BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF012L09

Length=794
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001234183.1|  plastid lipid associated protein CHRC              276   5e-88   Solanum lycopersicum
ref|NP_001275061.1|  light-induced protein, chloroplastic               275   2e-87   Solanum tuberosum [potatoes]
sp|O99019.1|LIPC_SOLDE  RecName: Full=Light-induced protein, chlo...    273   9e-87   Solanum demissum
ref|XP_011086212.1|  PREDICTED: light-induced protein, chloroplas...    270   1e-85   Sesamum indicum [beniseed]
emb|CAA75657.1|  Plastid-lipid-Associated Protein                       265   3e-84   Nicotiana tabacum [American tobacco]
dbj|BAF95867.1|  putative plastid lipid-associated protein              263   4e-84   Vitis hybrid cultivar
ref|XP_009628206.1|  PREDICTED: light-induced protein, chloroplastic    266   6e-84   Nicotiana tomentosiformis
gb|KDP20693.1|  hypothetical protein JCGZ_21164                         265   1e-83   Jatropha curcas
ref|XP_009783682.1|  PREDICTED: light-induced protein, chloroplas...    260   1e-83   Nicotiana sylvestris
emb|CAN69132.1|  hypothetical protein VITISV_012048                     263   2e-83   Vitis vinifera
ref|XP_011047005.1|  PREDICTED: plastid-lipid-associated protein,...    263   7e-83   Populus euphratica
ref|XP_009795634.1|  PREDICTED: light-induced protein, chloroplastic    263   1e-82   Nicotiana sylvestris
emb|CAA50750.1|  fibrillin                                              262   1e-82   Capsicum annuum
ref|XP_006383843.1|  chromoplast-specific carotenoid-associated p...    261   3e-82   Populus trichocarpa [western balsam poplar]
gb|AIX02791.1|  fibrillin 1 protein                                     261   6e-82   Capsicum annuum
gb|AIX02792.1|  fibrillin 1 protein                                     261   6e-82   Capsicum annuum
ref|XP_002524410.1|  Plastid-lipid-associated protein, chloroplas...    260   7e-82   Ricinus communis
ref|XP_010057882.1|  PREDICTED: plastid-lipid-associated protein,...    260   1e-81   Eucalyptus grandis [rose gum]
ref|XP_009788638.1|  PREDICTED: light-induced protein, chloroplas...    259   2e-81   Nicotiana sylvestris
ref|XP_006449818.1|  hypothetical protein CICLE_v10015934mg             259   2e-81   Citrus clementina [clementine]
gb|KDO78378.1|  hypothetical protein CISIN_1g020639mg                   259   4e-81   Citrus sinensis [apfelsine]
gb|ABK96652.1|  unknown                                                 259   4e-81   Populus trichocarpa x Populus deltoides
gb|EYU33869.1|  hypothetical protein MIMGU_mgv1a010099mg                258   5e-81   Erythranthe guttata [common monkey flower]
ref|XP_010099142.1|  Plastid-lipid-associated protein                   258   8e-81   Morus notabilis
ref|XP_007026203.1|  Plastid-lipid associated protein PAP / fibri...    260   2e-80   
ref|XP_006467367.1|  PREDICTED: plastid-lipid-associated protein,...    258   4e-80   
ref|XP_008349368.1|  PREDICTED: plastid-lipid-associated protein,...    249   7e-79   
emb|CDP04455.1|  unnamed protein product                                253   8e-79   Coffea canephora [robusta coffee]
gb|ABA43902.1|  fibrillin                                               253   8e-79   Coffea canephora [robusta coffee]
ref|XP_009357505.1|  PREDICTED: plastid-lipid-associated protein,...    252   2e-78   Pyrus x bretschneideri [bai li]
gb|AIX87511.1|  fibrillin                                               252   2e-78   Lycium barbarum [Duke of Argyll's teatree]
gb|KJB57828.1|  hypothetical protein B456_009G182500                    252   2e-78   Gossypium raimondii
gb|KHG02015.1|  Plastid-lipid-associated, chloroplastic                 252   2e-78   Gossypium arboreum [tree cotton]
gb|AIX87535.1|  fibrillin                                               251   2e-78   Lycium ruthenicum
ref|XP_008384113.1|  PREDICTED: plastid-lipid-associated protein,...    250   7e-78   
ref|XP_007147677.1|  hypothetical protein PHAVU_006G145100g             248   3e-77   Phaseolus vulgaris [French bean]
ref|XP_004293330.1|  PREDICTED: plastid-lipid-associated protein,...    248   4e-77   Fragaria vesca subsp. vesca
ref|XP_008224724.1|  PREDICTED: plastid-lipid-associated protein,...    247   1e-76   Prunus mume [ume]
ref|XP_003534708.1|  PREDICTED: plastid-lipid-associated protein,...    247   1e-76   Glycine max [soybeans]
gb|KHN40849.1|  Plastid-lipid-associated protein, chloroplastic         246   2e-76   Glycine soja [wild soybean]
emb|CDX82925.1|  BnaC01g13750D                                          246   2e-76   
ref|XP_004486195.1|  PREDICTED: plastid-lipid-associated protein,...    246   4e-76   Cicer arietinum [garbanzo]
ref|XP_009392110.1|  PREDICTED: chromoplast-specific carotenoid-a...    245   6e-76   Musa acuminata subsp. malaccensis [pisang utan]
sp|Q94KU6.1|PAP2_BRACM  RecName: Full=Plastid lipid-associated pr...    245   7e-76   Brassica rapa
gb|AAK57562.1|  plastid-lipid associated protein PAP2                   245   7e-76   Brassica rapa subsp. oleifera [biennial turnip rape]
emb|CDX79139.1|  BnaA01g12060D                                          245   7e-76   
ref|XP_009135738.1|  PREDICTED: plastid lipid-associated protein ...    245   7e-76   Brassica rapa
ref|XP_010943242.1|  PREDICTED: probable plastid-lipid-associated...    246   7e-76   
ref|XP_007211630.1|  hypothetical protein PRUPE_ppa005787mg             249   8e-76   
ref|XP_006413678.1|  hypothetical protein EUTSA_v10025758mg             244   1e-75   Eutrema salsugineum [saltwater cress]
ref|XP_010448920.1|  PREDICTED: probable plastid-lipid-associated...    243   2e-75   
ref|XP_010434068.1|  PREDICTED: probable plastid-lipid-associated...    242   7e-75   Camelina sativa [gold-of-pleasure]
ref|XP_003546169.1|  PREDICTED: plastid-lipid-associated protein,...    242   9e-75   Glycine max [soybeans]
sp|B2LU34.1|CHRC1_ONCHC  RecName: Full=Chromoplast-specific carot...    242   9e-75   Oncidium hybrid cultivar
ref|XP_008440050.1|  PREDICTED: chromoplast-specific carotenoid-a...    242   1e-74   Cucumis melo [Oriental melon]
sp|B4F6G1.1|CHRC2_ONCHC  RecName: Full=Chromoplast-specific carot...    241   2e-74   Oncidium hybrid cultivar
ref|XP_010686767.1|  PREDICTED: plastid-lipid-associated protein,...    241   2e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002867781.1|  hypothetical protein ARALYDRAFT_914391             241   2e-74   Arabidopsis lyrata subsp. lyrata
ref|XP_010529464.1|  PREDICTED: probable plastid-lipid-associated...    240   6e-74   Tarenaya hassleriana [spider flower]
ref|XP_006396722.1|  hypothetical protein EUTSA_v10028808mg             240   7e-74   Eutrema salsugineum [saltwater cress]
ref|XP_006284145.1|  hypothetical protein CARUB_v10005278mg             239   8e-74   Capsella rubella
gb|AGN30962.1|  chromoplast-specific carotenoid-associated protein      239   8e-74   Narcissus tazetta subsp. chinensis
emb|CDY71809.1|  BnaCnng74600D                                          235   9e-74   Brassica napus [oilseed rape]
ref|NP_193955.1|  plastid-lipid associated protein PAP / fibrilli...    239   1e-73   Arabidopsis thaliana [mouse-ear cress]
gb|AAM67287.1|  fibrillin precursor-like protein                        239   1e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008799426.1|  PREDICTED: light-induced protein, chloroplas...    234   1e-73   
ref|XP_004134784.1|  PREDICTED: chromoplast-specific carotenoid-a...    239   2e-73   Cucumis sativus [cucumbers]
gb|KFK30956.1|  hypothetical protein AALP_AA6G049300                    238   4e-73   Arabis alpina [alpine rockcress]
ref|XP_003594155.1|  Plastid-lipid-associated protein                   238   4e-73   Medicago truncatula
gb|AAD03693.1|  fibrillin                                               234   6e-73   Brassica napus [oilseed rape]
gb|AAL67120.1|  AT4g22240/T10I14_70                                     236   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008803509.1|  PREDICTED: probable plastid-lipid-associated...    234   1e-72   Phoenix dactylifera
ref|XP_010422246.1|  PREDICTED: probable plastid-lipid-associated...    236   3e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010252567.1|  PREDICTED: plastid-lipid-associated protein,...    236   3e-72   Nelumbo nucifera [Indian lotus]
ref|XP_010496158.1|  PREDICTED: probable plastid-lipid-associated...    236   3e-72   Camelina sativa [gold-of-pleasure]
emb|CDY16684.1|  BnaA09g20620D                                          235   5e-72   Brassica napus [oilseed rape]
emb|CDY21291.1|  BnaC03g29750D                                          234   6e-72   Brassica napus [oilseed rape]
ref|NP_192311.1|  fibrillin                                             234   7e-72   Arabidopsis thaliana [mouse-ear cress]
gb|EYU27736.1|  hypothetical protein MIMGU_mgv1a010083mg                234   9e-72   Erythranthe guttata [common monkey flower]
ref|XP_006288225.1|  hypothetical protein CARUB_v10001463mg             234   1e-71   Capsella rubella
gb|EYU27735.1|  hypothetical protein MIMGU_mgv1a010083mg                234   1e-71   Erythranthe guttata [common monkey flower]
ref|XP_010433071.1|  PREDICTED: probable plastid-lipid-associated...    234   2e-71   Camelina sativa [gold-of-pleasure]
ref|XP_002872677.1|  plastid lipid-associated protein 1, chloropl...    233   3e-71   Arabidopsis lyrata subsp. lyrata
emb|CDX90850.1|  BnaA03g25300D                                          233   3e-71   
ref|XP_009114588.1|  PREDICTED: probable plastid-lipid-associated...    233   4e-71   Brassica rapa
ref|XP_009134286.1|  PREDICTED: plastid lipid-associated protein ...    232   7e-71   Brassica rapa
ref|XP_010538742.1|  PREDICTED: plastid lipid-associated protein ...    232   8e-71   Tarenaya hassleriana [spider flower]
ref|XP_006661039.1|  PREDICTED: probable plastid-lipid-associated...    229   8e-71   Oryza brachyantha
gb|AAK57561.1|  plastid-lipid associated protein PAP1                   231   3e-70   Brassica rapa subsp. oleifera [biennial turnip rape]
gb|AAP74338.1|  fibrillin-like protein                                  225   3e-70   Elaeis guineensis
ref|XP_010928413.1|  PREDICTED: probable plastid-lipid-associated...    229   2e-69   Elaeis guineensis
ref|NP_001062631.2|  Os09g0133600                                       226   2e-69   
ref|XP_009408003.1|  PREDICTED: probable plastid-lipid-associated...    228   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAO72593.1|  fibrillin-like protein                                  227   9e-69   Oryza sativa Japonica Group [Japonica rice]
gb|EEC84129.1|  hypothetical protein OsI_30469                          226   1e-68   Oryza sativa Indica Group [Indian rice]
sp|Q6K439.1|PAP2_ORYSJ  RecName: Full=Probable plastid-lipid-asso...    226   1e-68   Oryza sativa Japonica Group [Japonica rice]
gb|EEE69226.1|  hypothetical protein OsJ_28458                          226   2e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002447942.1|  hypothetical protein SORBIDRAFT_06g018550          226   2e-68   Sorghum bicolor [broomcorn]
gb|AFW58454.1|  plastid-lipid-associated protein 2                      224   1e-67   
ref|XP_004956481.1|  PREDICTED: probable plastid-lipid-associated...    223   2e-67   Setaria italica
ref|NP_001150448.1|  LOC100284078                                       223   2e-67   Zea mays [maize]
ref|NP_001150453.1|  LOC100284083                                       223   2e-67   
gb|EPS66635.1|  hypothetical protein M569_08140                         219   3e-67   Genlisea aurea
gb|KHG06297.1|  Plastid-lipid-associated, chloroplastic                 222   8e-67   Gossypium arboreum [tree cotton]
gb|KJB34758.1|  hypothetical protein B456_006G082400                    222   1e-66   Gossypium raimondii
ref|XP_003575588.1|  PREDICTED: probable plastid-lipid-associated...    221   1e-66   Brachypodium distachyon [annual false brome]
gb|EMS56479.1|  putative plastid-lipid-associated protein 2, chlo...    217   3e-66   Triticum urartu
gb|EMT11511.1|  Putative plastid-lipid-associated protein 2, chlo...    215   4e-66   
gb|ABK26110.1|  unknown                                                 220   6e-66   Picea sitchensis
gb|ABR17743.1|  unknown                                                 219   7e-66   Picea sitchensis
dbj|BAJ98727.1|  predicted protein                                      219   1e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003594154.1|  Plastid-lipid-associated protein                   216   1e-64   Medicago truncatula
gb|AFK48303.1|  unknown                                                 214   4e-64   Medicago truncatula
gb|ACJ85346.1|  unknown                                                 214   5e-64   Medicago truncatula
gb|ACJ84978.1|  unknown                                                 214   9e-64   Medicago truncatula
ref|XP_006849074.1|  hypothetical protein AMTR_s00028p00216930          213   1e-63   Amborella trichopoda
ref|XP_002983947.1|  hypothetical protein SELMODRAFT_156313             212   7e-63   Selaginella moellendorffii
ref|XP_002960725.1|  hypothetical protein SELMODRAFT_163532             211   1e-62   Selaginella moellendorffii
ref|XP_006844495.1|  hypothetical protein AMTR_s00016p00122150          202   2e-61   
ref|XP_009398685.1|  PREDICTED: probable plastid-lipid-associated...    202   3e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001766233.1|  predicted protein                                  179   3e-51   
ref|XP_008780182.1|  PREDICTED: probable plastid-lipid-associated...    166   3e-47   Phoenix dactylifera
gb|ABR17395.1|  unknown                                                 168   2e-45   Picea sitchensis
ref|XP_010270045.1|  PREDICTED: plastid-lipid-associated protein,...    164   2e-44   Nelumbo nucifera [Indian lotus]
ref|XP_006854055.1|  hypothetical protein AMTR_s00048p00085290          160   2e-43   Amborella trichopoda
ref|XP_001756848.1|  predicted protein                                  155   3e-42   
ref|XP_010276838.1|  PREDICTED: probable plastid-lipid-associated...    159   9e-42   Nelumbo nucifera [Indian lotus]
gb|KDP30383.1|  hypothetical protein JCGZ_17112                         155   9e-41   Jatropha curcas
ref|XP_002297709.2|  hypothetical protein POPTR_0001s02040g             154   1e-40   
ref|XP_002304354.1|  hypothetical protein POPTR_0003s09460g             154   1e-40   
gb|AFA36496.1|  fibrillin-like protein                                  145   4e-40   Lolium perenne [perennial ryegrass]
ref|XP_010245209.1|  PREDICTED: plastid lipid-associated protein ...    153   7e-40   Nelumbo nucifera [Indian lotus]
gb|ACG36654.1|  plastid-lipid-associated protein 2                      149   1e-39   Zea mays [maize]
ref|XP_009608239.1|  PREDICTED: plastoglobulin-1, chloroplastic i...    151   1e-39   Nicotiana tomentosiformis
ref|XP_009608213.1|  PREDICTED: plastoglobulin-1, chloroplastic i...    151   2e-39   Nicotiana tomentosiformis
ref|XP_011018504.1|  PREDICTED: plastid lipid-associated protein ...    152   2e-39   Populus euphratica
emb|CBI33829.3|  unnamed protein product                                148   3e-39   Vitis vinifera
ref|XP_008448650.1|  PREDICTED: plastoglobulin-1, chloroplastic         150   6e-39   Cucumis melo [Oriental melon]
ref|XP_009804524.1|  PREDICTED: light-induced protein, chloroplas...    143   1e-38   Nicotiana sylvestris
ref|XP_009789727.1|  PREDICTED: plastoglobulin-1, chloroplastic-like    144   1e-38   Nicotiana sylvestris
ref|XP_004300209.1|  PREDICTED: plastoglobulin-1, chloroplastic         149   1e-38   Fragaria vesca subsp. vesca
ref|XP_002276479.1|  PREDICTED: plastoglobulin-1, chloroplastic         149   2e-38   Vitis vinifera
ref|XP_008238187.1|  PREDICTED: plastoglobulin-1, chloroplastic         148   2e-38   Prunus mume [ume]
ref|XP_007209304.1|  hypothetical protein PRUPE_ppa007851mg             148   2e-38   Prunus persica
ref|XP_010053632.1|  PREDICTED: plastoglobulin-1, chloroplastic         148   2e-38   Eucalyptus grandis [rose gum]
ref|XP_011028127.1|  PREDICTED: plastid lipid-associated protein ...    149   2e-38   Populus euphratica
ref|XP_006367875.1|  PREDICTED: plastoglobulin-1, chloroplastic-like    144   4e-38   
gb|EYU19055.1|  hypothetical protein MIMGU_mgv1a026687mg                142   6e-38   Erythranthe guttata [common monkey flower]
ref|XP_008800089.1|  PREDICTED: probable plastid-lipid-associated...    148   6e-38   Phoenix dactylifera
ref|XP_004148751.1|  PREDICTED: plastid lipid-associated protein ...    147   9e-38   Cucumis sativus [cucumbers]
ref|XP_010096934.1|  putative plastid-lipid-associated protein 3        147   1e-37   Morus notabilis
ref|XP_009766235.1|  PREDICTED: plastoglobulin-1, chloroplastic         146   1e-37   Nicotiana sylvestris
gb|EMS55390.1|  putative plastid-lipid-associated protein 3, chlo...    145   1e-37   Triticum urartu
gb|ABC96720.1|  plastid fibrillin 2                                     142   4e-37   Coffea canephora [robusta coffee]
ref|XP_011082345.1|  PREDICTED: plastoglobulin-1, chloroplastic         145   4e-37   Sesamum indicum [beniseed]
ref|XP_009619935.1|  PREDICTED: plastoglobulin-1, chloroplastic-like    146   4e-37   Nicotiana tomentosiformis
dbj|BAJ85307.1|  predicted protein                                      145   4e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006662632.1|  PREDICTED: probable plastid-lipid-associated...    144   5e-37   
dbj|BAJ98223.1|  predicted protein                                      145   6e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG16773.1|  Plastid lipid-associated 3, chloroplastic               144   7e-37   Gossypium arboreum [tree cotton]
ref|XP_010235051.1|  PREDICTED: probable plastid-lipid-associated...    143   2e-36   Brachypodium distachyon [annual false brome]
ref|XP_010518909.1|  PREDICTED: plastid lipid-associated protein ...    143   2e-36   Tarenaya hassleriana [spider flower]
ref|XP_006352897.1|  PREDICTED: plastoglobulin-1, chloroplastic-like    144   2e-36   Solanum tuberosum [potatoes]
ref|XP_004245973.1|  PREDICTED: plastoglobulin-1, chloroplastic         142   3e-36   Solanum lycopersicum
ref|XP_010919972.1|  PREDICTED: probable plastid-lipid-associated...    143   4e-36   Elaeis guineensis
gb|KJB37720.1|  hypothetical protein B456_006G217700                    142   5e-36   Gossypium raimondii
gb|KJB37719.1|  hypothetical protein B456_006G217700                    142   6e-36   Gossypium raimondii
ref|XP_010516724.1|  PREDICTED: probable plastid-lipid-associated...    142   6e-36   Camelina sativa [gold-of-pleasure]
gb|EMT01216.1|  Putative plastid-lipid-associated protein 3, chlo...    141   8e-36   
emb|CDP18539.1|  unnamed protein product                                142   9e-36   Coffea canephora [robusta coffee]
ref|XP_010509611.1|  PREDICTED: probable plastid-lipid-associated...    140   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010505057.1|  PREDICTED: probable plastid-lipid-associated...    140   3e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010677363.1|  PREDICTED: plastid lipid-associated protein ...    140   3e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002467442.1|  hypothetical protein SORBIDRAFT_01g028150          140   4e-35   Sorghum bicolor [broomcorn]
ref|XP_002518975.1|  Plastid lipid-associated protein 3, chloropl...    140   4e-35   Ricinus communis
ref|XP_009143664.1|  PREDICTED: plastid lipid-associated protein ...    139   5e-35   Brassica rapa
emb|CDY31692.1|  BnaA05g08550D                                          139   5e-35   Brassica napus [oilseed rape]
sp|Q94KU5.1|PAP3_BRACM  RecName: Full=Plastid lipid-associated pr...    139   6e-35   Brassica rapa
gb|AAK57563.1|  plastid-lipid associated protein PAP3                   139   6e-35   Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_006294405.1|  hypothetical protein CARUB_v10023422mg             139   7e-35   Capsella rubella
ref|XP_004983554.1|  PREDICTED: probable plastid-lipid-associated...    139   7e-35   Setaria italica
gb|KIZ02337.1|  hypothetical protein MNEG_5623                          137   9e-35   Monoraphidium neglectum
ref|XP_002881399.1|  hypothetical protein ARALYDRAFT_902655             139   1e-34   Arabidopsis lyrata subsp. lyrata
ref|NP_001149315.1|  fibrillin1                                         139   1e-34   Zea mays [maize]
gb|ACG41445.1|  plastid-lipid associated protein 3                      139   1e-34   Zea mays [maize]
ref|XP_008676981.1|  PREDICTED: fibrillin1 isoform X1                   139   1e-34   Zea mays [maize]
ref|XP_006432747.1|  hypothetical protein CICLE_v10002003mg             138   2e-34   Citrus clementina [clementine]
emb|CDX84202.1|  BnaC04g09640D                                          137   3e-34   
gb|KFK36419.1|  hypothetical protein AALP_AA4G121600                    137   4e-34   Arabis alpina [alpine rockcress]
ref|XP_009373486.1|  PREDICTED: plastoglobulin-1, chloroplastic         136   6e-34   Pyrus x bretschneideri [bai li]
ref|XP_006368003.1|  PREDICTED: probable plastid-lipid-associated...    137   9e-34   Solanum tuberosum [potatoes]
ref|XP_007040679.1|  Plastid-lipid associated protein PAP / fibri...    135   1e-33   
ref|XP_006410707.1|  hypothetical protein EUTSA_v10016800mg             135   2e-33   Eutrema salsugineum [saltwater cress]
ref|XP_005846413.1|  hypothetical protein CHLNCDRAFT_11571              132   2e-33   Chlorella variabilis
ref|NP_181092.1|  putative plastid-lipid-associated protein 3           135   2e-33   Arabidopsis thaliana [mouse-ear cress]
gb|AAK68845.1|  putative fibrillin                                      135   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004244405.1|  PREDICTED: plastoglobulin-1, chloroplastic         135   3e-33   Solanum lycopersicum
gb|KDO78379.1|  hypothetical protein CISIN_1g020639mg                   110   4e-33   Citrus sinensis [apfelsine]
ref|XP_007158264.1|  hypothetical protein PHAVU_002G137800g             134   5e-33   Phaseolus vulgaris [French bean]
ref|XP_004512496.1|  PREDICTED: plastoglobulin-1, chloroplastic-like    134   5e-33   Cicer arietinum [garbanzo]
ref|XP_009403116.1|  PREDICTED: LOW QUALITY PROTEIN: probable pla...    133   1e-32   
ref|XP_005645631.1|  hypothetical protein COCSUDRAFT_17945              130   3e-32   Coccomyxa subellipsoidea C-169
ref|XP_003516983.1|  PREDICTED: plastoglobulin-1, chloroplastic-like    132   4e-32   Glycine max [soybeans]
ref|XP_002505473.1|  predicted protein                                  129   5e-32   Micromonas commoda
sp|Q7XBW5.1|PAP3_ORYSJ  RecName: Full=Probable plastid-lipid-asso...    131   5e-32   Oryza sativa Japonica Group [Japonica rice]
gb|EEE51456.1|  hypothetical protein OsJ_32570                          131   5e-32   Oryza sativa Japonica Group [Japonica rice]
gb|ADK79127.1|  astaxanthin vesicles associated protein                 128   4e-31   Haematococcus lacustris
ref|XP_008373508.1|  PREDICTED: plastoglobulin-1, chloroplastic         129   4e-31   Malus domestica [apple tree]
ref|XP_006588307.1|  PREDICTED: plastoglobulin-1, chloroplastic-like    124   8e-30   
ref|XP_008802537.1|  PREDICTED: plastid-lipid-associated protein,...    119   5e-29   Phoenix dactylifera
gb|ACJ84215.1|  unknown                                                 121   2e-28   Medicago truncatula
ref|XP_003612834.1|  Plastoglobulin-1                                   121   2e-28   Medicago truncatula
ref|XP_009349223.1|  PREDICTED: plastoglobulin-1, chloroplastic-like    121   2e-28   Pyrus x bretschneideri [bai li]
sp|Q9ZP40.1|PG1_PEA  RecName: Full=Plastoglobulin-1, chloroplasti...    117   6e-28   Pisum sativum [garden pea]
gb|AFK33388.1|  unknown                                                 119   8e-28   Medicago truncatula
ref|XP_001760672.1|  predicted protein                                  112   2e-26   
ref|NP_001065482.2|  Os10g0575700                                       114   1e-25   
ref|XP_001692028.1|  plastid lipid associated protein                   112   3e-25   Chlamydomonas reinhardtii
gb|AFW58455.1|  hypothetical protein ZEAMMB73_538731                  87.0    2e-23   
gb|EEC67495.1|  hypothetical protein OsI_34766                          103   1e-22   Oryza sativa Indica Group [Indian rice]
gb|EPS69991.1|  hypothetical protein M569_04771                       88.2    7e-19   Genlisea aurea
gb|AFG70455.1|  hypothetical protein 0_2632_01                        84.3    3e-17   Pinus taeda
ref|XP_003059745.1|  predicted protein                                88.2    3e-17   Micromonas pusilla CCMP1545
ref|XP_001698968.1|  plastid lipid associated protein                 88.6    4e-17   Chlamydomonas reinhardtii
gb|AEW07488.1|  hypothetical protein 0_2632_01                        83.2    7e-17   Pinus radiata
ref|XP_001698965.1|  plastid lipid associated protein                 88.6    9e-17   Chlamydomonas reinhardtii
emb|CAA75658.1|  Plastid-lipid-Associated Protein                     60.5    1e-16   Solanum lycopersicum
gb|AFG70460.1|  hypothetical protein 0_2632_01                        82.4    1e-16   Pinus taeda
gb|AFG70450.1|  hypothetical protein 0_2632_01                        82.0    2e-16   Pinus taeda
ref|XP_002950467.1|  hypothetical protein VOLCADRAFT_104724           86.7    2e-16   Volvox carteri f. nagariensis
ref|XP_002945997.1|  hypothetical protein VOLCADRAFT_46017            79.0    4e-14   Volvox carteri f. nagariensis
ref|XP_002945995.1|  hypothetical protein VOLCADRAFT_46047            79.0    5e-14   Volvox carteri f. nagariensis
ref|WP_016862318.1|  fibrillin                                        70.9    2e-11   Fischerella muscicola
ref|XP_010279319.1|  PREDICTED: plastid-lipid-associated protein,...  60.8    2e-11   Nelumbo nucifera [Indian lotus]
ref|WP_008274287.1|  fibrillin                                        68.6    9e-11   Cyanothece sp. CCY0110
ref|WP_039742995.1|  fibrillin                                        65.9    1e-10   
ref|WP_009545266.1|  MULTISPECIES: fibrillin                          68.2    1e-10   Cyanothece
gb|ACB52918.1|  fibrillin                                             67.8    2e-10   Cyanothece sp. ATCC 51142
ref|WP_002797657.1|  fibrillin                                        67.4    3e-10   Microcystis
ref|WP_002736482.1|  fibrillin                                        66.6    4e-10   Microcystis aeruginosa
ref|WP_017310080.1|  fibrillin                                        66.2    6e-10   Fischerella sp. PCC 9339
dbj|GAL94246.1|  fibrillin                                            66.2    6e-10   Microcystis aeruginosa NIES-44
ref|WP_044450060.1|  fibrillin                                        66.2    6e-10   Mastigocladus laminosus
ref|WP_017296325.1|  hypothetical protein                             65.9    9e-10   Geminocystis herdmanii
ref|WP_016878430.1|  fibrillin                                        65.1    1e-09   Chlorogloeopsis fritschii
ref|WP_002747500.1|  fibrillin                                        65.5    1e-09   Microcystis
ref|WP_008199162.1|  fibrillin                                        65.1    2e-09   Microcystis
ref|WP_006527167.1|  fibrillin                                        64.7    2e-09   Gloeocapsa sp. PCC 73106
ref|WP_009455625.1|  MULTISPECIES: fibrillin                          64.7    2e-09   Fischerella thermalis
ref|WP_019499433.1|  hypothetical protein                             64.3    3e-09   Pseudanabaena sp. PCC 6802
ref|WP_002759778.1|  fibrillin                                        63.9    5e-09   Microcystis aeruginosa
ref|WP_002784746.1|  Fibrillin                                        63.9    5e-09   Microcystis aeruginosa
ref|WP_016950092.1|  fibrillin                                        63.5    7e-09   Anabaena sp. PCC 7108
ref|WP_016867324.1|  fibrillin                                        63.5    7e-09   Fischerella
ref|WP_002788271.1|  fibrillin                                        62.8    1e-08   Microcystis
ref|WP_017745894.1|  fibrillin                                        62.4    1e-08   Scytonema hofmannii
ref|WP_019490506.1|  fibrillin                                        62.4    2e-08   Calothrix sp. PCC 7103
gb|AAD38023.1|AF148219_1  fibrillin                                   62.4    2e-08   Nostoc sp. PCC 8009
gb|KJB37718.1|  hypothetical protein B456_006G217700                  51.2    2e-08   Gossypium raimondii
ref|WP_012410287.1|  fibrillin                                        62.0    2e-08   Nostoc punctiforme
ref|WP_015167859.1|  PAP fibrillin                                    62.0    2e-08   Synechococcus sp. PCC 7502
ref|WP_015213736.1|  PAP fibrillin family protein                     62.0    2e-08   Anabaena cylindrica
ref|WP_015201000.1|  PAP fibrillin family protein                     61.6    3e-08   Calothrix parietina
ref|WP_006194699.1|  fibrillin                                        61.6    4e-08   Nodularia spumigena
ref|WP_007306077.1|  fibrillin                                        61.6    4e-08   Crocosphaera watsonii
ref|XP_008800090.1|  PREDICTED: probable plastid-lipid-associated...  53.5    4e-08   Phoenix dactylifera
ref|WP_044106796.1|  fibrillin                                        60.8    6e-08   cyanobacterium endosymbiont of Epithemia turgida
emb|CCQ69737.1|  fibrillin                                            59.7    6e-08   Crocosphaera watsonii WH 0402
ref|WP_012597880.1|  fibrillin                                        60.8    6e-08   Cyanothece sp. PCC 7424
ref|WP_009630980.1|  PAP_fibrillin                                    60.1    7e-08   Synechocystis sp. PCC 7509
ref|WP_015142149.1|  PAP fibrillin                                    60.5    8e-08   Pleurocapsa minor
ref|WP_007311273.1|  fibrillin                                        60.5    9e-08   Crocosphaera watsonii
ref|XP_011018505.1|  PREDICTED: probable plastid-lipid-associated...  48.1    1e-07   Populus euphratica
ref|WP_002765829.1|  fibrillin                                        60.1    1e-07   Microcystis aeruginosa
gb|KIJ80924.1|  fibrillin                                             57.8    1e-07   Scytonema tolypothrichoides VB-61278
ref|WP_006631292.1|  fibrillin                                        57.0    1e-07   Microcoleus vaginatus
ref|WP_015111813.1|  PAP fibrillin family protein                     59.7    2e-07   Nostoc sp. PCC 7107
ref|WP_012595043.1|  fibrillin                                        59.7    2e-07   Cyanothece sp. PCC 8801
ref|WP_018396788.1|  hypothetical protein                             59.7    2e-07   filamentous cyanobacterium ESFC-1
ref|WP_015156100.1|  PAP fibrillin family protein                     56.2    2e-07   
ref|WP_039716372.1|  fibrillin                                        56.6    2e-07   
ref|XP_002317175.1|  chromoplast-specific carotenoid-associated p...  55.5    3e-07   
ref|WP_015140456.1|  PAP fibrillin                                    58.9    3e-07   
ref|WP_015783811.1|  fibrillin                                        58.9    3e-07   
ref|XP_007040682.1|  Plastid-lipid associated protein PAP / fibri...  49.7    4e-07   
gb|KIE13446.1|  fibrillin                                             58.5    4e-07   
ref|WP_006617519.1|  fibrillin                                        58.5    4e-07   
ref|WP_006625760.1|  MULTISPECIES: fibrillin                          58.5    4e-07   
ref|WP_008050691.1|  fibrillin                                        58.5    4e-07   
ref|WP_027254936.1|  fibrillin                                        57.0    5e-07   
ref|WP_015223589.1|  fibrillin                                        58.2    5e-07   
ref|WP_042155767.1|  fibrillin                                        57.0    5e-07   
ref|WP_011056274.1|  fibrillin                                        58.2    5e-07   
ref|WP_040655771.1|  fibrillin                                        58.2    6e-07   
ref|WP_015231060.1|  PAP fibrillin                                    58.2    6e-07   
ref|WP_026786145.1|  MULTISPECIES: fibrillin                          56.6    6e-07   
ref|WP_017653873.1|  fibrillin                                        58.2    6e-07   
ref|WP_028082646.1|  fibrillin                                        57.8    7e-07   
ref|XP_006432746.1|  hypothetical protein CICLE_v10002003mg           46.6    8e-07   
gb|ERN41472.1|  PAP fibrillin                                         57.8    8e-07   
ref|XP_003592199.1|  Plastid-lipid-associated protein                 49.7    1e-06   
ref|WP_017717779.1|  fibrillin                                        57.0    2e-06   
ref|WP_017315378.1|  fibrillin                                        56.6    2e-06   
ref|WP_019506432.1|  fibrillin                                        56.6    2e-06   
ref|WP_017305990.1|  hypothetical protein                             56.6    2e-06   
ref|WP_041429685.1|  fibrillin                                        56.2    2e-06   
gb|AHB88680.1|  plastoglobulin-like protein Pgl1                      56.2    3e-06   
ref|WP_013323346.1|  fibrillin                                        56.2    3e-06   
ref|WP_028089769.1|  fibrillin                                        55.8    4e-06   
ref|WP_015210228.1|  PAP_fibrillin                                    55.5    5e-06   
ref|WP_015128015.1|  PAP fibrillin family protein                     55.5    6e-06   
ref|XP_007040681.1|  Plastid-lipid associated protein PAP / fibri...  45.8    6e-06   
ref|WP_008188169.1|  fibrillin                                        55.1    7e-06   
ref|WP_011613884.1|  fibrillin                                        54.3    8e-06   
ref|WP_015192734.1|  PAP fibrillin family protein                     55.1    8e-06   
ref|WP_015135028.1|  fibrillin family protein                         55.1    8e-06   
ref|XP_007158263.1|  hypothetical protein PHAVU_002G137800g           43.1    1e-05   
ref|WP_015226493.1|  fibrillin                                        53.9    2e-05   
ref|WP_009628669.1|  PAP fibrillin family protein                     53.9    2e-05   
ref|WP_009768204.1|  fibrillin                                        53.1    3e-05   
ref|WP_006102803.1|  fibrillin                                        52.4    7e-05   
gb|EKV03940.1|  PAP_fibrillin                                         52.0    1e-04   
ref|WP_036021731.1|  fibrillin                                        52.0    1e-04   
ref|WP_017297518.1|  hypothetical protein                             51.6    1e-04   
ref|WP_036485633.1|  fibrillin                                        50.8    2e-04   
ref|WP_035991998.1|  fibrillin                                        50.8    3e-04   
ref|WP_017711245.1|  hypothetical protein                             49.7    3e-04   
ref|WP_040936721.1|  fibrillin                                        50.4    4e-04   
ref|WP_023074381.1|  fibrillin                                        50.4    4e-04   
ref|WP_040932316.1|  fibrillin                                        50.1    4e-04   



