PSECLLLKNMFDPA ET+P+FDLDI++DV EECS+YG VKHI+VDKNS
Sbjct  473  IMSTTALDSVGQPSECLLLKNMFDPATETEPDFDLDIKEDVEEECSKYGRVKHIYVDKNS  532

Query  436  AGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFK  299
            AG VY  FDS E A  AQ+AMH RWFA RS+SA F+QP EY+A+FK
Sbjct  533  AGCVYLRFDSAEAAGKAQRAMHMRWFAGRSISALFMQPQEYEARFK  578



>gb|KHG26899.1| RNA-binding 39 [Gossypium arboreum]
Length=581

 Score =   157 bits (396),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = -3

Query  616  VVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS  437
            ++     + VG PSECLLLKNMFDPA ET+P+FDLDI++DV EECS+YG VKHI+VDKNS
Sbjct  475  IMSTTALDSVGQPSECLLLKNMFDPATETEPDFDLDIKEDVEEECSKYGRVKHIYVDKNS  534

Query  436  AGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFK  299
            AG VY  FDS E A  AQ+AMH RWFA RS+SA F+QP EY+A+FK
Sbjct  535  AGCVYLRFDSAEAAGKAQRAMHMRWFAGRSISALFMQPQEYEARFK  580



>ref|XP_007159797.1| hypothetical protein PHAVU_002G268000g [Phaseolus vulgaris]
 gb|ESW31791.1| hypothetical protein PHAVU_002G268000g [Phaseolus vulgaris]
Length=547

 Score =   156 bits (395),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            QV+   V EPVG+PSECLLLKNMFDP  E++P+FD+DI++DV EECS+YG VKHI VDK 
Sbjct  439  QVMPTPVVEPVGSPSECLLLKNMFDPTTESEPDFDIDIKEDVEEECSKYGRVKHIFVDKK  498

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKG  296
            SAG+VY  F++VE +  AQ+AMH RWFARR +SA F+QP  Y+AKFKG
Sbjct  499  SAGFVYLRFETVEASSAAQRAMHMRWFARRLISAIFMQPQIYEAKFKG  546



>ref|XP_007137677.1| hypothetical protein PHAVU_009G146500g [Phaseolus vulgaris]
 gb|ESW09671.1| hypothetical protein PHAVU_009G146500g [Phaseolus vulgaris]
Length=591

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 87/108 (81%), Gaps = 1/108 (1%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            QVV   V EPVGNPSECLLLKNMFDP  ET+P+FDLDI++DV EECS+YG VKHI+VDK 
Sbjct  482  QVVPTPVIEPVGNPSECLLLKNMFDPNTETEPDFDLDIKEDVEEECSKYGRVKHIYVDK-  540

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKG  296
            S G+VY  F++VE A  AQ+AMH RWFA R +SA ++QP  YDAKFKG
Sbjct  541  STGFVYLQFETVEAASAAQRAMHTRWFAGRMISAIYMQPQIYDAKFKG  588



>gb|KHN09571.1| RNA-binding protein rsd1 [Glycine soja]
Length=545

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            Q++   V EPVGNPSECLLLKNMFDP  ET+P+FDLDI++DV EECS+YG VKHI+VDK 
Sbjct  436  QIMPIPVTEPVGNPSECLLLKNMFDPNTETEPDFDLDIKEDVEEECSKYGRVKHIYVDKR  495

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
            SAG+VY  F++VE A  AQ+AMH RWFA R +SA ++ P  Y+ KFKG A
Sbjct  496  SAGFVYLQFETVEAASAAQRAMHTRWFAGRMISAIYMLPQMYETKFKGDA  545



>ref|XP_003526844.1| PREDICTED: RNA-binding protein 39-like [Glycine max]
Length=549

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            Q++   V EPVGNPSECLLLKNMFDP  ET+P+FDLDI++DV EECS+YG VKHI+VDK 
Sbjct  440  QIMPIPVTEPVGNPSECLLLKNMFDPNTETEPDFDLDIKEDVEEECSKYGRVKHIYVDKR  499

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
            SAG+VY  F++VE A  AQ+AMH RWFA R +SA ++ P  Y+ KFKG A
Sbjct  500  SAGFVYLQFETVEAASAAQRAMHTRWFAGRMISAIYMLPQMYETKFKGDA  549



>ref|XP_010452994.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Camelina sativa]
 ref|XP_010452995.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Camelina sativa]
Length=306

 Score =   150 bits (378),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            + EPVG PS+CLLLKNMFDPA ETDPEFDL+IR+DV EECS YG V HI+VDKNSAG+VY
Sbjct  202  ITEPVGQPSDCLLLKNMFDPATETDPEFDLEIREDVKEECSRYGRVSHIYVDKNSAGFVY  261

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFK  299
              F++V+ A  AQ  MH+RWFA++ ++A F+  +EY+AK K
Sbjct  262  LRFETVQGAVAAQGVMHRRWFAQKMITATFMPRHEYEAKAK  302



>ref|XP_008231785.1| PREDICTED: RNA-binding protein 39 [Prunus mume]
Length=575

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            V EP+GNPSECLLLKNMFDPA E +P+FD+DI+DDV EECS+ G VKHI+VDKN+AG+VY
Sbjct  474  VTEPIGNPSECLLLKNMFDPATEREPDFDIDIKDDVEEECSKCGRVKHIYVDKNTAGFVY  533

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              F++VE A  AQQ+MH RWFA R +SA F+QP  Y+A+F
Sbjct  534  LRFETVEAAAAAQQSMHLRWFAGRQISALFMQPQVYEARF  573



>ref|XP_011014283.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Populus euphratica]
Length=395

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = -3

Query  595  EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXX  416
            E +G PSECLLLKNMFDPA ET+P+FDLDI++DV EECS YG VKHI VDKNSAG+VY  
Sbjct  294  ESIGKPSECLLLKNMFDPATETEPDFDLDIKEDVEEECSRYGQVKHIWVDKNSAGHVYLH  353

Query  415  FDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
            FDS+E A  AQ+AMH RWFA+RS+ A F+  +EY+A+F+  A
Sbjct  354  FDSMEAAARAQRAMHMRWFAQRSILAVFMPTHEYEARFQNGA  395



>ref|XP_007212812.1| hypothetical protein PRUPE_ppa002854mg [Prunus persica]
 gb|EMJ14011.1| hypothetical protein PRUPE_ppa002854mg [Prunus persica]
Length=628

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            V EP+GNPSECLLLKNMFDPA E +P+FD+DI+DDV EECS+ G VKHI+VDKN+AG+VY
Sbjct  527  VTEPIGNPSECLLLKNMFDPATEREPDFDIDIKDDVEEECSKCGRVKHIYVDKNTAGFVY  586

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              F++VE A  AQQ+MH RWFA R +SA F+QP  Y+A+F
Sbjct  587  LRFETVEAAAAAQQSMHLRWFAGRQISALFMQPQVYEARF  626



>ref|XP_008781452.1| PREDICTED: RNA-binding protein 39-like [Phoenix dactylifera]
Length=568

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            + EP+G PSEC+LLKNMFDP+ ETDP+FDLDI+++V EECS++G+VKHI+VDKNS GYVY
Sbjct  465  LAEPIGEPSECVLLKNMFDPSTETDPDFDLDIKEEVEEECSKFGSVKHIYVDKNSHGYVY  524

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
              F S+  A   Q AMH RW+ARR++SA F++P EY+AKF+G +
Sbjct  525  LWFGSMAAAASCQHAMHMRWYARRTISATFMRPQEYEAKFRGVS  568



>ref|XP_003630170.1| RNA-binding protein [Medicago truncatula]
 gb|AET04646.1| CC1-like splicing factor [Medicago truncatula]
Length=567

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            QV+   V EPVG PSECLLLKNMFDP+ E +P+FD+DI++DV EECS+YG V HI+VDK 
Sbjct  458  QVMPTPVAEPVGIPSECLLLKNMFDPSTEIEPDFDIDIKEDVEEECSKYGRVMHIYVDKR  517

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFK  299
            SAG+VY  F++VE +  AQ+AMH RWFARR ++A F+QP+ Y+AKFK
Sbjct  518  SAGFVYLQFETVEASSAAQRAMHMRWFARRLITAIFMQPHLYEAKFK  564



>ref|XP_010491632.1| PREDICTED: RNA-binding protein 39-like [Camelina sativa]
Length=532

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = -3

Query  607  AMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGY  428
            + V EPVG PS+CLLLKNMFDPA ETDPEFDL+IR+DV EECS YG V HI+VDKNSAG+
Sbjct  426  SFVTEPVGQPSDCLLLKNMFDPATETDPEFDLEIREDVKEECSRYGRVSHIYVDKNSAGF  485

Query  427  VYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFK  299
            VY  F++V+ A  AQ  MH+RWFA++ ++A F+  +EY+AK K
Sbjct  486  VYLRFETVQGAVAAQNVMHRRWFAQKMITATFMPRHEYEAKAK  528



>ref|XP_010422929.1| PREDICTED: RNA-binding protein 39-like [Camelina sativa]
Length=528

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = -3

Query  607  AMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGY  428
            + V EPVG PS+CLLLKNMFDPA ETDPEFDL+IR+DV EECS YG V HI+VDKNSAG+
Sbjct  422  SFVTEPVGQPSDCLLLKNMFDPATETDPEFDLEIREDVKEECSRYGRVSHIYVDKNSAGF  481

Query  427  VYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFK  299
            VY  F++V+ A  AQ  MH+RWFA++ ++A F+  +EY+AK K
Sbjct  482  VYLRFETVQGAVAAQSVMHRRWFAQKMITATFMPRHEYEAKAK  524



>ref|XP_011021826.1| PREDICTED: RNA-binding protein 39-like [Populus euphratica]
Length=572

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = -3

Query  595  EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXX  416
            E +G PSECLLLKNMFDPA ET+P+FDLDI++DV EECS YG VKHI VDKNSAG+VY  
Sbjct  471  ESIGQPSECLLLKNMFDPATETEPDFDLDIKEDVEEECSRYGRVKHIWVDKNSAGHVYLH  530

Query  415  FDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
            FDS+E A  AQ+AMH RWFA+RS+ A F+  +EY+A+F+  A
Sbjct  531  FDSMEAAARAQRAMHMRWFAQRSILAIFMPTHEYEARFQNGA  572



>ref|XP_011014282.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Populus euphratica]
Length=564

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = -3

Query  595  EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXX  416
            E +G PSECLLLKNMFDPA ET+P+FDLDI++DV EECS YG VKHI VDKNSAG+VY  
Sbjct  463  ESIGKPSECLLLKNMFDPATETEPDFDLDIKEDVEEECSRYGQVKHIWVDKNSAGHVYLH  522

Query  415  FDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
            FDS+E A  AQ+AMH RWFA+RS+ A F+  +EY+A+F+  A
Sbjct  523  FDSMEAAARAQRAMHMRWFAQRSILAVFMPTHEYEARFQNGA  564



>dbj|BAD93824.1| splicing factor-like protein [Arabidopsis thaliana]
Length=308

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = -3

Query  613  VXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSA  434
            + + V E VG PSECLLLKNMFDPA ET+P FDL+IRDDV +ECS+YG V HI+VDKNSA
Sbjct  203  IPSFVNEHVGLPSECLLLKNMFDPATETEPNFDLEIRDDVADECSKYGPVNHIYVDKNSA  262

Query  433  GYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFK  299
            G+VY  F SVE A  AQ+AMH RWFA++ +SA F+ P+EY+AK K
Sbjct  263  GFVYLRFQSVEAAAAAQRAMHMRWFAQKMISATFMPPHEYEAKAK  307



>ref|XP_010452992.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Camelina sativa]
 ref|XP_010452993.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Camelina sativa]
Length=528

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = -3

Query  607  AMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGY  428
            + + EPVG PS+CLLLKNMFDPA ETDPEFDL+IR+DV EECS YG V HI+VDKNSAG+
Sbjct  422  SFITEPVGQPSDCLLLKNMFDPATETDPEFDLEIREDVKEECSRYGRVSHIYVDKNSAGF  481

Query  427  VYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFK  299
            VY  F++V+ A  AQ  MH+RWFA++ ++A F+  +EY+AK K
Sbjct  482  VYLRFETVQGAVAAQGVMHRRWFAQKMITATFMPRHEYEAKAK  524



>ref|XP_010930948.1| PREDICTED: RNA-binding protein 39 [Elaeis guineensis]
Length=595

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = -3

Query  595  EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXX  416
            EP+G PSEC+LLKNMFDP+ E DP+FDLDI+++V EECS++G VKHI+VDKNS GYVY  
Sbjct  494  EPIGEPSECVLLKNMFDPSTEMDPDFDLDIKEEVEEECSKFGLVKHIYVDKNSHGYVYLW  553

Query  415  FDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
            F S+E A   Q AMH RW+ARRS+SA F++P EY+AKF+  +
Sbjct  554  FGSMEAAASCQLAMHTRWYARRSISATFMRPQEYEAKFRSVS  595



>ref|XP_011466737.1| PREDICTED: RNA-binding protein 39 [Fragaria vesca subsp. vesca]
Length=606

 Score =   149 bits (375),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -3

Query  595  EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXX  416
            EP+GNPSECLLLK+MFDPA ET+P+FD+DI+DDV EECS+YG VKHI+V+KNSAG+VY  
Sbjct  507  EPIGNPSECLLLKDMFDPATETEPDFDVDIKDDVEEECSKYGRVKHIYVEKNSAGFVYLW  566

Query  415  FDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            F++VE A  AQ+AMH RWFA R +SA F+QP  Y AKF
Sbjct  567  FETVEAAAAAQRAMHLRWFAGRQISALFMQPQVYAAKF  604



>ref|XP_002873428.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49687.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=520

 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -3

Query  616  VVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS  437
             + + V EPVG PSECLLLKNMFDPA ET+ +FD +IR+DV +ECS+YG V HI+VDKNS
Sbjct  414  AIPSFVNEPVGQPSECLLLKNMFDPATETERDFDFEIREDVADECSKYGEVNHIYVDKNS  473

Query  436  AGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFK  299
            AG+VY  F SVE A  AQ+AMH RWFA++ +SA F+ P+EY+AK K
Sbjct  474  AGFVYLRFQSVEAAVAAQRAMHMRWFAQKMISATFMPPHEYEAKAK  519



>ref|XP_004160482.1| PREDICTED: RNA-binding protein 39-like [Cucumis sativus]
Length=598

 Score =   148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            V + VG+PSECLLLKNMFDP+ ET P+FD++I++DV EECS+YG VKHI+VDKNSAG VY
Sbjct  496  VLQSVGSPSECLLLKNMFDPSTETAPDFDMEIKEDVEEECSKYGRVKHIYVDKNSAGCVY  555

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGA  293
              +D+VE A  AQ+AMH RWFA R +S  F+QP  Y+AKF GA
Sbjct  556  LQYDTVEAAINAQRAMHLRWFAGRQISVLFMQPQVYEAKFIGA  598



>ref|XP_004141977.1| PREDICTED: RNA-binding protein 39-like [Cucumis sativus]
 gb|KGN48400.1| hypothetical protein Csa_6G486730 [Cucumis sativus]
Length=598

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            V + VG+PSECLLLKNMFDP+ ET P+FD++I++DV EECS+YG VKHI+VDKNSAG VY
Sbjct  496  VLQSVGSPSECLLLKNMFDPSTETAPDFDMEIKEDVEEECSKYGRVKHIYVDKNSAGCVY  555

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGA  293
              +D+VE A  AQ+AMH RWFA R +S  F+QP  Y+AKF GA
Sbjct  556  LQYDTVEAAINAQRAMHLRWFAGRQISVLFMQPQVYEAKFIGA  598



>ref|XP_011011956.1| PREDICTED: RNA-binding protein 39-like [Populus euphratica]
Length=558

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -3

Query  595  EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXX  416
            EP+G PSECLLLKNMFDPA ET+P+FDLDI++DV EECS+YG V+HI VDK SAG VY  
Sbjct  457  EPIGQPSECLLLKNMFDPATETEPDFDLDIKEDVEEECSKYGRVEHIFVDKKSAGCVYLR  516

Query  415  FDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
            FDS+E A  AQ+AMH RWFARR + A F+   EY+A+F+  A
Sbjct  517  FDSIEAAAGAQRAMHMRWFARRLILAVFMPTREYEARFQIGA  558



>ref|XP_010690339.1| PREDICTED: RNA-binding protein 39 [Beta vulgaris subsp. vulgaris]
Length=615

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            + +PVG PSECLLLKNMFDP +ET+P+FDLDI++DV EEC +YGAVKHI VDK+S GYVY
Sbjct  512  IADPVGVPSECLLLKNMFDPKLETEPDFDLDIKEDVQEECGKYGAVKHIFVDKDSEGYVY  571

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              FDS + A  AQ+A+H RWFA + +SA ++ P++Y+AKF
Sbjct  572  LKFDSTQAAMNAQRALHGRWFAAKMISATYIAPHDYEAKF  611



>ref|XP_008440993.1| PREDICTED: RNA-binding protein 39 isoform X4 [Cucumis melo]
Length=598

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            V + VG+PSECLLLKNMFDP+ ET P+FD++I++DV EECS+YG VKHI+VDKNSAG VY
Sbjct  496  VLQSVGSPSECLLLKNMFDPSTETAPDFDMEIKEDVEEECSKYGHVKHIYVDKNSAGCVY  555

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGA  293
              +D+VE A  AQ+AMH RWFA R +S  F+QP  Y+AKF GA
Sbjct  556  LQYDTVEAAVNAQRAMHLRWFAGRQISVLFMQPQVYEAKFIGA  598



>ref|XP_008440991.1| PREDICTED: RNA-binding protein 39 isoform X2 [Cucumis melo]
Length=600

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            V + VG+PSECLLLKNMFDP+ ET P+FD++I++DV EECS+YG VKHI+VDKNSAG VY
Sbjct  498  VLQSVGSPSECLLLKNMFDPSTETAPDFDMEIKEDVEEECSKYGHVKHIYVDKNSAGCVY  557

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGA  293
              +D+VE A  AQ+AMH RWFA R +S  F+QP  Y+AKF GA
Sbjct  558  LQYDTVEAAVNAQRAMHLRWFAGRQISVLFMQPQVYEAKFIGA  600



>dbj|BAH57172.1| AT5G09880 [Arabidopsis thaliana]
Length=505

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -3

Query  616  VVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS  437
             + + V E VG PSECLLLKNMFDPA ET+P FDL+IRDDV +ECS+YG V HI+VDKNS
Sbjct  399  AIPSFVNEHVGLPSECLLLKNMFDPATETEPNFDLEIRDDVADECSKYGPVNHIYVDKNS  458