>ref|NP_001234183.1| plastid lipid associated protein CHRC [Solanum lycopersicum]
 gb|ABC42191.1| plastid lipid associated protein CHRC [Solanum lycopersicum]
Length=326

 Score =   276 bits (707),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -2

Query  703  LWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTP  524
            L VRVEEI QTIDSESFTVQNSVVF+GPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTP
Sbjct  174  LLVRVEEISQTIDSESFTVQNSVVFAGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTP  233

Query  523  QLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESW  344
            QLTDSIVLPENVEFLGQKIDL+PFKGLITS+QDTASSV KSISSQPP+KF ++N+NA+SW
Sbjct  234  QLTDSIVLPENVEFLGQKIDLSPFKGLITSVQDTASSVAKSISSQPPIKFPISNNNAQSW  293

Query  343  LLTTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            LLTTYLD ELRISRG+AGS+FVLIKE SPLLKP
Sbjct  294  LLTTYLDDELRISRGDAGSVFVLIKEGSPLLKP  326


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTL  705
            TEALTL NGKW+LAYTSF GLFPLLSRG L
Sbjct  144  TEALTLLNGKWILAYTSFSGLFPLLSRGNL  173



>ref|NP_001275061.1| light-induced protein, chloroplastic [Solanum tuberosum]
 sp|P80471.2|LIPC_SOLTU RecName: Full=Light-induced protein, chloroplastic; AltName: 
Full=Drought-induced stress protein CDSP-34; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA75558.1| chloroplast drought-induced stress protein, 34 kD) [Solanum tuberosum]
Length=326

 Score =   275 bits (703),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            VRVEEI QTIDSESFTVQNSVVF+GPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL
Sbjct  176  VRVEEISQTIDSESFTVQNSVVFAGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  235

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSIVLPENVEFLGQKIDL+PFKGLITS+QDTASSV KSISSQPP+KF + N+NA+SWLL
Sbjct  236  TDSIVLPENVEFLGQKIDLSPFKGLITSVQDTASSVAKSISSQPPIKFPITNNNAQSWLL  295

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ELRISRG+AGS+FVLIKE SPLLKP
Sbjct  296  TTYLDDELRISRGDAGSVFVLIKEGSPLLKP  326


 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEALTL NGKW+LAYTSF GLFPLLSRG LPL
Sbjct  144  TEALTLLNGKWILAYTSFSGLFPLLSRGNLPL  175



>sp|O99019.1|LIPC_SOLDE RecName: Full=Light-induced protein, chloroplastic; AltName: 
Full=C40.4; Flags: Precursor [Solanum demissum]
 emb|CAA10372.1| fibrillin [Solanum demissum]
Length=326

 Score =   273 bits (699),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            VRVEEI QTIDSESFTVQNSVVF+GPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL
Sbjct  176  VRVEEISQTIDSESFTVQNSVVFAGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  235

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSIVLPENVEFLGQKID++PFKGLITS+QDTASSVVKSISSQPP+KF + N+NA+SWLL
Sbjct  236  TDSIVLPENVEFLGQKIDVSPFKGLITSVQDTASSVVKSISSQPPIKFPITNNNAQSWLL  295

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ELRI RG+AGS+FVLIKE SPLLKP
Sbjct  296  TTYLDDELRIPRGDAGSVFVLIKEGSPLLKP  326


 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEALTL NGKW+LAYTSF GLFPLLSRG LPL
Sbjct  144  TEALTLLNGKWILAYTSFSGLFPLLSRGNLPL  175



>ref|XP_011086212.1| PREDICTED: light-induced protein, chloroplastic-like [Sesamum 
indicum]
Length=312

 Score =   270 bits (690),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = -2

Query  718  QGAHSLWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEG  539
            +GA     ++EEI QTIDSE+FTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEG
Sbjct  155  RGASLPLAKLEEISQTIDSENFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEG  214

Query  538  IIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANS  359
            +IGTPQLTDSIVLPENVEFLGQKIDLTPFKGL+TS+QDTASSV K+ISS+PPLKFS++NS
Sbjct  215  VIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLLTSVQDTASSVAKTISSRPPLKFSISNS  274

Query  358  NAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            NAESWLLTTYLD ELRISRG+ GSIFVLIKE SPLL
Sbjct  275  NAESWLLTTYLDDELRISRGDGGSIFVLIKEGSPLL  310


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRG-TLPLGQ  693
            TEALTL NGKW+LAYT+F GLFPL SRG +LPL +
Sbjct  129  TEALTLLNGKWILAYTTFSGLFPLFSRGASLPLAK  163



>emb|CAA75657.1| Plastid-lipid-Associated Protein [Nicotiana tabacum]
Length=270

 Score =   265 bits (676),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            VRVEEI QTIDSE+FTVQNSVVF+GPLATTSI+TNAKFEVRSPKRVQIKF+EG+IGTPQL
Sbjct  120  VRVEEISQTIDSEAFTVQNSVVFAGPLATTSITTNAKFEVRSPKRVQIKFDEGVIGTPQL  179

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI LPEN+EFLGQKIDL+PFKGL+ S+QDTASSV KSISSQPP+KF ++NSNA+SWLL
Sbjct  180  TDSIELPENIEFLGQKIDLSPFKGLVNSVQDTASSVAKSISSQPPIKFPISNSNAQSWLL  239

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ELRISRG+ GS+FVLIKE SPLLKP
Sbjct  240  TTYLDHELRISRGDGGSVFVLIKEGSPLLKP  270


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEAL L NGKW+LAYTSF GLFPLLSRGTLPL
Sbjct  88   TEALPLLNGKWILAYTSFSGLFPLLSRGTLPL  119



>dbj|BAF95867.1| putative plastid lipid-associated protein [Vitis hybrid cultivar]
Length=238

 Score =   263 bits (673),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE+FTVQNSV FSGPLATTSISTNAKFEVRSPKRVQIKF+EGIIGTPQL
Sbjct  88   VKVEEISQTIDSENFTVQNSVQFSGPLATTSISTNAKFEVRSPKRVQIKFQEGIIGTPQL  147

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI LPENVEFLGQ IDLTPFKGLITS+QDTASSV K+ISSQPPLKFS+ NSNAESWLL
Sbjct  148  TDSIELPENVEFLGQNIDLTPFKGLITSVQDTASSVAKTISSQPPLKFSIPNSNAESWLL  207

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISRG+AGSIFVLIKE S LL P
Sbjct  208  TTYLDEDLRISRGDAGSIFVLIKEGSSLLVP  238


 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEALTL NGKW+LAYTSF GLFPLLSRGTLPL
Sbjct  56   TEALTLLNGKWILAYTSFAGLFPLLSRGTLPL  87



>ref|XP_009628206.1| PREDICTED: light-induced protein, chloroplastic [Nicotiana tomentosiformis]
Length=322

 Score =   266 bits (679),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            VRVEEI QTIDSE+FTVQNSVVF+GPLATTSI+TNAKFEVRSPKRVQIKF+EGIIGTPQL
Sbjct  172  VRVEEISQTIDSEAFTVQNSVVFAGPLATTSITTNAKFEVRSPKRVQIKFDEGIIGTPQL  231

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI LPEN+EFLGQKIDL+PFKGL+ S+QDTASSV KSISSQPP+KF ++NSNA+SWLL
Sbjct  232  TDSIELPENIEFLGQKIDLSPFKGLVNSVQDTASSVAKSISSQPPIKFPISNSNAQSWLL  291

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ELRISRG+ GS+FVLIKE SPLLKP
Sbjct  292  TTYLDHELRISRGDGGSVFVLIKEGSPLLKP  322


 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEAL L NGKW+LAYTSF GLFPLLSRGTLPL
Sbjct  140  TEALPLLNGKWILAYTSFSGLFPLLSRGTLPL  171



>gb|KDP20693.1| hypothetical protein JCGZ_21164 [Jatropha curcas]
Length=311

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE+FTVQNSV FSGPLATTSISTNAKFEVRSPKRVQIKFEEG+IGTPQL
Sbjct  161  VKVEEISQTIDSENFTVQNSVQFSGPLATTSISTNAKFEVRSPKRVQIKFEEGVIGTPQL  220

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSIV+PENVEFLGQKIDLTP KG++TS+QDTASSV K+ISSQPPLKF ++N+NAESWLL
Sbjct  221  TDSIVIPENVEFLGQKIDLTPLKGILTSVQDTASSVAKTISSQPPLKFPISNTNAESWLL  280

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISRG+ GS+FVLIKE SPLLKP
Sbjct  281  TTYLDEDLRISRGDGGSVFVLIKEGSPLLKP  311


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEALTL NGKW+LAYTSF GLFPLLSRG LPL
Sbjct  129  TEALTLLNGKWILAYTSFSGLFPLLSRGRLPL  160



>ref|XP_009783682.1| PREDICTED: light-induced protein, chloroplastic-like [Nicotiana 
sylvestris]
Length=181

 Score =   260 bits (664),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            VRVEEI QTIDSE+F VQN VVF+GPLATTSI+TNAKFEV+SPKRVQIKF+EGIIGTPQL
Sbjct  31   VRVEEISQTIDSETFAVQNCVVFAGPLATTSITTNAKFEVKSPKRVQIKFDEGIIGTPQL  90

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI LPENVEFLGQKIDL+PFKGLI S+QDTASSV KSISSQPP+KF ++NSNA+SWLL
Sbjct  91   TDSIELPENVEFLGQKIDLSPFKGLINSVQDTASSVAKSISSQPPIKFPISNSNAQSWLL  150

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ELRISRG+ GS+FVLIKE SPLLKP
Sbjct  151  TTYLDDELRISRGDGGSVFVLIKEGSPLLKP  181



>emb|CAN69132.1| hypothetical protein VITISV_012048 [Vitis vinifera]
Length=281

 Score =   263 bits (672),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE+FTVQNSV FSGPLATTSISTNAKFEVRSPKRVQIKF+EGIIGTPQL
Sbjct  131  VKVEEISQTIDSENFTVQNSVQFSGPLATTSISTNAKFEVRSPKRVQIKFQEGIIGTPQL  190

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI LPENVEFLGQ IDLTPFKGLITS+QDTASSV K+ISSQPPLKFS+ NSNAESWLL
Sbjct  191  TDSIELPENVEFLGQNIDLTPFKGLITSVQDTASSVAKTISSQPPLKFSIPNSNAESWLL  250

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISRG+AGSIFVLIKE S LL P
Sbjct  251  TTYLDEDLRISRGDAGSIFVLIKEGSSLLVP  281


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEALTL NGKW+LAYTSF GLFPLLSRGTLPL
Sbjct  99   TEALTLLNGKWILAYTSFAGLFPLLSRGTLPL  130



>ref|XP_011047005.1| PREDICTED: plastid-lipid-associated protein, chloroplastic [Populus 
euphratica]
Length=329

 Score =   263 bits (673),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE+ TVQNSV+FSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTP+L
Sbjct  179  VKVEEISQTIDSENLTVQNSVLFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPKL  238

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI LPENVEFLGQKIDLTPF+G+I+S+QDTASSV K+ISSQPPLKFS++N NAESWLL
Sbjct  239  TDSIELPENVEFLGQKIDLTPFRGIISSVQDTASSVAKTISSQPPLKFSISNRNAESWLL  298

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISRG+AGS+FVLIKE SPLL P
Sbjct  299  TTYLDDDLRISRGDAGSVFVLIKEGSPLLTP  329


 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEALTL NGKW+LAYTSF GLFPLLSRGTLPL
Sbjct  147  TEALTLLNGKWILAYTSFAGLFPLLSRGTLPL  178



>ref|XP_009795634.1| PREDICTED: light-induced protein, chloroplastic [Nicotiana sylvestris]
Length=321

 Score =   263 bits (671),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            VR+EEI QTIDSE+F VQN VVF+GPLATTSI+TNAKFEVRSPKRVQIKF+EGIIGTPQL
Sbjct  171  VRIEEISQTIDSETFAVQNCVVFAGPLATTSITTNAKFEVRSPKRVQIKFDEGIIGTPQL  230

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI LPENVEFLGQKIDL+PFKGLI S+QDTASSV KSISSQPP+KF ++NSNA+SWLL
Sbjct  231  TDSIELPENVEFLGQKIDLSPFKGLINSVQDTASSVAKSISSQPPIKFPISNSNAQSWLL  290

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ELRISRG+ GS+FVLIKE SPLLKP
Sbjct  291  TTYLDDELRISRGDGGSVFVLIKEGSPLLKP  321


 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEAL L NGKW+LAYTSF GLFPLLSRGTLPL
Sbjct  139  TEALPLLNGKWILAYTSFSGLFPLLSRGTLPL  170



>emb|CAA50750.1| fibrillin [Capsicum annuum]
 emb|CAA65784.1| plastoglobules associated protein [Capsicum annuum]
 emb|CAA66160.1| plastoglobules associated protein [Capsicum annuum]
 emb|CAA10373.1| plastid-lipid-associated protein [Capsicum annuum]
 gb|AIX02794.1| fibrillin 1 protein [Capsicum annuum]
Length=322

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -2

Query  703  LWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTP  524
            L VRVEEI QTID+E+ TVQNSVVF+GPL+TTSISTNAKFEVRSPKR+QI FEEGIIGTP
Sbjct  170  LPVRVEEISQTIDAETLTVQNSVVFAGPLSTTSISTNAKFEVRSPKRLQINFEEGIIGTP  229

Query  523  QLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESW  344
            QLTDSI LPENVEFLGQKIDL+PFKGLITS+QDTA+SV KSISSQPP+KF ++NS A+SW
Sbjct  230  QLTDSIELPENVEFLGQKIDLSPFKGLITSVQDTATSVAKSISSQPPIKFPISNSYAQSW  289

Query  343  LLTTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            LLTTYLD+ELRISRG+AGSIFVLIKE SPLLKP
Sbjct  290  LLTTYLDAELRISRGDAGSIFVLIKEGSPLLKP  322


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTL  705
            TEAL+L NGKW+LAYTSF GLFPLL+RG L
Sbjct  140  TEALSLLNGKWILAYTSFSGLFPLLARGNL  169



>ref|XP_006383843.1| chromoplast-specific carotenoid-associated protein CHRC [Populus 
trichocarpa]
 gb|ERP61640.1| chromoplast-specific carotenoid-associated protein CHRC [Populus 
trichocarpa]
Length=329

 Score =   261 bits (668),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE+ TVQNSV FSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTP+L
Sbjct  179  VKVEEISQTIDSENLTVQNSVQFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPKL  238

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI LPENVEFLGQKIDLTPF+G+I+S+QDTASSV K+ISSQPPLKFS+ N NAESWLL
Sbjct  239  TDSIELPENVEFLGQKIDLTPFRGIISSVQDTASSVAKTISSQPPLKFSIPNRNAESWLL  298

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISRG+AGSIFVLIKE SPLL P
Sbjct  299  TTYLDDDLRISRGDAGSIFVLIKEGSPLLTP  329


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEALTL NGKW+LAYTSF GLFPLLSRGTLPL
Sbjct  147  TEALTLLNGKWILAYTSFAGLFPLLSRGTLPL  178



>gb|AIX02791.1| fibrillin 1 protein [Capsicum annuum]
Length=322

 Score =   261 bits (666),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -2

Query  703  LWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTP  524
            L VRVEEI QTID+E+ TVQNS VF+GPL+TTSISTNAKFEVRSPKR+QI FEEGIIGTP
Sbjct  170  LPVRVEEISQTIDAETLTVQNSAVFAGPLSTTSISTNAKFEVRSPKRLQINFEEGIIGTP  229

Query  523  QLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESW  344
            QLTDSI LPENVEFLGQKIDL+PFKGLITS+QDTA+SV KSISSQPP+KF ++NS A+SW
Sbjct  230  QLTDSIELPENVEFLGQKIDLSPFKGLITSVQDTATSVAKSISSQPPIKFPISNSYAQSW  289

Query  343  LLTTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            LLTTYLD+ELRISRG+AGSIFVLIKE SPLLKP
Sbjct  290  LLTTYLDAELRISRGDAGSIFVLIKEGSPLLKP  322


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTL  705
            TEAL+L NGKW+LAYTSF GLFPLL+RG L
Sbjct  140  TEALSLLNGKWILAYTSFSGLFPLLARGNL  169



>gb|AIX02792.1| fibrillin 1 protein [Capsicum annuum]
 gb|AIX02793.1| fibrillin 1 protein [Capsicum annuum]
Length=322

 Score =   261 bits (666),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -2

Query  703  LWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTP  524
            L VRVEEI QTID+E+ TVQNSVVF+GPL+TTSISTNAKFEVRSPKR+QI FEEGIIG P
Sbjct  170  LPVRVEEISQTIDAETLTVQNSVVFAGPLSTTSISTNAKFEVRSPKRLQINFEEGIIGAP  229

Query  523  QLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESW  344
            QLTDSI LPENVEFLGQKIDL+PFKGLITS+QDTA+SV KSISSQPP+KF ++NS A+SW
Sbjct  230  QLTDSIELPENVEFLGQKIDLSPFKGLITSVQDTATSVAKSISSQPPIKFPISNSYAQSW  289

Query  343  LLTTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            LLTTYLD+ELRISRG+AGSIFVLIKE SPLLKP
Sbjct  290  LLTTYLDAELRISRGDAGSIFVLIKEGSPLLKP  322


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTL  705
            TEAL+L NGKW+LAYTSF GLFPLL+RG L
Sbjct  140  TEALSLLNGKWILAYTSFSGLFPLLARGNL  169



>ref|XP_002524410.1| Plastid-lipid-associated protein, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF38021.1| Plastid-lipid-associated protein, chloroplast precursor, putative 
[Ricinus communis]
Length=321

 Score =   260 bits (665),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE+FTVQNSV FSGPLATTSISTNAKFEVRSPKRVQIKF+EGIIGTPQL
Sbjct  168  VKVEEISQTIDSENFTVQNSVQFSGPLATTSISTNAKFEVRSPKRVQIKFDEGIIGTPQL  227

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSIVLPENVEFLGQKIDLTPFKG+ITS+QDTASSV K+ISSQPPLK  ++N+NA+SWLL
Sbjct  228  TDSIVLPENVEFLGQKIDLTPFKGIITSVQDTASSVAKTISSQPPLKIPISNNNAQSWLL  287

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP*TN  236
            TTYLD +LRISR +AGSIFVLIKE SPLL   TN
Sbjct  288  TTYLDEDLRISRADAGSIFVLIKEGSPLLTSLTN  321


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEALTL NGKW+LAYTSF GLFPLLSRGTLPL
Sbjct  136  TEALTLLNGKWILAYTSFSGLFPLLSRGTLPL  167



>ref|XP_010057882.1| PREDICTED: plastid-lipid-associated protein, chloroplastic [Eucalyptus 
grandis]
 gb|KCW75228.1| hypothetical protein EUGRSUZ_E03981 [Eucalyptus grandis]
Length=336

 Score =   260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE+FTVQNSV+FSGPLATTS STNAKFEVRSPKRVQIKFEEGIIGTPQL
Sbjct  186  VKVEEISQTIDSENFTVQNSVLFSGPLATTSFSTNAKFEVRSPKRVQIKFEEGIIGTPQL  245

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSIVLPENVEFLGQ+IDL PFKGLI S+QDTA SV K+ISSQPP+KFSL+N+NA+SWLL
Sbjct  246  TDSIVLPENVEFLGQRIDLAPFKGLINSVQDTAYSVAKTISSQPPIKFSLSNNNAQSWLL  305

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD ELRISRG+AGSIFVLIKE S LL
Sbjct  306  TTYLDEELRISRGDAGSIFVLIKEGSSLL  334


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEALTL NGKW+LAYTSF  LFPLL+RGTLPL
Sbjct  154  TEALTLLNGKWILAYTSFAQLFPLLARGTLPL  185



>ref|XP_009788638.1| PREDICTED: light-induced protein, chloroplastic-like [Nicotiana 
sylvestris]
Length=321

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            VRVEEI QTIDS +F VQN VVF+GPLATTSI+TNAKFEV+SPKRVQIKF+EGIIGTPQL
Sbjct  171  VRVEEISQTIDSGTFAVQNCVVFAGPLATTSITTNAKFEVKSPKRVQIKFDEGIIGTPQL  230

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI LPENVEFLGQKIDL+PFKGLI S+QDTASSV KSISSQPP+KF ++NSNA+SWLL
Sbjct  231  TDSIELPENVEFLGQKIDLSPFKGLINSVQDTASSVAKSISSQPPIKFPISNSNAQSWLL  290

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ELRISRG+ GS+FVLIKE SPLLKP
Sbjct  291  TTYLDDELRISRGDGGSVFVLIKEGSPLLKP  321


 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEAL L NGKW+LAYTSF GLFPLLSRGTLPL
Sbjct  139  TEALPLLNGKWILAYTSFSGLFPLLSRGTLPL  170



>ref|XP_006449818.1| hypothetical protein CICLE_v10015934mg [Citrus clementina]
 sp|Q9ZWQ8.1|PAP_CITUN RecName: Full=Plastid-lipid-associated protein, chloroplastic; 
AltName: Full=CitPAP; Flags: Precursor [Citrus unshiu]
 dbj|BAA34702.1| homolog to plastid-lipid-associated protein [Citrus unshiu]
 gb|ESR63058.1| hypothetical protein CICLE_v10015934mg [Citrus clementina]
Length=323

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
             RVEEI QTIDSE+FTVQNS+ F+GPLATTSISTNAKFEVRSPKRVQIKFEEG+IGTPQ+
Sbjct  173  ARVEEISQTIDSENFTVQNSIQFAGPLATTSISTNAKFEVRSPKRVQIKFEEGVIGTPQV  232

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDS+VLPENVEFLGQKIDL+PFKG+++S+QDTASSV K+ISSQPPLKFS++NSNA+SWLL
Sbjct  233  TDSLVLPENVEFLGQKIDLSPFKGILSSVQDTASSVAKTISSQPPLKFSISNSNAQSWLL  292

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISR +AGS+FV IKE SPLL P
Sbjct  293  TTYLDEDLRISRADAGSVFVFIKEGSPLLMP  323


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPLGQ  693
            TEALTL N KW+L YTSF GLFPLLSRGTLPL +
Sbjct  141  TEALTLLNAKWILVYTSFSGLFPLLSRGTLPLAR  174



>gb|KDO78378.1| hypothetical protein CISIN_1g020639mg [Citrus sinensis]
Length=323

 Score =   259 bits (661),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
             RVEEI QTIDSE+FTVQNS+ F+GPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ+
Sbjct  173  ARVEEISQTIDSENFTVQNSIRFAGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQV  232

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDS+V+PENVEFLGQKIDL+PFKG+++S+QDTASSV K+ISSQPPLKFS++NSNA+SWLL
Sbjct  233  TDSLVIPENVEFLGQKIDLSPFKGILSSVQDTASSVAKTISSQPPLKFSISNSNAQSWLL  292

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISR +AGS+FV IKE SPLL P
Sbjct  293  TTYLDEDLRISRADAGSVFVFIKEGSPLLMP  323


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPLGQ  693
            TEALTL N KW+L YTSF GLFPLLSRGTLPL +
Sbjct  141  TEALTLLNAKWILVYTSFSGLFPLLSRGTLPLAR  174



>gb|ABK96652.1| unknown [Populus trichocarpa x Populus deltoides]
Length=329

 Score =   259 bits (661),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE+ TVQNSV FSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTP+L
Sbjct  179  VKVEEISQTIDSENLTVQNSVQFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPKL  238

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI LPE VEFLGQKIDLTPF+G+I+S+QDTASSV K+ISSQPPLKFS+ N NAESWLL
Sbjct  239  TDSIELPEKVEFLGQKIDLTPFRGIISSVQDTASSVAKTISSQPPLKFSIPNRNAESWLL  298

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISRG+AGSIFVLIKE SPLL P
Sbjct  299  TTYLDDDLRISRGDAGSIFVLIKEGSPLLTP  329


 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEALTL NGKW+LAYTSF GLFPLLSRGTLPL
Sbjct  147  TEALTLLNGKWILAYTSFAGLFPLLSRGTLPL  178



>gb|EYU33869.1| hypothetical protein MIMGU_mgv1a010099mg [Erythranthe guttata]
Length=322

 Score =   258 bits (660),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = -2

Query  718  QGAHSLWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEG  539
            +GA    V++EEI QTID+++FTVQNSV+FSGPLATT+I+TNAKFEVRSPKRVQIKFE G
Sbjct  165  RGATFPLVKLEEISQTIDADNFTVQNSVLFSGPLATTAITTNAKFEVRSPKRVQIKFEGG  224

Query  538  IIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANS  359
            +IGTPQLTDSIVLPENVEFLGQ IDL+PFKGL  S+QDTASSV K+ISSQPPLKFS++N 
Sbjct  225  VIGTPQLTDSIVLPENVEFLGQNIDLSPFKGLFASVQDTASSVAKTISSQPPLKFSISNK  284

Query  358  NAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            NAESWLLTTYLD ELRISRG+ GSIFVLIKE SPLL
Sbjct  285  NAESWLLTTYLDDELRISRGDGGSIFVLIKEGSPLL  320


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 1/33 (3%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRG-TLPL  699
            TEAL L NGKW+LAYT+F GLFPLLSRG T PL
Sbjct  139  TEALPLLNGKWILAYTTFAGLFPLLSRGATFPL  171



>ref|XP_010099142.1| Plastid-lipid-associated protein [Morus notabilis]
 gb|EXB77014.1| Plastid-lipid-associated protein [Morus notabilis]
Length=324

 Score =   258 bits (659),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE+FTVQNSV F+GPLATTSI+TNAKFEVRSPKRVQIKFE GIIGTPQL
Sbjct  174  VKVEEISQTIDSENFTVQNSVQFAGPLATTSITTNAKFEVRSPKRVQIKFEAGIIGTPQL  233

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSIV+PENVEFLGQKIDLTPFKGLITS+QDTASSVVK+ISSQPPLK  ++N+NA+SWLL
Sbjct  234  TDSIVVPENVEFLGQKIDLTPFKGLITSVQDTASSVVKTISSQPPLKIPISNNNAQSWLL  293

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ELRISRG+ GS+FVLIKE S LL P
Sbjct  294  TTYLDGELRISRGDGGSVFVLIKEGSSLLTP  324


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEAL+L NGKW+LAYTSF GL  LLSRGTLPL
Sbjct  142  TEALSLLNGKWILAYTSFPGLLTLLSRGTLPL  173



>ref|XP_007026203.1| Plastid-lipid associated protein PAP / fibrillin family protein 
[Theobroma cacao]
 gb|EOY28825.1| Plastid-lipid associated protein PAP / fibrillin family protein 
[Theobroma cacao]
Length=427

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTID+ESFTVQNSV FSGPLA+ +ISTNAKFEVRSPKRVQIKF+EGIIGTPQL
Sbjct  277  VKVEEISQTIDAESFTVQNSVQFSGPLASNTISTNAKFEVRSPKRVQIKFQEGIIGTPQL  336

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSIVLPENVEFLGQ+ DLTP KGL+TS+QDTASSV K+ISSQPPLKFSL+NSNAESWLL
Sbjct  337  TDSIVLPENVEFLGQRFDLTPVKGLLTSVQDTASSVAKTISSQPPLKFSLSNSNAESWLL  396

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ELRISRG+AGS+FVLIKE S LL P
Sbjct  397  TTYLDEELRISRGDAGSVFVLIKEGSALLTP  427



>ref|XP_006467367.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Citrus sinensis]
Length=392

 Score =   258 bits (660),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  694  RVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLT  515
            RVEEI QTIDSE+FTVQNS+ F+GPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ+T
Sbjct  243  RVEEISQTIDSENFTVQNSIRFAGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQVT  302

Query  514  DSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLT  335
            DS+V+PENVEFLGQKIDL+PFKG+++S+QDTASSV K+ISSQPPLKFS++NSNA+SWLLT
Sbjct  303  DSLVIPENVEFLGQKIDLSPFKGILSSVQDTASSVAKTISSQPPLKFSISNSNAQSWLLT  362

Query  334  TYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TYLD +LRISR +AGS+FV IKE SPLL P
Sbjct  363  TYLDEDLRISRADAGSVFVFIKEGSPLLMP  392


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPLGQ  693
            TEALTL N KW+L YTSF GLFPLLSRGTLPL +
Sbjct  210  TEALTLLNAKWILVYTSFSGLFPLLSRGTLPLAR  243



>ref|XP_008349368.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Malus domestica]
Length=205

 Score =   249 bits (635),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE+FTVQNSV F+GPLATTSISTNA FEVRSPKRVQIKFEEG+IGTPQL
Sbjct  55   VKVEEISQTIDSENFTVQNSVQFAGPLATTSISTNATFEVRSPKRVQIKFEEGVIGTPQL  114

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDS+V+PENV+FLGQKI+L PFKGL+ S+QDTASSVVK+ISSQPP KFS+ +SNA+SWLL
Sbjct  115  TDSLVIPENVDFLGQKIELAPFKGLLNSVQDTASSVVKTISSQPPFKFSIPSSNAQSWLL  174

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD ELRISRG+ GS+FVLIK  SPLL
Sbjct  175  TTYLDGELRISRGDNGSVFVLIKAGSPLL  203


 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEAL L NGKW+LAYTSF GLFPLLSRGTLPL
Sbjct  23   TEALPLLNGKWILAYTSFAGLFPLLSRGTLPL  54



>emb|CDP04455.1| unnamed protein product [Coffea canephora]
Length=320

 Score =   253 bits (645),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE+F+V+N V F+GPLATTSI+TNAKFEVRSPKRVQIKFEEG+IGTPQL
Sbjct  170  VKVEEISQTIDSEAFSVENVVQFAGPLATTSITTNAKFEVRSPKRVQIKFEEGVIGTPQL  229

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI LPE+VE LGQKIDL P KGL+TS+QDTASSV KSISS+PPLKFSL+N NAESWLL
Sbjct  230  TDSIELPESVELLGQKIDLNPVKGLLTSVQDTASSVAKSISSRPPLKFSLSNRNAESWLL  289

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ELRISRG+ GSIFVLIKE  PLLKP
Sbjct  290  TTYLDDELRISRGDGGSIFVLIKEGCPLLKP  320


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEALTL NGKW+LAYTSFIGLFPLLSRGTLPL
Sbjct  138  TEALTLLNGKWILAYTSFIGLFPLLSRGTLPL  169



>gb|ABA43902.1| fibrillin [Coffea canephora]
Length=320

 Score =   253 bits (645),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE+F+V+N V F+GPLATTSI+TNAKFEVRSPKRVQIKFEEG+IGTPQL
Sbjct  170  VKVEEISQTIDSEAFSVENVVQFAGPLATTSITTNAKFEVRSPKRVQIKFEEGVIGTPQL  229

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI LPE+VE LGQKIDL P KGL+TS+QDTASSV KSISS+PPLKFSL+N NAESWLL
Sbjct  230  TDSIELPESVELLGQKIDLNPVKGLLTSVQDTASSVAKSISSRPPLKFSLSNRNAESWLL  289

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ELRISRG+ GSIFVLIKE  PLLKP
Sbjct  290  TTYLDDELRISRGDGGSIFVLIKEGCPLLKP  320


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEALTL NGKW+LAYTSFIGLFPLLSRGTLPL
Sbjct  138  TEALTLLNGKWILAYTSFIGLFPLLSRGTLPL  169



>ref|XP_009357505.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Pyrus x bretschneideri]
Length=315

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 141/151 (93%), Gaps = 1/151 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDS++FTVQNSV F+GPLATTSISTNAKFEVRSPKRVQIKFEEG+IGTPQL
Sbjct  166  VKVEEISQTIDSDNFTVQNSVQFAGPLATTSISTNAKFEVRSPKRVQIKFEEGVIGTPQL  225

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDS+V+PENVEFLGQKI+L PFKGL+ S+QDTASSVVK+ISS+PP KFS++ SNA+SWLL
Sbjct  226  TDSLVIPENVEFLGQKIELAPFKGLLNSVQDTASSVVKTISSRPPFKFSIS-SNAQSWLL  284

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ELRISRG+ GS+FVLIKE SPLL P
Sbjct  285  TTYLDGELRISRGDNGSVFVLIKEGSPLLTP  315


 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEAL L NGKW+LAYTSF GLFPLLSRGTLPL
Sbjct  134  TEALPLLNGKWILAYTSFAGLFPLLSRGTLPL  165



>gb|AIX87511.1| fibrillin [Lycium barbarum]
Length=321

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            +RVEEI QTIDSE+F VQNSVVF+GPL TT ISTNAKFEVRSPKRVQIKF+EGII TPQL
Sbjct  171  LRVEEISQTIDSENFAVQNSVVFAGPLTTTEISTNAKFEVRSPKRVQIKFDEGIIRTPQL  230

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI  PENVEFLGQKIDL+PFKGLITS+QDTASSV KSIS+QPP+KF ++  +A+SWLL
Sbjct  231  TDSIEFPENVEFLGQKIDLSPFKGLITSVQDTASSVAKSISNQPPIKFPISTDSAQSWLL  290

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ELRISRG+AGS+FVLIKE SPLLKP
Sbjct  291  TTYLDDELRISRGDAGSVFVLIKEGSPLLKP  321


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEALTL NG+W+LAYTSF GLFPLLSRG LPL
Sbjct  139  TEALTLLNGRWILAYTSFSGLFPLLSRGNLPL  170



>gb|KJB57828.1| hypothetical protein B456_009G182500 [Gossypium raimondii]
Length=326

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTID+ES TVQNSV F+GPLA++SIST+AKFEVRSPKRVQIKF+EGIIGTPQL
Sbjct  177  VKVEEISQTIDAESLTVQNSVQFAGPLASSSISTSAKFEVRSPKRVQIKFQEGIIGTPQL  236

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSIVLPENVEFLGQKIDLTP KGL+TS+QDTASSV K+ISSQPPLK  L+NSNAESWLL
Sbjct  237  TDSIVLPENVEFLGQKIDLTPIKGLLTSVQDTASSVAKTISSQPPLKIPLSNSNAESWLL  296

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD ELRISRG+AGS+FVL+KE S LL
Sbjct  297  TTYLDDELRISRGDAGSVFVLVKEGSALL  325


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEAL L NGKW+L YTSF GLFPLLSRG  PL
Sbjct  145  TEALPLLNGKWILKYTSFPGLFPLLSRGQFPL  176



>gb|KHG02015.1| Plastid-lipid-associated, chloroplastic [Gossypium arboreum]
Length=326

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTID+ES TVQNSV F+GPLA++SIST+AKFEVRSPKRVQIKF+EGIIGTPQL
Sbjct  177  VKVEEISQTIDAESLTVQNSVQFAGPLASSSISTSAKFEVRSPKRVQIKFQEGIIGTPQL  236

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSIVLPENVEFLGQKIDLTP KGL+TS+QDTASSV K+ISSQPPLK  L+NSNAESWLL
Sbjct  237  TDSIVLPENVEFLGQKIDLTPIKGLLTSVQDTASSVAKTISSQPPLKIPLSNSNAESWLL  296

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD ELRISRG+AGS+FVL+KE S LL
Sbjct  297  TTYLDDELRISRGDAGSVFVLVKEGSALL  325


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEAL L NGKW+L YTSF GLFPLLSRG  PL
Sbjct  145  TEALPLLNGKWILKYTSFPGLFPLLSRGQFPL  176



>gb|AIX87535.1| fibrillin [Lycium ruthenicum]
Length=321

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            +RVEEI QTIDSE+F VQNSVVF+GPL TT ISTNAK EVRSPKRVQIKF+EGII TPQL
Sbjct  171  LRVEEISQTIDSENFAVQNSVVFAGPLTTTEISTNAKLEVRSPKRVQIKFDEGIIRTPQL  230

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI LPENVEFLGQKIDL+PFKGLITS+QDTASSV KSIS+QPP+KF ++  +A+SWLL
Sbjct  231  TDSIELPENVEFLGQKIDLSPFKGLITSVQDTASSVAKSISNQPPIKFPISTDSAQSWLL  290

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ELRISRG+AGS+FVLIKE SPLLKP
Sbjct  291  TTYLDDELRISRGDAGSVFVLIKEGSPLLKP  321


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEALTL NG+W+LAYTSF GLFPLLSRG LPL
Sbjct  139  TEALTLLNGRWILAYTSFSGLFPLLSRGNLPL  170



>ref|XP_008384113.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Malus domestica]
 ref|XP_008358758.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Malus domestica]
Length=320

 Score =   250 bits (639),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE+FTVQNSV F+GPLATTSISTNA FEVRSPKRVQIKFEEG+IGTPQL
Sbjct  170  VKVEEISQTIDSENFTVQNSVQFAGPLATTSISTNATFEVRSPKRVQIKFEEGVIGTPQL  229

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDS+V+PENV+FLGQKI+L PFKGL+ S+QDTASSVVK+ISSQPP KFS+ +SNA+SWLL
Sbjct  230  TDSLVIPENVDFLGQKIELAPFKGLLNSVQDTASSVVKTISSQPPFKFSIPSSNAQSWLL  289

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD ELRISRG+ GS+FVLIK  SPLL
Sbjct  290  TTYLDGELRISRGDNGSVFVLIKAGSPLL  318


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEAL L NGKW+LAYTSF GLFPLLSRGTLPL
Sbjct  138  TEALPLLNGKWILAYTSFAGLFPLLSRGTLPL  169



>ref|XP_007147677.1| hypothetical protein PHAVU_006G145100g [Phaseolus vulgaris]
 gb|ESW19671.1| hypothetical protein PHAVU_006G145100g [Phaseolus vulgaris]
Length=310

 Score =   248 bits (633),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE+FTVQNSV F+GPLA+TSI TNAKF+VRSPKRVQIKFEEGIIGTPQL
Sbjct  160  VKVEEISQTIDSENFTVQNSVQFAGPLASTSIITNAKFDVRSPKRVQIKFEEGIIGTPQL  219

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDS+ +PENVEFLGQKIDLTPFKG+ TS+QDTASSVVK+ISS+PPLK  ++NSNA+SWLL
Sbjct  220  TDSLEIPENVEFLGQKIDLTPFKGIFTSIQDTASSVVKTISSRPPLKIPISNSNAQSWLL  279

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD ELRISRG+ GS+FVLIKE S LL
Sbjct  280  TTYLDQELRISRGDGGSVFVLIKEGSSLL  308


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            T+ALTL NGKW+LAYTSF GLFPLLS GTLPL
Sbjct  128  TDALTLLNGKWILAYTSFAGLFPLLSSGTLPL  159



>ref|XP_004293330.1| PREDICTED: plastid-lipid-associated protein, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=322

 Score =   248 bits (634),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V EI QTIDS++FTV+NSV FSGPLATTS STNA F+VRSPKRVQ+KFEEG+IGTPQL
Sbjct  172  VKVAEISQTIDSDNFTVENSVRFSGPLATTSFSTNATFDVRSPKRVQLKFEEGVIGTPQL  231

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDS+V+PE+VEFLGQKIDL PFKGL+TS+QDTASSV KSISSQPP+KFS+++SNAESWLL
Sbjct  232  TDSLVIPEDVEFLGQKIDLAPFKGLLTSVQDTASSVAKSISSQPPIKFSISSSNAESWLL  291