Query  436  AGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFK  299
            AG+VY  F SVE A  AQ+AMH RWFA++ +SA F+ P+EY+AK K
Sbjct  459  AGFVYLRFQSVEAAAAAQRAMHMRWFAQKMISATFMPPHEYEAKAK  504



>gb|AES72768.2| CC1-like splicing factor [Medicago truncatula]
Length=576

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            Q++   V EPVG PS CLLLKNMFDP  ET+P+FDLDI++DV EECS+YG VKHI+VDKN
Sbjct  478  QIMPTQVAEPVGTPSNCLLLKNMFDPTTETEPDFDLDIKEDVEEECSKYGRVKHIYVDKN  537

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQ  326
            SAG+VY  F++VE A  AQ+AMH RWFAR+ +SA +++
Sbjct  538  SAGFVYLMFETVEAASAAQRAMHMRWFARKMISAIYME  575



>gb|AAO30095.1| splicing factor-like protein [Arabidopsis thaliana]
Length=527

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -3

Query  616  VVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS  437
             + + V E VG PSECLLLKNMFDPA ET+P FDL+IRDDV +ECS+YG V HI+VDKNS
Sbjct  421  AIPSFVNEHVGLPSECLLLKNMFDPATETEPNFDLEIRDDVADECSKYGPVNHIYVDKNS  480

Query  436  AGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFK  299
            AG+VY  F SVE A  AQ+AMH RWFA++ +SA F+ P+EY+AK K
Sbjct  481  AGFVYLRFQSVEAAAAAQRAMHMRWFAQKMISATFMPPHEYEAKAK  526



>ref|XP_002306512.2| hypothetical protein POPTR_0005s19200g [Populus trichocarpa]
 gb|EEE93508.2| hypothetical protein POPTR_0005s19200g [Populus trichocarpa]
Length=551

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -3

Query  595  EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXX  416
            EP+G PSECL+LKNMFDPA ET+P+FDLDI++DV EECS+YG V+HI VDKNS G VY  
Sbjct  450  EPIGQPSECLMLKNMFDPATETEPDFDLDIKEDVEEECSKYGQVEHIFVDKNSTGCVYLR  509

Query  415  FDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
            F S+E A  AQ+AMH RWFARR + A F+   EY+A+F+  A
Sbjct  510  FGSIEAAAGAQRAMHMRWFARRLILAVFMPTREYEARFQIGA  551



>ref|XP_002465838.1| hypothetical protein SORBIDRAFT_01g046740 [Sorghum bicolor]
 gb|EER92836.1| hypothetical protein SORBIDRAFT_01g046740 [Sorghum bicolor]
Length=541

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -3

Query  580  PSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVE  401
            PSECLLLKNMFDPA+ETDP+FDLDIRDDV EECS++G +KHI VDKN+AG+VY  FDS+ 
Sbjct  447  PSECLLLKNMFDPALETDPDFDLDIRDDVQEECSKFGQLKHIFVDKNTAGFVYLRFDSIT  506

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
             A  AQ+A+H RWFA + ++A F+ P +Y+ KF
Sbjct  507  AAMSAQKALHGRWFAGKMITATFMTPQQYEMKF  539



>ref|NP_568220.1| splicing factor, CC1-like [Arabidopsis thaliana]
 gb|AAK96794.1| splicing factor-like protein [Arabidopsis thaliana]
 gb|AED91460.1| splicing factor, CC1-like [Arabidopsis thaliana]
Length=527

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -3

Query  616  VVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS  437
             + + V E VG PSECLLLKNMFDPA ET+P FDL+IRDDV +ECS+YG V HI+VDKNS
Sbjct  421  AIPSFVNEHVGLPSECLLLKNMFDPATETEPNFDLEIRDDVADECSKYGPVNHIYVDKNS  480

Query  436  AGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFK  299
            AG+VY  F SVE A  AQ+AMH RWFA++ +SA F+ P+EY+AK K
Sbjct  481  AGFVYLRFQSVEAAAAAQRAMHMRWFAQKMISATFMPPHEYEAKAK  526



>gb|AFW68703.1| hypothetical protein ZEAMMB73_109361 [Zea mays]
Length=300

 Score =   142 bits (357),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -3

Query  583  NPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSV  404
             P+E LLLKNMFDP++ETDP+FDLDIRDDV +ECS++GAVKHI VDKN+AG+VY  FDSV
Sbjct  204  TPTEFLLLKNMFDPSLETDPDFDLDIRDDVQDECSKFGAVKHIFVDKNTAGFVYLQFDSV  263

Query  403  EFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              A  AQQA+H RWFA + ++A F+   EY  KF
Sbjct  264  TAAGKAQQALHGRWFAGKMITATFMSDQEYSTKF  297



>ref|XP_010229190.1| PREDICTED: RNA-binding protein 39-like isoform X3 [Brachypodium 
distachyon]
Length=407

 Score =   144 bits (362),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 82/103 (80%), Gaps = 2/103 (2%)
 Frame = -3

Query  604  MVPEPVGN--PSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAG  431
            ++ +P+    PSECLLLKNMFDPA+ETDP+FDLDI+DDV EECS++G ++HI VDKN+AG
Sbjct  303  VISQPIATAPPSECLLLKNMFDPAVETDPDFDLDIKDDVREECSKFGQIRHIFVDKNTAG  362

Query  430  YVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            +VY  FDS+  A  AQ+A+  RWFA + ++A F+ P +Y+AKF
Sbjct  363  FVYLRFDSITAAMGAQKALQGRWFAGKMITATFMSPQQYEAKF  405



>ref|NP_001169267.1| hypothetical protein [Zea mays]
 gb|ACN32166.1| unknown [Zea mays]
 gb|AFW68702.1| hypothetical protein ZEAMMB73_109361 [Zea mays]
Length=318

 Score =   142 bits (357),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -3

Query  583  NPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSV  404
             P+E LLLKNMFDP++ETDP+FDLDIRDDV +ECS++GAVKHI VDKN+AG+VY  FDSV
Sbjct  222  TPTEFLLLKNMFDPSLETDPDFDLDIRDDVQDECSKFGAVKHIFVDKNTAGFVYLQFDSV  281

Query  403  EFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              A  AQQA+H RWFA + ++A F+   EY  KF
Sbjct  282  TAAGKAQQALHGRWFAGKMITATFMSDQEYSTKF  315



>ref|NP_001142242.1| uncharacterized protein LOC100274411 [Zea mays]
 gb|ACF79521.1| unknown [Zea mays]
 gb|ACF87970.1| unknown [Zea mays]
 tpg|DAA49864.1| TPA: hypothetical protein ZEAMMB73_656561 [Zea mays]
 tpg|DAA49865.1| TPA: hypothetical protein ZEAMMB73_656561 [Zea mays]
Length=318

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -3

Query  583  NPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSV  404
             P+E LLLKNMFDPA+ETDP+FDLDIRDDV +ECS++GAVKHI VDKN+AG+VY  FDSV
Sbjct  222  TPTEFLLLKNMFDPALETDPDFDLDIRDDVQDECSKFGAVKHIFVDKNTAGFVYLQFDSV  281

Query  403  EFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              A  AQ A+H RWFA + ++A F+   EY  KF
Sbjct  282  TAAAKAQNALHGRWFAGKMITATFMSALEYSTKF  315



>ref|XP_007137678.1| hypothetical protein PHAVU_009G146500g [Phaseolus vulgaris]
 gb|ESW09672.1| hypothetical protein PHAVU_009G146500g [Phaseolus vulgaris]
Length=590

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            QVV   V EPVGNPSECLLLKNMFDP  ET+P+FDLDI++DV EECS+YG VKHI+VDK 
Sbjct  482  QVVPTPVIEPVGNPSECLLLKNMFDPNTETEPDFDLDIKEDVEEECSKYGRVKHIYVDKR  541

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQP  323
            S G+VY  F++VE A  AQ+AMH RWFA R +SA ++ P
Sbjct  542  STGFVYLQFETVEAASAAQRAMHTRWFAGRMISAIYMVP  580



>ref|XP_006649420.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Oryza brachyantha]
Length=401

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = -3

Query  580  PSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVE  401
            PSECLLLKNMFDPA+ETDP+FDLDI++DV EECS++G VKHI VDKN+AG+VY  FDS+ 
Sbjct  307  PSECLLLKNMFDPAVETDPDFDLDIKEDVQEECSKFGQVKHIFVDKNTAGFVYLRFDSIT  366

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
             A  AQ+A+H RWFA + ++A F+ P +Y  KF
Sbjct  367  AAMSAQKALHGRWFAGKMITATFMTPQQYSMKF  399



>ref|XP_003558785.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Brachypodium 
distachyon]
Length=551

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 82/103 (80%), Gaps = 2/103 (2%)
 Frame = -3

Query  604  MVPEPVGN--PSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAG  431
            ++ +P+    PSECLLLKNMFDPA+ETDP+FDLDI+DDV EECS++G ++HI VDKN+AG
Sbjct  447  VISQPIATAPPSECLLLKNMFDPAVETDPDFDLDIKDDVREECSKFGQIRHIFVDKNTAG  506

Query  430  YVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            +VY  FDS+  A  AQ+A+  RWFA + ++A F+ P +Y+AKF
Sbjct  507  FVYLRFDSITAAMGAQKALQGRWFAGKMITATFMSPQQYEAKF  549



>ref|XP_008668579.1| PREDICTED: uncharacterized protein LOC100274411 isoform X2 [Zea 
mays]
Length=337

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -3

Query  583  NPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSV  404
             P+E LLLKNMFDPA+ETDP+FDLDIRDDV +ECS++GAVKHI VDKN+AG+VY  FDSV
Sbjct  241  TPTEFLLLKNMFDPALETDPDFDLDIRDDVQDECSKFGAVKHIFVDKNTAGFVYLQFDSV  300

Query  403  EFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              A  AQ A+H RWFA + ++A F+   EY  KF
Sbjct  301  TAAAKAQNALHGRWFAGKMITATFMSALEYSTKF  334



>ref|XP_009399181.1| PREDICTED: RNA-binding protein 39 [Musa acuminata subsp. malaccensis]
Length=544

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 82/106 (77%), Gaps = 1/106 (1%)
 Frame = -3

Query  616  VVXAM-VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            VV A   P  V  PSECLLLKNMFDP+ ET+P+FDL+I++DV EECS++G VKHIHV+KN
Sbjct  439  VVSAQHTPTSVVEPSECLLLKNMFDPSTETEPDFDLEIKEDVQEECSKFGPVKHIHVEKN  498

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            S G+VY  F+SV  A   Q+AM  RWFA RSVSA F++P EY+AKF
Sbjct  499  STGFVYLRFESVTAAVSCQRAMQGRWFAGRSVSATFMRPQEYEAKF  544



>ref|XP_004985661.1| PREDICTED: RNA-binding protein 39-like [Setaria italica]
Length=552

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -3

Query  580  PSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVE  401
            PSECLLLKNMFDPA+ETDP+FDLDIRDDV +ECS++G +KHI VDKN+AG+VY  FDS+ 
Sbjct  458  PSECLLLKNMFDPAVETDPDFDLDIRDDVQDECSKFGQLKHIFVDKNTAGFVYLRFDSIT  517

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
             A  AQ+A+H RWFA + ++A F+ P +Y+ KF
Sbjct  518  AAMSAQKALHGRWFAGKMITATFMTPQQYEMKF  550



>gb|KHN34036.1| RNA-binding protein 39 [Glycine soja]
Length=564

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            V EPVGNPSECLLLKNMFDP+ ET+P+FD+DI++DV EECS+YG VKHI VDK SAG+VY
Sbjct  451  VVEPVGNPSECLLLKNMFDPSTETEPDFDIDIKEDVEEECSKYGRVKHIFVDKKSAGFVY  510

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFL  329
              FD+VE A  AQ AMH RWFARR +SA F+
Sbjct  511  LRFDTVEAASAAQHAMHLRWFARRLISAVFM  541



>gb|EEE58341.1| hypothetical protein OsJ_09449 [Oryza sativa Japonica Group]
Length=565

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = -3

Query  580  PSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVE  401
            PSECLLLKNMFDP++ETDP+FDLDI+DDV EECS++G VKHI VDKN++G+VY  FDS+ 
Sbjct  471  PSECLLLKNMFDPSVETDPDFDLDIKDDVQEECSKFGQVKHIFVDKNTSGFVYLRFDSIT  530

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
             A  AQ+A+H RWFA + ++A F+ P +Y  KF
Sbjct  531  AAMSAQKALHGRWFAGKMITATFMSPQQYSTKF  563



>gb|EEC74539.1| hypothetical protein OsI_10059 [Oryza sativa Indica Group]
Length=567

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = -3

Query  580  PSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVE  401
            PSECLLLKNMFDP++ETDP+FDLDI+DDV EECS++G VKHI VDKN++G+VY  FDS+ 
Sbjct  473  PSECLLLKNMFDPSVETDPDFDLDIKDDVQEECSKFGQVKHIFVDKNTSGFVYLRFDSIT  532

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
             A  AQ+A+H RWFA + ++A F+ P +Y  KF
Sbjct  533  AAMSAQKALHGRWFAGKMITATFMSPQQYSTKF  565



>gb|ABF94032.1| transposon protein, putative, CACTA, En/Spm sub-class, expressed 
[Oryza sativa Japonica Group]
Length=566

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = -3

Query  580  PSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVE  401
            PSECLLLKNMFDP++ETDP+FDLDI+DDV EECS++G VKHI VDKN++G+VY  FDS+ 
Sbjct  472  PSECLLLKNMFDPSVETDPDFDLDIKDDVQEECSKFGQVKHIFVDKNTSGFVYLRFDSIT  531

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
             A  AQ+A+H RWFA + ++A F+ P +Y  KF
Sbjct  532  AAMSAQKALHGRWFAGKMITATFMSPQQYSTKF  564



>ref|XP_006649419.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Oryza brachyantha]
Length=575

 Score =   142 bits (359),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = -3

Query  580  PSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVE  401
            PSECLLLKNMFDPA+ETDP+FDLDI++DV EECS++G VKHI VDKN+AG+VY  FDS+ 
Sbjct  481  PSECLLLKNMFDPAVETDPDFDLDIKEDVQEECSKFGQVKHIFVDKNTAGFVYLRFDSIT  540

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
             A  AQ+A+H RWFA + ++A F+ P +Y  KF
Sbjct  541  AAMSAQKALHGRWFAGKMITATFMTPQQYSMKF  573



>ref|XP_010935165.1| PREDICTED: RNA-binding protein 39-like [Elaeis guineensis]
Length=572

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 84/111 (76%), Gaps = 3/111 (3%)
 Frame = -3

Query  613  VXAMVPEP---VGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDK  443
            V +  P+P   VG PSECLLLKNMFDP +ET+P+FDLDI++DV +ECS++G VKHI VDK
Sbjct  462  VASTAPQPAETVGAPSECLLLKNMFDPNVETEPDFDLDIKEDVQDECSKFGPVKHIFVDK  521

Query  442  NSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
            NSAG+VY  FDS   A  AQ+A+H RWFA + ++A F+ P  Y+AKF  A+
Sbjct  522  NSAGHVYIRFDSPTSAINAQRALHGRWFAGKMITATFMLPQNYEAKFPSAS  572



>ref|XP_007048199.1| Splicing factor isoform 2 [Theobroma cacao]
 gb|EOX92356.1| Splicing factor isoform 2 [Theobroma cacao]
Length=497

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = -3

Query  616  VVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS  437
            ++     +P G PSECLLLKNMFDPA E +P+FDL+I++DV EECS+YG VKHIHVDKNS
Sbjct  393  IMSTTAVDPTGQPSECLLLKNMFDPATEMEPDFDLEIKEDVEEECSKYGRVKHIHVDKNS  452

Query  436  AGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAK  305
            AG VY  FDS E A  AQ+AMH RWFA RS+SA F+      +K
Sbjct  453  AGCVYLRFDSAEAAGKAQRAMHMRWFAGRSISALFMATTRVRSK  496



>gb|ADE76571.1| unknown [Picea sitchensis]
Length=203

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = -3

Query  595  EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXX  416
            +P+G P++CLLLKNMFDP  ET+P+FDLDI++DV +ECS++GAV+HI VDK+SAG+VY  
Sbjct  102  DPIGVPNDCLLLKNMFDPNNETEPDFDLDIKEDVQDECSKFGAVRHIFVDKHSAGHVYLR  161

Query  415  FDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            FDS   A  AQ+A+H RWFA + ++A F+  Y Y+AKF
Sbjct  162  FDSATSAIGAQRALHGRWFAGKMITATFMPSYTYEAKF  199



>gb|ACN36244.1| unknown [Zea mays]
Length=410

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -3

Query  583  NPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSV  404
             P+E LLLKNMFDP++ETDP+FDLDIRDDV +ECS++GAVKHI VDKN+AG+VY  FDSV
Sbjct  314  TPTEFLLLKNMFDPSLETDPDFDLDIRDDVQDECSKFGAVKHIFVDKNTAGFVYLQFDSV  373

Query  403  EFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              A  AQQA+H RWFA + ++A F+   EY  KF
Sbjct  374  TAAGKAQQALHGRWFAGKMITATFMSDQEYSTKF  407



>ref|XP_004983028.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Setaria italica]
Length=407

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -3

Query  580  PSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVE  401
            P+E LLLKNMFDP +ETDP+FDLDIRDDV +ECS++GAVKHI VDKN+AG+VY  FDSV 
Sbjct  312  PTEFLLLKNMFDPTVETDPDFDLDIRDDVQDECSKFGAVKHIFVDKNTAGFVYLHFDSVT  371

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
             A  AQQA+H RWFA + ++A F+   EY AKF
Sbjct  372  AAAKAQQALHGRWFAGKMITATFMTAQEYSAKF  404



>ref|XP_011045848.1| PREDICTED: RNA-binding protein 39 [Populus euphratica]
Length=595

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 83/108 (77%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            Q+    +P  E +G PS+CLLLKNMFDP  ET+P+FDLDI++DV EECS +G VKHIHVD
Sbjct  484  QLPATTIPTVETIGVPSDCLLLKNMFDPKTETEPDFDLDIKEDVQEECSRFGNVKHIHVD  543

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            KNSAG+VY  F++++ A  AQ+A+H RWFA + ++A F+ P  Y+AKF
Sbjct  544  KNSAGFVYMRFENMQGAVNAQRALHGRWFAGKMITATFMVPQAYEAKF  591