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ELRISRG+ GS+FVLIKE S LL P
Sbjct  292  TTYLDQELRISRGDNGSVFVLIKEGSSLLTP  322


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            T+AL L NGKW+LAYTSF GLFP+LSRGTLPL
Sbjct  140  TDALPLLNGKWILAYTSFAGLFPILSRGTLPL  171



>ref|XP_008224724.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Prunus mume]
Length=324

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEE+ QTIDS++FTVQNSV F+GPLATTSI+TNA FEVRSPKRVQIKFEEG+IGTPQL
Sbjct  174  VKVEEVSQTIDSQNFTVQNSVQFAGPLATTSITTNATFEVRSPKRVQIKFEEGVIGTPQL  233

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDS+V+PENVEFLGQK+DLT FK L+TS+QDTASSV K+ISSQPP KFS++NS AESWLL
Sbjct  234  TDSLVIPENVEFLGQKLDLTVFKSLLTSVQDTASSVAKTISSQPPFKFSISNSKAESWLL  293

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ELRISRG+ GS+FVLIKE S LL P
Sbjct  294  TTYLDPELRISRGDNGSVFVLIKEGSSLLTP  324


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGT  708
            TEAL L NGKW+LAYTSF GLFPLLSRGT
Sbjct  143  TEALPLLNGKWILAYTSFAGLFPLLSRGT  171



>ref|XP_003534708.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Glycine max]
Length=312

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTID+ +FTVQNSV F+GPLATTSISTNAKF+VRSPKRVQIKFEEGIIGTPQL
Sbjct  162  VKVEEISQTIDTLNFTVQNSVQFAGPLATTSISTNAKFDVRSPKRVQIKFEEGIIGTPQL  221

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDS+ +PENVE LGQKIDLTPFKG++TS+QDTASSVVK+ISS+PPLK  ++NSNA+SWLL
Sbjct  222  TDSLEIPENVELLGQKIDLTPFKGILTSVQDTASSVVKTISSRPPLKIPISNSNAQSWLL  281

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD ELRISRG+ GS+FVLIKE S LL
Sbjct  282  TTYLDEELRISRGDGGSVFVLIKEGSSLL  310


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            T+ALTL NGKW+LAYTSF GLFPLLS GTLPL
Sbjct  130  TDALTLLNGKWILAYTSFAGLFPLLSSGTLPL  161



>gb|KHN40849.1| Plastid-lipid-associated protein, chloroplastic [Glycine soja]
Length=314

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTID+ +FTVQNSV F+GPLATTSISTNAKF+VRSPKRVQIKFEEGIIGTPQL
Sbjct  164  VKVEEISQTIDTLNFTVQNSVQFAGPLATTSISTNAKFDVRSPKRVQIKFEEGIIGTPQL  223

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDS+ +PENVE LGQKIDLTPFKG++TS+QDTASSVVK+ISS+PPLK  ++NSNA+SWLL
Sbjct  224  TDSLEIPENVELLGQKIDLTPFKGILTSVQDTASSVVKTISSRPPLKIPISNSNAQSWLL  283

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD ELRISRG+ GS+FVLIKE S LL
Sbjct  284  TTYLDEELRISRGDGGSVFVLIKEGSSLL  312


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            T+ALTL NGKW+LAYTSF GLFPLLS GTLPL
Sbjct  132  TDALTLLNGKWILAYTSFAGLFPLLSSGTLPL  163



>emb|CDX82925.1| BnaC01g13750D [Brassica napus]
Length=317

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDSE+FTV+NSV+F+GPLATTSISTNAKFE+RSPKRVQIKFEEG+IGTPQL
Sbjct  167  VKVDEISQTIDSENFTVENSVLFAGPLATTSISTNAKFEIRSPKRVQIKFEEGVIGTPQL  226

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE VEFLGQKIDLTP +GL+TS+QDTA+SV ++ISSQPPLKFSL   NA+SWLL
Sbjct  227  TDSIEIPEYVEFLGQKIDLTPIRGLLTSVQDTATSVARTISSQPPLKFSLPGDNAQSWLL  286

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
            TTYLD ++RISRG+ GS+FVLIKE SPLL 
Sbjct  287  TTYLDKDIRISRGDGGSVFVLIKEGSPLLN  316


 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            T+AL L NGKW+LAYTSF+GLFPLLSRG +PL
Sbjct  135  TDALFLLNGKWILAYTSFVGLFPLLSRGIVPL  166



>ref|XP_004486195.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Cicer arietinum]
 ref|XP_004517240.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Cicer arietinum]
Length=320

 Score =   246 bits (627),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 141/156 (90%), Gaps = 3/156 (2%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE+FTVQNSV F+GPL TTSISTNAKFEVRSPKRVQIKF+EGIIGTPQL
Sbjct  167  VKVEEISQTIDSEAFTVQNSVRFAGPLTTTSISTNAKFEVRSPKRVQIKFDEGIIGTPQL  226

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDS+ +PENVEFLGQ+IDLTPFKG++TS+Q+TASSVV++IS+QPPLKF ++N+ A+SWLL
Sbjct  227  TDSLEIPENVEFLGQRIDLTPFKGILTSVQNTASSVVRTISNQPPLKFPISNNKAQSWLL  286

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP*TNSR  230
            TTYLD ELRISRG+ G +FVLIKE S LL   TN R
Sbjct  287  TTYLDEELRISRGDGGGVFVLIKEGSSLL---TNQR  319


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            T+ALTL NGKW+L YTSF GLFPLLS GTLPL
Sbjct  135  TDALTLLNGKWILVYTSFAGLFPLLSSGTLPL  166



>ref|XP_009392110.1| PREDICTED: chromoplast-specific carotenoid-associated protein 
C1, chromoplast-like [Musa acuminata subsp. malaccensis]
Length=320

 Score =   245 bits (626),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 140/164 (85%), Gaps = 5/164 (3%)
 Frame = -2

Query  742  LLGCSHCYQGAHSLWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKR  563
            LLG     Q      V+V+EICQTIDSESFTVQNSV F+GPLATTS++TNAKFEVRSPKR
Sbjct  161  LLGSGRLPQ-----LVKVDEICQTIDSESFTVQNSVKFAGPLATTSVTTNAKFEVRSPKR  215

Query  562  VQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPP  383
            VQIKFEEGIIGTPQLTD IV+P+ VEFLGQ +DL+PFKG+I+S+Q+ ASSVV++IS QPP
Sbjct  216  VQIKFEEGIIGTPQLTDDIVVPDKVEFLGQNVDLSPFKGVISSIQNAASSVVRTISGQPP  275

Query  382  LKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            LK  + N+NA+SWLLTTYLD ELRISR + GS+FVLIKE SPLL
Sbjct  276  LKIPINNTNAQSWLLTTYLDEELRISRSDGGSVFVLIKEGSPLL  319



>sp|Q94KU6.1|PAP2_BRACM RecName: Full=Plastid lipid-associated protein 2, chloroplastic; 
Flags: Precursor [Brassica rapa]
 gb|AAK57565.1|AF290567_1 plastid-lipid associated protein PAP2 [Brassica rapa subsp. oleifera]
Length=319

 Score =   245 bits (625),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDS++FTV+NSV+F+GPLATTSISTNAKFE+RSPKRVQIKFEEG+IGTPQL
Sbjct  169  VKVDEISQTIDSDNFTVENSVLFAGPLATTSISTNAKFEIRSPKRVQIKFEEGVIGTPQL  228

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE VEFLGQKIDLTP +GL+TS+QDTA+SV ++ISSQPPLKFSL   +A+SWLL
Sbjct  229  TDSIEIPEYVEFLGQKIDLTPIRGLLTSVQDTATSVARTISSQPPLKFSLPGDSAQSWLL  288

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ++RISRG+ GS+FVLIKE SPLL P
Sbjct  289  TTYLDKDIRISRGDGGSVFVLIKEGSPLLNP  319


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            T+AL L NGKW+LAYTSF+GLFPLLSRG +PL
Sbjct  137  TDALFLLNGKWILAYTSFVGLFPLLSRGIVPL  168



>gb|AAK57562.1| plastid-lipid associated protein PAP2 [Brassica rapa subsp. oleifera]
Length=319

 Score =   245 bits (625),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDS++FTV+NSV+F+GPLATTSISTNAKFE+RSPKRVQIKFEEG+IGTPQL
Sbjct  169  VKVDEISQTIDSDNFTVENSVLFAGPLATTSISTNAKFEIRSPKRVQIKFEEGVIGTPQL  228

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE VEFLGQKIDLTP +GL+TS+QDTA+SV ++ISSQPPLKFSL   +A+SWLL
Sbjct  229  TDSIEIPEYVEFLGQKIDLTPIRGLLTSVQDTATSVARTISSQPPLKFSLPGDSAQSWLL  288

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ++RISRG+ GS+FVLIKE SPLL P
Sbjct  289  TTYLDKDIRISRGDGGSVFVLIKEGSPLLNP  319


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            T+AL L NGKW+LAYTSF+GLFPLLSRG +PL
Sbjct  137  TDALFLLNGKWILAYTSFVGLFPLLSRGIVPL  168



>emb|CDX79139.1| BnaA01g12060D [Brassica napus]
Length=319

 Score =   245 bits (625),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDS++FTV+NSV+F+GPLATTSISTNAKFE+RSPKRVQIKFEEG+IGTPQL
Sbjct  169  VKVDEISQTIDSDNFTVENSVLFAGPLATTSISTNAKFEIRSPKRVQIKFEEGVIGTPQL  228

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE VEFLGQKIDLTP +GL+TS+QDTA+SV ++ISSQPPLKFSL   +A+SWLL
Sbjct  229  TDSIEIPEYVEFLGQKIDLTPIRGLLTSVQDTATSVARTISSQPPLKFSLPGDSAQSWLL  288

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ++RISRG+ GS+FVLIKE SPLL P
Sbjct  289  TTYLDKDIRISRGDGGSVFVLIKEGSPLLNP  319


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            T+AL L NGKW+LAYTSF+GLFPLLSRG +PL
Sbjct  137  TDALFLLNGKWILAYTSFVGLFPLLSRGIVPL  168



>ref|XP_009135738.1| PREDICTED: plastid lipid-associated protein 2, chloroplastic 
[Brassica rapa]
Length=319

 Score =   245 bits (625),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDS++FTV+NSV+F+GPLATTSISTNAKFE+RSPKRVQIKFEEG+IGTPQL
Sbjct  169  VKVDEISQTIDSDNFTVENSVLFAGPLATTSISTNAKFEIRSPKRVQIKFEEGVIGTPQL  228

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE VEFLGQKIDLTP +GL+TS+QDTA+SV ++ISSQPPLKFSL   +A+SWLL
Sbjct  229  TDSIEIPEYVEFLGQKIDLTPIRGLLTSVQDTATSVARTISSQPPLKFSLPGDSAQSWLL  288

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ++RISRG+ GS+FVLIKE SPLL P
Sbjct  289  TTYLDKDIRISRGDGGSVFVLIKEGSPLLNP  319


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            T+AL L NGKW+LAYTSF+GLFPLLSRG +PL
Sbjct  137  TDALFLLNGKWILAYTSFVGLFPLLSRGIVPL  168



>ref|XP_010943242.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Elaeis guineensis]
Length=351

 Score =   246 bits (628),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE+FTVQNSV F+GPLATTS++TNAKFEVRSPKRVQIKFEEGIIGTPQL
Sbjct  202  VKVEEISQTIDSENFTVQNSVQFAGPLATTSVTTNAKFEVRSPKRVQIKFEEGIIGTPQL  261

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSIV+PE VEFLGQ IDL+PFKG+ITS+QD ASSV ++IS QPPLK  + N+NA+SWLL
Sbjct  262  TDSIVVPEKVEFLGQNIDLSPFKGVITSVQDAASSVARTISGQPPLKIPINNNNAQSWLL  321

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD ELRISRG+ GSIFVLIKE S LL
Sbjct  322  TTYLDEELRISRGDGGSIFVLIKEGSSLL  350


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLP  702
            TEALTL NGKW+LAYTSF  LFPLL  G LP
Sbjct  169  TEALTLLNGKWILAYTSFSQLFPLLGSGRLP  199



>ref|XP_007211630.1| hypothetical protein PRUPE_ppa005787mg [Prunus persica]
 gb|EMJ12829.1| hypothetical protein PRUPE_ppa005787mg [Prunus persica]
Length=444

 Score =   249 bits (635),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEE+ QTIDSE+FTVQNSV F+GPLATTS STNA FEVRSPKRVQIKFEEG+IGTPQL
Sbjct  294  VKVEEVSQTIDSENFTVQNSVQFAGPLATTSFSTNATFEVRSPKRVQIKFEEGVIGTPQL  353

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDS+V+PENVEFLGQK+DLT FK L+TS+QDTASSVVK+ISSQPP KFS++NS AESWLL
Sbjct  354  TDSLVIPENVEFLGQKLDLTVFKSLLTSVQDTASSVVKTISSQPPFKFSISNSKAESWLL  413

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ELRISRG+ GS+FVLIKE S LL P
Sbjct  414  TTYLDPELRISRGDNGSVFVLIKEGSSLLSP  444


 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEAL L NGKW+LAYTSF GLFPLLSRGTLPL
Sbjct  262  TEALPLLNGKWILAYTSFAGLFPLLSRGTLPL  293



>ref|XP_006413678.1| hypothetical protein EUTSA_v10025758mg [Eutrema salsugineum]
 dbj|BAJ33603.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ55131.1| hypothetical protein EUTSA_v10025758mg [Eutrema salsugineum]
Length=317

 Score =   244 bits (623),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDSE+FTVQNSV F+GPLATTSISTNAKFE+RSPKRVQIKFE+G+IGTPQL
Sbjct  167  VKVDEISQTIDSENFTVQNSVRFAGPLATTSISTNAKFEIRSPKRVQIKFEQGVIGTPQL  226

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE VE LGQKIDL P +GL+TS+QDTASSV ++ISSQPPLKFSL   NA+SWLL
Sbjct  227  TDSIEIPEYVEVLGQKIDLNPIRGLLTSVQDTASSVARTISSQPPLKFSLPGDNAQSWLL  286

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ++RISRG+ GS+FVLIKE SPLL P
Sbjct  287  TTYLDKDIRISRGDGGSVFVLIKEGSPLLNP  317


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEAL L NGKW+LAYTSF+GLFPLLSRG +PL
Sbjct  135  TEALFLLNGKWILAYTSFVGLFPLLSRGIVPL  166



>ref|XP_010448920.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Camelina sativa]
 ref|XP_010448921.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Camelina sativa]
Length=310

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDS++FTVQNSV F+GPL T SISTNAKFE+RSPKRVQIKFE+G+IGTPQL
Sbjct  160  VKVDEISQTIDSDNFTVQNSVRFAGPLGTNSISTNAKFEIRSPKRVQIKFEQGVIGTPQL  219

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PENVE LGQKIDL P +GL+TS+QDTASSV +SISSQPPLKFSL    AESWLL
Sbjct  220  TDSIEIPENVEVLGQKIDLNPIRGLLTSVQDTASSVARSISSQPPLKFSLPGDKAESWLL  279

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ++RISRG+ GS+FVLIKE SPLL P
Sbjct  280  TTYLDKDIRISRGDGGSVFVLIKEGSPLLNP  310


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            T+AL L NGKW+LAYTSF+ LFPLLSRG LPL
Sbjct  128  TDALFLLNGKWILAYTSFVNLFPLLSRGILPL  159



>ref|XP_010434068.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Camelina sativa]
Length=319

 Score =   242 bits (618),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDS++FTVQNSV F+GPL T SISTNAKFE+RSPKRVQIKFE+G+IGTPQL
Sbjct  169  VKVDEISQTIDSDNFTVQNSVRFAGPLGTNSISTNAKFEIRSPKRVQIKFEQGVIGTPQL  228

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +P+NVE LGQKIDL P +GL+TS+QDTASSV +SISSQPPLKFSL    AESWLL
Sbjct  229  TDSIEIPDNVEVLGQKIDLNPIRGLLTSVQDTASSVARSISSQPPLKFSLPGDKAESWLL  288

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ++RISRG+ GSIFVLIKE SPLL P
Sbjct  289  TTYLDKDIRISRGDGGSIFVLIKEGSPLLNP  319


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEAL L NGKW+LAYTSF+ LFPLLSRG LPL
Sbjct  137  TEALFLLNGKWILAYTSFVNLFPLLSRGILPL  168



>ref|XP_003546169.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Glycine max]
 gb|KHN32987.1| Plastid-lipid-associated protein, chloroplastic [Glycine soja]
Length=306

 Score =   242 bits (617),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI Q IDS +FTVQNSV F+GPLATTSISTNAKF+VRSPKRVQIKFEEGIIGTPQL
Sbjct  156  VKVEEISQIIDSLNFTVQNSVQFAGPLATTSISTNAKFDVRSPKRVQIKFEEGIIGTPQL  215

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDS+ +PENVEFLGQKIDLT FKG++TS+QDTA+SVVK+ISS+PPLK  ++NSNA+SWLL
Sbjct  216  TDSLEIPENVEFLGQKIDLTLFKGILTSVQDTATSVVKTISSRPPLKIPISNSNAQSWLL  275

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD ELRISRG+ GS+FVLIKE S LL
Sbjct  276  TTYLDEELRISRGDGGSVFVLIKEGSSLL  304


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            T+ALTL NGKW+LAYTSF GLFPLLS GTLPL
Sbjct  124  TDALTLLNGKWILAYTSFAGLFPLLSSGTLPL  155



>sp|B2LU34.1|CHRC1_ONCHC RecName: Full=Chromoplast-specific carotenoid-associated protein 
C1, chromoplast; Short=OgCHRC1; AltName: Full=Fibrillin-like 
protein 1; AltName: Full=Plastid lipid-associated protein 
CHRC1; Flags: Precursor [Oncidium hybrid cultivar]
 gb|ACC59805.1| chromoplast specific carotenoid associated protein [Oncidium 
hybrid cultivar]
Length=319

 Score =   242 bits (618),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 138/157 (88%), Gaps = 2/157 (1%)
 Frame = -2

Query  715  GAHSL--WVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEE  542
            GA SL   ++V+EI QTIDSE FTVQNSV F GP ++TS++TNAKFEVRSPKRVQIKFEE
Sbjct  162  GAESLQQLLKVDEISQTIDSEGFTVQNSVRFVGPFSSTSVTTNAKFEVRSPKRVQIKFEE  221

Query  541  GIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLAN  362
            GIIGTPQLTDSIV+P+  EF GQ IDL+PFKG+I+SLQDTASSV K+ISSQPP+KF ++N
Sbjct  222  GIIGTPQLTDSIVIPDKFEFFGQNIDLSPFKGVISSLQDTASSVAKTISSQPPIKFPISN  281

Query  361  SNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            SNA+SWLLTTYLD ELRISR + GS+FVLIKE SPLL
Sbjct  282  SNAQSWLLTTYLDDELRISRADGGSVFVLIKEGSPLL  318



>ref|XP_008440050.1| PREDICTED: chromoplast-specific carotenoid-associated protein, 
chromoplast [Cucumis melo]
Length=323

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE+ TVQNSV FSGPLATTSI+TNAKFEVRSP RV IKFEEG+IGTPQL
Sbjct  173  VKVEEISQTIDSENLTVQNSVQFSGPLATTSITTNAKFEVRSPLRVHIKFEEGVIGTPQL  232

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSIV+P+NV+FLGQKIDL+PF G+I+S+QDTAS+V K+ISSQPPLKFS++N+  ESWLL
Sbjct  233  TDSIVIPDNVDFLGQKIDLSPFNGIISSIQDTASNVAKTISSQPPLKFSISNTKVESWLL  292

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISRG+ GS+FVL+KE S LL P
Sbjct  293  TTYLDEDLRISRGDGGSVFVLLKEGSALLSP  323


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEALTL NGKW+L YTSF GLFPLLSR TLPL
Sbjct  141  TEALTLLNGKWILQYTSFSGLFPLLSRNTLPL  172



>sp|B4F6G1.1|CHRC2_ONCHC RecName: Full=Chromoplast-specific carotenoid-associated protein 
C2, chromoplast; Short=OgCHRC2; AltName: Full=Chromoplast 
specific carotenoid associated protein C2; AltName: Full=Fibrillin-like 
protein 2; Flags: Precursor [Oncidium hybrid cultivar]
 gb|AAY24688.1| fibrillin-like protein [Oncidium hybrid cultivar]
Length=319

 Score =   241 bits (616),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 138/157 (88%), Gaps = 2/157 (1%)
 Frame = -2

Query  715  GAHSL--WVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEE  542
            GA SL   ++V+EI QTIDSE FTVQNSV F GP ++TS++TNAKFEVRSPKRVQIKFEE
Sbjct  162  GAESLQQLLKVDEISQTIDSEGFTVQNSVRFVGPFSSTSVTTNAKFEVRSPKRVQIKFEE  221

Query  541  GIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLAN  362
            GIIGTPQLTDSIV+P+ VEF GQ IDL+PFKG+I+SLQDTASSV K+ISSQPP+KF ++N
Sbjct  222  GIIGTPQLTDSIVIPDKVEFFGQNIDLSPFKGVISSLQDTASSVAKTISSQPPIKFPISN  281

Query  361  SNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            SNA+SWLLTTYLD ELRISR + GS+FVLI E SPLL
Sbjct  282  SNAQSWLLTTYLDDELRISRADGGSVFVLILESSPLL  318



>ref|XP_010686767.1| PREDICTED: plastid-lipid-associated protein, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=310

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 134/151 (89%), Gaps = 1/151 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE FTVQNSV FSGP +TTS+STNAKFEVRSPKRVQIKF EG++GTPQ+
Sbjct  161  VKVEEISQTIDSEQFTVQNSVQFSGPFSTTSVSTNAKFEVRSPKRVQIKFMEGVVGTPQI  220

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDS+VLPENVEFLGQKIDLTP KGL  S+QDTASSV K+ISSQPPLKF++A  N ESWLL
Sbjct  221  TDSLVLPENVEFLGQKIDLTPLKGLFDSVQDTASSVAKTISSQPPLKFNIAR-NPESWLL  279

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ELRISRG+ GS+FV IKE+S LL P
Sbjct  280  TTYLDEELRISRGDGGSVFVFIKEESLLLPP  310


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            T+AL+L NGKW+LAYTSF GLFPLLS+G LPL
Sbjct  129  TDALSLLNGKWILAYTSFSGLFPLLSQGRLPL  160



>ref|XP_002867781.1| hypothetical protein ARALYDRAFT_914391 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44040.1| hypothetical protein ARALYDRAFT_914391 [Arabidopsis lyrata subsp. 
lyrata]
Length=310

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDSE+FTVQNSV F+GPL T SISTNAKFE+RSPKRVQIKFE+G+IGTPQL
Sbjct  160  VKVDEISQTIDSENFTVQNSVRFAGPLGTNSISTNAKFEIRSPKRVQIKFEQGVIGTPQL  219

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE VE LGQKIDL P +GL+TS+QDTASSV ++ISSQPPLKFSL   NA+SWLL
Sbjct  220  TDSIEIPEYVEVLGQKIDLNPIRGLLTSVQDTASSVARTISSQPPLKFSLPGDNAQSWLL  279

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ++RISRG+ GS+FVLIKE SPLL P
Sbjct  280  TTYLDKDIRISRGDGGSVFVLIKEGSPLLNP  310


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEAL L NGKW+LAYTSF+ LFPLLSRG +PL
Sbjct  128  TEALFLLNGKWILAYTSFVNLFPLLSRGIVPL  159



>ref|XP_010529464.1| PREDICTED: probable plastid-lipid-associated protein 1, chloroplastic 
[Tarenaya hassleriana]
Length=323

 Score =   240 bits (613),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDSESFTVQNSV F+GPLATTSISTNAKFEVRSP+RVQIKFE+GIIGTPQL
Sbjct  171  VKVDEISQTIDSESFTVQNSVRFAGPLATTSISTNAKFEVRSPRRVQIKFEQGIIGTPQL  230

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PENVE LGQKIDL P +GL+TSLQDTA+SV ++ISS+PPLKFSL + NA+SWLL
Sbjct  231  TDSIEIPENVEVLGQKIDLNPIRGLLTSLQDTATSVARTISSRPPLKFSLPSDNAQSWLL  290

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
            TT+LD +LRISRG+ GS+FVL KE S LL+
Sbjct  291  TTFLDKDLRISRGDGGSVFVLFKEGSSLLE  320


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            T+AL L NGKW+LAYTSF+GLFPLLSRG +P+
Sbjct  139  TDALFLLNGKWILAYTSFVGLFPLLSRGIVPV  170



>ref|XP_006396722.1| hypothetical protein EUTSA_v10028808mg [Eutrema salsugineum]
 gb|ESQ38175.1| hypothetical protein EUTSA_v10028808mg [Eutrema salsugineum]
Length=318

 Score =   240 bits (612),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDS+SFTVQNSV F+GPLATTSISTNAKFE+RSPKRVQIKFE+G+IGTPQL
Sbjct  168  VKVDEISQTIDSDSFTVQNSVRFAGPLATTSISTNAKFEIRSPKRVQIKFEQGVIGTPQL  227

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE VE LGQKIDL P +GL+TS+QDTASSV ++ISSQPPLKFSL   NA+SWLL
Sbjct  228  TDSIEIPEFVEVLGQKIDLNPIRGLLTSVQDTASSVARTISSQPPLKFSLPGDNAQSWLL  287

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISRG+ GS+FVL+KE S LL P
Sbjct  288  TTYLDKDLRISRGDGGSVFVLVKEGSSLLSP  318


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
             EAL L NGKW+LAYTSF+GLFPLLSR   PL
Sbjct  136  NEALFLLNGKWILAYTSFVGLFPLLSRRISPL  167



>ref|XP_006284145.1| hypothetical protein CARUB_v10005278mg [Capsella rubella]
 gb|EOA17043.1| hypothetical protein CARUB_v10005278mg [Capsella rubella]
Length=317

 Score =   239 bits (611),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDS++FTVQNSV F+GPL T SISTNAKFE+RSPKRVQIKFE+G+IGTPQL
Sbjct  167  VKVDEISQTIDSDNFTVQNSVRFAGPLGTNSISTNAKFEIRSPKRVQIKFEQGVIGTPQL  226

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE VE LGQKIDL P +GL+TS+QDTASSV ++ISSQPPLKFSL   NA+SWLL
Sbjct  227  TDSIEIPEYVEVLGQKIDLNPIRGLLTSVQDTASSVARTISSQPPLKFSLPGDNAQSWLL  286

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ++RISRG+ GS+FVLIKE SPLL P
Sbjct  287  TTYLDKDIRISRGDGGSVFVLIKEGSPLLNP  317


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            T+AL L NGKW+LAYTSF+ LFPLLSRG LPL
Sbjct  135  TDALFLLNGKWILAYTSFVNLFPLLSRGILPL  166



>gb|AGN30962.1| chromoplast-specific carotenoid-associated protein [Narcissus 
tazetta var. chinensis]
Length=316

 Score =   239 bits (611),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDSE+FTVQNSV F+GPLATTS++TNAKFEVRSPKRVQIKFEEGIIGTPQL
Sbjct  167  VKVDEISQTIDSEAFTVQNSVKFAGPLATTSVTTNAKFEVRSPKRVQIKFEEGIIGTPQL  226

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSIV+PE VEF GQKIDL+P +G+ITS++D+ SSVVK+IS +PPLK  +AN  A+SWLL
Sbjct  227  TDSIVIPEKVEFFGQKIDLSPLRGVITSIEDSYSSVVKTISGRPPLKIPIANDKAQSWLL  286

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD ELRISR + GS+FVLIKE SPLL
Sbjct  287  TTYLDGELRISRADGGSVFVLIKEGSPLL  315


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLP  702
            TEALTL NGKW+LAYTSF  LFPLL  G LP
Sbjct  134  TEALTLLNGKWILAYTSFSQLFPLLGSGRLP  164



>emb|CDY71809.1| BnaCnng74600D, partial [Brassica napus]
Length=188

 Score =   235 bits (599),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDS+SFTVQNSV F+GPLATTS STNAKFEV+SPKRVQIKFE+G+IGTPQL
Sbjct  38   VKVDEISQTIDSDSFTVQNSVRFAGPLATTSFSTNAKFEVQSPKRVQIKFEQGVIGTPQL  97

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE+VE LGQKIDL P +GL+TS+QDTASSV ++ISSQPPLKFSL    A+SWLL
Sbjct  98   TDSIEIPESVEVLGQKIDLNPIRGLLTSVQDTASSVARTISSQPPLKFSLPADRAQSWLL  157

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISRG+ GSIFVL KE S LL P
Sbjct  158  TTYLDKDLRISRGDGGSIFVLFKEGSSLLNP  188



>ref|NP_193955.1| plastid-lipid associated protein PAP / fibrillin family protein 
[Arabidopsis thaliana]
 sp|O49629.1|PAP2_ARATH RecName: Full=Probable plastid-lipid-associated protein 2, chloroplastic; 
Short=AtPap2; AltName: Full=Fibrillin-1b; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAA16774.1| fibrillin precursor-like protein [Arabidopsis thaliana]
 emb|CAB79179.1| fibrillin precursor-like protein [Arabidopsis thaliana]
 gb|AAW28556.1| At4g22240 [Arabidopsis thaliana]
 gb|AAW38981.1| At4g22240 [Arabidopsis thaliana]
 gb|AEE84581.1| plastid-lipid associated protein PAP / fibrillin family protein 
[Arabidopsis thaliana]
Length=310

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V+EI QTIDS++FTVQNSV F+GPL T SISTNAKFE+RSPKRVQIKFE+G+IGTPQL
Sbjct  160  IKVDEISQTIDSDNFTVQNSVRFAGPLGTNSISTNAKFEIRSPKRVQIKFEQGVIGTPQL  219

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE VE LGQKIDL P +GL+TS+QDTASSV ++ISSQPPLKFSL   NA+SWLL
Sbjct  220  TDSIEIPEYVEVLGQKIDLNPIRGLLTSVQDTASSVARTISSQPPLKFSLPADNAQSWLL  279

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ++RISRG+ GS+FVLIKE SPLL P
Sbjct  280  TTYLDKDIRISRGDGGSVFVLIKEGSPLLNP  310


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEAL L NGKW+LAYTSF+ LFPLLSRG +PL
Sbjct  128  TEALFLLNGKWILAYTSFVNLFPLLSRGIVPL  159



>gb|AAM67287.1| fibrillin precursor-like protein [Arabidopsis thaliana]
Length=310

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V+EI QTIDS++FTVQNSV F+GPL T SISTNAKFE+RSPKRVQIKFE+G+IGTPQL
Sbjct  160  IKVDEISQTIDSDNFTVQNSVRFAGPLGTNSISTNAKFEIRSPKRVQIKFEQGVIGTPQL  219

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE VE LGQKIDL P +GL+TS+QDTASSV ++ISSQPPLKFSL   NA+SWLL
Sbjct  220  TDSIEIPEYVEVLGQKIDLNPIRGLLTSVQDTASSVARTISSQPPLKFSLPADNAQSWLL  279

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ++RISRG+ GS+FVLIKE SPLL P
Sbjct  280  TTYLDKDIRISRGDGGSVFVLIKEGSPLLNP  310


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEAL L NGKW+LA TSF+ LFPLLSRG +PL
Sbjct  128  TEALFLLNGKWILACTSFVNLFPLLSRGIVPL  159



>ref|XP_008799426.1| PREDICTED: light-induced protein, chloroplastic-like, partial 
[Phoenix dactylifera]
Length=171

 Score =   234 bits (597),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE+FTVQNSV F+GPLATT ++TNAKFEVRSPKRVQIKFEEGIIGTPQ+
Sbjct  22   VKVEEILQTIDSENFTVQNSVQFAGPLATTCVTTNAKFEVRSPKRVQIKFEEGIIGTPQI  81

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSIV+PE VEFLGQ IDL+PFKG+ITS+QD ASSV ++IS +PP K  + N+NA+SWLL
Sbjct  82   TDSIVIPEKVEFLGQNIDLSPFKGVITSVQDAASSVARTISERPPWKIPINNNNAQSWLL  141

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
            TTYLD ELRISR + GS+FVLIKE S LL 
Sbjct  142  TTYLDEELRISRADGGSVFVLIKEGSSLLN  171



>ref|XP_004134784.1| PREDICTED: chromoplast-specific carotenoid-associated protein, 
chromoplast-like [Cucumis sativus]
 ref|XP_004169325.1| PREDICTED: chromoplast-specific carotenoid-associated protein, 
chromoplast-like [Cucumis sativus]
 sp|Q96398.1|CHRC_CUCSA RecName: Full=Chromoplast-specific carotenoid-associated protein, 
chromoplast; Flags: Precursor [Cucumis sativus]
 emb|CAA64846.1| chromoplast-specific carotenoid-associated protein, CHRC [Cucumis 
sativus]
 gb|AAD05165.1| chromoplast-specific carotenoid-associated protein CHRC [Cucumis 
sativus]
 gb|KGN49072.1| hypothetical protein Csa_6G512870 [Cucumis sativus]
Length=322

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE+ TVQNSV FSGPLATTSI+TNAKFEVRSP RV IKFEEG+IGTPQL
Sbjct  172  VKVEEISQTIDSENLTVQNSVQFSGPLATTSITTNAKFEVRSPLRVHIKFEEGVIGTPQL  231

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSIV+P+NV+FLGQKID TPF G+I+SLQDTAS+V K+ISSQPP+KFS++N+  ESWLL
Sbjct  232  TDSIVIPDNVDFLGQKIDFTPFNGIISSLQDTASNVAKTISSQPPIKFSISNTRVESWLL  291

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD +LRISRG+ GS+FVL+KE S  L
Sbjct  292  TTYLDEDLRISRGDGGSVFVLLKEGSSFL  320


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 1/32 (3%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEALTL NGKW+LAYT+F GLFPLLSR  LPL
Sbjct  141  TEALTLLNGKWILAYTTFAGLFPLLSRN-LPL  171



>gb|KFK30956.1| hypothetical protein AALP_AA6G049300 [Arabis alpina]
Length=320

 Score =   238 bits (607),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDS+SFTVQNSV F+GPLATTS STNAKFE+RSPKRVQIKFE+G+IGTPQL
Sbjct  170  VKVDEISQTIDSDSFTVQNSVRFAGPLATTSFSTNAKFEIRSPKRVQIKFEQGVIGTPQL  229

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE VE LGQKIDL P KGL+TS+QDTASSV K+ISSQPPLKFSL     +SWLL
Sbjct  230  TDSIEIPEFVEVLGQKIDLNPIKGLLTSVQDTASSVAKTISSQPPLKFSLPGDRTQSWLL  289

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISRG+AGS+FVLIKE S LL P
Sbjct  290  TTYLDKDLRISRGDAGSVFVLIKEGSSLLNP  320


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
             EAL L NGKW+LAYTSF+GLFPLLSR   PL
Sbjct  138  NEALFLLNGKWILAYTSFVGLFPLLSRRIEPL  169



>ref|XP_003594155.1| Plastid-lipid-associated protein [Medicago truncatula]
 gb|ABD32657.1| PAP fibrillin [Medicago truncatula]
 gb|AES64406.1| plastid lipid-associated protein [Medicago truncatula]
Length=317

 Score =   238 bits (607),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  691  VEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTD  512
            VEEI QTIDSES TVQNSV+F+GPL TTSISTNAKFEVRSP R+QIKFEEG+IGTPQLTD
Sbjct  169  VEEISQTIDSESLTVQNSVLFAGPLTTTSISTNAKFEVRSPNRLQIKFEEGVIGTPQLTD  228

Query  511  SIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTT  332
            S+ +PENVE LGQKIDL+PFKG+ TS+Q+TASSVV++IS+QPPLK  ++N NA+SWLLTT
Sbjct  229  SLEIPENVEVLGQKIDLSPFKGIFTSVQNTASSVVQTISNQPPLKIPISNDNAQSWLLTT  288

Query  331  YLDSELRISRGEAGSIFVLIKEDSPLL  251
            YLD ELRISRG+ GS+FVLIKE S LL
Sbjct  289  YLDEELRISRGDGGSVFVLIKEGSSLL  315



>gb|AAD03693.1| fibrillin [Brassica napus]
Length=237

 Score =   234 bits (598),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDS+SFTV NSV F+GPLATTS+STNAKFEVRSPKRVQ+KFE+G+IGTPQL
Sbjct  87   VKVDEISQTIDSDSFTVHNSVRFAGPLATTSLSTNAKFEVRSPKRVQVKFEQGVIGTPQL  146

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE VE LGQKIDL P KGL+TS+QDTASSV ++ISSQPPLKFSL    A+SWLL
Sbjct  147  TDSIEIPEFVEVLGQKIDLNPIKGLLTSVQDTASSVARTISSQPPLKFSLPGEIAQSWLL  206

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISRG+ GS+FVLI+E S LL P
Sbjct  207  TTYLDKDLRISRGDGGSVFVLIREGSSLLNP  237


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
             EAL L NGKW+L YTSF+GLFPLLSR   PL
Sbjct  55   NEALFLLNGKWILVYTSFVGLFPLLSRRISPL  86



>gb|AAL67120.1| AT4g22240/T10I14_70 [Arabidopsis thaliana]
Length=310

 Score =   236 bits (603),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V+EI QTIDS++FTVQNSV F+GPL T SISTNAKFE+RSPKRVQIKFE+G+IGTPQL
Sbjct  160  IKVDEISQTIDSDNFTVQNSVRFAGPLGTNSISTNAKFEIRSPKRVQIKFEQGVIGTPQL  219

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE VE LGQKIDL P +GL+TS+QDTASSV ++ISSQPPLKF L   NA+SWLL
Sbjct  220  TDSIEIPEYVEVLGQKIDLNPIRGLLTSVQDTASSVARTISSQPPLKFFLPADNAQSWLL  279

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ++RISRG+ GS+FVLIKE SPLL P
Sbjct  280  TTYLDKDIRISRGDGGSVFVLIKEGSPLLNP  310


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEAL L NGKW+LAYTSF+ LFPLLSRG +PL
Sbjct  128  TEALFLLNGKWILAYTSFVNLFPLLSRGIVPL  159



>ref|XP_008803509.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Phoenix dactylifera]
Length=256

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 132/149 (89%), Gaps = 4/149 (3%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE+FTVQNSV F+GPLATT    NAKFEVRSPKRVQIKFEEGIIGTPQL
Sbjct  111  VKVEEISQTIDSENFTVQNSVQFAGPLATT----NAKFEVRSPKRVQIKFEEGIIGTPQL  166

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSIV+P+ VEFLGQ IDL+PFKG+ITS+QD ASSV ++IS QPPLK  + N+NA+SWLL
Sbjct  167  TDSIVIPKKVEFLGQNIDLSPFKGVITSVQDAASSVARTISGQPPLKIPINNNNAQSWLL  226

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD ELR+SRG+ GS++VL+KE SPLL
Sbjct  227  TTYLDEELRVSRGDGGSVYVLVKEGSPLL  255



>ref|XP_010422246.1| PREDICTED: probable plastid-lipid-associated protein 1, chloroplastic 
[Camelina sativa]
Length=320

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDS++FTVQNSV+F+GP +TTS+STNAKFE+RSPKRVQIKFE+G+IGTPQL
Sbjct  170  VKVDEISQTIDSDTFTVQNSVLFAGPFSTTSVSTNAKFEIRSPKRVQIKFEQGVIGTPQL  229

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE VE LGQKIDL+P KGL+TS+QDTASSV ++ISSQPPLKFSL++   +SWLL
Sbjct  230  TDSIEIPEFVEVLGQKIDLSPIKGLLTSVQDTASSVARTISSQPPLKFSLSSDKTQSWLL  289

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISRG+ GS+FVLIKE S LL P
Sbjct  290  TTYLDKDLRISRGDGGSLFVLIKEGSSLLNP  320


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            T+AL L NGKW+LAYTSF+G+FPLLSR   PL
Sbjct  138  TDALFLLNGKWILAYTSFVGMFPLLSRRIEPL  169



>ref|XP_010252567.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Nelumbo nucifera]
Length=332

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI Q+IDS +FTV+N V F+GPLATT++STNAKFE+RSPKRVQIKFEEGIIGTPQL
Sbjct  181  VKVEEISQSIDSSNFTVENVVQFAGPLATTTLSTNAKFEIRSPKRVQIKFEEGIIGTPQL  240

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE  EFLGQ IDLTP KGLI+S+Q+TASSVVKSISS+PPLK  ++N+NAESWLL
Sbjct  241  TDSIEIPEKAEFLGQTIDLTPLKGLISSVQNTASSVVKSISSRPPLKIPISNTNAESWLL  300

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD ELRISRG+ GS+FVL+KE S LL
Sbjct  301  TTYLDDELRISRGDGGSVFVLVKEGSSLL  329


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEALTL NGKW+LAYTSF+GLF L SRGTLPL
Sbjct  149  TEALTLLNGKWILAYTSFVGLFLLFSRGTLPL  180



>ref|XP_010496158.1| PREDICTED: probable plastid-lipid-associated protein 1, chloroplastic 
[Camelina sativa]
Length=321

 Score =   236 bits (601),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDS++FTVQNSV+F+GP +TTS+STNAKFE+RSPKRVQIKFE+G+IGTPQL
Sbjct  171  VKVDEISQTIDSDTFTVQNSVLFAGPFSTTSVSTNAKFEIRSPKRVQIKFEQGVIGTPQL  230

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE VE LGQKIDL+P KGL+TS+QDTASSV ++ISSQPPLKFSL++   +SWLL
Sbjct  231  TDSIEIPEFVEVLGQKIDLSPIKGLLTSVQDTASSVARTISSQPPLKFSLSSDKTQSWLL  290

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISRG+ GS+FVLIKE S LL P
Sbjct  291  TTYLDKDLRISRGDGGSLFVLIKEGSSLLNP  321


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            T+AL L NGKW+LAYTSF+G+FPLLSR   PL
Sbjct  139  TDALFLLNGKWILAYTSFVGMFPLLSRRIEPL  170



>emb|CDY16684.1| BnaA09g20620D [Brassica napus]
Length=318

 Score =   235 bits (600),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDS+SFTVQNSV F+GPLATTS STNAKFEV+SPKRVQIKFE+G+IGTPQL
Sbjct  168  VKVDEISQTIDSDSFTVQNSVRFAGPLATTSFSTNAKFEVQSPKRVQIKFEQGVIGTPQL  227

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE+VE LGQKIDL P +GL+TS+QDTASSV ++ISSQPPLKFSL    A+SWLL
Sbjct  228  TDSIEIPESVEVLGQKIDLNPIRGLLTSVQDTASSVARTISSQPPLKFSLPADRAQSWLL  287

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISRG+ GSIFVL KE S LL P
Sbjct  288  TTYLDKDLRISRGDGGSIFVLFKEGSSLLNP  318



>emb|CDY21291.1| BnaC03g29750D [Brassica napus]
Length=316

 Score =   234 bits (598),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDS+SFTV NSV F+GPLATTS+STNAKFEVRSPKRVQ+KFE+G+IGTPQL
Sbjct  166  VKVDEISQTIDSDSFTVHNSVRFAGPLATTSLSTNAKFEVRSPKRVQVKFEQGVIGTPQL  225

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE VE LGQKIDL P +GL+TS+QDTASSV ++ISSQPPLKFSL   +A+SWLL
Sbjct  226  TDSIEIPEFVEVLGQKIDLNPIRGLLTSVQDTASSVARTISSQPPLKFSLPGDSAQSWLL  285

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISRG+ GS+FVLI+E S LL P
Sbjct  286  TTYLDKDLRISRGDGGSVFVLIREGSSLLNP  316



>ref|NP_192311.1| fibrillin [Arabidopsis thaliana]
 sp|O81439.1|PAP1_ARATH RecName: Full=Probable plastid-lipid-associated protein 1, chloroplastic; 
Short=AtPap1; AltName: Full=Fibrillin-1a; AltName: 
Full=Plastoglobulin 35; Short=AtPGL35; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC28198.1| contains similarity to fibrillins [Arabidopsis thaliana]
 emb|CAB77870.1| putative fibrillin [Arabidopsis thaliana]
 gb|AAM53324.1| putative fibrillin [Arabidopsis thaliana]
 gb|AAM62561.1| putative fibrillin [Arabidopsis thaliana]
 gb|AAN15467.1| putative fibrillin [Arabidopsis thaliana]
 gb|AEE82363.1| fibrillin [Arabidopsis thaliana]
Length=318

 Score =   234 bits (598),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDS+SFTVQNSV F+GP +TTS STNAKFE+RSPKRVQIKFE+G+IGTPQL
Sbjct  168  VKVDEISQTIDSDSFTVQNSVRFAGPFSTTSFSTNAKFEIRSPKRVQIKFEQGVIGTPQL  227

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE+VE LGQKIDL P KGL+TS+QDTASSV ++IS+QPPLKFSL + N +SWLL
Sbjct  228  TDSIEIPESVEVLGQKIDLNPIKGLLTSVQDTASSVARTISNQPPLKFSLPSDNTQSWLL  287

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISRG+ GS++VLIKE S LL P
Sbjct  288  TTYLDKDLRISRGDGGSVYVLIKEGSSLLNP  318


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -1

Query  791  EALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            EAL L NGKW+LAYTSF+GLFPLLSR   PL
Sbjct  137  EALFLLNGKWILAYTSFVGLFPLLSRRIEPL  167



>gb|EYU27736.1| hypothetical protein MIMGU_mgv1a010083mg [Erythranthe guttata]
Length=319

 Score =   234 bits (598),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSESFTVQ+SV+FSGPL+TT+ISTN+KFEVR+PKRVQIK EEGIIGTPQL
Sbjct  169  VKVEEISQTIDSESFTVQSSVLFSGPLSTTAISTNSKFEVRTPKRVQIKIEEGIIGTPQL  228

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              S+VLPENVE  GQ IDLTPFK L TS+Q+TASSV  +ISSQPPLKFS+++ +AESWLL
Sbjct  229  IYSVVLPENVELFGQNIDLTPFKELFTSVQETASSVATTISSQPPLKFSISHKDAESWLL  288

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ELRISR + G IFVLIKE SPLL P
Sbjct  289  TTYLDEELRISREDGGGIFVLIKEGSPLLTP  319



>ref|XP_006288225.1| hypothetical protein CARUB_v10001463mg [Capsella rubella]
 gb|EOA21123.1| hypothetical protein CARUB_v10001463mg [Capsella rubella]
Length=322

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDS+SF VQNSV F+GP +TTS STNAKFEVRSPKRVQIKFE+G+IGTPQL
Sbjct  172  VKVDEISQTIDSDSFAVQNSVRFAGPFSTTSFSTNAKFEVRSPKRVQIKFEQGVIGTPQL  231

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE VE LGQKIDL P KGL+TS+QDTASSV ++ISSQPPLKFSL + N +SWLL
Sbjct  232  TDSIEIPEFVEVLGQKIDLNPIKGLLTSVQDTASSVARTISSQPPLKFSLPSDNTQSWLL  291

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISRG+ GS+FVLIKE S LL P
Sbjct  292  TTYLDKDLRISRGDGGSVFVLIKEGSSLLNP  322


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
             EAL L NGKW+LAYTSF+GLFPLLSR   PL
Sbjct  140  NEALFLLNGKWILAYTSFVGLFPLLSRRIEPL  171



>gb|EYU27735.1| hypothetical protein MIMGU_mgv1a010083mg [Erythranthe guttata]
Length=323

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSESFTVQ+SV+FSGPL+TT+ISTN+KFEVR+PKRVQIK EEGIIGTPQL
Sbjct  173  VKVEEISQTIDSESFTVQSSVLFSGPLSTTAISTNSKFEVRTPKRVQIKIEEGIIGTPQL  232

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              S+VLPENVE  GQ IDLTPFK L TS+Q+TASSV  +ISSQPPLKFS+++ +AESWLL
Sbjct  233  IYSVVLPENVELFGQNIDLTPFKELFTSVQETASSVATTISSQPPLKFSISHKDAESWLL  292

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD ELRISR + G IFVLIKE SPLL P
Sbjct  293  TTYLDEELRISREDGGGIFVLIKEGSPLLTP  323



>ref|XP_010433071.1| PREDICTED: probable plastid-lipid-associated protein 1, chloroplastic 
[Camelina sativa]
Length=320

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDS++FTVQNSV+F+GP +TTS+STNAKFE+RSPKRVQI FE+G+IGTPQL
Sbjct  170  VKVDEISQTIDSDTFTVQNSVLFAGPFSTTSVSTNAKFEIRSPKRVQIMFEQGVIGTPQL  229

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE VE LGQKIDL+P KGL+TS+QDTASSV ++ISSQPPLKFSL++   +SWLL
Sbjct  230  TDSIEIPEFVEVLGQKIDLSPIKGLLTSVQDTASSVARTISSQPPLKFSLSSDKTQSWLL  289

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISRG+ GS+FVLIKE S LL P
Sbjct  290  TTYLDKDLRISRGDGGSLFVLIKEGSSLLNP  320


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            T+AL L NGKW+LAYTSF+G+FPLLSR   PL
Sbjct  138  TDALFLLNGKWILAYTSFVGMFPLLSRRIEPL  169



>ref|XP_002872677.1| plastid lipid-associated protein 1, chloroplast precursor [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH48936.1| plastid lipid-associated protein 1, chloroplast precursor [Arabidopsis 
lyrata subsp. lyrata]
Length=322

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDS+SFTVQNSV F+GP +TTS STNAKFE+RSPKRVQIKFE+G+IGTPQL
Sbjct  172  VKVDEISQTIDSDSFTVQNSVRFAGPFSTTSFSTNAKFEIRSPKRVQIKFEQGVIGTPQL  231

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
             DSI +PE+VE LGQKIDL P KG++TS+QDTASSV ++IS+QPPLKFSL + N +SWLL
Sbjct  232  MDSIEIPESVEILGQKIDLNPIKGILTSVQDTASSVARTISNQPPLKFSLPSDNTQSWLL  291

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISRG+ GS+FVLIKE S LL P
Sbjct  292  TTYLDKDLRISRGDGGSVFVLIKEGSSLLNP  322


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
             EAL L NGKW+LAYTSF+GLFPLLSR   PL
Sbjct  140  NEALFLLNGKWILAYTSFVGLFPLLSRRIEPL  171