>ref|XP_002467180.1| hypothetical protein SORBIDRAFT_01g021020 [Sorghum bicolor]
 gb|EER94178.1| hypothetical protein SORBIDRAFT_01g021020 [Sorghum bicolor]
Length=535

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -3

Query  583  NPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSV  404
             P+E LLLKNMFDPA+ETDP+FDLDIRDDV +ECS++GAVKHI VDKN+AG+VY  FDSV
Sbjct  439  TPTEFLLLKNMFDPALETDPDFDLDIRDDVQDECSKFGAVKHIFVDKNTAGFVYLQFDSV  498

Query  403  EFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              A  AQQA+H RWFA + ++A F+   EY  KF
Sbjct  499  AAAGKAQQALHGRWFAGKMITATFMSAQEYSTKF  532



>ref|XP_008338762.1| PREDICTED: RNA-binding protein 39 isoform X2 [Malus domestica]
Length=598

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            V EPVGNPSECLLLKNMFDPA E +P+FD+DI++DV EECS+YG VKHI+VDKNSAG+VY
Sbjct  497  VNEPVGNPSECLLLKNMFDPATEREPDFDVDIKEDVEEECSKYGRVKHIYVDKNSAGFVY  556

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              F++VE A  AQ+AMH RWFA R +SA F+QP  Y+AKF
Sbjct  557  LRFEAVEAAAAAQRAMHLRWFAGRLISALFMQPQVYEAKF  596



>ref|XP_008338761.1| PREDICTED: RNA-binding protein 39 isoform X1 [Malus domestica]
Length=599

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            V EPVGNPSECLLLKNMFDPA E +P+FD+DI++DV EECS+YG VKHI+VDKNSAG+VY
Sbjct  498  VNEPVGNPSECLLLKNMFDPATEREPDFDVDIKEDVEEECSKYGRVKHIYVDKNSAGFVY  557

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              F++VE A  AQ+AMH RWFA R +SA F+QP  Y+AKF
Sbjct  558  LRFEAVEAAAAAQRAMHLRWFAGRLISALFMQPQVYEAKF  597



>ref|XP_009384003.1| PREDICTED: RNA-binding protein 39 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=425

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 80/107 (75%), Gaps = 2/107 (2%)
 Frame = -3

Query  616  VVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDK  443
            V  A  P  +  G PSECLLLKNMFDP++E +P+FDLDI+DDV +ECS++G VKHI VDK
Sbjct  315  VASATAPALQTAGVPSECLLLKNMFDPSVEAEPDFDLDIKDDVQDECSKFGTVKHISVDK  374

Query  442  NSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            NSAGYVY  FD++  A  AQ A+H RWFA + ++A F+   +Y+AKF
Sbjct  375  NSAGYVYLRFDNITSAMKAQNALHGRWFAGKMITATFMSLQQYEAKF  421



>gb|EMS53612.1| RNA-binding protein 39 [Triticum urartu]
Length=440

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -3

Query  580  PSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVE  401
            PSECLLLKNMFDPA+ETDP+FDLDIRDDV EECS++G V+HI VDKN+AG+VY  FDS+ 
Sbjct  346  PSECLLLKNMFDPAVETDPDFDLDIRDDVREECSKFGQVRHIFVDKNTAGFVYLRFDSIT  405

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
             A  AQ+A+  RWFA + ++A F+   +Y+ KF
Sbjct  406  AAMGAQKALQGRWFAGKMITATFMSTQQYEMKF  438



>ref|XP_008377726.1| PREDICTED: RNA-binding protein 39-like [Malus domestica]
Length=239

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 80/108 (74%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            Q+  A +P  + +G PSECLLLKNMFDP  E++P FDLDI+DDV +ECS+YG +KHI+VD
Sbjct  128  QIPTATLPSVDTIGVPSECLLLKNMFDPTAESEPNFDLDIKDDVQDECSKYGTLKHIYVD  187

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            KN+AG+VY  F++ + A  A+  +H RWFA + + A F+ P  Y+AKF
Sbjct  188  KNTAGHVYLRFENTQAAISARHVLHGRWFAGKMIEATFMLPQTYEAKF  235



>emb|CBI37850.3| unnamed protein product [Vitis vinifera]
Length=427

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 84/108 (78%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            QV    VP  + +G PSECL+LKNMFDP +ET+P+FDLDI++DV +ECS++G VKHI+VD
Sbjct  316  QVPAVTVPSIDTIGVPSECLMLKNMFDPKLETEPDFDLDIKEDVQDECSKFGTVKHIYVD  375

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            KNSAG+V+  F++ + A  AQ+A+H RWFA + ++A F+ P  Y+AKF
Sbjct  376  KNSAGFVFLRFENTQAAISAQRALHGRWFAGKMITATFMLPQNYEAKF  423



>ref|XP_009384002.1| PREDICTED: RNA-binding protein 39 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=574

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 80/107 (75%), Gaps = 2/107 (2%)
 Frame = -3

Query  616  VVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDK  443
            V  A  P  +  G PSECLLLKNMFDP++E +P+FDLDI+DDV +ECS++G VKHI VDK
Sbjct  464  VASATAPALQTAGVPSECLLLKNMFDPSVEAEPDFDLDIKDDVQDECSKFGTVKHISVDK  523

Query  442  NSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            NSAGYVY  FD++  A  AQ A+H RWFA + ++A F+   +Y+AKF
Sbjct  524  NSAGYVYLRFDNITSAMKAQNALHGRWFAGKMITATFMSLQQYEAKF  570



>ref|XP_002312948.2| hypothetical protein POPTR_0009s13940g [Populus trichocarpa]
 gb|EEE86903.2| hypothetical protein POPTR_0009s13940g [Populus trichocarpa]
Length=599

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 83/108 (77%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            Q+    +P  E +G PS+C+LLKNMFDP  ET+P+FDLDI++DV EECS +G VKHIHVD
Sbjct  488  QLPATTIPTVETIGVPSDCILLKNMFDPKKETEPDFDLDIKEDVQEECSRFGNVKHIHVD  547

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            KNSAG+VY  F++++ A  AQ+A+H RWFA + ++A F+ P  Y+AKF
Sbjct  548  KNSAGFVYMRFENMQGAVNAQRALHGRWFAGKMITATFMVPQTYEAKF  595



>ref|XP_008809443.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Phoenix dactylifera]
Length=601

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = -3

Query  595  EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXX  416
            E VG PSECLLLKNMFDP +ET+P+FDLDI++DV +ECS++G VKHI VDKNSAG VY  
Sbjct  500  ETVGIPSECLLLKNMFDPNVETEPDFDLDIKEDVQDECSKFGTVKHIFVDKNSAGNVYLR  559

Query  415  FDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            FD++  A  AQ+A+H RWFA + ++A F+ P +Y+AKF
Sbjct  560  FDNITSAMNAQRALHGRWFAGKMITATFMLPQQYEAKF  597



>ref|XP_008809442.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Phoenix dactylifera]
Length=646

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = -3

Query  595  EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXX  416
            E VG PSECLLLKNMFDP +ET+P+FDLDI++DV +ECS++G VKHI VDKNSAG VY  
Sbjct  545  ETVGIPSECLLLKNMFDPNVETEPDFDLDIKEDVQDECSKFGTVKHIFVDKNSAGNVYLR  604

Query  415  FDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            FD++  A  AQ+A+H RWFA + ++A F+ P +Y+AKF
Sbjct  605  FDNITSAMNAQRALHGRWFAGKMITATFMLPQQYEAKF  642



>ref|XP_006661796.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Oryza brachyantha]
Length=332

 Score =   137 bits (345),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -3

Query  589  VGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFD  410
            +G P+E LLLKNMFDPA+ETDP+FDLDI+DDV +ECS++GAV HI VDKN+AG+VY  FD
Sbjct  235  IGPPTEFLLLKNMFDPALETDPDFDLDIKDDVQDECSKFGAVNHIFVDKNTAGFVYLHFD  294

Query  409  SVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            SV  A  AQ+A+H RWFA + ++A F+   +Y  KF
Sbjct  295  SVAAATNAQRALHGRWFAGKMITATFMTAQQYKMKF  330



>gb|EMT10841.1| RNA-binding protein 39 [Aegilops tauschii]
Length=469

 Score =   139 bits (350),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -3

Query  580  PSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVE  401
            PSECLLLKNMFDPA+ETDP+FDLDIRDDV EECS++G V+HI VDKN+AG+VY  FDS+ 
Sbjct  375  PSECLLLKNMFDPAVETDPDFDLDIRDDVREECSKFGQVRHIFVDKNTAGFVYLRFDSIT  434

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
             A  AQ+A+  RWFA + ++A F+   +Y+ KF
Sbjct  435  AAMGAQKALQGRWFAGKMITATFMSTQQYEMKF  467



>ref|XP_008644042.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW68704.1| hypothetical protein ZEAMMB73_109361 [Zea mays]
 gb|AFW68705.1| hypothetical protein ZEAMMB73_109361 [Zea mays]
Length=536

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -3

Query  583  NPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSV  404
             P+E LLLKNMFDP++ETDP+FDLDIRDDV +ECS++GAVKHI VDKN+AG+VY  FDSV
Sbjct  440  TPTEFLLLKNMFDPSLETDPDFDLDIRDDVQDECSKFGAVKHIFVDKNTAGFVYLQFDSV  499

Query  403  EFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              A  AQQA+H RWFA + ++A F+   EY  KF
Sbjct  500  TAAGKAQQALHGRWFAGKMITATFMSDQEYSTKF  533



>ref|XP_004983027.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Setaria italica]
Length=542

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -3

Query  580  PSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVE  401
            P+E LLLKNMFDP +ETDP+FDLDIRDDV +ECS++GAVKHI VDKN+AG+VY  FDSV 
Sbjct  447  PTEFLLLKNMFDPTVETDPDFDLDIRDDVQDECSKFGAVKHIFVDKNTAGFVYLHFDSVT  506

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
             A  AQQA+H RWFA + ++A F+   EY AKF
Sbjct  507  AAAKAQQALHGRWFAGKMITATFMTAQEYSAKF  539



>ref|XP_010266038.1| PREDICTED: RNA-binding protein 39 [Nelumbo nucifera]
Length=602

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = -3

Query  613  VXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSA  434
            V A   + +G PSECLLLKNMFDP +ET+P+FDLDI++DV +ECS++G VKHI+VDKNSA
Sbjct  495  VTAPAIDTLGAPSECLLLKNMFDPKVETEPDFDLDIKEDVQDECSKFGTVKHIYVDKNSA  554

Query  433  GYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            GYVY  F++ + A  AQ+++H RWFA + ++A F+ P  Y+AKF
Sbjct  555  GYVYLRFENAQSAMNAQRSLHGRWFAGKMITATFMLPQNYEAKF  598



>ref|XP_010920083.1| PREDICTED: RNA-binding protein 39-like [Elaeis guineensis]
Length=597

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = -3

Query  595  EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXX  416
            E VG PSECLLLKN+FDP +ET+P+FDLDI++DV +ECS++G VKHI VDKN+AG+VY  
Sbjct  496  ETVGIPSECLLLKNLFDPNVETEPDFDLDIKEDVQDECSKFGTVKHIFVDKNTAGHVYLR  555

Query  415  FDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            FD++  A  AQ+A+H RWFA + ++A F+ P +Y+AKF
Sbjct  556  FDNITSAMNAQRALHGRWFAGKMITATFMLPQQYEAKF  593



>gb|KDP33302.1| hypothetical protein JCGZ_13089 [Jatropha curcas]
Length=611

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -3

Query  589  VGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFD  410
            +G PSECLLLKNMFDP +ET+P+FDLDIR+DV EECS++G++KHI+VDKNSAG+VY  F+
Sbjct  512  IGVPSECLLLKNMFDPKLETEPDFDLDIREDVQEECSKFGSLKHIYVDKNSAGFVYLRFE  571

Query  409  SVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            + + A  AQ+A+H RWFA + ++A ++ P  Y+AKF
Sbjct  572  NTQAAINAQRALHGRWFAGKMITATYMVPQVYEAKF  607



>ref|XP_008668576.1| PREDICTED: uncharacterized protein LOC100274411 isoform X1 [Zea 
mays]
 gb|ACF86417.1| unknown [Zea mays]
 tpg|DAA49861.1| TPA: hypothetical protein ZEAMMB73_656561 [Zea mays]
Length=537

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -3

Query  583  NPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSV  404
             P+E LLLKNMFDPA+ETDP+FDLDIRDDV +ECS++GAVKHI VDKN+AG+VY  FDSV
Sbjct  441  TPTEFLLLKNMFDPALETDPDFDLDIRDDVQDECSKFGAVKHIFVDKNTAGFVYLQFDSV  500

Query  403  EFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              A  AQ A+H RWFA + ++A F+   EY  KF
Sbjct  501  TAAAKAQNALHGRWFAGKMITATFMSALEYSTKF  534



>ref|XP_006589727.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Glycine max]
Length=421

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 82/108 (76%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            Q+  A +P  +P+G PSECL+LKNMFDP  ET+P+FDLDI++DV  ECS++GA+KHI+VD
Sbjct  310  QIPTATIPSIDPIGVPSECLMLKNMFDPKDETEPDFDLDIKEDVEAECSKFGALKHIYVD  369

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            K SAG+VY  F+  + A  AQQA+H RWFA + ++A F+ P  Y+ KF
Sbjct  370  KKSAGFVYLRFEDTQSAISAQQALHGRWFAGKMITASFMVPQSYEDKF  417



>ref|XP_002279887.2| PREDICTED: RNA-binding protein 39 [Vitis vinifera]
Length=609

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 84/108 (78%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            QV    VP  + +G PSECL+LKNMFDP +ET+P+FDLDI++DV +ECS++G VKHI+VD
Sbjct  498  QVPAVTVPSIDTIGVPSECLMLKNMFDPKLETEPDFDLDIKEDVQDECSKFGTVKHIYVD  557

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            KNSAG+V+  F++ + A  AQ+A+H RWFA + ++A F+ P  Y+AKF
Sbjct  558  KNSAGFVFLRFENTQAAISAQRALHGRWFAGKMITATFMLPQNYEAKF  605



>ref|XP_006661795.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Oryza brachyantha]
Length=383

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -3

Query  589  VGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFD  410
            +G P+E LLLKNMFDPA+ETDP+FDLDI+DDV +ECS++GAV HI VDKN+AG+VY  FD
Sbjct  286  IGPPTEFLLLKNMFDPALETDPDFDLDIKDDVQDECSKFGAVNHIFVDKNTAGFVYLHFD  345

Query  409  SVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            SV  A  AQ+A+H RWFA + ++A F+   +Y  KF
Sbjct  346  SVAAATNAQRALHGRWFAGKMITATFMTAQQYKMKF  381



>ref|XP_008806137.1| PREDICTED: RNA-binding protein 39-like [Phoenix dactylifera]
 ref|XP_008806138.1| PREDICTED: RNA-binding protein 39-like [Phoenix dactylifera]
 ref|XP_008806139.1| PREDICTED: RNA-binding protein 39-like [Phoenix dactylifera]
Length=580

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -3

Query  595  EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXX  416
            E +G PSECLLLKNMFDP +ET+P+FDLDI++DV +ECS++G VKHI V+KNSAG+VY  
Sbjct  479  ETLGAPSECLLLKNMFDPNVETEPDFDLDIKEDVQDECSKFGTVKHIFVEKNSAGHVYIR  538

Query  415  FDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            FDS   A  AQ+A+H RWFA + ++A F+ P  Y+AKF
Sbjct  539  FDSATSAMNAQRALHGRWFAGKMITATFMLPQNYEAKF  576



>gb|KFK25283.1| hypothetical protein AALP_AA8G092000 [Arabis alpina]
Length=522

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -3

Query  616  VVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS  437
             + A V EP+G PSECLLLKNMFDPA E +P+F+ +I+DDV +ECS+YG V+HI+VD+NS
Sbjct  416  AIPAFVAEPIGQPSECLLLKNMFDPATEMEPDFENEIKDDVVDECSKYGTVEHIYVDRNS  475

Query  436  AGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFK  299
            AG+VY  F+SV  A  AQ+AMH RWFA++ +SA F+  +EY+AK K
Sbjct  476  AGFVYLRFESVHAAAAAQKAMHTRWFAQKMISAIFMPRHEYEAKVK  521



>gb|KHN37392.1| RNA-binding protein 39 [Glycine soja]
Length=351

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 82/108 (76%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            Q+  A +P  +P+G PSECL+LKNMFDP  ET+P+FDLDI++DV  ECS++GA+KHI+VD
Sbjct  240  QIPTATIPSIDPIGVPSECLMLKNMFDPKDETEPDFDLDIKEDVEAECSKFGALKHIYVD  299

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            K SAG+VY  F+  + A  AQQA+H RWFA + ++A F+ P  Y+ KF
Sbjct  300  KKSAGFVYLRFEDTQSAISAQQALHGRWFAGKMITASFMVPQSYEDKF  347



>gb|KJB12136.1| hypothetical protein B456_002G002300 [Gossypium raimondii]
Length=591

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            V + +G+PSECLLLKNMFDP +ET+PEFDLDI++DV EECS++G +KHIHVD++SAG+VY
Sbjct  487  VIDTIGSPSECLLLKNMFDPTLETEPEFDLDIKEDVQEECSKFGKLKHIHVDRDSAGFVY  546

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              F+  + A  AQ+ +H RWFA + ++A ++ P  Y+AKF
Sbjct  547  LRFEDAQGAINAQRNLHGRWFAGKMITATYMVPQTYEAKF  586



>gb|KHF98937.1| RNA-binding 39 [Gossypium arboreum]
Length=619

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            V + +G+PSECLLLKNMFDP +ET+PEFDLDI++DV EECS++G +KHIHVD++SAG+VY
Sbjct  515  VIDTIGSPSECLLLKNMFDPTLETEPEFDLDIKEDVQEECSKFGKLKHIHVDRDSAGFVY  574

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              F+  + A  AQ+ +H RWFA + ++A ++ P  Y+AKF
Sbjct  575  LRFEDAQGAINAQRNLHGRWFAGKMITATYMVPQTYEAKF  614



>ref|XP_008382102.1| PREDICTED: RNA-binding protein 39-like [Malus domestica]
Length=601

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 81/108 (75%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            Q+  A +P  + VG PSECLLLKNMFDP  E++P+FDLDI+DDV EECS+YG +KHI+VD
Sbjct  490  QIPTATLPSVDTVGVPSECLLLKNMFDPTAESEPDFDLDIKDDVQEECSKYGKLKHIYVD  549

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            KN+AG+VY  F+++E A  A+  +H RWFA + +   F+ P  Y+AKF
Sbjct  550  KNTAGHVYLRFETIEAALNARHVLHGRWFAGKMIETTFMLPQTYEAKF  597