>emb|CDX90850.1| BnaA03g25300D [Brassica napus]
Length=316

 Score =   233 bits (594),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDS+SFTV NSV F+GPLATTS+STNAKFEVRSPKRVQ+KFE+G+IGTPQL
Sbjct  166  VKVDEISQTIDSDSFTVHNSVRFAGPLATTSLSTNAKFEVRSPKRVQVKFEQGVIGTPQL  225

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE VE LGQKIDL P +GL+TS+QDTASSV ++ISSQPPLKFSL    A+SWLL
Sbjct  226  TDSIEIPEFVEVLGQKIDLNPIRGLLTSVQDTASSVARTISSQPPLKFSLPGEIAQSWLL  285

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISRG+ GS+FVLI+E S LL P
Sbjct  286  TTYLDKDLRISRGDGGSVFVLIREGSSLLNP  316



>ref|XP_009114588.1| PREDICTED: probable plastid-lipid-associated protein 1, chloroplastic 
[Brassica rapa]
Length=318

 Score =   233 bits (594),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDS+SFTVQNSV F+GPLATTS STNAKFEV+SPKRVQIKFE+G+IGTPQL
Sbjct  168  VKVDEISQTIDSDSFTVQNSVRFAGPLATTSFSTNAKFEVQSPKRVQIKFEQGVIGTPQL  227

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE+VE LGQKIDL P +GL+TS+QDTASSV ++IS++PPLKFSL    A+SWLL
Sbjct  228  TDSIEIPESVEVLGQKIDLNPIRGLLTSVQDTASSVARTISNRPPLKFSLPADRAQSWLL  287

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISRG+ GSIFVL KE S LL P
Sbjct  288  TTYLDKDLRISRGDGGSIFVLFKEGSSLLNP  318



>ref|XP_009134286.1| PREDICTED: plastid lipid-associated protein 1, chloroplastic 
[Brassica rapa]
 sp|Q94FZ9.1|PAP1_BRACM RecName: Full=Plastid lipid-associated protein 1, chloroplastic; 
Flags: Precursor [Brassica rapa]
 gb|AAK57564.1| plastid-lipid associated protein PAP1 [Brassica rapa subsp. oleifera]
Length=327

 Score =   232 bits (592),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDS+SFTV NSV F+ PLATTS+STNAKFEVRSPKRVQ+KFE+G+IGTPQL
Sbjct  177  VKVDEISQTIDSDSFTVHNSVRFASPLATTSLSTNAKFEVRSPKRVQVKFEQGVIGTPQL  236

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE VE LGQKIDL P KGL+TS+QDTASSV ++ISSQPPLKFSL   +A+SWLL
Sbjct  237  TDSIEIPEFVEVLGQKIDLNPIKGLLTSVQDTASSVARTISSQPPLKFSLPGDSAQSWLL  296

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISRG+ GS+FVLI+E S LL P
Sbjct  297  TTYLDKDLRISRGDGGSVFVLIREGSSLLNP  327



>ref|XP_010538742.1| PREDICTED: plastid lipid-associated protein 2, chloroplastic 
[Tarenaya hassleriana]
Length=323

 Score =   232 bits (592),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+++EI Q IDS++FTVQNS+ F+ PLAT SISTN+KFEVRSP+RVQIKFEEGIIGTPQL
Sbjct  171  VKLDEISQMIDSDNFTVQNSIRFASPLATASISTNSKFEVRSPRRVQIKFEEGIIGTPQL  230

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE V+ LGQKI+LTP KGL+TSLQ TASS+ K+ISSQPPLKFSL  SNA+SWLL
Sbjct  231  TDSIQIPEEVKVLGQKINLTPIKGLLTSLQGTASSMAKTISSQPPLKFSLPGSNAQSWLL  290

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISRG+ GS+FVL KE + LLKP
Sbjct  291  TTYLDKDLRISRGDGGSVFVLFKEGNSLLKP  321


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            T+AL L NGKW+LAYTSF  LFPLLSRG +P+
Sbjct  139  TDALFLLNGKWILAYTSFSALFPLLSRGYVPV  170



>ref|XP_006661039.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic-like, 
partial [Oryza brachyantha]
Length=239

 Score =   229 bits (584),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 130/157 (83%), Gaps = 2/157 (1%)
 Frame = -2

Query  715  GAHSL--WVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEE  542
            GA SL   V+VEEI QTIDSE+FTVQN + FSGPLATTS+STNAKFEVRSPKRVQIKF+E
Sbjct  82   GAASLPQLVKVEEISQTIDSENFTVQNCIKFSGPLATTSVSTNAKFEVRSPKRVQIKFDE  141

Query  541  GIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLAN  362
            GIIGTPQLTDSIVLPE  EF GQ IDLTP KG+ +S+++ ASSV ++IS QPPLK  +  
Sbjct  142  GIIGTPQLTDSIVLPEKFEFFGQNIDLTPLKGIFSSIENAASSVARTISGQPPLKIPIRT  201

Query  361  SNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
             NAE+WLLTTYLD ELRISRG+  SIFVL KE S LL
Sbjct  202  DNAEAWLLTTYLDDELRISRGDGSSIFVLFKEGSTLL  238



>gb|AAK57561.1| plastid-lipid associated protein PAP1 [Brassica rapa subsp. oleifera]
Length=327

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDS+SFTV NSV F+ PLATTS+STNAKFEVRSPKRVQ+KFE+G+IGTPQL
Sbjct  177  VKVDEISQTIDSDSFTVHNSVRFASPLATTSLSTNAKFEVRSPKRVQVKFEQGVIGTPQL  236

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PE VE  GQKIDL P KGL+TS+QDTASSV ++ISSQPPLKFSL   +A+SWLL
Sbjct  237  TDSIEIPEFVEVFGQKIDLNPIKGLLTSVQDTASSVARTISSQPPLKFSLPGDSAQSWLL  296

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISRG+ GS+FVLI+E S LL P
Sbjct  297  TTYLDKDLRISRGDGGSVFVLIREGSSLLNP  327



>gb|AAP74338.1| fibrillin-like protein [Elaeis guineensis]
Length=172

 Score =   225 bits (574),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE+FTVQNSV F+ PLATTS++TNAKFEVRSPKRVQIKFEEGIIGTPQL
Sbjct  25   VKVEEISQTIDSENFTVQNSVQFAVPLATTSVTTNAKFEVRSPKRVQIKFEEGIIGTPQL  84

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSIVLPE VEFLGQ IDL+PFK +ITS+Q+ ASSV ++IS +PP K S+ N NA+SWLL
Sbjct  85   TDSIVLPEKVEFLGQNIDLSPFKSVITSVQNAASSVARTISERPPWKISINNDNAQSWLL  144

Query  337  TTYLDSELRISRGEAGSIFVLIKEDS  260
            TTYLD EL+ISR + G IF+LIKE S
Sbjct  145  TTYLDEELKISRADGGGIFLLIKEGS  170



>ref|XP_010928413.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Elaeis guineensis]
Length=328

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE+FTVQNSV F+ PLATTS++TNAKFEVRSPKRVQIKFEEGIIGTPQL
Sbjct  179  VKVEEISQTIDSENFTVQNSVQFAVPLATTSVTTNAKFEVRSPKRVQIKFEEGIIGTPQL  238

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSIVLPE VEFLGQ IDL+PFK +ITS+Q+ ASSV ++IS +PP K S+ N NA+SWLL
Sbjct  239  TDSIVLPEKVEFLGQNIDLSPFKSVITSVQNAASSVARTISERPPWKISINNDNAQSWLL  298

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD EL+ISR + G IF+LIKE S LL
Sbjct  299  TTYLDEELKISRADGGGIFLLIKEGSSLL  327



>ref|NP_001062631.2| Os09g0133600, partial [Oryza sativa Japonica Group]
 dbj|BAF24545.2| Os09g0133600, partial [Oryza sativa Japonica Group]
Length=241

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -2

Query  715  GAHSLWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  536
            G+    V+VEEI QTIDSE+FTVQN + FSGPLATTS+STNAKFEVRSPKRVQIKF+EGI
Sbjct  86   GSLPQLVKVEEISQTIDSENFTVQNCIKFSGPLATTSVSTNAKFEVRSPKRVQIKFDEGI  145

Query  535  IGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSN  356
            IGTPQLTDSIVLPE  E  GQ IDLTP KG+ +S+++ ASSV ++IS QPPLK  +   N
Sbjct  146  IGTPQLTDSIVLPEKFELFGQNIDLTPLKGIFSSIENAASSVARTISGQPPLKIPIRTDN  205

Query  355  AESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            AESWLLTTYLD ELRISRG+  SIFVL KE S LL
Sbjct  206  AESWLLTTYLDDELRISRGDGSSIFVLFKEGSTLL  240


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLP  702
            TEALTL NGKW+LAYTSF  LFPLL  G+LP
Sbjct  59   TEALTLLNGKWILAYTSFSQLFPLLGSGSLP  89



>ref|XP_009408003.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=305

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDSESFTVQNSV FSGPLATTS++TNAKFEVRSPKRVQIKFEEGIIGTPQL
Sbjct  158  VKVDEISQTIDSESFTVQNSVKFSGPLATTSVTTNAKFEVRSPKRVQIKFEEGIIGTPQL  217

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TD IV+P+ VEFLGQ IDL+PF G+I+S+Q+ A+SV ++IS QP LK  + N+N +SWLL
Sbjct  218  TDDIVIPDKVEFLGQNIDLSPFNGVISSIQNAAASVARTISGQPLLKIPINNTNVQSWLL  277

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPL  254
            TTYLD ELRISRG+AGS+FVL KE   L
Sbjct  278  TTYLDEELRISRGDAGSVFVLTKEGCSL  305


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLP  702
            T+AL L NGKW+LAYTSF GLFPLLS G LP
Sbjct  125  TDALALLNGKWILAYTSFSGLFPLLSSGRLP  155



>gb|AAO72593.1| fibrillin-like protein [Oryza sativa Japonica Group]
Length=319

 Score =   227 bits (578),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -2

Query  715  GAHSLWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  536
            G+    V+VEEI QTIDSE+FTVQN + FSGPLATTS+STNAKFEVRSPKRVQIKF+EGI
Sbjct  164  GSLPQLVKVEEISQTIDSENFTVQNCIKFSGPLATTSVSTNAKFEVRSPKRVQIKFDEGI  223

Query  535  IGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSN  356
            IGTPQLTDSIVLPE  E  GQ IDLTP KG+ +S+++ ASSV ++IS QPPLK  +   N
Sbjct  224  IGTPQLTDSIVLPEKFELFGQNIDLTPLKGIFSSIENAASSVARTISGQPPLKIPIRTDN  283

Query  355  AESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            AESWLLTTYLD ELRISRG+  SIFVL KE S LL
Sbjct  284  AESWLLTTYLDDELRISRGDGSSIFVLFKEGSTLL  318


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLP  702
            TEALTL NGKW+LAYTSF  LFPLL  G+LP
Sbjct  137  TEALTLLNGKWILAYTSFSQLFPLLGSGSLP  167



>gb|EEC84129.1| hypothetical protein OsI_30469 [Oryza sativa Indica Group]
Length=319

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -2

Query  715  GAHSLWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  536
            G+    V+VEEI QTIDSE+FTVQN + FSGPLATTS+STNAKFEVRSPKRVQIKF+EGI
Sbjct  164  GSLPQLVKVEEISQTIDSENFTVQNCIKFSGPLATTSVSTNAKFEVRSPKRVQIKFDEGI  223

Query  535  IGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSN  356
            IGTPQLTDSIVLPE  E  GQ IDLTP KG+ +S+++ ASSV ++IS QPPLK  +   N
Sbjct  224  IGTPQLTDSIVLPEKFELFGQNIDLTPLKGIFSSIENAASSVARTISGQPPLKIPIRTDN  283

Query  355  AESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            AESWLLTTYLD ELRISRG+  SIFVL KE S LL
Sbjct  284  AESWLLTTYLDDELRISRGDGSSIFVLFKEGSTLL  318


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLP  702
            TEALTL NGKW+LAYTSF  LFPLL  G+LP
Sbjct  137  TEALTLLNGKWILAYTSFSQLFPLLGSGSLP  167



>sp|Q6K439.1|PAP2_ORYSJ RecName: Full=Probable plastid-lipid-associated protein 2, chloroplastic; 
AltName: Full=Fibrillin-like protein 2; Flags: 
Precursor [Oryza sativa Japonica Group]
 dbj|BAD22310.1| putative chloroplast drought-induced stress protein, 34 kD [Oryza 
sativa Japonica Group]
 dbj|BAG94105.1| unnamed protein product [Oryza sativa Japonica Group]
Length=319

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE+FTVQN + FSGPLATTS+STNAKFEVRSPKRVQIKF+EGIIGTPQL
Sbjct  170  VKVEEISQTIDSENFTVQNCIKFSGPLATTSVSTNAKFEVRSPKRVQIKFDEGIIGTPQL  229

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSIVLPE  E  GQ IDLTP KG+ +S+++ ASSV ++IS QPPLK  +   NAESWLL
Sbjct  230  TDSIVLPEKFELFGQNIDLTPLKGIFSSIENAASSVARTISGQPPLKIPIRTDNAESWLL  289

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD ELRISRG+  SIFVL KE S LL
Sbjct  290  TTYLDDELRISRGDGSSIFVLFKEGSTLL  318


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLP  702
            TEALTL NGKW+LAYTSF  LFPLL  G+LP
Sbjct  137  TEALTLLNGKWILAYTSFSQLFPLLGSGSLP  167



>gb|EEE69226.1| hypothetical protein OsJ_28458 [Oryza sativa Japonica Group]
Length=319

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE+FTVQN + FSGPLATTS+STNAKFEVRSPKRVQIKF+EGIIGTPQL
Sbjct  170  VKVEEISQTIDSENFTVQNCIKFSGPLATTSVSTNAKFEVRSPKRVQIKFDEGIIGTPQL  229

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSIVLPE  E  GQ IDLTP KG+ +S+++ ASSV ++IS QPPLK  +   NAESWLL
Sbjct  230  TDSIVLPEKFELFGQNIDLTPLKGIFSSIENAASSVARTISGQPPLKIPIRTDNAESWLL  289

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD ELRISRG+  SIFVL KE S LL
Sbjct  290  TTYLDDELRISRGDGSSIFVLFKEGSTLL  318


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLP  702
            TEALTL NGKW+LAYTSF  LFPLL  G+LP
Sbjct  137  TEALTLLNGKWILAYTSFSQLFPLLGSGSLP  167



>ref|XP_002447942.1| hypothetical protein SORBIDRAFT_06g018550 [Sorghum bicolor]
 gb|EES12270.1| hypothetical protein SORBIDRAFT_06g018550 [Sorghum bicolor]
Length=330

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE+FTVQN + FSGPLATTS++TNAKFE+RSPKRVQIKFEEGI+GTPQL
Sbjct  181  VKVEEISQTIDSENFTVQNCIKFSGPLATTSVATNAKFEIRSPKRVQIKFEEGIVGTPQL  240

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSIVLPE  E  GQ IDL+P KG+ TS+++ ASSV K+IS QPPLK  +  +NAESWLL
Sbjct  241  TDSIVLPEKFELFGQNIDLSPLKGIFTSIENAASSVAKTISDQPPLKIPIRTNNAESWLL  300

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
            TTYLD ELRISRG+  SIFVL KE S LL 
Sbjct  301  TTYLDEELRISRGDGSSIFVLFKEGSTLLN  330



>gb|AFW58454.1| plastid-lipid-associated protein 2 [Zea mays]
Length=314

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDS++FTVQN + FSGPLATTS+STNAKFE+RSPKRVQIKF+EGI+GTPQL
Sbjct  165  VKVEEISQTIDSKNFTVQNCIKFSGPLATTSVSTNAKFEIRSPKRVQIKFDEGIVGTPQL  224

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDS+VLPE  E  GQ IDL+P KG+ +S+++ ASSV K+IS QPPLK  +  +NAESWLL
Sbjct  225  TDSVVLPEKFEVFGQNIDLSPLKGIFSSIENAASSVAKTISGQPPLKIPIRANNAESWLL  284

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD E+RISRGE G IFVL KE S LL
Sbjct  285  TTYLDEEVRISRGEGGGIFVLFKEGSTLL  313



>ref|XP_004956481.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic-like 
[Setaria italica]
Length=318

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE+FTVQN + FSGPLATTS+STNAKFE+RSPKRVQIKF+EG+IGTPQL
Sbjct  169  VKVEEISQTIDSETFTVQNCIKFSGPLATTSVSTNAKFEIRSPKRVQIKFDEGVIGTPQL  228

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSIVLPE  E  GQ IDL+P KG+ +S+++ ASSV  +IS QPPLK  +  +NAESWLL
Sbjct  229  TDSIVLPEKFELFGQNIDLSPLKGIFSSIENAASSVANTISGQPPLKIPIRTNNAESWLL  288

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
            TTYLD ELRISRG+  SIFVL KE S LL 
Sbjct  289  TTYLDEELRISRGDGSSIFVLFKEGSSLLN  318


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLP  702
            TEALTL NGKW+LAYTSF  LFPLL  G LP
Sbjct  136  TEALTLLNGKWILAYTSFSQLFPLLGSGRLP  166



>ref|NP_001150448.1| LOC100284078 [Zea mays]
 gb|ACF84791.1| unknown [Zea mays]
 gb|ACG39141.1| plastid-lipid-associated protein 2 [Zea mays]
 tpg|DAA37512.1| TPA: plastid-lipid-associated protein 2 [Zea mays]
Length=318

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 131/164 (80%), Gaps = 5/164 (3%)
 Frame = -2

Query  742  LLGCSHCYQGAHSLWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKR  563
            LLG  +  Q      V+VEEI QTIDSE+FTVQN + FSGPLATTS++TNAKFE+RSPKR
Sbjct  159  LLGFGNLPQ-----LVKVEEISQTIDSENFTVQNCIKFSGPLATTSVATNAKFEIRSPKR  213

Query  562  VQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPP  383
            VQIKF+EGI+GTPQLTDSIVLPE  E  GQ IDL+P KG+ +S+++ ASSV K+IS QPP
Sbjct  214  VQIKFDEGIVGTPQLTDSIVLPEKFELFGQNIDLSPLKGIFSSIENAASSVAKTISEQPP  273

Query  382  LKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            LK  +  +NAESWLLTTYLD ELRISRG+  SIFVL KE S LL
Sbjct  274  LKIPIRTNNAESWLLTTYLDEELRISRGDGSSIFVLFKEGSTLL  317



>ref|NP_001150453.1| LOC100284083 [Zea mays]
 gb|ACG39157.1| plastid-lipid-associated protein 2 [Zea mays]
Length=314

 Score =   223 bits (568),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDS++FTVQN + FSGPLATTS+STNAKFE+RSPKRVQIKF+EGI+GTPQL
Sbjct  165  VKVEEISQTIDSKNFTVQNCIKFSGPLATTSVSTNAKFEIRSPKRVQIKFDEGIVGTPQL  224

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDS+VLPE  E  GQ IDL+P KG+ +S+++ ASSV K++S QPPLK  +  +NAESWLL
Sbjct  225  TDSVVLPEKFEIFGQNIDLSPLKGIFSSIENAASSVAKTLSGQPPLKIPIRANNAESWLL  284

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD ELRISRG+ G IFVL KE S LL
Sbjct  285  TTYLDEELRISRGDGGGIFVLFKEGSTLL  313



>gb|EPS66635.1| hypothetical protein M569_08140, partial [Genlisea aurea]
Length=228

 Score =   219 bits (559),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 130/145 (90%), Gaps = 1/145 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
             ++EEI QT+DSE FTVQNS +FSGPLATTSISTN+ FE+RSPKRVQIKF  G+IGTPQ+
Sbjct  83   AKLEEISQTVDSEKFTVQNSFLFSGPLATTSISTNSTFEIRSPKRVQIKFVGGVIGTPQV  142

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLA-NSNAESWL  341
            +DSI +PE+V+ LGQKIDLTPFKGL++S+QDTAS+V K+ISSQPPL+FS+  NS  ESW+
Sbjct  143  SDSIEIPESVDILGQKIDLTPFKGLLSSVQDTASTVAKTISSQPPLEFSVPDNSYTESWI  202

Query  340  LTTYLDSELRISRGEAGSIFVLIKE  266
            LTTYLD++LRISRG+ GSIFVLIKE
Sbjct  203  LTTYLDNDLRISRGDGGSIFVLIKE  227


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSR-GTLPLGQ  693
            T+AL L NGKW+LAYT+F GLFPLLSR  +LPL +
Sbjct  50   TDALPLLNGKWILAYTTFSGLFPLLSRAASLPLAK  84



>gb|KHG06297.1| Plastid-lipid-associated, chloroplastic [Gossypium arboreum]
Length=336

 Score =   222 bits (566),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 135/149 (91%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTID+E+ TVQNSV FSGPLA++SIS +AKFEVRSP+RVQIKF+EGIIGTPQL
Sbjct  185  VKVEEISQTIDAENLTVQNSVQFSGPLASSSISASAKFEVRSPRRVQIKFQEGIIGTPQL  244

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSIVLPENVEF+GQKIDL P K L+ S+QDTAS+V K+ISS+PPLKFSL+NSN+ESWLL
Sbjct  245  TDSIVLPENVEFMGQKIDLAPIKSLLNSVQDTASTVAKTISSRPPLKFSLSNSNSESWLL  304

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD +LRISR + GS+FVLIKE S LL
Sbjct  305  TTYLDEDLRISR-DGGSVFVLIKEGSSLL  332


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            T++L L NGKW+LAYTSF GLFPLLSRG L L
Sbjct  153  TDSLPLLNGKWILAYTSFTGLFPLLSRGQLRL  184



>gb|KJB34758.1| hypothetical protein B456_006G082400 [Gossypium raimondii]
Length=338

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 134/149 (90%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTID+ES TVQNSV FSGPLA++SIS +AKFEVRSP+RVQIKF+EGIIGTPQL
Sbjct  187  VKVEEISQTIDAESLTVQNSVQFSGPLASSSISASAKFEVRSPRRVQIKFQEGIIGTPQL  246

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSIVLPENVEF+GQ IDL P KGL+ S+QDTAS+V K+ISS+PPLKFSL+NSN+ESWLL
Sbjct  247  TDSIVLPENVEFMGQNIDLAPIKGLLNSVQDTASTVAKTISSRPPLKFSLSNSNSESWLL  306

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD +LRISR + GS+FVLIKE S  L
Sbjct  307  TTYLDEDLRISR-DGGSVFVLIKEGSSFL  334


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            T++L L NGKW+LAYTSF GLFPLLSRG L L
Sbjct  155  TDSLPLLNGKWILAYTSFTGLFPLLSRGQLRL  186



>ref|XP_003575588.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Brachypodium distachyon]
Length=324

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V V+EI QTIDSE+FTVQN + FSGPLATTS+STNA+FE+RSPKRVQIKF+EGIIGTPQL
Sbjct  175  VTVDEISQTIDSENFTVQNCIKFSGPLATTSVSTNARFEIRSPKRVQIKFDEGIIGTPQL  234

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSIVLPE  EF GQ IDL+P  G+ TS+++ ASSV K+IS QPPLK  + + NA SWLL
Sbjct  235  TDSIVLPEKFEFFGQNIDLSPLSGIFTSIENAASSVAKTISGQPPLKVPIRSDNARSWLL  294

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD ELRISRG+  SIFVL KE S LL
Sbjct  295  TTYLDDELRISRGDGSSIFVLFKEGSGLL  323



>gb|EMS56479.1| putative plastid-lipid-associated protein 2, chloroplastic [Triticum 
urartu]
Length=220

 Score =   217 bits (553),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDSE+F VQN + FSGPLA+TS+STNAKFE+RSPKRVQIKFEEGIIGTPQL
Sbjct  71   VKVDEISQTIDSENFAVQNCIKFSGPLASTSVSTNAKFEIRSPKRVQIKFEEGIIGTPQL  130

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSIVLPE  EF GQ IDL+P  G+ TS+++ ASSV K+IS QPPLK    + +A SWLL
Sbjct  131  TDSIVLPEKFEFFGQNIDLSPLSGIFTSIENAASSVAKTISGQPPLKIPFRSESAGSWLL  190

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPL  254
            TTYLD+ELRISRG+  SIFVL KE S L
Sbjct  191  TTYLDAELRISRGDGSSIFVLFKEGSSL  218



>gb|EMT11511.1| Putative plastid-lipid-associated protein 2, chloroplastic [Aegilops 
tauschii]
Length=183

 Score =   215 bits (548),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = -2

Query  715  GAHSLWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  536
            G     V+V+EI QTIDSE+F VQN + FSGPLA+TS+STNAKFE+RSPKRVQIKFEEGI
Sbjct  28   GRLQALVKVDEISQTIDSENFAVQNCIKFSGPLASTSVSTNAKFEIRSPKRVQIKFEEGI  87

Query  535  IGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSN  356
            IGTPQLTDSIVLPE  E  GQ IDL+P  G+ TS+++ ASSV K+IS QPPLK    + +
Sbjct  88   IGTPQLTDSIVLPEKFELFGQNIDLSPLSGIFTSIENAASSVAKTISGQPPLKIPFRSES  147

Query  355  AESWLLTTYLDSELRISRGEAGSIFVLIKEDSPL  254
            A SWLLTTYLD+ELRISRG+  SIFVL KE S L
Sbjct  148  AGSWLLTTYLDAELRISRGDGSSIFVLFKEGSAL  181



>gb|ABK26110.1| unknown [Picea sitchensis]
 gb|ABR17902.1| unknown [Picea sitchensis]
Length=331

 Score =   220 bits (560),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI Q  DS + TV+NSV F+GPLATTS STNA FEVRSPKRVQIKFEEG+I TPQL
Sbjct  180  VKVQEISQKFDSGTLTVENSVQFAGPLATTSFSTNASFEVRSPKRVQIKFEEGVISTPQL  239

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TD+I +PE+VE LG+KIDL PFKGLI+S+Q+ ASSVVKSIS +PP+KF +    A+SWLL
Sbjct  240  TDAIEIPESVEVLGKKIDLAPFKGLISSVQNAASSVVKSISERPPIKFPIRTERAQSWLL  299

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISRG+  S+FVLIKE SPLL P
Sbjct  300  TTYLDEDLRISRGDGSSVFVLIKEGSPLLPP  330


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEAL L NGKW+L YTSF  LFPLL+ GTLPL
Sbjct  148  TEALNLLNGKWILVYTSFSELFPLLATGTLPL  179



>gb|ABR17743.1| unknown [Picea sitchensis]
 gb|ADE77567.1| unknown [Picea sitchensis]
Length=331

 Score =   219 bits (559),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI Q  DS + TV+NSV F+GPLATTS STNA FEVRSPKRVQIKFEEG+I TPQL
Sbjct  180  VKVQEISQKFDSGTLTVENSVQFAGPLATTSFSTNASFEVRSPKRVQIKFEEGVISTPQL  239

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TD+I +PE+VE LG+KIDL PFKGLI+S+Q+ ASSVVKSIS +PP+KF +    A+SWLL
Sbjct  240  TDAIEIPESVEVLGKKIDLAPFKGLISSVQNAASSVVKSISERPPIKFPIRTERAQSWLL  299

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TTYLD +LRISRG+  S+FVLIKE SPLL P
Sbjct  300  TTYLDEDLRISRGDGSSVFVLIKEGSPLLPP  330


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEAL L NGKW+L YTSF  LFPLL+ GTLPL
Sbjct  148  TEALNLLNGKWILVYTSFSELFPLLATGTLPL  179



>dbj|BAJ98727.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87659.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88297.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97495.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=313

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDSE+F VQN + FSGPLA+TS+STNAKFE+RSPKRVQIKFEEGIIGTPQL
Sbjct  164  VKVDEISQTIDSENFAVQNCIKFSGPLASTSVSTNAKFEIRSPKRVQIKFEEGIIGTPQL  223

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSIVLPE  EF GQ IDL+P  G+ TS+++ ASSV K+IS QPPLK    + +A SWLL
Sbjct  224  TDSIVLPEKFEFFGQNIDLSPLSGIFTSIENAASSVAKTISGQPPLKIPFRSESAGSWLL  283

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPL  254
            TTYLD+ELRISRG+  SIFVL KE S L
Sbjct  284  TTYLDAELRISRGDGSSIFVLFKEGSSL  311



>ref|XP_003594154.1| Plastid-lipid-associated protein [Medicago truncatula]
 gb|ABD32658.1| PAP fibrillin [Medicago truncatula]
 gb|AES64405.1| plastid lipid-associated protein [Medicago truncatula]
Length=316

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  679  CQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVL  500
             QTIDSES +VQNSV+ +GPL TTSISTNAKFEVRSP R+QIKFEEG+IGTPQLTDS+ +
Sbjct  172  SQTIDSESLSVQNSVLLAGPLTTTSISTNAKFEVRSPNRLQIKFEEGVIGTPQLTDSLEI  231

Query  499  PENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDS  320
            PE VEFLGQ+IDL+ FK + TS+Q+TASSVV++IS QPPLK  ++NS A+SWLLTTYLD 
Sbjct  232  PETVEFLGQEIDLSSFKDIFTSIQNTASSVVQTISDQPPLKIPISNSYAQSWLLTTYLDE  291

Query  319  ELRISRGEAGSIFVLIKEDSPLL  251
            ELR++RG+ GS+FVLIKE S LL
Sbjct  292  ELRVARGDGGSVFVLIKEGSSLL  314



>gb|AFK48303.1| unknown [Medicago truncatula]
Length=316

 Score =   214 bits (546),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  679  CQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVL  500
             QTIDSES +VQNSV+ +GPL TTSISTNAKFEVRSP R+QIKFEEG+IGTPQLTDS+ +
Sbjct  172  SQTIDSESLSVQNSVLLAGPLTTTSISTNAKFEVRSPNRLQIKFEEGVIGTPQLTDSLEI  231

Query  499  PENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDS  320
            PE VEFLGQ+IDL+ FK + TS+Q+TASSVV++IS QPPLK  ++NS A+SWLLTTYLD 
Sbjct  232  PETVEFLGQEIDLSSFKDIFTSIQNTASSVVQTISDQPPLKIPISNSYAQSWLLTTYLDE  291

Query  319  ELRISRGEAGSIFVLIKEDSPLL  251
            ELR++RG+ G +FVLIKE S LL
Sbjct  292  ELRVARGDGGGVFVLIKEGSSLL  314



>gb|ACJ85346.1| unknown [Medicago truncatula]
Length=315

 Score =   214 bits (546),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  676  QTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLP  497
            QTIDSE  +VQNSV+ +GPL TTSISTNAKFEVRSP R+QIKFEEG+IGTPQLTDS+ +P
Sbjct  172  QTIDSECLSVQNSVLLAGPLTTTSISTNAKFEVRSPNRLQIKFEEGVIGTPQLTDSLEIP  231

Query  496  ENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSE  317
            E VEFLGQ+IDL+ FK + TS+Q+TASSVV++IS QPPLK  ++NS A+SWLLTTYLD E
Sbjct  232  ETVEFLGQEIDLSSFKDIFTSIQNTASSVVQTISDQPPLKIPISNSYAQSWLLTTYLDEE  291

Query  316  LRISRGEAGSIFVLIKEDSPLL  251
            LR++RG+ GS+FVLIKE S LL
Sbjct  292  LRVARGDGGSVFVLIKEGSSLL  313



>gb|ACJ84978.1| unknown [Medicago truncatula]
Length=316

 Score =   214 bits (544),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  679  CQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVL  500
             QTIDSES +VQNSV+ +GPL TTSISTNAKFEVRSP R+QIKFEEG+IGTPQLTDS+ +
Sbjct  172  SQTIDSESLSVQNSVLLAGPLTTTSISTNAKFEVRSPNRLQIKFEEGVIGTPQLTDSLEI  231

Query  499  PENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDS  320
            PE VEFLGQ+IDL+ FK + TS+Q+TASSVV++IS QPPLK  ++NS A+SWLLTTYLD 
Sbjct  232  PETVEFLGQEIDLSSFKDIFTSIQNTASSVVQTISDQPPLKTPISNSYAQSWLLTTYLDE  291

Query  319  ELRISRGEAGSIFVLIKEDSPLL  251
            ELR++RG+ G +FVLIKE S LL
Sbjct  292  ELRVARGDGGGVFVLIKEGSSLL  314



>ref|XP_006849074.1| hypothetical protein AMTR_s00028p00216930 [Amborella trichopoda]
 gb|ERN10655.1| hypothetical protein AMTR_s00028p00216930 [Amborella trichopoda]
Length=322

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI QTIDSE+FTV+N+V+FSGPLATTS +TNAKF VRSPKRVQIKFEEG+IGTP+L
Sbjct  170  VKVQEISQTIDSENFTVENTVLFSGPLATTSFTTNAKFAVRSPKRVQIKFEEGVIGTPKL  229

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +P+    +GQ IDL+PF+G+I ++QD A+SV +SIS +PP KF +    AESWLL
Sbjct  230  TDSIEIPDYAVVMGQTIDLSPFRGIINTIQDAAASVARSISGRPPFKFPITTDRAESWLL  289

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TT+LD +LRISRG+A S+FVLIKE S LL
Sbjct  290  TTFLDEDLRISRGDASSVFVLIKEGSSLL  318



>ref|XP_002983947.1| hypothetical protein SELMODRAFT_156313 [Selaginella moellendorffii]
 gb|EFJ14959.1| hypothetical protein SELMODRAFT_156313 [Selaginella moellendorffii]
Length=326

 Score =   212 bits (539),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V EI QT+DS + TVQNSV F GPLATTS S +A FEVRSPKRVQIKFEEG+IGTPQL
Sbjct  174  VKVGEISQTVDSNALTVQNSVSFVGPLATTSFSASASFEVRSPKRVQIKFEEGVIGTPQL  233

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDS+ LP+ V+F+G+KIDLTP +  +  LQD A+SV +++S QPPLKFS+  + A+SWLL
Sbjct  234  TDSVELPDTVDFMGRKIDLTPAQNALRPLQDAANSVARTLSGQPPLKFSIPGNKAQSWLL  293

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD +LRISRG+ G +F+L+KE SPL+
Sbjct  294  TTYLDEDLRISRGDGGGVFLLVKEGSPLI  322


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEAL + NGKW+LAYTSF  LFPLL+ GTLPL
Sbjct  142  TEALAVLNGKWILAYTSFSELFPLLAAGTLPL  173



>ref|XP_002960725.1| hypothetical protein SELMODRAFT_163532 [Selaginella moellendorffii]
 gb|EFJ38264.1| hypothetical protein SELMODRAFT_163532 [Selaginella moellendorffii]
Length=324

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V EI QT+DS + TVQNSV F GPLATTS S +A FEVRSPKRVQIKFEEG+IGTPQL
Sbjct  172  VKVGEISQTVDSNALTVQNSVSFVGPLATTSFSASASFEVRSPKRVQIKFEEGVIGTPQL  231

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDS+ LP+ V+F+G+KIDLTP +  +  LQD A+SV +++S QPPLKFS+  + A+SWLL
Sbjct  232  TDSVELPDTVDFMGRKIDLTPAQDALRPLQDAANSVARTLSGQPPLKFSIPGNKAQSWLL  291

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD +LRISRG+ G +F+L+KE SPL+
Sbjct  292  TTYLDEDLRISRGDGGGVFLLVKEGSPLI  320


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEAL + NGKW+LAYTSF  LFPLL+ GTLPL
Sbjct  140  TEALAVLNGKWILAYTSFSELFPLLAAGTLPL  171



>ref|XP_006844495.1| hypothetical protein AMTR_s00016p00122150 [Amborella trichopoda]
 gb|ERN06170.1| hypothetical protein AMTR_s00016p00122150 [Amborella trichopoda]
Length=157

 Score =   202 bits (514),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 122/151 (81%), Gaps = 2/151 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++ EEI QTID+ESFTV+NSV+FSGPLATTS +T+AKFEVRSPKRVQ  FEEG+ GTPQL
Sbjct  7    LKAEEISQTIDAESFTVENSVLFSGPLATTSFTTHAKFEVRSPKRVQ--FEEGVFGTPQL  64

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TDSI +PENVE LGQ I+L+PF+  IT LQD A+SV +SIS   P KF +    AESWLL
Sbjct  65   TDSIEIPENVEVLGQTIELSPFREFITPLQDAATSVARSISGSTPFKFLITIDRAESWLL  124

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  245
            TT+LD +L ISRG+A S+FVLIKE S LL P
Sbjct  125  TTFLDEDLCISRGDASSVFVLIKEGSSLLPP  155



>ref|XP_009398685.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=312

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V+EI Q+ DSESFTVQNSV   GPLATTS++T+AKFEVRSPKRVQIKFEEGIIGTPQL
Sbjct  167  VKVDEISQSFDSESFTVQNSVKLLGPLATTSVTTSAKFEVRSPKRVQIKFEEGIIGTPQL  226

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            TD+IV+P+ VEFLGQ +DL+   G+  S+Q+ ASSVV++IS +PPLK  + N+  +SWLL
Sbjct  227  TDNIVIPDKVEFLGQSLDLSLLDGVFKSIQNAASSVVRTISGRPPLKIPINNA-LQSWLL  285

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSP  257
            TTYLD ELRISR  AGS+FVL K + P
Sbjct  286  TTYLDEELRISRDYAGSVFVLTKANDP  312



>ref|XP_001766233.1| predicted protein [Physcomitrella patens]
 gb|EDQ68865.1| predicted protein [Physcomitrella patens]
Length=318

 Score =   179 bits (454),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V EI Q ID+++ T++N V F GP+  TS S +A FE+RSPKR+Q+KFEEG I  P++
Sbjct  169  VKVGEITQIIDAQALTIENCVSFEGPVTATSFSASASFEIRSPKRIQVKFEEGSISAPKV  228

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            ++S  +P +++ +GQKID +  KGL+  LQD A +V +++S QPPLKFS+ N  A+SWLL
Sbjct  229  SNSAEIPSSLDIMGQKIDFSAAKGLLKPLQDAAMTVARTLSGQPPLKFSIPNDRAQSWLL  288

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD +LRISRG+ GS+FVL++E S LL
Sbjct  289  TTYLDEDLRISRGDGGSVFVLLREGSTLL  317


 Score = 51.2 bits (121),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            T ALTL NGKWVLAYTSF  LFPLL+ G LPL
Sbjct  137  TAALTLLNGKWVLAYTSFSELFPLLAAGNLPL  168



>ref|XP_008780182.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic, 
partial [Phoenix dactylifera]
Length=281

 Score =   166 bits (420),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VEEI QTIDSE+FTVQNSV F+ PLATT ++TNAKFEVRSPKRVQIKFEEGIIGTPQ+
Sbjct  182  VKVEEISQTIDSENFTVQNSVQFAEPLATTCVTTNAKFEVRSPKRVQIKFEEGIIGTPQI  241

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSI  398
            TDSIV+PE VEFLGQ IDL+PFKG+ITS+QD ASSV ++I
Sbjct  242  TDSIVIPEKVEFLGQNIDLSPFKGVITSVQDAASSVARTI  281


 Score = 50.4 bits (119),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLP  702
            TEALTL NGKW+LAYTSF  LFPLL  G LP
Sbjct  149  TEALTLLNGKWILAYTSFSPLFPLLGSGRLP  179



>gb|ABR17395.1| unknown [Picea sitchensis]
Length=436

 Score =   168 bits (425),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 109/150 (73%), Gaps = 0/150 (0%)
 Frame = -2

Query  700  WVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  521
            +V++ +I Q ID + FT++NS  +SGP AT S    A FEVRSPKR+++KFEEGII  P+
Sbjct  285  FVKLGKIFQEIDIDKFTIENSASYSGPFATFSFRALASFEVRSPKRIEVKFEEGIIPPPE  344

Query  520  LTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWL  341
            +T ++ +PE VE  GQKIDLT F+G +  LQ+ A+++ + IS QPPLK  +    A+SWL
Sbjct  345  ITSTLDIPEKVEIFGQKIDLTSFQGSLRPLQEAATNISRVISGQPPLKLPIRRDGAQSWL  404

Query  340  LTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            L TYLD +LRISRG+ G +FVL+KE S LL
Sbjct  405  LITYLDKDLRISRGDGGGLFVLVKEGSSLL  434


 Score = 42.7 bits (99),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEA +L  GKWVL YTSF  L PL++ GTLP 
Sbjct  254  TEAPSLLQGKWVLVYTSFSELLPLIAAGTLPF  285



>ref|XP_010270045.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Nelumbo nucifera]
Length=349

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 122/181 (67%), Gaps = 24/181 (13%)
 Frame = -2

Query  724  CYQGAHSLWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFE  545
            C +G   + V+VEEI QTIDS SFT+ N V F  PL+TTS  TNAKFEVRSPKR+Q+ FE
Sbjct  168  CTRGKLPM-VKVEEISQTIDSSSFTLNNEVQFICPLSTTSFRTNAKFEVRSPKRIQVWFE  226

Query  544  EGI--------------------IGTPQLTDSIVLPENVEFLGQKID--LTPFKGLITSL  431
            E I                    I +PQLTD++ +PE VEF+ QK+   L P    I S+
Sbjct  227  ENITITSQTTEPVGQTLRLRLCPIISPQLTDAVEIPETVEFVRQKLGFCLCPLNATIRSV  286

Query  430  QDTASSVVKSISSQPPLKFSLANSNAE-SWLLTTYLDSELRISRGEAGSIFVLIKEDSPL  254
            ++TASSVV+ ISSQ  LK   +N+N++ SWLLTTYLD+ELRI+RG+ G++FVLIKE S L
Sbjct  287  KNTASSVVRIISSQLLLKVLSSNTNSQSSWLLTTYLDNELRIARGDGGNVFVLIKEGSSL  346

Query  253  L  251
            L
Sbjct  347  L  347



>ref|XP_006854055.1| hypothetical protein AMTR_s00048p00085290 [Amborella trichopoda]
 gb|ERN15522.1| hypothetical protein AMTR_s00048p00085290 [Amborella trichopoda]
Length=479

 Score =   160 bits (406),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 108/149 (72%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            + +E+ICQ I+++SFTVQNS+ +S PLAT S S +A FEVRSP R+Q+KFEEG+   P++
Sbjct  330  LELEKICQEINTKSFTVQNSITYSSPLATFSFSASASFEVRSPSRIQVKFEEGVFNPPEI  389

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
                 LP  V+  GQ IDL+P   +++ L++  +++ ++IS QPPLK  +    +ESWLL
Sbjct  390  RTPADLPTKVDVFGQSIDLSPLSSVLSPLEEGFANISRAISGQPPLKLRIPGQGSESWLL  449

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
             +YLD +LRISRG+ G +FVL+KE SPLL
Sbjct  450  ISYLDKDLRISRGDGG-LFVLVKEGSPLL  477


 Score = 42.7 bits (99),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TE+L+L +G WVL YT+F  L PL++ GTLPL
Sbjct  298  TESLSLLDGNWVLRYTAFSELLPLIAAGTLPL  329



>ref|XP_001756848.1| predicted protein [Physcomitrella patens]
 gb|EDQ78445.1| predicted protein, partial [Physcomitrella patens]
Length=242

 Score =   155 bits (393),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 114/155 (74%), Gaps = 7/155 (5%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRV------QIKFEEGI  536
            V V E+ QTID+++ +V+NSV+F  P+ TTS  T+  FE+RSPK +      Q+K EEGI
Sbjct  88   VEVAEVSQTIDAQALSVENSVLFESPV-TTSFGTSVFFEIRSPKLIVLLLWFQVKLEEGI  146

Query  535  IGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSN  356
            I +P++ DS  +P N++ +GQKIDL+   GL+  LQD A+++++++S QPPLKFS+ N  
Sbjct  147  ISSPKVRDSAEIPSNLDIMGQKIDLSFAMGLLKPLQDVATTIIRNLSGQPPLKFSIQNDR  206

Query  355  AESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            A+SWLLTT+L+ +LRISR + GS+FV ++E + LL
Sbjct  207  AQSWLLTTFLEEDLRISRIDGGSMFVFLREGTTLL  241


 Score = 44.3 bits (103),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            T++L+L NGKW+L YTS+  L+PLL+ G LPL
Sbjct  56   TDSLSLLNGKWILLYTSYSELYPLLAAGNLPL  87



>ref|XP_010276838.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic 
[Nelumbo nucifera]
Length=446

 Score =   159 bits (402),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 105/149 (70%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            + ++ ICQ ID++S T++NS   S P AT S S +A FEVRSP R+Q++F+EG    P++
Sbjct  297  LEIKRICQKIDTKSLTIENSTSLSSPFATFSFSASATFEVRSPSRIQVQFKEGAFQPPEI  356

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              +  LPEN++  GQKIDL+P +  +  LQD  +SV ++IS QPPLK  +    ++SWL+
Sbjct  357  KSTFHLPENIDVFGQKIDLSPVQRSLNPLQDAVASVSRAISGQPPLKLPIPGERSQSWLI  416

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD +LRISRG+ G +F+L KE SPLL
Sbjct  417  TTYLDEDLRISRGDGG-LFILAKEGSPLL  444



>gb|KDP30383.1| hypothetical protein JCGZ_17112 [Jatropha curcas]
Length=382

 Score =   155 bits (392),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 108/156 (69%), Gaps = 2/156 (1%)
 Frame = -2

Query  715  GAHSLWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  536
            GA  L ++VE I Q ID+ + ++ NS   S P AT S S +A FEVRSP R+Q++F+EG 
Sbjct  228  GATPL-LKVERISQAIDTSNLSIVNSTTLSSPFATFSFSASASFEVRSPSRIQVEFKEGT  286

Query  535  IGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSN  356
            +  P++  SI LPEN++  GQKI+L+P +  +  LQ+ A+++ ++IS QPPLK  +  S 
Sbjct  287  LQPPEIKSSIDLPENLDIFGQKINLSPVQQSLNPLQEVAANIARTISGQPPLKIPIPGSR  346

Query  355  AESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
              SWLL TYLD +LRISRG+ G +FVL+KE SPLL 
Sbjct  347  TRSWLLITYLDDDLRISRGDGG-LFVLVKEGSPLLN  381



>ref|XP_002297709.2| hypothetical protein POPTR_0001s02040g [Populus trichocarpa]
 gb|EEE82514.2| hypothetical protein POPTR_0001s02040g [Populus trichocarpa]
Length=349

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 109/156 (70%), Gaps = 2/156 (1%)
 Frame = -2

Query  715  GAHSLWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  536
            GA  L ++V+ I QTIDS + ++ NS   S P AT S S +A FEVR+P R+Q++F+EG 
Sbjct  195  GATPL-LKVKSISQTIDSSNLSIVNSTTLSSPFATFSFSASATFEVRTPSRIQVEFKEGT  253

Query  535  IGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSN  356
            +  P++  +I LPENVE  GQKI+L+P +  +  LQ+ A+++ ++IS QPPLK  +    
Sbjct  254  LQPPEINSNIDLPENVELFGQKINLSPVQQSLNPLQEAAANIGRTISGQPPLKVPIPGKQ  313

Query  355  AESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
            A SWLL TYLD +LRISRG+ G +FVL KE SPLL+
Sbjct  314  ASSWLLITYLDEDLRISRGDGG-LFVLAKEGSPLLE  348



>ref|XP_002304354.1| hypothetical protein POPTR_0003s09460g [Populus trichocarpa]
 gb|EEE79333.1| hypothetical protein POPTR_0003s09460g [Populus trichocarpa]
Length=373

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 109/151 (72%), Gaps = 1/151 (1%)
 Frame = -2

Query  700  WVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  521
            +++V+ I QTID+ S ++ NS   SGP AT S S +A FE R+P R+Q++F+EG++  PQ
Sbjct  223  FLKVKSISQTIDASSLSIVNSTTLSGPFATFSFSASATFEFRTPSRIQVEFKEGVLQPPQ  282

Query  520  LTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWL  341
            +  S+ LPENV+  GQKI+L+P +  +  LQ+ A+++ ++IS QPPLK  +  + A +WL
Sbjct  283  INSSVELPENVDLFGQKINLSPIQQSLGPLQEAAANIGRTISGQPPLKVPIPGNRASTWL  342

Query  340  LTTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
            L TYLD +L+ISRG+ G +FVL KE SPLL+
Sbjct  343  LITYLDEDLQISRGDGG-LFVLAKEGSPLLE  372



>gb|AFA36496.1| fibrillin-like protein, partial [Lolium perenne]
Length=104

 Score =   145 bits (367),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = -2

Query  559  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPL  380
            QIKF+EGIIGTPQLTDSIVLPE  EF GQ IDLTP  G+ TS+++ ASSV K+IS QPPL
Sbjct  1    QIKFDEGIIGTPQLTDSIVLPEKFEFFGQNIDLTPLSGIFTSIENAASSVAKTISGQPPL  60

Query  379  KFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            K  +++  A SWLLTTYLD ELRISRG+  SIFVL KE S LL
Sbjct  61   KIPISSDKAGSWLLTTYLDDELRISRGDGSSIFVLFKEGSTLL  103



>ref|XP_010245209.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic-like 
[Nelumbo nucifera]
Length=376

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 100/148 (68%), Gaps = 1/148 (1%)
 Frame = -2

Query  694  RVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLT  515
            +++ ICQ ID++S  ++NS   S P AT S S +A FEVR P ++Q+KF EG    P++ 
Sbjct  228  KIKRICQKIDTKSLAIENSTALSSPFATFSFSASATFEVRGPSKMQVKFTEGAFQPPEIK  287

Query  514  DSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLT  335
             ++ LPENVE  GQKIDL P +  +  LQD  +S+ ++IS QPPLK  +    ++SWL+ 
Sbjct  288  STVDLPENVEIFGQKIDLAPIQQSLKPLQDAVASISRAISGQPPLKLPIPGERSQSWLII  347

Query  334  TYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TYLD +LRISRG+ G +F+L KE S LL
Sbjct  348  TYLDKDLRISRGDGG-LFILAKEGSSLL  374



>gb|ACG36654.1| plastid-lipid-associated protein 2 [Zea mays]
Length=262

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 88/109 (81%), Gaps = 5/109 (5%)
 Frame = -2

Query  742  LLGCSHCYQGAHSLWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKR  563
            LLG  +  Q      V+VEEI QTIDSE+FTVQN + FSGPLATTS++TNAKFE+RSPKR
Sbjct  159  LLGFGNLPQ-----LVKVEEISQTIDSENFTVQNCIKFSGPLATTSVATNAKFEIRSPKR  213