>ref|XP_003536719.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Glycine max]
Length=597

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 82/108 (76%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            Q+  A +P  +P+G PSECL+LKNMFDP  ET+P+FDLDI++DV  ECS++GA+KHI+VD
Sbjct  486  QIPTATIPSIDPIGVPSECLMLKNMFDPKDETEPDFDLDIKEDVEAECSKFGALKHIYVD  545

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            K SAG+VY  F+  + A  AQQA+H RWFA + ++A F+ P  Y+ KF
Sbjct  546  KKSAGFVYLRFEDTQSAISAQQALHGRWFAGKMITASFMVPQSYEDKF  593



>ref|XP_010912455.1| PREDICTED: RNA-binding protein 39-like [Elaeis guineensis]
Length=574

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 80/104 (77%), Gaps = 3/104 (3%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            + EP+G PSEC++LKNMFDP+ E DP+FDL+   +V EECS++G VKHI VDKNS G+VY
Sbjct  474  LTEPIGEPSECVILKNMFDPSTEMDPDFDLE---EVEEECSKFGPVKHIFVDKNSFGHVY  530

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
              F SV  A   QQAMH RW+ARRS+SA F++P EY+AKF+  +
Sbjct  531  LRFHSVAAAASCQQAMHMRWYARRSISATFMRPQEYEAKFRSVS  574



>gb|KFK40079.1| hypothetical protein AALP_AA3G327700 [Arabis alpina]
Length=408

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = -3

Query  616  VVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS  437
            ++   V +PVG PSECLLLKNMFDP+ ET+PEFDLDI+DDV +EC ++G + HI VDKNS
Sbjct  300  IIPPAVLDPVGVPSECLLLKNMFDPSTETEPEFDLDIKDDVKDECKKFGELNHIFVDKNS  359

Query  436  AGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
             G+VY  F +VE A  AQ+A+H RWFA + ++A ++    Y+AKF
Sbjct  360  VGFVYLRFANVEAAMGAQRALHGRWFAGKMITATYMTTEAYEAKF  404



>emb|CDY40065.1| BnaC02g00650D [Brassica napus]
Length=531

 Score =   136 bits (343),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = -3

Query  616  VVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS  437
            ++ ++V EP+G PSECLLLKNMFDPA ET+  FD DI++DV +ECS+YG VKHI+VDKNS
Sbjct  425  LLPSVVTEPIGQPSECLLLKNMFDPATETELNFDEDIKEDVGDECSKYGEVKHIYVDKNS  484

Query  436  AGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFK  299
            AG+VY  F+SV+ A  AQ+AMH RWFA++ +SA FL P+EY+A+ K
Sbjct  485  AGFVYLRFESVQAAMAAQRAMHTRWFAQKMISATFLPPHEYEARAK  530



>ref|XP_006847132.1| hypothetical protein AMTR_s00017p00234440 [Amborella trichopoda]
 gb|ERN08713.1| hypothetical protein AMTR_s00017p00234440 [Amborella trichopoda]
Length=716

 Score =   138 bits (347),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 81/108 (75%), Gaps = 1/108 (1%)
 Frame = -3

Query  613  VXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDK-NS  437
            V A V + +G PSECLLLKNMFDP+ ETDPEFDL+I++ V +ECS +G+VKHIHVDK N 
Sbjct  608  VTAPVVDSLGVPSECLLLKNMFDPSTETDPEFDLEIKEQVADECSRFGSVKHIHVDKYNP  667

Query  436  AGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGA  293
             G+VY  FDS   A  AQ+ +H RWFA++ +SA F+ P +Y+AKF G 
Sbjct  668  GGHVYLRFDSAASAINAQRGLHGRWFAQKMISATFIPPQQYEAKFSGG  715



>gb|AFK46942.1| unknown [Lotus japonicus]
Length=175

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 80/108 (74%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            Q+  A +P  + +G PSECL+LKNMFDP  ET+P+FDLDI++DV  ECS++G +KHI+VD
Sbjct  64   QIPTATIPSVDTIGVPSECLMLKNMFDPKAETEPDFDLDIKEDVEAECSKFGKLKHIYVD  123

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            K SAG+VY  F++ + A  AQ+A+H RWFA + ++  F+ P  Y+ +F
Sbjct  124  KKSAGFVYLRFEATQAAIGAQRALHGRWFAGKMITVSFMVPQSYEDRF  171



>ref|XP_007041785.1| Splicing factor isoform 4 [Theobroma cacao]
 gb|EOX97616.1| Splicing factor isoform 4 [Theobroma cacao]
Length=452

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -3

Query  595  EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXX  416
            + +G PSECLLLKNMFDP +ET+P+FDLDI++DV EECS++G +KHI+VD++SAG+VY  
Sbjct  347  DTIGTPSECLLLKNMFDPDLETEPDFDLDIKEDVQEECSKFGKLKHIYVDRDSAGFVYLR  406

Query  415  FDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            F+  + A  AQ+ +H RWFA + ++A F+ P  Y+AKF
Sbjct  407  FEDTQAAMSAQRNLHGRWFAAKMITATFMVPQTYEAKF  444



>gb|KJB32668.1| hypothetical protein B456_005G254800 [Gossypium raimondii]
 gb|KJB32669.1| hypothetical protein B456_005G254800 [Gossypium raimondii]
Length=577

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -3

Query  589  VGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFD  410
            +G PSECLLLKNMFDP++ET+P+FDLDI++DV EECS++G +KHI+VD+NSAG+VY  F+
Sbjct  478  IGTPSECLLLKNMFDPSLETEPDFDLDIKEDVQEECSKFGKLKHIYVDRNSAGFVYLRFE  537

Query  409  SVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              + A  AQ+ +H RWFA + ++A ++ P  Y+AKF
Sbjct  538  DAQGAINAQRNLHGRWFAGKMITATYMIPQTYEAKF  573



>ref|XP_009355642.1| PREDICTED: RNA-binding protein 39 isoform X1 [Pyrus x bretschneideri]
Length=601

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 80/108 (74%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            Q+  A +P  + +G PSECLLLKNMFDP  E++P FDLDI+DDV EECS+YG +KHI+VD
Sbjct  490  QIPTATLPSVDTIGVPSECLLLKNMFDPTAESEPNFDLDIKDDVQEECSKYGTLKHIYVD  549

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            KN+AG+VY  F++ + A  A+  +H RWFA + + A F+ P  Y+AKF
Sbjct  550  KNTAGHVYLRFENTQAAISARHVLHGRWFAGKMIEATFMLPQTYEAKF  597



>ref|XP_010530926.1| PREDICTED: RNA-binding protein 39 [Tarenaya hassleriana]
Length=577

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -3

Query  595  EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXX  416
            +PVG P+ECLLLKNMFDP  ET+P+FDLDI++DV EECS++G + HI VDKNSAG+VY  
Sbjct  476  DPVGVPTECLLLKNMFDPNSETEPDFDLDIKEDVQEECSKFGKLNHIFVDKNSAGFVYLR  535

Query  415  FDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            F++ + A  AQ+A+H RWFA   ++A ++ P  Y+AKF
Sbjct  536  FETTQAAMSAQRALHGRWFAGNMITATYMTPQAYEAKF  573



>ref|XP_008236127.1| PREDICTED: RNA-binding protein 39-like [Prunus mume]
Length=279

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 80/108 (74%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            Q+  A +P  + +G PSECLLLKNMFDPA+ET+P FDLDI++DV EECS+YG ++HI VD
Sbjct  168  QIPTATLPSIDTIGVPSECLLLKNMFDPAVETEPNFDLDIKEDVQEECSKYGNLRHIFVD  227

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            KN+AG+VY  F++ + A  A+  +H R FA + + A F+ P  YDAKF
Sbjct  228  KNTAGHVYLRFENTQAAINARHVLHGRRFAGKMIEATFMLPQNYDAKF  275



>ref|XP_010548117.1| PREDICTED: RNA-binding protein 39-like [Tarenaya hassleriana]
Length=565

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            +P+PVG P+ECLLLKNMFDP  ET+P+FDLDI++DV EECS++G + HI VDKNS+G+VY
Sbjct  462  LPDPVGVPTECLLLKNMFDPKTETEPDFDLDIKEDVQEECSKFGKLNHIFVDKNSSGFVY  521

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              F++V+ A   Q+A+H RWFA   ++A ++ P  Y+ KF
Sbjct  522  LRFETVQAAMNGQRALHGRWFAGNMITATYMTPQMYEEKF  561



>ref|XP_009355643.1| PREDICTED: RNA-binding protein 39 isoform X2 [Pyrus x bretschneideri]
Length=601

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 80/108 (74%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            Q+  A +P  + +G PSECLLLKNMFDP  E++P FDLDI+DDV EECS+YG +KHI+VD
Sbjct  490  QIPTATLPSVDTIGVPSECLLLKNMFDPTAESEPNFDLDIKDDVQEECSKYGTLKHIYVD  549

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            KN+AG+VY  F++ + A  A+  +H RWFA + + A F+ P  Y+AKF
Sbjct  550  KNTAGHVYLRFENTQAAISARHVLHGRWFAGKMIEATFMLPQTYEAKF  597



>gb|KHG01335.1| RNA-binding 39 [Gossypium arboreum]
Length=620

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 83/108 (77%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            Q+    +P  + +G PSECLLLKNMFDP++ET+P+FDLDI++DV EECS++G +KHI+VD
Sbjct  508  QIPTNGIPTIDTIGTPSECLLLKNMFDPSLETEPDFDLDIKEDVQEECSKFGKLKHIYVD  567

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            +NSAG+VY  F+  + A  AQ+ +H RWFA + ++A ++ P  Y+AKF
Sbjct  568  RNSAGFVYLRFEDAQGAINAQRNLHGRWFAGKMITATYMVPQTYEAKF  615



>ref|XP_006580322.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Glycine max]
Length=566

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            V EPVGNPSECLLLKNMFDP+ ET+P+FD+DI++DV EECS+YG VKHI VDK SAG+VY
Sbjct  451  VVEPVGNPSECLLLKNMFDPSTETEPDFDIDIKEDVEEECSKYGRVKHIFVDKKSAGFVY  510

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVS  341
              FD+VE A  AQ AMH RWFAR + S
Sbjct  511  LRFDTVEAASAAQHAMHLRWFARSNQS  537



>ref|XP_007201184.1| hypothetical protein PRUPE_ppa003064mg [Prunus persica]
 gb|EMJ02383.1| hypothetical protein PRUPE_ppa003064mg [Prunus persica]
Length=607

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 82/108 (76%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            Q+  A++P  + +G PSECLLLKNMFDPA+ET+P FDLDI++DV EECS+YG ++HI VD
Sbjct  496  QIPTAILPSIDTIGVPSECLLLKNMFDPAVETEPNFDLDIKEDVQEECSKYGNLRHIFVD  555

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            KN+AG+VY  F++ + A  A+  +H RWFA + + A F+ P  Y+AKF
Sbjct  556  KNTAGHVYLRFENTQAAINARHVLHGRWFAGKMIEATFMLPQNYEAKF  603



>ref|XP_007041782.1| Splicing factor isoform 1 [Theobroma cacao]
 ref|XP_007041783.1| Splicing factor isoform 1 [Theobroma cacao]
 gb|EOX97613.1| Splicing factor isoform 1 [Theobroma cacao]
 gb|EOX97614.1| Splicing factor isoform 1 [Theobroma cacao]
Length=581

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -3

Query  595  EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXX  416
            + +G PSECLLLKNMFDP +ET+P+FDLDI++DV EECS++G +KHI+VD++SAG+VY  
Sbjct  476  DTIGTPSECLLLKNMFDPDLETEPDFDLDIKEDVQEECSKFGKLKHIYVDRDSAGFVYLR  535

Query  415  FDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            F+  + A  AQ+ +H RWFA + ++A F+ P  Y+AKF
Sbjct  536  FEDTQAAMSAQRNLHGRWFAAKMITATFMVPQTYEAKF  573



>ref|XP_008236128.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein 39 [Prunus 
mume]
Length=624

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 81/108 (75%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            Q+  A +P  + +G PSECLLLKNMFDPA+ET+P FDLDI++DV EECS+YG ++HI VD
Sbjct  513  QIPTATLPSIDTIGVPSECLLLKNMFDPAVETEPNFDLDIKEDVQEECSKYGNLRHIFVD  572

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            KN+AG+VY  F++ + A  A+  +H RWFA + + A F+ P  Y+AKF
Sbjct  573  KNTAGHVYLRFENTQAAINARHVLHGRWFAGKMIEATFMLPQNYEAKF  620



>ref|XP_011046657.1| PREDICTED: RNA-binding protein 39-like [Populus euphratica]
 ref|XP_011046658.1| PREDICTED: RNA-binding protein 39-like [Populus euphratica]
 ref|XP_011046659.1| PREDICTED: RNA-binding protein 39-like [Populus euphratica]
Length=607

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 82/108 (76%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            Q+    +P  + +G PS+CL LKNMFDP  ET+P+FDLDI++DV EECS +G VKHI+VD
Sbjct  496  QLPATAIPTMDTIGVPSDCLFLKNMFDPKAETEPDFDLDIKEDVQEECSRFGNVKHIYVD  555

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            KNSAG+VY  F++++ A  AQ+A+H RWFA + ++A F+ P  Y+AKF
Sbjct  556  KNSAGFVYMRFENMQAAINAQRALHGRWFAGKLITATFMVPQTYEAKF  603



>ref|XP_002306193.2| hypothetical protein POPTR_0004s18320g [Populus trichocarpa]
 gb|EEE86704.2| hypothetical protein POPTR_0004s18320g [Populus trichocarpa]
Length=609

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 81/108 (75%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            Q+    +P  + +G PS+CL LKNMFDP  ET+P+FDLDI++DV EECS +G VKHI+VD
Sbjct  498  QLPATAIPTMDTIGVPSDCLFLKNMFDPKTETEPDFDLDIKEDVQEECSRFGNVKHIYVD  557

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            KNSAG+VY  F++++ A  AQ A+H RWFA + ++A F+ P  Y+AKF
Sbjct  558  KNSAGFVYMRFENMQAAINAQHALHGRWFAGKLITATFMVPQTYEAKF  605



>ref|XP_010107642.1| RNA-binding protein 39 [Morus notabilis]
 gb|EXC16553.1| RNA-binding protein 39 [Morus notabilis]
Length=811

 Score =   136 bits (343),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 59/107 (55%), Positives = 81/107 (76%), Gaps = 2/107 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            QV    VP  + +G PSECL LKNMFDPA ET+P FDLDI++DV +ECS++G ++HI+VD
Sbjct  365  QVPAVTVPSIDTIGAPSECLQLKNMFDPAAETEPNFDLDIKEDVQDECSKFGNLQHIYVD  424

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAK  305
            KNSAGYVY  F+  + A  AQ+A+H RWFA + ++A F+ P +Y+A+
Sbjct  425  KNSAGYVYLRFEHTQSAIAAQRALHGRWFAGKMITASFMLPQDYEAR  471



>dbj|BAJ92968.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=592

 Score =   134 bits (338),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -3

Query  589  VGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFD  410
            +G P+E LLLKNMFDP++ETDP+FDLDIRDDV EECS++G VKHI VDK++AG+VY  FD
Sbjct  490  IGTPTEFLLLKNMFDPSVETDPDFDLDIRDDVQEECSKFGVVKHIFVDKHTAGFVYLHFD  549

Query  409  SVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            S   A  AQ+++H RWFA + ++A F+  ++Y+ KF
Sbjct  550  SATAAASAQRSLHGRWFAGKMITATFMTAHQYEMKF  585



>dbj|BAJ94512.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=592

 Score =   134 bits (338),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -3

Query  589  VGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFD  410
            +G P+E LLLKNMFDP++ETDP+FDLDIRDDV EECS++G VKHI VDK++AG+VY  FD
Sbjct  490  IGTPTEFLLLKNMFDPSVETDPDFDLDIRDDVQEECSKFGVVKHIFVDKHTAGFVYLHFD  549

Query  409  SVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            S   A  AQ+++H RWFA + ++A F+  ++Y+ KF
Sbjct  550  SATAAASAQRSLHGRWFAGKMITATFMTAHQYEMKF  585



>dbj|BAK06658.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=592

 Score =   134 bits (338),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -3

Query  589  VGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFD  410
            +G P+E LLLKNMFDP++ETDP+FDLDIRDDV EECS++G VKHI VDK++AG+VY  FD
Sbjct  490  IGTPTEFLLLKNMFDPSVETDPDFDLDIRDDVQEECSKFGVVKHIFVDKHTAGFVYLHFD  549

Query  409  SVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            S   A  AQ+++H RWFA + ++A F+  ++Y+ KF
Sbjct  550  SATAAASAQRSLHGRWFAGKMITATFMTAHQYEMKF  585



>ref|XP_010028763.1| PREDICTED: RNA-binding protein 39 [Eucalyptus grandis]
 gb|KCW55579.1| hypothetical protein EUGRSUZ_I01450 [Eucalyptus grandis]
Length=598

 Score =   134 bits (338),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 81/108 (75%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            QV     P  + VG PSECLLLKNMFDP +ET+P+F+LDI++DV EECS++G ++HI VD
Sbjct  487  QVTATTGPTIDTVGVPSECLLLKNMFDPTLETEPDFELDIKEDVQEECSKFGNLRHIFVD  546

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            KNS+G+VY  F+  + A  AQ+A+H RWFA + ++A F+ P  Y+AKF
Sbjct  547  KNSSGFVYLRFEDTQSASNAQRALHGRWFAGKMITATFMVPLTYEAKF  594



>gb|KHN29140.1| RNA-binding protein 39 [Glycine soja]
Length=573

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -3

Query  619  QVVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKN  440
            QV+     EPVGNPS+CLLLKNMFDP+ ET+P+FD+DI++DV EECS+YG VKHI VDK 
Sbjct  441  QVMPNPAVEPVGNPSDCLLLKNMFDPSTETEPDFDIDIKEDVEEECSKYGRVKHIFVDKK  500

Query  439  SAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVS  341
            S+G+VY  FD+VE A  AQ+AMH RWFAR + S
Sbjct  501  SSGFVYLRFDTVEAASGAQRAMHMRWFARSNQS  533



>ref|XP_008784182.1| PREDICTED: RNA-binding protein 39-like [Phoenix dactylifera]
Length=584

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 80/107 (75%), Gaps = 3/107 (3%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            + E +G PSEC++LKNMFDP  E DP+FDLD   +V EECS++G VKHI+VDKNS G+VY
Sbjct  479  LTEAIGEPSECVILKNMFDPGTEMDPDFDLD---EVEEECSKFGPVKHIYVDKNSLGHVY  535

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA*TS  281
              FDSV  A    +AMH RW+ARRS+SA F++P EY+A F+  + TS
Sbjct  536  LRFDSVAAAASCVRAMHMRWYARRSISAAFMRPEEYEAIFRSVSRTS  582



>emb|CDY21612.1| BnaC09g46800D [Brassica napus]
Length=536

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = -3

Query  616  VVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS  437
             + A V EP+G PS+CLLLKNMFDPA ET+ +FD +I+DDV +ECS+YG V HI+VDK S
Sbjct  430  AIPAFVTEPIGQPSQCLLLKNMFDPATETELDFDEEIKDDVGQECSKYGQVNHIYVDKKS  489

Query  436  AGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFK  299
            AG+VY  F+SV+ A  AQ+AMH RWFA++ +SA F+ P EY+AK K
Sbjct  490  AGFVYLRFESVQAAAAAQRAMHMRWFAQKMISATFMPPNEYEAKAK  535



>ref|XP_011088626.1| PREDICTED: RNA-binding protein 39 isoform X2 [Sesamum indicum]
Length=578

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -3

Query  595  EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXX  416
            + +G PSECLLLKNMFDP  E +P+FDLDI+DDV EECS++G +KHI+V+KNSAG+VY  
Sbjct  476  DTIGAPSECLLLKNMFDPNSEAEPDFDLDIKDDVQEECSKFGRLKHIYVEKNSAGFVYLR  535

Query  415  FDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            F++ E A  AQ+A+H RWFA + ++A F+  + Y+AKF
Sbjct  536  FENAESAIAAQRALHGRWFAGKMITATFMLHHNYEAKF  573



>dbj|BAB09409.1| splicing factor-like protein [Arabidopsis thaliana]
Length=604

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = -3

Query  613  VXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSA  434
            + + V E VG PSECLLLKNMFDPA ET+P FDL+IRDDV +ECS+YG V HI+VDKNSA
Sbjct  422  IPSFVNEHVGLPSECLLLKNMFDPATETEPNFDLEIRDDVADECSKYGPVNHIYVDKNSA  481

Query  433  GYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFL  329
            G+VY  F SVE A  AQ+AMH RWFA++ +SA F+
Sbjct  482  GFVYLRFQSVEAAAAAQRAMHMRWFAQKMISATFM  516



>ref|XP_003573971.1| PREDICTED: RNA-binding protein 39-like [Brachypodium distachyon]
Length=597

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -3

Query  589  VGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFD  410
            +G P+E LLLKNMFDPA+ETDP+FDLDIRDDV EECS++G VKHI VDK++AG+VY  FD
Sbjct  496  IGTPTEFLLLKNMFDPAVETDPDFDLDIRDDVQEECSKFGVVKHIFVDKHTAGFVYLHFD  555

Query  409  SVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            S   A  AQ+++H RWFA + ++A F+   +Y+ KF
Sbjct  556  SSTAATSAQRSLHGRWFAGKMITATFMTAQQYEMKF  591



>ref|XP_001782480.1| predicted protein [Physcomitrella patens]
 gb|EDQ52699.1| predicted protein [Physcomitrella patens]
Length=363

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = -3

Query  589  VGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFD  410
            +G PSE LLLKNMFDP+ E+DPEFDLDI++DV +ECS++GAVKHI VDKNSAG+VY  F+
Sbjct  264  IGQPSEYLLLKNMFDPSTESDPEFDLDIKEDVQDECSKFGAVKHIFVDKNSAGHVYLCFE  323

Query  409  SVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            S   A  AQ+A+H RWFA + ++A ++    Y  KF
Sbjct  324  STPAAMAAQRALHGRWFAGKMITATYMSALAYQTKF  359



>ref|XP_004144853.1| PREDICTED: RNA-binding protein 39-like [Cucumis sativus]
 ref|XP_004162902.1| PREDICTED: RNA-binding protein 39-like [Cucumis sativus]
Length=562

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -3

Query  589  VGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFD  410
            VG PSECLLLKNMFDP  E++P FDLDIRDDV EECS +G +KHI+VD+NSAG+VY  F+
Sbjct  463  VGTPSECLLLKNMFDPTAESEPTFDLDIRDDVEEECSRFGKLKHIYVDRNSAGFVYLRFE  522

Query  409  SVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              E A  AQ+A++ RWFA + + A F+    Y+AKF
Sbjct  523  KSESAMEAQRALNGRWFAGKMIGATFMDIPSYEAKF  558



>ref|XP_011088625.1| PREDICTED: RNA-binding protein 39 isoform X1 [Sesamum indicum]
Length=604

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -3

Query  595  EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXX  416
            + +G PSECLLLKNMFDP  E +P+FDLDI+DDV EECS++G +KHI+V+KNSAG+VY  
Sbjct  502  DTIGAPSECLLLKNMFDPNSEAEPDFDLDIKDDVQEECSKFGRLKHIYVEKNSAGFVYLR  561

Query  415  FDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            F++ E A  AQ+A+H RWFA + ++A F+  + Y+AKF
Sbjct  562  FENAESAIAAQRALHGRWFAGKMITATFMLHHNYEAKF  599



>ref|XP_006409370.1| hypothetical protein EUTSA_v10022624mg [Eutrema salsugineum]
 gb|ESQ50823.1| hypothetical protein EUTSA_v10022624mg [Eutrema salsugineum]
Length=566

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -3

Query  595  EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXX  416
            +PVG PSECLLLKNMFDP+ ET+P+FDLDI++DV EECS++G + HI VDKNS G+VY  
Sbjct  465  DPVGVPSECLLLKNMFDPSTETEPDFDLDIKEDVQEECSKFGNLNHIFVDKNSVGFVYLR  524

Query  415  FDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            F++ + A  AQ+A+H RWFA + ++A ++    Y+AKF
Sbjct  525  FENAQAAMGAQRALHGRWFAGKMITATYMTTETYEAKF  562



>emb|CDX85791.1| BnaA02g00220D [Brassica napus]
Length=537

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = -3

Query  607  AMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGY  428
            ++V EP+G PSECLLLKNMFDPA ET+  FD DI++DV +ECS+YG VK I+VDKNSAG+
Sbjct  434  SVVTEPIGQPSECLLLKNMFDPATETELNFDEDIKEDVGDECSKYGEVKDIYVDKNSAGF  493

Query  427  VYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFK  299
            VY  F+SV+ A  AQ+AMH RWFA++ +SA FL P+EY+A+ K
Sbjct  494  VYLRFESVQAAMAAQRAMHTRWFAQKMISATFLPPHEYEARAK  536



>gb|KGN43267.1| hypothetical protein Csa_7G014530 [Cucumis sativus]
Length=593

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -3

Query  589  VGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFD  410
            VG PSECLLLKNMFDP  E++P FDLDIRDDV EECS +G +KHI+VD+NSAG+VY  F+
Sbjct  494  VGTPSECLLLKNMFDPTAESEPTFDLDIRDDVEEECSRFGKLKHIYVDRNSAGFVYLRFE  553

Query  409  SVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              E A  AQ+A++ RWFA + + A F+    Y+AKF
Sbjct  554  KSESAMEAQRALNGRWFAGKMIGATFMDIPSYEAKF  589



>gb|ABB47696.1| splicing factor, CC1-like family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG90413.1| unnamed protein product [Oryza sativa Japonica Group]
Length=320

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -3

Query  589  VGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFD  410
            +G+P+E LLLKNMFDPA+ETDP+FDLDI+DDV +ECS++GAV HI VDKN+AG+VY  FD
Sbjct  223  IGSPTEFLLLKNMFDPAVETDPDFDLDIKDDVQDECSKFGAVNHIFVDKNTAGFVYLHFD  282

Query  409  SVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            SV  A  AQ+A+H RWFA + ++A F+   +Y  KF
Sbjct  283  SVAAATAAQRALHGRWFAGKMITATFMTAQQYKMKF  318



>ref|XP_009122113.1| PREDICTED: RNA-binding protein 39 [Brassica rapa]
 emb|CDX69880.1| BnaA10g22290D [Brassica napus]
Length=538

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = -3

Query  616  VVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS  437
             + A V EPVG PS+CLLLKNMFDPA ET+ +FD +I DDV +ECS+YG V HI+VDK S
Sbjct  432  AIPAFVTEPVGQPSQCLLLKNMFDPATETELDFDEEIEDDVGQECSKYGQVNHIYVDKKS  491

Query  436  AGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFK  299
            AG+VY  F+SV+ A  AQ+AMH RWFA++ +SA F+ P EY+AK K
Sbjct  492  AGFVYLRFESVQAAAAAQRAMHMRWFAQKMISATFMPPNEYEAKAK  537



>ref|XP_009125340.1| PREDICTED: RNA-binding protein 39-like [Brassica rapa]
Length=546

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = -3

Query  607  AMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGY  428
            ++V EP+G PSECLLLKNMFDPA ET+  FD DI++DV +ECS+YG VK I+VDKNSAG+
Sbjct  443  SVVTEPIGQPSECLLLKNMFDPATETELNFDEDIKEDVGDECSKYGEVKDIYVDKNSAGF  502

Query  427  VYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFK  299
            VY  F+SV+ A  AQ+AMH RWFA++ +SA FL P+EY+A+ K
Sbjct  503  VYLRFESVQAAMAAQRAMHTRWFAQKMISATFLPPHEYEARAK  545



>ref|XP_008447937.1| PREDICTED: RNA-binding protein 39 isoform X2 [Cucumis melo]
Length=592

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -3

Query  589  VGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFD  410
            VG PSECLLLKNMFDP  E++P FDLDIRDDV EECS +G +KHI+VDKNSAG+VY  F+
Sbjct  493  VGTPSECLLLKNMFDPTAESEPTFDLDIRDDVEEECSRFGKLKHIYVDKNSAGFVYLRFE  552

Query  409  SVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              E A  AQ+A++ RWFA + + A F+    Y+AKF
Sbjct  553  KPESATEAQRALNGRWFAGKMIGATFMDIPSYEAKF  588



>ref|XP_008447936.1| PREDICTED: RNA-binding protein 39 isoform X1 [Cucumis melo]
Length=593

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -3

Query  589  VGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFD  410
            VG PSECLLLKNMFDP  E++P FDLDIRDDV EECS +G +KHI+VDKNSAG+VY  F+
Sbjct  494  VGTPSECLLLKNMFDPTAESEPTFDLDIRDDVEEECSRFGKLKHIYVDKNSAGFVYLRFE  553

Query  409  SVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              E A  AQ+A++ RWFA + + A F+    Y+AKF
Sbjct  554  KPESATEAQRALNGRWFAGKMIGATFMDIPSYEAKF  589



>ref|XP_006829172.1| hypothetical protein AMTR_s00001p00270600 [Amborella trichopoda]
 gb|ERM96588.1| hypothetical protein AMTR_s00001p00270600 [Amborella trichopoda]
Length=641

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 78/107 (73%), Gaps = 3/107 (3%)
 Frame = -3

Query  613  VXAMVPEPV---GNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDK  443
            + A +  PV   G PSECLLLKNMFDP  ET+P+FD+DI++DV EECS++G +KHI VDK
Sbjct  531  IAAAIASPVISIGVPSECLLLKNMFDPKAETEPDFDVDIKEDVQEECSKFGTLKHIFVDK  590

Query  442  NSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
             S G+VY  FDS   A  AQ+AMH RWFA + ++A F+ P  Y+AKF
Sbjct  591  ISEGHVYLRFDSATAAIGAQRAMHGRWFAGKMITATFMLPQNYEAKF  637



>gb|EMT08795.1| RNA-binding protein 39 [Aegilops tauschii]
Length=647

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -3

Query  589  VGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFD  410
            +G P+E LLLKNMFDPA+ETDP+FDLDIRDDV +ECS++G VKHI VDK++AG+VY  FD
Sbjct  545  IGTPTEFLLLKNMFDPAVETDPDFDLDIRDDVQDECSKFGVVKHIFVDKHTAGFVYLHFD  604

Query  409  SVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            S   A  AQ+++H RWFA + ++A F+   +Y+ KF
Sbjct  605  SATAAASAQRSLHGRWFAGKMITATFMTAQQYEMKF  640



>gb|EMS55916.1| RNA-binding protein 39 [Triticum urartu]
Length=626

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -3

Query  589  VGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFD  410
            +G P+E LLLKNMFDPA+ETDP+FDLDIRDDV +ECS++G VKHI VDK++AG+VY  FD
Sbjct  524  IGTPTEFLLLKNMFDPAVETDPDFDLDIRDDVQDECSKFGVVKHIFVDKHTAGFVYLHFD  583

Query  409  SVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            S   A  AQ+++H RWFA + ++A F+   +Y+ KF
Sbjct  584  SATAAASAQRSLHGRWFAGKMITATFMTAQQYEMKF  619



>ref|XP_002516388.1| splicing factor, putative [Ricinus communis]
 gb|EEF46005.1| splicing factor, putative [Ricinus communis]
Length=609

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -3

Query  589  VGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFD  410
            +G PSECLLLKNMFDP++ET+P+FDLDI++DV  ECS++G ++HI+VDKNSAG+VY  F+
Sbjct  510  IGVPSECLLLKNMFDPSIETEPDFDLDIKEDVQLECSKFGNLQHIYVDKNSAGFVYLRFE  569

Query  409  SVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            + + A  AQ+A+H RWFA + ++A F+ P  Y+ KF
Sbjct  570  NTQSAISAQRALHGRWFAGKMITATFMVPQVYETKF  605



>gb|ABB47695.1| splicing factor, CC1-like family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG86782.1| unnamed protein product [Oryza sativa Japonica Group]
Length=339

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -3

Query  589  VGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFD  410
            +G+P+E LLLKNMFDPA+ETDP+FDLDI+DDV +ECS++GAV HI VDKN+AG+VY  FD
Sbjct  242  IGSPTEFLLLKNMFDPAVETDPDFDLDIKDDVQDECSKFGAVNHIFVDKNTAGFVYLHFD  301

Query  409  SVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            SV  A  AQ+A+H RWFA + ++A F+   +Y  KF
Sbjct  302  SVAAATAAQRALHGRWFAGKMITATFMTAQQYKMKF  337



>ref|XP_006299838.1| hypothetical protein CARUB_v10016041mg [Capsella rubella]
 gb|EOA32736.1| hypothetical protein CARUB_v10016041mg [Capsella rubella]
Length=550

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 81/108 (75%), Gaps = 3/108 (3%)
 Frame = -3

Query  616  VVXAMVP---EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            ++  ++P   +PVG PSECLLLKNMFDP+ ET+P FD DI++DV EECS++G + HI+VD
Sbjct  437  IIPGVIPAVLDPVGIPSECLLLKNMFDPSTETEPHFDEDIKEDVKEECSKFGQLDHIYVD  496

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            KNS G+VY  F++ + A  AQ+A+H RWFA + ++A ++    Y+AKF
Sbjct  497  KNSVGFVYLRFENTQAAMGAQRALHGRWFAGKMITATYMTTEVYEAKF  544



>gb|KJB12137.1| hypothetical protein B456_002G002300 [Gossypium raimondii]
Length=585

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            V + +G+PSECLLLKNMFDP +ET+PEFDLDI++DV EECS++G +KHIHVD++SAG+VY
Sbjct  487  VIDTIGSPSECLLLKNMFDPTLETEPEFDLDIKEDVQEECSKFGKLKHIHVDRDSAGFVY  546

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEY  314
              F+  + A  AQ+ +H RWFA + ++A ++  Y +
Sbjct  547  LRFEDAQGAINAQRNLHGRWFAGKMITATYMVKYHF  582



>ref|XP_007142808.1| hypothetical protein PHAVU_007G018500g [Phaseolus vulgaris]
 gb|ESW14802.1| hypothetical protein PHAVU_007G018500g [Phaseolus vulgaris]
Length=603

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 80/108 (74%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            Q+  A +P  + +G PSECL+LKNMFDP  ET+P+FDLDI++DV  ECS++G +KHI+VD
Sbjct  492  QIPTATIPSIDTIGVPSECLMLKNMFDPKDETEPDFDLDIKEDVEAECSKFGTLKHIYVD  551

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            K SAG+VY  F+  + A  AQ+++H RWFA + ++A F+ P  Y+ KF
Sbjct  552  KKSAGFVYLRFEETQSAISAQRSLHGRWFAGKMITASFMVPQSYEDKF  599



>ref|XP_008338763.1| PREDICTED: RNA-binding protein 39 isoform X3 [Malus domestica]
Length=597

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 82/100 (82%), Gaps = 2/100 (2%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            V EPVGNPSECLLLKNMFDPA E +P+FD+DI++DV EECS+YG VKHI+VD  +AG+VY
Sbjct  498  VNEPVGNPSECLLLKNMFDPATEREPDFDVDIKEDVEEECSKYGRVKHIYVD--NAGFVY  555

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              F++VE A  AQ+AMH RWFA R +SA F+QP  Y+AKF
Sbjct  556  LRFEAVEAAAAAQRAMHLRWFAGRLISALFMQPQVYEAKF  595



>gb|AAM20703.1| putative splicing factor [Arabidopsis thaliana]
Length=420

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 80/108 (74%), Gaps = 3/108 (3%)
 Frame = -3

Query  616  VVXAMVP---EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            ++  ++P   +P+G PSECLLLKNMFDP+ ET+ +FD DI++DV EECS++G + HI VD
Sbjct  307  IIPGVIPAGFDPIGVPSECLLLKNMFDPSTETEDDFDEDIKEDVKEECSKFGKLNHIFVD  366

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            KNS G+VY  F++ + A  AQ+A+H RWFA + ++A ++    Y+AKF
Sbjct  367  KNSVGFVYLRFENAQAAIGAQRALHGRWFAGKMITATYMTTEAYEAKF  414



>gb|EYU37971.1| hypothetical protein MIMGU_mgv1a003198mg [Erythranthe guttata]
Length=600

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -3

Query  589  VGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFD  410
             G PSECLLLKNMFDP+ E +P+FDLDI++DV EECS++G +KHI+V+KNSAG+VY  F+
Sbjct  501  TGVPSECLLLKNMFDPSSEVEPDFDLDIKEDVQEECSKFGRLKHIYVEKNSAGFVYLRFE  560

Query  409  SVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            + E A  AQ+A+H RWFA + ++A ++   +Y+A+F
Sbjct  561  NTEAAMAAQRALHGRWFAGKMITATYMLHQDYEARF  596



>gb|KDO68180.1| hypothetical protein CISIN_1g006398mg [Citrus sinensis]
Length=639

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 81/108 (75%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            QV  A VP  + +G PSECLLLKNMFDP  ET  EFD+DI++DV  ECS++G +KHI V+
Sbjct  528  QVPTASVPIFDTIGVPSECLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVE  587

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            K+SAG+VY  F++ + AF AQ+A+H RWFA + ++A F+ P  Y+AKF
Sbjct  588  KDSAGFVYLRFENTQSAFAAQRALHGRWFAGKMITATFMVPQTYEAKF  635



>ref|XP_010467428.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Camelina sativa]
Length=418

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            V +P+G PSECLLLKNMFDP+ ET+P FD DI++DV +ECS++G + HI+VDK S G+VY
Sbjct  313  VVDPLGVPSECLLLKNMFDPSTETEPHFDEDIKEDVKDECSKFGELNHIYVDKYSIGFVY  372

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              F++VE A  AQ+A+H RWFA + ++A ++    Y+AKF
Sbjct  373  LRFENVEAAMGAQRALHGRWFAGKMITATYMTTEAYEAKF  412



>gb|EAY78664.1| hypothetical protein OsI_33765 [Oryza sativa Indica Group]
Length=549

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -3

Query  589  VGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFD  410
            +G+P+E LLLKNMFDPA+ETDP+FDLDI+DDV +ECS++GAV HI VDKN+AG+VY  FD
Sbjct  452  IGSPTEFLLLKNMFDPAVETDPDFDLDIKDDVQDECSKFGAVNHIFVDKNTAGFVYLHFD  511

Query  409  SVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            SV  A  AQ+A+H RWFA + ++A F+   +Y  KF
Sbjct  512  SVAAATAAQRALHGRWFAGKMITATFMTAQQYKMKF  547



>ref|XP_006486689.1| PREDICTED: RNA-binding protein 39-like isoform X5 [Citrus sinensis]
Length=639

 Score =   129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 81/108 (75%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            QV  A VP  + +G PSECLLLKNMFDP  ET  EFD+DI++DV  ECS++G +KHI V+
Sbjct  528  QVPTASVPIFDTIGVPSECLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVE  587

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            K+SAG+VY  F++ + AF AQ+A+H RWFA + ++A F+ P  Y+AKF
Sbjct  588  KDSAGFVYLRFENTQSAFAAQRALHGRWFAGKMITATFMVPQTYEAKF  635



>ref|XP_010489301.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Camelina sativa]
 ref|XP_010489302.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Camelina sativa]
Length=409

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -3

Query  595  EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXX  416
            +PVG PSECLLLKNMFDP+ ET+P FD DI++DV EECS++G + HI+VDK S G+VY  
Sbjct  306  DPVGVPSECLLLKNMFDPSTETEPHFDEDIKEDVKEECSKFGELNHIYVDKYSIGFVYLR  365

Query  415  FDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            F++V+ A  AQ A+H RWFA + ++A ++    Y+AKF
Sbjct  366  FENVKAAMGAQHALHGRWFAGKMITATYMTTEAYEAKF  403



>ref|XP_006422532.1| hypothetical protein CICLE_v10027985mg [Citrus clementina]
 gb|ESR35772.1| hypothetical protein CICLE_v10027985mg [Citrus clementina]
Length=639

 Score =   129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 81/108 (75%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            QV  A VP  + +G PSECLLLKNMFDP  ET  EFD+DI++DV  ECS++G +KHI V+
Sbjct  528  QVPTASVPIFDTIGVPSECLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVE  587

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            K+SAG+VY  F++ + AF AQ+A+H RWFA + ++A F+ P  Y+AKF
Sbjct  588  KDSAGFVYLRFENTQSAFAAQRALHGRWFAGKMITATFMVPQTYEAKF  635



>gb|KDO68179.1| hypothetical protein CISIN_1g006398mg [Citrus sinensis]
Length=647

 Score =   129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 81/108 (75%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            QV  A VP  + +G PSECLLLKNMFDP  ET  EFD+DI++DV  ECS++G +KHI V+
Sbjct  536  QVPTASVPIFDTIGVPSECLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVE  595

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            K+SAG+VY  F++ + AF AQ+A+H RWFA + ++A F+ P  Y+AKF
Sbjct  596  KDSAGFVYLRFENTQSAFAAQRALHGRWFAGKMITATFMVPQTYEAKF  643



>ref|XP_006486688.1| PREDICTED: RNA-binding protein 39-like isoform X4 [Citrus sinensis]
Length=647

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 81/108 (75%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            QV  A VP  + +G PSECLLLKNMFDP  ET  EFD+DI++DV  ECS++G +KHI V+
Sbjct  536  QVPTASVPIFDTIGVPSECLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVE  595

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            K+SAG+VY  F++ + AF AQ+A+H RWFA + ++A F+ P  Y+AKF
Sbjct  596  KDSAGFVYLRFENTQSAFAAQRALHGRWFAGKMITATFMVPQTYEAKF  643



>ref|XP_006422531.1| hypothetical protein CICLE_v10027985mg [Citrus clementina]
 gb|ESR35771.1| hypothetical protein CICLE_v10027985mg [Citrus clementina]
Length=647

 Score =   129 bits (324),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 81/108 (75%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            QV  A VP  + +G PSECLLLKNMFDP  ET  EFD+DI++DV  ECS++G +KHI V+
Sbjct  536  QVPTASVPIFDTIGVPSECLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVE  595

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            K+SAG+VY  F++ + AF AQ+A+H RWFA + ++A F+ P  Y+AKF
Sbjct  596  KDSAGFVYLRFENTQSAFAAQRALHGRWFAGKMITATFMVPQTYEAKF  643



>ref|XP_006486687.1| PREDICTED: RNA-binding protein 39-like isoform X3 [Citrus sinensis]
Length=658

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 81/108 (75%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            QV  A VP  + +G PSECLLLKNMFDP  ET  EFD+DI++DV  ECS++G +KHI V+
Sbjct  547  QVPTASVPIFDTIGVPSECLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVE  606

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            K+SAG+VY  F++ + AF AQ+A+H RWFA + ++A F+ P  Y+AKF
Sbjct  607  KDSAGFVYLRFENTQSAFAAQRALHGRWFAGKMITATFMVPQTYEAKF  654



>ref|XP_006486686.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Citrus sinensis]
Length=661

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 81/108 (75%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            QV  A VP  + +G PSECLLLKNMFDP  ET  EFD+DI++DV  ECS++G +KHI V+
Sbjct  550  QVPTASVPIFDTIGVPSECLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVE  609

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            K+SAG+VY  F++ + AF AQ+A+H RWFA + ++A F+ P  Y+AKF
Sbjct  610  KDSAGFVYLRFENTQSAFAAQRALHGRWFAGKMITATFMVPQTYEAKF  657



>gb|EEE51022.1| hypothetical protein OsJ_31660 [Oryza sativa Japonica Group]
Length=548

 Score =   128 bits (322),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -3

Query  589  VGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFD  410
            +G+P+E LLLKNMFDPA+ETDP+FDLDI+DDV +ECS++GAV HI VDKN+AG+VY  FD
Sbjct  451  IGSPTEFLLLKNMFDPAVETDPDFDLDIKDDVQDECSKFGAVNHIFVDKNTAGFVYLHFD  510

Query  409  SVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            SV  A  AQ+A+H RWFA + ++A F+   +Y  KF
Sbjct  511  SVAAATAAQRALHGRWFAGKMITATFMTAQQYKMKF  546



>ref|XP_006486685.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Citrus sinensis]
Length=669

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 81/108 (75%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            QV  A VP  + +G PSECLLLKNMFDP  ET  EFD+DI++DV  ECS++G +KHI V+
Sbjct  558  QVPTASVPIFDTIGVPSECLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVE  617

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            K+SAG+VY  F++ + AF AQ+A+H RWFA + ++A F+ P  Y+AKF
Sbjct  618  KDSAGFVYLRFENTQSAFAAQRALHGRWFAGKMITATFMVPQTYEAKF  665



>ref|NP_565399.1| splicing factor, CC1-like protein [Arabidopsis thaliana]
 gb|AAC64224.2| putative splicing factor [Arabidopsis thaliana]
 gb|ABO38752.1| At2g16940 [Arabidopsis thaliana]
 gb|AEC06558.1| splicing factor, CC1-like protein [Arabidopsis thaliana]
Length=561

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 80/108 (74%), Gaps = 3/108 (3%)
 Frame = -3

Query  616  VVXAMVP---EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            ++  ++P   +P+G PSECLLLKNMFDP+ ET+ +FD DI++DV EECS++G + HI VD
Sbjct  448  IIPGVIPAGFDPIGVPSECLLLKNMFDPSTETEDDFDEDIKEDVKEECSKFGKLNHIFVD  507

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            KNS G+VY  F++ + A  AQ+A+H RWFA + ++A ++    Y+AKF
Sbjct  508  KNSVGFVYLRFENAQAAIGAQRALHGRWFAGKMITATYMTTEAYEAKF  555



>gb|AAM62839.1| putative splicing factor [Arabidopsis thaliana]
Length=560

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 80/108 (74%), Gaps = 3/108 (3%)
 Frame = -3

Query  616  VVXAMVP---EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            ++  ++P   +P+G PSECLLLKNMFDP+ ET+ +FD DI++DV EECS++G + HI VD
Sbjct  447  IIPGVIPAGFDPIGVPSECLLLKNMFDPSTETEDDFDEDIKEDVKEECSKFGKLNHIFVD  506

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            KNS G+VY  F++ + A  AQ+A+H RWFA + ++A ++    Y+AKF
Sbjct  507  KNSVGFVYLRFENAQAAIGAQRALHGRWFAGKMITATYMTTEAYEAKF  554



>gb|ACJ85781.1| unknown [Medicago truncatula]
Length=346

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = -3

Query  589  VGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFD  410
            +G PSECLLLKNMFDP  E +P+FDLD+++DV  ECS++G +KHI+VDK SAG+VY  F+
Sbjct  247  IGTPSECLLLKNMFDPEDEKEPDFDLDVKEDVEAECSKFGNLKHIYVDKRSAGFVYLRFE  306

Query  409  SVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            + + A  AQ+A+H RWFA + ++A F+ P  Y+ +F
Sbjct  307  NTQPAISAQRALHGRWFAGKMITASFMVPQLYEDRF  342



>ref|XP_002976923.1| hypothetical protein SELMODRAFT_151471 [Selaginella moellendorffii]
 ref|XP_002980666.1| hypothetical protein SELMODRAFT_178258 [Selaginella moellendorffii]
 gb|EFJ18317.1| hypothetical protein SELMODRAFT_178258 [Selaginella moellendorffii]
 gb|EFJ22033.1| hypothetical protein SELMODRAFT_151471 [Selaginella moellendorffii]
Length=532

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = -3

Query  595  EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXX  416
            EP+G PSECLLLKNMFDPA ETDPEFD+DI++DV +ECS++G VKHI VDK S G+VY  
Sbjct  429  EPIGPPSECLLLKNMFDPATETDPEFDIDIKNDVQDECSKFGPVKHISVDKYSQGHVYVR  488

Query  415  FDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            F +   A  AQ  ++KRWFA +++ A F+    Y+ KF
Sbjct  489  FGTAIDALAAQLNLNKRWFAGKTIRATFMNVQVYEEKF  526



>ref|XP_004290736.1| PREDICTED: RNA-binding protein 39 [Fragaria vesca subsp. vesca]
 ref|XP_011458688.1| PREDICTED: RNA-binding protein 39 [Fragaria vesca subsp. vesca]
Length=588

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 79/109 (72%), Gaps = 3/109 (3%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPA-METDPEFDLDIRDDVHEECSEYGAVKHIHV  449
            Q+  A VP  + +G PSECLLL NMFDP  +E +P+ D+DI++DV EECS+YG +KHI V
Sbjct  476  QIPTATVPSVDTIGVPSECLLLTNMFDPKEIEAEPDIDVDIKEDVQEECSKYGKLKHIFV  535

Query  448  DKNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            DKN+AG+VY  F++ + A  A+Q +H RWFA + ++A F+ P  Y+ KF
Sbjct  536  DKNTAGFVYLRFENTQAAINARQVLHGRWFAGKMITATFMSPQNYETKF  584



>ref|XP_010467427.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Camelina sativa]
Length=564

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            V +P+G PSECLLLKNMFDP+ ET+P FD DI++DV +ECS++G + HI+VDK S G+VY
Sbjct  459  VVDPLGVPSECLLLKNMFDPSTETEPHFDEDIKEDVKDECSKFGELNHIYVDKYSIGFVY  518

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              F++VE A  AQ+A+H RWFA + ++A ++    Y+AKF
Sbjct  519  LRFENVEAAMGAQRALHGRWFAGKMITATYMTTEAYEAKF  558



>ref|XP_002886087.1| hypothetical protein ARALYDRAFT_480573 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62346.1| hypothetical protein ARALYDRAFT_480573 [Arabidopsis lyrata subsp. 
lyrata]
Length=557

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            V +PVG PSECLLLKNMFDP+ +T+ +FD DI +DV EECS++G + HI+VDKNS G+VY
Sbjct  452  VIDPVGVPSECLLLKNMFDPSTQTEDDFDKDIEEDVKEECSKFGNLNHIYVDKNSVGFVY  511

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              F++ + A  AQ+A+H RWFA + ++A ++    Y+AKF
Sbjct  512  LRFENAQAAIGAQRALHGRWFAGKMITATYMTTVAYEAKF  551



>ref|XP_010489300.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Camelina sativa]
Length=555

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -3

Query  595  EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXX  416
            +PVG PSECLLLKNMFDP+ ET+P FD DI++DV EECS++G + HI+VDK S G+VY  
Sbjct  452  DPVGVPSECLLLKNMFDPSTETEPHFDEDIKEDVKEECSKFGELNHIYVDKYSIGFVYLR  511

Query  415  FDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            F++V+ A  AQ A+H RWFA + ++A ++    Y+AKF
Sbjct  512  FENVKAAMGAQHALHGRWFAGKMITATYMTTEAYEAKF  549



>ref|NP_001189538.1| splicing factor, CC1-like protein [Arabidopsis thaliana]
 gb|AEC06560.1| splicing factor, CC1-like protein [Arabidopsis thaliana]
Length=610

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 80/108 (74%), Gaps = 3/108 (3%)
 Frame = -3

Query  616  VVXAMVP---EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            ++  ++P   +P+G PSECLLLKNMFDP+ ET+ +FD DI++DV EECS++G + HI VD
Sbjct  497  IIPGVIPAGFDPIGVPSECLLLKNMFDPSTETEDDFDEDIKEDVKEECSKFGKLNHIFVD  556

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            KNS G+VY  F++ + A  AQ+A+H RWFA + ++A ++    Y+AKF
Sbjct  557  KNSVGFVYLRFENAQAAIGAQRALHGRWFAGKMITATYMTTEAYEAKF  604



>ref|NP_001189537.1| splicing factor, CC1-like protein [Arabidopsis thaliana]
 gb|AEC06559.1| splicing factor, CC1-like protein [Arabidopsis thaliana]
Length=599

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 80/108 (74%), Gaps = 3/108 (3%)
 Frame = -3

Query  616  VVXAMVP---EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            ++  ++P   +P+G PSECLLLKNMFDP+ ET+ +FD DI++DV EECS++G + HI VD
Sbjct  486  IIPGVIPAGFDPIGVPSECLLLKNMFDPSTETEDDFDEDIKEDVKEECSKFGKLNHIFVD  545

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            KNS G+VY  F++ + A  AQ+A+H RWFA + ++A ++    Y+AKF
Sbjct  546  KNSVGFVYLRFENAQAAIGAQRALHGRWFAGKMITATYMTTEAYEAKF  593



>ref|XP_003555861.1| PREDICTED: RNA-binding protein 39-like [Glycine max]
 gb|KHN11495.1| RNA-binding protein 39 [Glycine soja]
Length=600

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 77/108 (71%), Gaps = 2/108 (2%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            Q+  A +P  + +G  SECL+LKNMFDP  E +P+FDLDI++DV  ECS+ G +KHI+VD
Sbjct  489  QIPTATIPSIDTIGVASECLMLKNMFDPKDEIEPDFDLDIKEDVEAECSKLGTLKHIYVD  548

Query  445  KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            K SAG+VY  F+  + A  AQQA+H RWFA + ++A F+ P  Y+ KF
Sbjct  549  KKSAGFVYLRFEDTQSAISAQQALHGRWFAGKMITASFMVPQSYEDKF  596



>ref|XP_010515902.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein 39-like [Camelina 
sativa]
Length=569

 Score =   125 bits (315),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -3

Query  595  EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXX  416
            +PVG PSECLLLKNMFDP+ ET+P FD DI++DV +ECS++G + HI+VDK S G+VY  
Sbjct  466  DPVGVPSECLLLKNMFDPSTETEPHFDDDIKEDVKDECSKFGELNHIYVDKYSIGFVYLR  525

Query  415  FDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            F++VE A  AQ A+H RWFA + ++A ++    Y+AKF
Sbjct  526  FENVEAAMGAQHALHGRWFAGKMITASYMTTEAYEAKF  563



>ref|XP_001776557.1| predicted protein [Physcomitrella patens]
 gb|EDQ58690.1| predicted protein [Physcomitrella patens]
Length=372

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = -3

Query  589  VGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFD  410
            +G PSE LLLKNMFDP+ E+DP+FD+DI+DDV EECS++G VKHI VDKNSAG+VY  FD
Sbjct  264  IGQPSEYLLLKNMFDPSTESDPDFDMDIKDDVQEECSKFGVVKHIFVDKNSAGHVYLCFD  323

Query  409  SVEFAFXAQQAMHKRWFARRSVSAXFLQPYEY  314
            S+  A  AQ+A+H RWFA + ++A +L+P ++
Sbjct  324  SIAAAMAAQRALHGRWFAGKMITATYLKPCKH  355



>gb|KCW55580.1| hypothetical protein EUGRSUZ_I01450 [Eucalyptus grandis]
Length=610

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 81/120 (68%), Gaps = 14/120 (12%)
 Frame = -3

Query  619  QVVXAMVP--EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD  446
            QV     P  + VG PSECLLLKNMFDP +ET+P+F+LDI++DV EECS++G ++HI VD
Sbjct  487  QVTATTGPTIDTVGVPSECLLLKNMFDPTLETEPDFELDIKEDVQEECSKFGNLRHIFVD  546

Query  445  ------------KNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
                        +NS+G+VY  F+  + A  AQ+A+H RWFA + ++A F+ P  Y+AKF
Sbjct  547  NFVACVSFLPKNRNSSGFVYLRFEDTQSASNAQRALHGRWFAGKMITATFMVPLTYEAKF  606



>tpg|DAA49863.1| TPA: hypothetical protein ZEAMMB73_656561 [Zea mays]
Length=357

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 74/133 (56%), Gaps = 39/133 (29%)
 Frame = -3

Query  583  NPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDK-------------  443
             P+E LLLKNMFDPA+ETDP+FDLDIRDDV +ECS++GAVKHI VDK             
Sbjct  222  TPTEFLLLKNMFDPALETDPDFDLDIRDDVQDECSKFGAVKHIFVDKCYYIFLKTGSTLE  281

Query  442  --------------------------NSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVS  341
                                      N+AG+VY  FDSV  A  AQ A+H RWFA + ++
Sbjct  282  KIDLGQVNYNLDAGSGICLGCPTIVVNTAGFVYLQFDSVTAAAKAQNALHGRWFAGKMIT  341

Query  340  AXFLQPYEYDAKF  302
            A F+   EY  KF
Sbjct  342  ATFMSALEYSTKF  354



>emb|CDX89762.1| BnaC03g46760D [Brassica napus]
Length=172

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            V +PVG PSECLLLKNMFDP+ ET+PEFD DI++DV ++ S++G +  I VD+NS  +VY
Sbjct  69   VVDPVGVPSECLLLKNMFDPSTETEPEFDEDIKEDVKDKFSQFGELNRIFVDENSIAFVY  128

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              F++ + A  AQ+A+H RWFA + ++A ++    Y+AKF
Sbjct  129  LRFENAQAAMGAQRALHGRWFAGKMITATYMTKESYEAKF  168



>ref|XP_004497188.1| PREDICTED: RNA-binding protein 39-like [Cicer arietinum]
Length=613

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = -3

Query  595  EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXX  416
            E +G PSECLLL+NMFDP  E +P+FD D+++DV  ECS++G ++HI+VDK SAG+VY  
Sbjct  512  ETIGVPSECLLLRNMFDPENEKEPDFDFDVKEDVEAECSKFGNLQHIYVDKKSAGFVYLR  571

Query  415  FDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            F+  + A  AQ+A+H RWFA + ++A F+ P  Y+ KF
Sbjct  572  FEDTQSAISAQRALHGRWFAGKMITASFMVPQSYEDKF  609



>emb|CDP19575.1| unnamed protein product [Coffea canephora]
Length=593

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -3

Query  589  VGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFD  410
            +G PSECLLLKN+FDP +E++PEFD DI+DDV +ECS++G +KHI+VDK S G VY  F+
Sbjct  494  IGIPSECLLLKNVFDPKLESEPEFDQDIKDDVEDECSKFGKLKHIYVDKKSDGLVYLRFE  553

Query  409  SVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            + + A  AQ+A+H RWFA + + A F+ P  Y+  F
Sbjct  554  NNQAAIAAQRALHGRWFAGKMILATFMVPQNYEVTF  589



>emb|CDX71317.1| BnaC07g05960D [Brassica napus]
Length=1644

 Score =   123 bits (308),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            V +PVG PSECLLLKNMFDP+ ET+ +FD DI +DV +ECS++G + HI VDKNS G+VY
Sbjct  493  VVDPVGVPSECLLLKNMFDPSTETELDFDKDIEEDVRDECSKFGELNHIFVDKNSMGFVY  552

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              F++ + A  AQ+A+H RWFA + ++A ++    Y+AKF
Sbjct  553  LRFENAQAAMGAQRALHGRWFAGKMITATYMTTETYEAKF  592



>ref|XP_010088741.1| RNA-binding protein 39 [Morus notabilis]
 gb|EXB36922.1| RNA-binding protein 39 [Morus notabilis]
Length=773

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = -3

Query  592  PVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXF  413
            PVG+P+ECLLL NMFDPA ETDPEFD+DI++DV EECS+ G V HI+VDKNSAG VY  F
Sbjct  477  PVGSPTECLLLNNMFDPATETDPEFDVDIKEDVEEECSKCGRVVHIYVDKNSAGCVYLRF  536

Query  412  DSVEFAFXAQQAMHKRWFARRSVSAXFL  329
            ++ E A  AQ+AMH RWFA R +SA F+
Sbjct  537  ETAEAAAAAQRAMHGRWFAGRQISALFM  564



>ref|XP_009121181.1| PREDICTED: RNA-binding protein 39 isoform X1 [Brassica rapa]
Length=559

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            V +PVG PSE LLLKNMFDP+ ET+  FD DI +DV +ECS++G + HI VDKNS G+VY
Sbjct  456  VVDPVGVPSEFLLLKNMFDPSTETELGFDKDIEEDVRDECSKFGELNHIFVDKNSMGFVY  515

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              F++ + A  AQ+A+H RWFA + ++A ++    Y+AKF
Sbjct  516  LRFENAQAAMGAQRALHGRWFAGKMITATYMTTETYEAKF  555



>ref|XP_009121183.1| PREDICTED: RNA-binding protein 39 isoform X2 [Brassica rapa]
Length=587

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            V +PVG PSE LLLKNMFDP+ ET+  FD DI +DV +ECS++G + HI VDKNS G+VY
Sbjct  484  VVDPVGVPSEFLLLKNMFDPSTETELGFDKDIEEDVRDECSKFGELNHIFVDKNSMGFVY  543

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              F++ + A  AQ+A+H RWFA + ++A ++    Y+AKF
Sbjct  544  LRFENAQAAMGAQRALHGRWFAGKMITATYMTTETYEAKF  583



>ref|XP_006399474.1| hypothetical protein EUTSA_v100130050mg, partial [Eutrema salsugineum]
 gb|ESQ40927.1| hypothetical protein EUTSA_v100130050mg, partial [Eutrema salsugineum]
Length=583

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 78/124 (63%), Gaps = 28/124 (23%)
 Frame = -3

Query  616  VVXAMVPEPVGNPSECLLLKNMFDPAME----------------------------TDPE  521
             + ++V EP+G PSECLLLKNMFDPA E                            T+P+
Sbjct  438  AIPSLVTEPIGQPSECLLLKNMFDPATEVRFRASSSSFCSRFKGSNYSHEVVTWLQTEPD  497

Query  520  FDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSVS  341
            F+ DI+ DV EECS+YG V HI+VDKNSAG+VY  FDSV+ A  AQ+AMH RWFA++ +S
Sbjct  498  FEEDIKVDVEEECSKYGRVNHIYVDKNSAGFVYVRFDSVQAAAAAQRAMHTRWFAQKMIS  557

Query  340  AXFL  329
            A F+
Sbjct  558  AIFM  561



>emb|CDY31398.1| BnaA07g03330D [Brassica napus]
Length=1649

 Score =   117 bits (293),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVY  422
            V +PVG PSE LLLKNMFDP+ ET+  FD DI +DV +ECS++G + HI VDKNS G+VY
Sbjct  505  VVDPVGVPSEFLLLKNMFDPSTETELGFDKDIEEDVRDECSKFGELNHIFVDKNSMGFVY  564

Query  421  XXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
              F++ + A  AQ+A+H RWFA + ++A ++    Y+AKF
Sbjct  565  LRFENAQAAMGAQRALHGRWFAGKMITATYMTTETYEAKF  604



>ref|XP_005650141.1| splicing factor, CC1-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25597.1| splicing factor, CC1-like protein [Coccomyxa subellipsoidea C-169]
Length=497

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -3

Query  580  PSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVE  401
            P++CLLLKNMFDP  ET+P++D +I  DV EECS+YG V H HVDKNS G+VY  F +VE
Sbjct  403  PTQCLLLKNMFDPKEETEPDWDQEIATDVTEECSKYGPVSHTHVDKNSKGFVYLKFVTVE  462

Query  400  FAFXAQQAMHKRWFARRSVSAXF  332
             +  AQ+A+H RWFA R V A F
Sbjct  463  GSAAAQKALHGRWFAGRQVVAEF  485



>ref|XP_002508355.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69613.1| predicted protein [Micromonas sp. RCC299]
Length=518

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = -3

Query  580  PSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVE  401
            P++CLLLKNMFDPA ET+PE+ +DI +DV +ECS++G V HIHVDK S G+VY  F S E
Sbjct  424  PTQCLLLKNMFDPAEETEPEWWIDIGEDVKDECSKHGPVSHIHVDKESRGFVYLKFGSTE  483

Query  400  FAFXAQQAMHKRWFARRSVSAXF  332
             A  A+QA+H RWFA + ++A F
Sbjct  484  GASAARQALHGRWFAGKMIAAEF  506



>ref|XP_010515913.1| PREDICTED: RNA-binding protein 39-like [Camelina sativa]
 ref|XP_010515921.1| PREDICTED: RNA-binding protein 39-like [Camelina sativa]
Length=88

 Score = 99.0 bits (245),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -3

Query  553  MFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVEFAFXAQQAM  374
            MFDP+ ET P FD+D+R+DV EECS +G +KHI+VD NSAG+VY  F   + A  AQ+A+
Sbjct  1    MFDPSTETYPYFDVDVREDVIEECSNFGRMKHIYVDTNSAGFVYLRFVKAQAAMGAQRAL  60

Query  373  HKRWFARRSVSAXFLQPYEYDAKF  302
            H RWF  R ++A ++    Y+AKF
Sbjct  61   HGRWFGGRMMTATYMTREAYEAKF  84



>gb|KJE89116.1| RNA binding domain-containing protein 39, variant [Capsaspora 
owczarzaki ATCC 30864]
Length=441

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = -3

Query  568  LLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVEFAFX  389
            LLLKNMFDPA E DPE+ LDIRD V +EC ++G+V HI VD NS G+V+  F SVE    
Sbjct  339  LLLKNMFDPAQERDPEWQLDIRDTVLDECVKHGSVTHIFVDANSPGFVFIKFSSVEACIA  398

Query  388  AQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
             Q+ MH RWFA + ++A ++    Y A+F
Sbjct  399  VQRTMHGRWFAGKLITADYVPEPMYHARF  427



>ref|XP_007199063.1| hypothetical protein PRUPE_ppa018661mg, partial [Prunus persica]
 gb|EMJ00262.1| hypothetical protein PRUPE_ppa018661mg, partial [Prunus persica]
Length=349

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -3

Query  589  VGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFD  410
            +G PSECLLLKNMF+PA+ET+P FDLDI++DV EECS+Y  ++HI VDKN+AG+VY  F+
Sbjct  270  IGVPSECLLLKNMFNPAVETEPNFDLDIKEDVQEECSKYRNLRHIFVDKNTAGHVYLRFE  329

Query  409  SVEFAFXAQQAMH  371
            + + A  A+  +H
Sbjct  330  NTQAAINARHVLH  342



>ref|XP_010495125.1| PREDICTED: RNA-binding protein 39-like [Camelina sativa]
Length=99

 Score = 96.7 bits (239),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = -3

Query  523  EFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVEFAFXAQQAMHKRWFARRSV  344
            EFDL+IR+DV EECS YG V HI+VDKNSAG+VY  F++V+ A  AQ  MH+RWFA++ +
Sbjct  24   EFDLEIREDVKEECSRYGRVSHIYVDKNSAGFVYLRFETVQGAVAAQNVMHRRWFAQKMI  83

Query  343  SAXFLQPYEYDAKFK  299
            +A F+   EY+AK K
Sbjct  84   TATFMPRDEYEAKAK  98



>ref|XP_004365528.1| RNA binding domain-containing protein 39 [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE89115.1| RNA binding domain-containing protein 39 [Capsaspora owczarzaki 
ATCC 30864]
Length=600

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = -3

Query  577  SECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVEF  398
            ++ LLLKNMFDPA E DPE+ LDIRD V +EC ++G+V HI VD NS G+V+  F SVE 
Sbjct  495  TQFLLLKNMFDPAQERDPEWQLDIRDTVLDECVKHGSVTHIFVDANSPGFVFIKFSSVEA  554

Query  397  AFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
                Q+ MH RWFA + ++A ++    Y A+F
Sbjct  555  CIAVQRTMHGRWFAGKLITADYVPEPMYHARF  586



>ref|XP_005850115.1| hypothetical protein CHLNCDRAFT_57088 [Chlorella variabilis]
 gb|EFN58013.1| hypothetical protein CHLNCDRAFT_57088 [Chlorella variabilis]
Length=546

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -3

Query  580  PSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVE  401
            P++CLLLKNMFDPA ET   +D +I +DV  EC +YG V+H+ VD+NS G+VY  F ++ 
Sbjct  452  PTQCLLLKNMFDPAEETADNWDAEIAEDVGSECQKYGPVEHVFVDRNSRGFVYVKFTAIS  511

Query  400  FAFXAQQAMHKRWFARRSVSAXF  332
             A  AQ+A+H RWFA R ++A F
Sbjct  512  SAANAQRALHGRWFAARQIAADF  534



>ref|XP_005703854.1| RNA-binding protein [Galdieria sulphuraria]
 gb|EME27334.1| RNA-binding protein [Galdieria sulphuraria]
Length=596

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 66/95 (69%), Gaps = 1/95 (1%)
 Frame = -3

Query  583  NPSECLLLKNMFDPAMETDPEFDLDIRDDVHEEC-SEYGAVKHIHVDKNSAGYVYXXFDS  407
            +PS CL+L+NMFDPA ETDP F L++++DV +EC S++G ++HI VDKNSAG VY  F++
Sbjct  492  SPSTCLMLRNMFDPAQETDPNFHLEVQEDVRDECISKFGPLRHIFVDKNSAGLVYVQFET  551

Query  406  VEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            +  A  A+Q +H RWFA   V   ++    Y  +F
Sbjct  552  MSDAMKAKQGLHGRWFAGHQVIVEYISESVYYIRF  586



>ref|XP_003080863.1| RNA recognition motif (ISS) [Ostreococcus tauri]
Length=387

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 63/95 (66%), Gaps = 4/95 (4%)
 Frame = -3

Query  580  PSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVE  401
            P+ CLLLKN+F+ A ETDPE+ LDI +DV  EC ++G + H  VDK+S G+VY  F  V 
Sbjct  291  PTPCLLLKNLFNAAEETDPEWWLDIAEDVKGECEKFGEITHTFVDKDSQGFVYLKFADVA  350

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKG  296
             +  AQQA+H RWFA R ++A     Y++ A + G
Sbjct  351  SSTRAQQALHTRWFAGRKIAAE----YQFAATYNG  381



>emb|CEG01539.1| Nucleotide-binding, alpha-beta plait [Ostreococcus tauri]
Length=528

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 63/95 (66%), Gaps = 4/95 (4%)
 Frame = -3

Query  580  PSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVE  401
            P+ CLLLKN+F+ A ETDPE+ LDI +DV  EC ++G + H  VDK+S G+VY  F  V 
Sbjct  432  PTPCLLLKNLFNAAEETDPEWWLDIAEDVKGECEKFGEITHTFVDKDSQGFVYLKFADVA  491

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKG  296
             +  AQQA+H RWFA R ++A     Y++ A + G
Sbjct  492  SSTRAQQALHTRWFAGRKIAAE----YQFAATYNG  522



>ref|XP_003059052.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57507.1| predicted protein [Micromonas pusilla CCMP1545]
Length=515

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -3

Query  580  PSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVE  401
            P++ LLLKN+FDP  ET+PE+  DI +DV +EC ++GAV H HVDK+S G+VY  F  V+
Sbjct  421  PTQTLLLKNLFDPKEETEPEWWNDIAEDVKDECGKHGAVAHCHVDKDSEGFVYLKFAEVK  480

Query  400  FAFXAQQAMHKRWFARRSVSAXF  332
             A  AQ A+H RWFA R ++A +
Sbjct  481  GAERAQAALHSRWFAGRMIAAEY  503



>gb|EFA79920.1| putative RNA splicing factor [Polysphondylium pallidum PN500]
Length=606

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 63/97 (65%), Gaps = 0/97 (0%)
 Frame = -3

Query  592  PVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXF  413
            PV   S C++LKNMFDP  ET  ++D +I  DV  ECS YG VKHI +DKNS GY+Y  +
Sbjct  504  PVTITSTCIVLKNMFDPDTETGDDWDKEIERDVELECSTYGNVKHIFLDKNSQGYIYLCY  563

Query  412  DSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            DS+E A  A   +++RWFA + +SA  +    Y AKF
Sbjct  564  DSIEGASTAINKLNRRWFAGKMLSAESIPENIYFAKF  600



>gb|KDR08287.1| RNA-binding protein 39, partial [Zootermopsis nevadensis]
Length=361

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = -3

Query  577  SECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS-AGYVYXXFDSVE  401
            ++C +L NMFDPAMET+P +D++IRDDV EEC+++G V H++VDK S  G VY    S+ 
Sbjct  250  TQCFMLANMFDPAMETNPTWDVEIRDDVIEECNKHGGVLHVYVDKASPQGNVYVKCPSIA  309

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGA  293
             A  A  ++H RWFA R ++A ++    Y + F  A
Sbjct  310  TAVAAVNSLHGRWFAGRVITAAYVPLINYHSLFPDA  345



>ref|XP_001419396.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97689.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=516

 Score = 97.4 bits (241),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -3

Query  580  PSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVE  401
            P+ C+LLKN+F+ A ETDPE+ LDI +DV  EC ++G + H  VDK+S G+VY  F    
Sbjct  420  PTPCILLKNLFNAAEETDPEWWLDIAEDVKGECEKFGEITHAFVDKDSQGFVYLKFVDTA  479

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
             +  AQQA+H RWFA R ++A F     YD  F
Sbjct  480  SSTRAQQALHARWFAGRKIAAEFQFAEVYDGHF  512



>ref|XP_002108274.1| hypothetical protein TRIADDRAFT_37071 [Trichoplax adhaerens]
 gb|EDV29072.1| hypothetical protein TRIADDRAFT_37071 [Trichoplax adhaerens]
Length=351

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = -3

Query  577  SECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS-AGYVYXXFDSVE  401
            S C L+ NMFDPA ETD ++DLDIRDD+ EEC+++G V H++VDK S  G VY    +++
Sbjct  244  SPCFLISNMFDPAKETDQDWDLDIRDDIIEECNKHGNVYHVYVDKTSPKGIVYVKCQTID  303

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
             A  A ++++ RWFA   ++A FL    Y   F  AA
Sbjct  304  VAARAVKSLNGRWFAGNMITAQFLSLASYHTTFPQAA  340



>ref|XP_008475058.1| PREDICTED: RNA-binding protein 39 isoform X3 [Diaphorina citri]
Length=306

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 61/93 (66%), Gaps = 1/93 (1%)
 Frame = -3

Query  577  SECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSA-GYVYXXFDSVE  401
            ++C LL NMFDPA ET+P +D++IRDDV EEC+++G V H+ VDK S  G VY    ++ 
Sbjct  196  TQCFLLANMFDPATETNPTWDVEIRDDVIEECNKHGGVLHVFVDKVSPQGNVYVKCPTIN  255

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
             A  A  ++H RWFA R ++A ++    Y + F
Sbjct  256  TAVAAVNSLHGRWFAGRIITAAYVPVINYHSLF  288



>ref|XP_002018768.1| GL25979 [Drosophila persimilis]
 gb|EDW36964.1| GL25979 [Drosophila persimilis]
Length=289

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 62/100 (62%), Gaps = 1/100 (1%)
 Frame = -3

Query  577  SECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS-AGYVYXXFDSVE  401
            ++C +L NMFDP  ET+P +D++IRDDV EEC+++G V HIHVD  S  G VY    S  
Sbjct  177  TQCFILSNMFDPRTETNPTWDVEIRDDVLEECAKHGGVLHIHVDTASPTGTVYVKCPSTT  236

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA*TS  281
             A  A  A+H RWFA R ++A ++    Y + F  +  TS
Sbjct  237  TAVLAVNALHGRWFAGRVITAAYVPVVNYHSMFPDSVGTS  276



>gb|KJB14937.1| hypothetical protein B456_002G149800 [Gossypium raimondii]
Length=569

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -3

Query  616  VVXAMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDK  443
            ++     EP+G PSECLLLKNMFDPA ET+P+FDLDI++DV EECS+YG VKHI+VDK
Sbjct  512  IMSTTALEPIGQPSECLLLKNMFDPATETEPDFDLDIKEDVEEECSKYGRVKHIYVDK  569



>ref|XP_317010.3| AGAP008433-PA [Anopheles gambiae str. PEST]
 gb|EAA12873.4| AGAP008433-PA [Anopheles gambiae str. PEST]
Length=526

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = -3

Query  577  SECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS-AGYVYXXFDSVE  401
            ++C LL NMFDPA ET+P +DL+I+DDV EEC+++G V+H++VDK S +G VY    S+ 
Sbjct  418  TQCFLLSNMFDPATETNPNWDLEIQDDVIEECNKHGGVQHVYVDKQSPSGNVYVKCPSIA  477

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
             A  A  A+H RWFA R + A ++    Y   F  AA
Sbjct  478  TAVLAVNALHGRWFAGRVIGAAYVPLINYYNLFPEAA  514



>gb|KFB39087.1| AGAP008433-PA-like protein [Anopheles sinensis]
Length=586

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = -3

Query  577  SECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS-AGYVYXXFDSVE  401
            ++C LL NMFDPA ET+P +D++I+DDV EEC+++G V+H++VDK S AG VY    S+ 
Sbjct  478  TQCFLLSNMFDPATETNPSWDVEIQDDVIEECNKHGGVQHVYVDKQSPAGNVYVKCPSIA  537

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
             A  A  A+H RWFA R + A ++    Y   F  AA
Sbjct  538  TAVLAVNALHGRWFAGRVIGAAYVPLVNYYNLFPDAA  574



>ref|XP_001869868.1| splicing factor [Culex quinquefasciatus]
 gb|EDS30585.1| splicing factor [Culex quinquefasciatus]
Length=524

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = -3

Query  577  SECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS-AGYVYXXFDSVE  401
            ++C LL NMFDPA ET+P +D++I DDV EEC+++G V H++VDK S AG VY    S+ 
Sbjct  416  TQCFLLSNMFDPATETNPSWDVEIEDDVIEECNKHGGVLHVYVDKQSPAGNVYVKCPSIA  475

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
             A  A  A+H RWFA R ++A ++    Y   F+ +A
Sbjct  476  TAVLAVNALHGRWFAGRVIAAAYVPLVNYHTLFQESA  512



>ref|XP_004334854.1| splicing factor, CC1like subfamily protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR12841.1| splicing factor, CC1like subfamily protein [Acanthamoeba castellanii 
str. Neff]
Length=594

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 67/103 (65%), Gaps = 2/103 (2%)
 Frame = -3

Query  604  MVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS-AGY  428
            + P PV   S  +LLKNMFDPA ET+P F LDI++DV EECS+YG V   HV ++S +G 
Sbjct  492  VAPRPV-VASAFMLLKNMFDPAQETEPNFHLDIQEDVTEECSKYGKVLQCHVVRDSPSGL  550

Query  427  VYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFK  299
            VY  F+S E A  A QA++ RWFA + +SA F+    + A  K
Sbjct  551  VYLRFESSEGAAKAIQALNGRWFAGKVISAEFIDENTFAAGCK  593



>ref|XP_002428613.1| RNA-binding region-containing protein, putative [Pediculus humanus 
corporis]
 gb|EEB15875.1| RNA-binding region-containing protein, putative [Pediculus humanus 
corporis]
Length=593

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 63/95 (66%), Gaps = 0/95 (0%)
 Frame = -3

Query  577  SECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVEF  398
            ++C +L NMFDPA ET+P +D++IRDDV EEC+++G V H++VDK S G VY    ++  
Sbjct  412  TQCFMLANMFDPATETNPTWDVEIRDDVIEECNKHGGVLHVYVDKTSNGNVYVKCPTIAT  471

Query  397  AFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGA  293
            A  +  ++H RWFA R ++A ++    Y + F  A
Sbjct  472  AVASVNSLHGRWFAGRIITAAYVPLLNYHSHFPDA  506



>emb|CDH60258.1| splicing factor cc1-like protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=474

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = -3

Query  577  SECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVEF  398
            S  ++L NMF+PA ET+P++  D+  DV EEC+++G V+HIHV+++S G VY  F+SVE 
Sbjct  381  SRTIMLNNMFNPAEETEPDWVKDLETDVKEECTKFGQVEHIHVNEDSLGEVYLKFESVES  440

Query  397  AFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            A  A +A+  RWF  + +SA F+    Y+AKF
Sbjct  441  AQNALEALDGRWFGGKQISAVFVPEAIYNAKF  472



>emb|CDH60257.1| splicing factor cc1-like protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=475

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = -3

Query  577  SECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVEF  398
            S  ++L NMF+PA ET+P++  D+  DV EEC+++G V+HIHV+++S G VY  F+SVE 
Sbjct  382  SRTIMLNNMFNPAEETEPDWVKDLETDVKEECTKFGQVEHIHVNEDSLGEVYLKFESVES  441

Query  397  AFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            A  A +A+  RWF  + +SA F+    Y+AKF
Sbjct  442  AQNALEALDGRWFGGKQISAVFVPEAIYNAKF  473



>dbj|GAM16879.1| hypothetical protein SAMD00019534_000540 [Acytostelium subglobosum 
LB1]
Length=633

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 61/95 (64%), Gaps = 0/95 (0%)
 Frame = -3

Query  577  SECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVEF  398
            S C++LKNMFDPA ET   ++ +I  DV  ECS YG + HIH+++NS GY+Y  +D VE 
Sbjct  526  STCMVLKNMFDPATETGENWETEIEKDVELECSNYGNIIHIHLERNSQGYIYLRYDKVES  585

Query  397  AFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGA  293
            A  A   +++RWFA + ++A  +    Y A+F  A
Sbjct  586  AALAISKLNRRWFASKMLTAESIPEPTYLARFPNA  620



>ref|XP_001865056.1| splicing factor [Culex quinquefasciatus]
 gb|EDS41115.1| splicing factor [Culex quinquefasciatus]
Length=546

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = -3

Query  577  SECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS-AGYVYXXFDSVE  401
            ++C LL NMFDPA ET+P +D++I DDV EEC+++G V H++VDK S AG VY    S+ 
Sbjct  438  TQCFLLSNMFDPATETNPSWDVEIEDDVIEECNKHGGVLHVYVDKQSPAGNVYVKCPSIA  497

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
             A  A  A+H RWFA R ++A ++    Y   F+ +A
Sbjct  498  TAVLAVNALHGRWFAGRVIAAAYVPLVNYHTLFQESA  534



>ref|XP_008475057.1| PREDICTED: RNA-binding protein 39 isoform X2 [Diaphorina citri]
Length=380

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 61/93 (66%), Gaps = 1/93 (1%)
 Frame = -3

Query  577  SECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSA-GYVYXXFDSVE  401
            ++C LL NMFDPA ET+P +D++IRDDV EEC+++G V H+ VDK S  G VY    ++ 
Sbjct  270  TQCFLLANMFDPATETNPTWDVEIRDDVIEECNKHGGVLHVFVDKVSPQGNVYVKCPTIN  329

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
             A  A  ++H RWFA R ++A ++    Y + F
Sbjct  330  TAVAAVNSLHGRWFAGRIITAAYVPVINYHSLF  362



>emb|CBJ30774.1| conserved unknown protein [Ectocarpus siliculosus]
Length=604

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 62/95 (65%), Gaps = 1/95 (1%)
 Frame = -3

Query  583  NPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVD-KNSAGYVYXXFDS  407
             P+ CLL+KNMFDPA ETD  ++LDI++++ EECS++GAV H +V+ +   G VY  F +
Sbjct  493  TPTFCLLVKNMFDPATETDEGWELDIKEEMEEECSKHGAVMHSYVESRQPGGLVYVMFST  552

Query  406  VEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
               A  + + ++ RWFA R V   +L P  Y AKF
Sbjct  553  TGAAVASAEMLNGRWFAGRMVLVEYLNPKVYTAKF  587



>ref|XP_002078467.1| GD23448 [Drosophila simulans]
 gb|EDX04052.1| GD23448 [Drosophila simulans]
Length=608

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 58/93 (62%), Gaps = 1/93 (1%)
 Frame = -3

Query  577  SECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS-AGYVYXXFDSVE  401
            ++C +L NMFDP  ET+P +D++IRDDV EEC+++G V HIHVD  S  G VY    S  
Sbjct  497  TQCFILSNMFDPRTETNPTWDVEIRDDVLEECAKHGGVLHIHVDTISHTGTVYVKCPSTT  556

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
             A  A  A+H RWFA R ++A +L    Y   F
Sbjct  557  TAVLAVNALHGRWFAGRVITAAYLPVINYHTMF  589



>ref|XP_001626026.1| predicted protein [Nematostella vectensis]
 gb|EDO33926.1| predicted protein [Nematostella vectensis]
Length=468

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = -3

Query  601  VPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS-AGYV  425
             P  V  P+ C +L NMFDP  E D  +DLDIRDDV EEC+++G + HIHVDKNS  G V
Sbjct  353  TPVAVSLPTPCFMLTNMFDPTKERDAGWDLDIRDDVLEECNKFGPIVHIHVDKNSPQGIV  412

Query  424  YXXFDSVEFAFXAQQAMHKRWFARRSVSA  338
            Y    + + A  A +++H RWFA + + A
Sbjct  413  YVKCATPDIAISASKSLHGRWFAGKQIIA  441



>ref|XP_002036031.1| GM16278 [Drosophila sechellia]
 gb|EDW51954.1| GM16278 [Drosophila sechellia]
Length=596

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 58/93 (62%), Gaps = 1/93 (1%)
 Frame = -3

Query  577  SECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS-AGYVYXXFDSVE  401
            ++C +L NMFDP  ET+P +D++IRDDV EEC+++G V HIHVD  S  G VY    S  
Sbjct  485  TQCFILSNMFDPRTETNPTWDVEIRDDVLEECAKHGGVLHIHVDTISHTGTVYVKCPSTT  544

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
             A  A  A+H RWFA R ++A +L    Y   F
Sbjct  545  TAVLAVNALHGRWFAGRVITAAYLPVINYHTMF  577



>gb|EXX55443.1| Pab1p [Rhizophagus irregularis DAOM 197198w]
 gb|EXX55444.1| Pab1p [Rhizophagus irregularis DAOM 197198w]
Length=471

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = -3

Query  595  EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXX  416
            +P  NP+ C+LLKNMF+P  ET+  +  ++ +DV  EC +YG V HI VD+ SAG +Y  
Sbjct  368  QPRVNPTRCVLLKNMFNPDEETESNWAEELEEDVKSECIKYGPVVHISVDRESAGDIYMK  427

Query  415  FDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
            FDSV  A  A   ++ RWF    +SA F+    Y+ +F  AA
Sbjct  428  FDSVSSAQAAVNGLNGRWFGGNQISAVFILDMFYNVRFPKAA  469



>emb|CDS08376.1| hypothetical protein LRAMOSA02324 [Absidia idahoensis var. thermophila]
Length=463

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = -3

Query  577  SECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDSVEF  398
            S  ++L NMF+PA ET+P++  D+  DV EEC+++G V+HIHV+++S G VY  F +VE 
Sbjct  370  SRTIMLNNMFNPAEETEPDWVKDLETDVKEECTKFGQVEHIHVNEDSLGEVYLKFATVES  429

Query  397  AFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            A  A +A+  RWF  + +SA F+    Y+AKF
Sbjct  430  AQKALEALDGRWFGGKQISAVFVPEAIYNAKF  461



>emb|CBK24895.2| unnamed protein product [Blastocystis hominis]
Length=465

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = -3

Query  607  AMVPEPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGY  428
            A  P   GN S CL+L NMF+ A+E  P +D+DI++DV  EC +YGA+ H  VDKNS+G 
Sbjct  346  AAKPTIEGNASNCLVLHNMFNSAIEQGPHWDIDIQEDVRTECQKYGAILHCFVDKNSSGD  405

Query  427  VYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
            VY  FD++     A   M+ RW+  R V   ++   EY  +F
Sbjct  406  VYLMFDNMNSCQNAANDMNGRWYDGRVVQVSYMPSGEYVNRF  447



>gb|ENN76275.1| hypothetical protein YQE_07239, partial [Dendroctonus ponderosae]
 gb|ERL87102.1| hypothetical protein D910_04502 [Dendroctonus ponderosae]
Length=566

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 62/93 (67%), Gaps = 1/93 (1%)
 Frame = -3

Query  577  SECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS-AGYVYXXFDSVE  401
            ++C +L NMFDPA ET+P +D++IRDDV EEC+++G V H++VDK S  G VY    S+ 
Sbjct  458  TQCFMLSNMFDPATETNPTWDIEIRDDVIEECNKHGGVLHVYVDKGSPQGNVYVKCPSIA  517

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
             A  +  ++H RWFA R ++A ++    Y + F
Sbjct  518  TAVASVNSLHGRWFAGRVITAAYVPLLNYHSLF  550



>ref|XP_004929275.1| PREDICTED: RNA-binding protein 39-like isoform X2 [Bombyx mori]
Length=350

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 65/103 (63%), Gaps = 4/103 (4%)
 Frame = -3

Query  598  PEPVGNP---SECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNS-AG  431
            P+P   P   ++C +L NMFDPA ET+P +D++IRDDV  EC+++G V H++VDK S  G
Sbjct  232  PQPQVAPPIATQCFMLNNMFDPATETNPSWDIEIRDDVISECNKHGGVLHVYVDKASPQG  291

Query  430  YVYXXFDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
             VY    ++  A  +  ++H RWFA R ++A ++    Y + F
Sbjct  292  NVYCKCPTIATAVASVNSLHGRWFAGRVITAAYVPLVNYHSLF  334



>ref|XP_001650224.1| AAEL005046-PA [Aedes aegypti]
 gb|EAT43555.1| AAEL005046-PA [Aedes aegypti]
Length=544

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 61/97 (63%), Gaps = 1/97 (1%)
 Frame = -3

Query  577  SECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDK-NSAGYVYXXFDSVE  401
            ++C LL NMFDP  ET+P +D +I DDV EEC+++G V H++VDK N AG VY    S+ 
Sbjct  436  TQCFLLSNMFDPTTETNPTWDTEIEDDVIEECNKHGGVLHVYVDKENPAGNVYVKCPSIA  495

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
             A  A  A+H RWFA R ++A ++    Y   F  +A
Sbjct  496  TAVLAVNALHGRWFAGRIITAAYVPLVNYHTLFPDSA  532



>gb|ESA21112.1| hypothetical protein GLOINDRAFT_92051 [Rhizophagus irregularis 
DAOM 181602]
Length=466

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = -3

Query  595  EPVGNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXX  416
            +P  NP+ C+LLKNMF+P  ET+  +  ++ +DV  EC +YG V HI VD+ SAG +Y  
Sbjct  363  QPRVNPTRCVLLKNMFNPDEETESNWAEELEEDVKSECIKYGPVVHISVDRESAGDIYMK  422

Query  415  FDSVEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKFKGAA  290
            FDSV  A  A   ++ RWF    +SA F+    Y+ +F  AA
Sbjct  423  FDSVSSAQAAVNGLNGRWFGGNQISAVFILDMFYNVRFPKAA  464



>ref|XP_008475056.1| PREDICTED: RNA-binding protein 39 isoform X1 [Diaphorina citri]
Length=522

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 61/93 (66%), Gaps = 1/93 (1%)
 Frame = -3

Query  577  SECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSA-GYVYXXFDSVE  401
            ++C LL NMFDPA ET+P +D++IRDDV EEC+++G V H+ VDK S  G VY    ++ 
Sbjct  412  TQCFLLANMFDPATETNPTWDVEIRDDVIEECNKHGGVLHVFVDKVSPQGNVYVKCPTIN  471

Query  400  FAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
             A  A  ++H RWFA R ++A ++    Y + F
Sbjct  472  TAVAAVNSLHGRWFAGRIITAAYVPVINYHSLF  504



>ref|XP_003283761.1| hypothetical protein DICPUDRAFT_74732 [Dictyostelium purpureum]
 gb|EGC39775.1| hypothetical protein DICPUDRAFT_74732 [Dictyostelium purpureum]
Length=630

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 60/95 (63%), Gaps = 0/95 (0%)
 Frame = -3

Query  586  GNPSECLLLKNMFDPAMETDPEFDLDIRDDVHEECSEYGAVKHIHVDKNSAGYVYXXFDS  407
            G  S CL+L+NMFDP  ET+ ++D DI  + H ECS++G ++HI++DKN+ G +Y  +D+
Sbjct  534  GFSSTCLILRNMFDPDTETEEDWDQDITTETHSECSQFGKIQHIYLDKNTKGCIYIRYDN  593

Query  406  VEFAFXAQQAMHKRWFARRSVSAXFLQPYEYDAKF  302
             E    A Q +H RWF++  + A  +    Y  KF
Sbjct  594  PESPLKAIQKLHGRWFSKNEIIAELVPEPVYKLKF  628



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077565505600