Query  562  VQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTAS  416
            VQIKF+EGI+GTPQLTDSIVLPE  E  GQ IDL+P KG+ +S+++ AS
Sbjct  214  VQIKFDEGIVGTPQLTDSIVLPEKFELFGQNIDLSPLKGIFSSIENAAS  262



>ref|XP_009608239.1| PREDICTED: plastoglobulin-1, chloroplastic isoform X2 [Nicotiana 
tomentosiformis]
Length=341

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 105/149 (70%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VE+I Q ID+ +FT++NS   S P+AT S S  A FEVRSP R+Q++F+EG    P++
Sbjct  193  VKVEKISQGIDTSNFTIENSTTLSSPVATLSFSATATFEVRSPSRIQVEFKEGNFKPPEI  252

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              +I LPENV+  GQKI L+P +  ++ L++  + + ++IS QPPLK  +     +SWLL
Sbjct  253  KSNIELPENVDVFGQKISLSPVQQSLSPLENAVAGIARTISGQPPLKIPIPGERTKSWLL  312

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD +LRIS+G+ G +FVL+KE S LL
Sbjct  313  TTYLDKDLRISKGDGG-LFVLVKEGSSLL  340



>ref|XP_009608213.1| PREDICTED: plastoglobulin-1, chloroplastic isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009608224.1| PREDICTED: plastoglobulin-1, chloroplastic isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009608233.1| PREDICTED: plastoglobulin-1, chloroplastic isoform X1 [Nicotiana 
tomentosiformis]
Length=354

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 105/149 (70%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VE+I Q ID+ +FT++NS   S P+AT S S  A FEVRSP R+Q++F+EG    P++
Sbjct  206  VKVEKISQGIDTSNFTIENSTTLSSPVATLSFSATATFEVRSPSRIQVEFKEGNFKPPEI  265

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              +I LPENV+  GQKI L+P +  ++ L++  + + ++IS QPPLK  +     +SWLL
Sbjct  266  KSNIELPENVDVFGQKISLSPVQQSLSPLENAVAGIARTISGQPPLKIPIPGERTKSWLL  325

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD +LRIS+G+ G +FVL+KE S LL
Sbjct  326  TTYLDKDLRISKGDGG-LFVLVKEGSSLL  353



>ref|XP_011018504.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic-like 
isoform X1 [Populus euphratica]
Length=369

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 108/156 (69%), Gaps = 2/156 (1%)
 Frame = -2

Query  715  GAHSLWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  536
            GA  L ++V+ I QTIDS + ++ N    S P AT S S +A F+VR+P R+Q++F+EG 
Sbjct  215  GATPL-LKVKSISQTIDSSNLSIVNKTTLSSPFATFSFSASATFDVRTPSRIQVEFKEGT  273

Query  535  IGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSN  356
            +  P++  +I LPENVE  GQKI+L+P +  +  LQ+ A+++ ++IS QPPLK  +    
Sbjct  274  LQPPEINSNIGLPENVELFGQKINLSPVQQSLNPLQEAAANIGRTISGQPPLKVPIPGQQ  333

Query  355  AESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
            A SWLL TYLD +LRISRG+ G +FVL KE SPLL+
Sbjct  334  ASSWLLITYLDEDLRISRGDGG-LFVLAKEGSPLLE  368



>emb|CBI33829.3| unnamed protein product [Vitis vinifera]
Length=273

 Score =   148 bits (374),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 104/149 (70%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V+ ICQ+I++ S T+ NS   S P AT S S +A FEVRSP R+Q++F+EG +  P++
Sbjct  123  LKVKSICQSIETSSRTIVNSTTLSSPFATFSFSASATFEVRSPSRIQVQFKEGTLQPPEI  182

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              S+ LPENV+  GQKI+L+  +  +  LQ+  +S+ ++IS QPPLK  +    + SWLL
Sbjct  183  KSSLNLPENVDVFGQKINLSAVQQYLNPLQEAVASISRAISGQPPLKVPIPGERSSSWLL  242

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
             TYLD ++RISRG+ G +FVL +E SPLL
Sbjct  243  ITYLDKDIRISRGDGG-LFVLAREGSPLL  270



>ref|XP_008448650.1| PREDICTED: plastoglobulin-1, chloroplastic [Cucumis melo]
 ref|XP_008448651.1| PREDICTED: plastoglobulin-1, chloroplastic [Cucumis melo]
 ref|XP_008448652.1| PREDICTED: plastoglobulin-1, chloroplastic [Cucumis melo]
Length=367

 Score =   150 bits (379),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 103/149 (69%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VE+I Q IDS++FT+ NS   S P  T S S +A FEVRSP R+Q++F+EGI+  P++
Sbjct  218  VKVEKITQEIDSKTFTIVNSTTLSSPFTTFSFSASAAFEVRSPSRIQVQFKEGILQPPEI  277

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
               + LPEN++  GQK++L+P +  +  +Q T +S+ + IS QPPLK  +      SWLL
Sbjct  278  KSRLDLPENIDIFGQKVNLSPVQQTLNPVQQTVASLFQVISGQPPLKIPIPGDRNRSWLL  337

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
             TYLD +LRISRG+ G +FVL+KE S LL
Sbjct  338  ITYLDEDLRISRGDGG-LFVLVKEGSALL  365



>ref|XP_009804524.1| PREDICTED: light-induced protein, chloroplastic-like [Nicotiana 
sylvestris]
Length=124

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/79 (89%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            VRVEEI QTIDSE+F VQN VVF+GPLATTSI+TNAKFEV+SPKRVQIKF+EGIIGTPQL
Sbjct  46   VRVEEISQTIDSETFAVQNCVVFAGPLATTSITTNAKFEVKSPKRVQIKFDEGIIGTPQL  105

Query  517  TDSIVLPENVEFLGQKIDL  461
            TDSI LPENVEFLGQKIDL
Sbjct  106  TDSIELPENVEFLGQKIDL  124



>ref|XP_009789727.1| PREDICTED: plastoglobulin-1, chloroplastic-like, partial [Nicotiana 
sylvestris]
Length=184

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 101/149 (68%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++VE I Q I + + T++NS   S P AT+S S NA FEVRSP R+Q++F+EG +  P++
Sbjct  35   LKVENISQAISTSNLTIENSTTLSSPFATSSFSANAAFEVRSPSRIQVEFKEGTVNPPEV  94

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
               I LPENV+  GQ I L+P +  +  L++  + + ++IS  PPLK  +     +SWL+
Sbjct  95   KSKIDLPENVDIFGQTISLSPIQQSLGPLENVVAGIARAISGLPPLKIPIPGERTKSWLI  154

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD +LRISRG+ G +FVL+KE+S L+
Sbjct  155  TTYLDKDLRISRGDGG-LFVLVKEESSLI  182



>ref|XP_004300209.1| PREDICTED: plastoglobulin-1, chloroplastic [Fragaria vesca subsp. 
vesca]
Length=352

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 106/151 (70%), Gaps = 1/151 (1%)
 Frame = -2

Query  700  WVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  521
            +++V++I Q+ID+ S T+ NS+  SGP AT S S +A FEVRSP R+Q++F+EG    P 
Sbjct  202  FLKVDKINQSIDTSSLTILNSITLSGPFATFSFSASASFEVRSPSRIQVQFKEGTFQPPD  261

Query  520  LTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWL  341
            +  SI LP+ VE  GQ+I+L+P +  ++ LQ+ A+S+ ++IS Q  LK  +     +SWL
Sbjct  262  IKSSIDLPQEVEIFGQRINLSPVQQALSPLQEVAASISRTISGQQSLKVPIPGERTQSWL  321

Query  340  LTTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
            LTTYLD + RISRG+ G +FVL KE SPLL+
Sbjct  322  LTTYLDEDFRISRGDGG-LFVLAKEGSPLLE  351



>ref|XP_002276479.1| PREDICTED: plastoglobulin-1, chloroplastic [Vitis vinifera]
Length=382

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 104/149 (70%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V+ ICQ+I++ S T+ NS   S P AT S S +A FEVRSP R+Q++F+EG +  P++
Sbjct  232  LKVKSICQSIETSSRTIVNSTTLSSPFATFSFSASATFEVRSPSRIQVQFKEGTLQPPEI  291

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              S+ LPENV+  GQKI+L+  +  +  LQ+  +S+ ++IS QPPLK  +    + SWLL
Sbjct  292  KSSLNLPENVDVFGQKINLSAVQQYLNPLQEAVASISRAISGQPPLKVPIPGERSSSWLL  351

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
             TYLD ++RISRG+ G +FVL +E SPLL
Sbjct  352  ITYLDKDIRISRGDGG-LFVLAREGSPLL  379



>ref|XP_008238187.1| PREDICTED: plastoglobulin-1, chloroplastic [Prunus mume]
Length=353

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 104/149 (70%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V +I Q+ID+ S T+ NS   SGP AT S S +A FEVRSP R+Q++F+EG +  P++
Sbjct  204  LKVSKIGQSIDTSSLTIVNSTTLSGPFATFSFSASASFEVRSPSRIQVEFKEGSVLPPKI  263

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              S+ LP+ V+  GQKI+L+P +  +  LQ+  +S+ ++IS QPP K S+     +SWLL
Sbjct  264  KSSVDLPQEVDIFGQKINLSPVQRTLNPLQEAVASISRAISGQPPFKVSIPGERTKSWLL  323

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
             TYLD +LRISRG+ G +FVL +E SPL+
Sbjct  324  ITYLDEDLRISRGDGG-LFVLAREGSPLI  351



>ref|XP_007209304.1| hypothetical protein PRUPE_ppa007851mg [Prunus persica]
 gb|EMJ10503.1| hypothetical protein PRUPE_ppa007851mg [Prunus persica]
Length=353

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 104/149 (70%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V +I Q+ID+ S T+ NS   SGP AT S S +A FEVRSP R+Q++F+EG +  P++
Sbjct  204  LKVSKIGQSIDTSSLTIVNSTTLSGPFATFSFSASASFEVRSPSRIQVEFKEGSVLPPKI  263

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              S+ LP+ V+  GQKI+L+P +  +  LQ+  +S+ ++IS QPP K S+     +SWLL
Sbjct  264  KSSVDLPQEVDIFGQKINLSPVQRTLNPLQEAVASISRAISGQPPFKVSIPGERTKSWLL  323

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
             TYLD +LRISRG+ G +FVL +E SPL+
Sbjct  324  ITYLDEDLRISRGDGG-LFVLAREGSPLI  351



>ref|XP_010053632.1| PREDICTED: plastoglobulin-1, chloroplastic [Eucalyptus grandis]
 gb|KCW77976.1| hypothetical protein EUGRSUZ_D02221 [Eucalyptus grandis]
Length=360

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 102/150 (68%), Gaps = 1/150 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++VE+I Q++D+ + T+ NS   S P AT S S +A FE+RSP R+Q++F+EG    P++
Sbjct  212  LKVEKISQSVDTSNLTIVNSTTLSSPFATLSFSASAAFEIRSPSRIQVEFKEGTFQPPEI  271

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              +I LPE+V   GQ I+L P +  I+ LQ+  +S+ ++IS QPPLK  +      SWLL
Sbjct  272  KPTIDLPESVNLFGQNINLMPVQQSISPLQEAVASLSRAISGQPPLKLPIPGERTRSWLL  331

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
             TYLD ++RISRG+ G +FVL+KE SPLL 
Sbjct  332  ITYLDKDMRISRGDGG-LFVLVKEGSPLLN  360



>ref|XP_011028127.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic 
[Populus euphratica]
Length=373

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 109/156 (70%), Gaps = 2/156 (1%)
 Frame = -2

Query  715  GAHSLWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  536
            GA  L ++V+ I QTID+ S ++ NS   SGP AT S S +A FE R+P R++++F+EG+
Sbjct  219  GATPL-LKVKSISQTIDASSLSIVNSTTLSGPFATFSFSASATFEFRTPSRIRVEFKEGV  277

Query  535  IGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSN  356
            +  PQ+  S+ LPEN +  GQKI+L+P +  +  LQ+ A+++ ++IS QPPLK  +  + 
Sbjct  278  LQPPQINSSVELPENFDLFGQKINLSPIQQSLGPLQEAAANIGRTISGQPPLKVPIPGNR  337

Query  355  AESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
              +WLL TYLD +L+ISRG+ G +F+L KE SPLL+
Sbjct  338  VSTWLLITYLDEDLQISRGDGG-LFILAKEGSPLLE  372



>ref|XP_006367875.1| PREDICTED: plastoglobulin-1, chloroplastic-like [Solanum tuberosum]
Length=204

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 102/149 (68%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++VE+I QTI   S T++NS   S P+AT+S S  A FEV+SP R+Q++F+EG    P++
Sbjct  56   LKVEKISQTISMSSLTIENSTTLSSPVATSSFSATAVFEVQSPSRIQVEFKEGTFKPPEI  115

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
               I LP+NV+  GQ I L+P +  +  L++  + + ++ISS PPLK  +     +SWL+
Sbjct  116  KSKIDLPKNVDIFGQNISLSPLQQSLGPLENVVAGIARNISSMPPLKVPIPGERTKSWLI  175

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLDS+LRISRG+ G +FVL+KE S LL
Sbjct  176  TTYLDSDLRISRGDGG-LFVLVKEQSSLL  203



>gb|EYU19055.1| hypothetical protein MIMGU_mgv1a026687mg, partial [Erythranthe 
guttata]
Length=168

 Score =   142 bits (358),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 101/149 (68%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VE+I Q+ID+ S T+ NSV  S P++T S S +A FEVR+P R+Q++F++G    P++
Sbjct  19   VKVEKIVQSIDTSSLTIDNSVTLSSPVSTLSFSASASFEVRTPSRIQVEFKQGTFKPPEI  78

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              SI LPE++   GQ I L+  +  ++ L++    + ++IS QP LK  +     +SWLL
Sbjct  79   KSSIDLPESINIFGQNISLSSVQQYMSPLENAVEGLARTISGQPSLKIPIPGEGTKSWLL  138

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD + RISRG+ G +FVL+KE SPLL
Sbjct  139  TTYLDKDFRISRGDGG-LFVLVKEGSPLL  166



>ref|XP_008800089.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic 
isoform X1 [Phoenix dactylifera]
Length=402

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 108/155 (70%), Gaps = 2/155 (1%)
 Frame = -2

Query  715  GAHSLWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  536
            GA  L +++++I Q ID+++ T+ N+ + S P AT S S +A FEVRSP R+Q++F+EG 
Sbjct  246  GATPL-LKIKKISQAIDTKNMTIVNATMLSSPFATFSFSASASFEVRSPSRIQVQFKEGT  304

Query  535  IGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSN  356
               P+++ ++ LPE V   GQ IDL P +  +  +Q+  +++ ++IS QPPLK  L  ++
Sbjct  305  FQPPEISSTVDLPEKVNIFGQLIDLKPVQQTLNPVQENIANITRAISGQPPLKVPLPGNS  364

Query  355  AESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            A+SWLLTTYLD + RISRG+ G +FVL KE SPLL
Sbjct  365  AQSWLLTTYLDQDFRISRGDGG-LFVLAKEGSPLL  398



>ref|XP_004148751.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004165579.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55727.1| hypothetical protein Csa_3G008840 [Cucumis sativus]
Length=363

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 102/149 (68%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VE+I Q IDS + T+ NS   S P  T S S +A FEVRSP R+Q++F+EGI+  P++
Sbjct  214  VKVEKITQEIDSNTLTIVNSTTLSSPFTTFSFSASAAFEVRSPSRIQVQFKEGILQPPEI  273

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
               + LPEN++  GQK++L+P +  +  +Q T +S+ + IS QPPLK  +     +SWLL
Sbjct  274  KSRLDLPENIDIFGQKVNLSPVQQTLDPVQQTVASLFQVISGQPPLKIPIPGDRNKSWLL  333

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
             TYLD +LRISRG+ G +FVL+KE S LL
Sbjct  334  ITYLDEDLRISRGDGG-LFVLVKEGSALL  361



>ref|XP_010096934.1| putative plastid-lipid-associated protein 3 [Morus notabilis]
 gb|EXB66511.1| putative plastid-lipid-associated protein 3 [Morus notabilis]
Length=368

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 102/149 (68%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V++ICQ+ID+ + T+ NS   S P++T S S  A FEVRSP R+Q++F+EG    P++
Sbjct  219  LKVDKICQSIDTSNLTIVNSTTLSSPVSTFSFSATATFEVRSPFRIQVQFKEGTFQAPEI  278

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              S+ LP  V+  GQKI L+P +  +  +Q+ A+++ ++IS QPPL+  +     +SWLL
Sbjct  279  KSSVDLPREVDIFGQKISLSPLQQTLNPIQEAAANISRAISGQPPLRLPIPGERTQSWLL  338

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
             TYLD + RISRG+ G +FVL KE SPLL
Sbjct  339  ITYLDEDFRISRGDGG-LFVLAKEGSPLL  366



>ref|XP_009766235.1| PREDICTED: plastoglobulin-1, chloroplastic [Nicotiana sylvestris]
 ref|XP_009766236.1| PREDICTED: plastoglobulin-1, chloroplastic [Nicotiana sylvestris]
 ref|XP_009766237.1| PREDICTED: plastoglobulin-1, chloroplastic [Nicotiana sylvestris]
Length=342

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 102/149 (68%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VE+I Q ID+ +FT++NS   S  +AT S S  A FEVRSP R+Q++F+EG    P++
Sbjct  194  VKVEKISQGIDTSNFTIENSTALSSLVATLSFSATATFEVRSPSRIQVEFKEGNFKPPEI  253

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              +I LPENV+  GQKI L+P +  +  L+   + + ++IS QPPLK  +     +SWLL
Sbjct  254  KSNIELPENVDVFGQKISLSPMQQSLGPLEYAVAGIARTISGQPPLKIPIPGERTKSWLL  313

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD +LRIS+G+ G IFVL+KE S LL
Sbjct  314  TTYLDKDLRISKGDGG-IFVLVKEGSSLL  341



>gb|EMS55390.1| putative plastid-lipid-associated protein 3, chloroplastic [Triticum 
urartu]
Length=325

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 100/151 (66%), Gaps = 1/151 (1%)
 Frame = -2

Query  700  WVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  521
            + RV++I Q IDS S T+ N+   S P A+ S S  A FEV++P R++++F+EG    P+
Sbjct  174  FTRVDKISQEIDSRSMTIINASTISTPFASFSFSATASFEVQTPSRIEVQFKEGSFQPPE  233

Query  520  LTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSN-AESW  344
            ++ S+ LPE +   GQK  L P K L+  LQ   +S+  SIS QPPLK  +   N A+SW
Sbjct  234  ISSSVNLPEQIAIFGQKFSLGPVKELLEPLQRAFASIAGSISGQPPLKVPIPGDNKAKSW  293

Query  343  LLTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            LLTTYLD +LRIS+G+ G +F+L KE SPLL
Sbjct  294  LLTTYLDKDLRISKGDGGGVFILAKEGSPLL  324



>gb|ABC96720.1| plastid fibrillin 2 [Coffea canephora]
Length=229

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 106/149 (71%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VE+I Q+++S S T+ NS   SGP+A+ S S +A FEVRSP R+Q++F+EG +  P++
Sbjct  80   VKVEKISQSVNSSSLTIDNSTTISGPVASLSFSASAAFEVRSPSRIQVQFKEGTLNPPEI  139

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              SI LPE+V+  GQKI+L+P +  +  LQ+  + + ++IS QPPLK  +    A+SWLL
Sbjct  140  KSSIDLPEDVDIFGQKINLSPVQQSLNPLQNAVAGIGRAISGQPPLKIPIPGERAKSWLL  199

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
             TYLD +LRISRG+ G +FVL KE S LL
Sbjct  200  ITYLDKDLRISRGDGG-LFVLAKEGSTLL  227



>ref|XP_011082345.1| PREDICTED: plastoglobulin-1, chloroplastic [Sesamum indicum]
Length=359

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 103/149 (69%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VE+I Q+ID+ S T++NS+  S P++T S S +A FEVRSP R+Q++F+EG    P++
Sbjct  210  VKVEKIGQSIDTSSLTIENSITLSSPVSTLSFSASASFEVRSPTRIQVEFKEGTFKPPEI  269

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              SI LPE++   GQ I+L+  +  ++ LQ+    + ++IS QPPLK  +     +SWLL
Sbjct  270  KSSIDLPESINVFGQNINLSSIQQSLSPLQNAVEGIARTISGQPPLKIPIPGERTKSWLL  329

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
             TYLD +LRISRG+ G +FVL+KE S LL
Sbjct  330  ITYLDKDLRISRGDGG-LFVLVKEGSALL  357



>ref|XP_009619935.1| PREDICTED: plastoglobulin-1, chloroplastic-like [Nicotiana tomentosiformis]
Length=427

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 105/150 (70%), Gaps = 1/150 (1%)
 Frame = -2

Query  700  WVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  521
            +++VE+I QTI + S T+++S   S P+AT+S S  A FEVRSP R+Q++F+EG    P+
Sbjct  277  FLKVEKISQTISTSSLTIESSTTLSSPVATSSFSATAAFEVRSPSRIQVQFKEGTFNPPE  336

Query  520  LTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWL  341
            +   I LPENV+  GQKI L+P +  +  L++  +++ ++IS  PPLK  +     +SWL
Sbjct  337  VKSKINLPENVDIFGQKISLSPVQQSLGPLENAVAAIARAISGLPPLKIPIPGERTKSWL  396

Query  340  LTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            +TTYLD +LRISRG+ G +FVL+KE+S LL
Sbjct  397  ITTYLDKDLRISRGDGG-LFVLVKEESSLL  425



>dbj|BAJ85307.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=371

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 100/151 (66%), Gaps = 1/151 (1%)
 Frame = -2

Query  700  WVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  521
            + RV++I Q IDS S T+ N+     P A+ S S  A FEV++P R++++F+EG    P+
Sbjct  220  FARVDKISQEIDSRSMTIINASTILTPFASFSFSATASFEVQTPSRIEVQFKEGSFHPPE  279

Query  520  LTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSN-AESW  344
            ++ S+ LPE +   GQKI L P K L+  LQ   +S+  SIS QPPLK  +   N A+SW
Sbjct  280  ISSSVNLPEQIAIFGQKISLGPVKQLLEPLQRAFASIAGSISGQPPLKVPIPGDNKAKSW  339

Query  343  LLTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            LLTTYLD +LRIS+G+ G +F+L KE SPLL
Sbjct  340  LLTTYLDKDLRISKGDGGGVFILAKEGSPLL  370



>ref|XP_006662632.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic-like 
[Oryza brachyantha]
Length=330

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 105/156 (67%), Gaps = 3/156 (2%)
 Frame = -2

Query  715  GAHSLWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  536
            GA  L+ +V+EI Q +D++S T+ N+   S P A+ S S  A F+V+SP RVQ++F+EG 
Sbjct  174  GAAPLF-KVDEISQEVDTKSMTIVNASTISSPFASLSFSATASFDVQSPSRVQVQFKEGS  232

Query  535  IGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSL-ANS  359
               P+++ S+ LP  V+  GQKI L P + ++  LQ   +S+  SIS QPPLK  +  N+
Sbjct  233  FQPPKISSSVDLPAEVDIFGQKISLGPVQQVLNPLQQAFASIAGSISGQPPLKLQIPGNN  292

Query  358  NAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
               SWLLTTYLD +LRISRG+ G +F+L+KE SPLL
Sbjct  293  RGRSWLLTTYLDKDLRISRGDGG-LFILVKEGSPLL  327



>dbj|BAJ98223.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=371

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 100/151 (66%), Gaps = 1/151 (1%)
 Frame = -2

Query  700  WVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  521
            + RV++I Q IDS S T+ N+     P A+ S S  A FEV++P R++++F+EG    P+
Sbjct  220  FARVDKISQEIDSRSMTIINASTILTPFASFSFSATASFEVQTPSRIEVQFKEGSFQPPE  279

Query  520  LTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSN-AESW  344
            ++ S+ LPE +   GQKI L P K L+  LQ   +S+  SIS QPPLK  +   N A+SW
Sbjct  280  ISSSVNLPEQIAIFGQKISLGPVKQLLEPLQRAFASIAGSISGQPPLKVPIPGDNKAKSW  339

Query  343  LLTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            LLTTYLD +LRIS+G+ G +F+L KE SPLL
Sbjct  340  LLTTYLDKDLRISKGDGGGVFILAKEGSPLL  370



>gb|KHG16773.1| Plastid lipid-associated 3, chloroplastic [Gossypium arboreum]
Length=367

 Score =   144 bits (364),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 108/156 (69%), Gaps = 2/156 (1%)
 Frame = -2

Query  715  GAHSLWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  536
            GA  L ++V+ I Q+ID+ S ++ NS   SGP A  S S +A FEVRSP R+Q++F+EGI
Sbjct  213  GATPL-LKVKSISQSIDTASQSIVNSTTLSGPFADLSFSASATFEVRSPSRIQVEFKEGI  271

Query  535  IGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSN  356
            +  P++  S+ LP +++  GQ+I L+P +  +  LQD  +++ ++IS QPPLK  +  + 
Sbjct  272  VQPPEIKPSVDLPADIDVFGQRISLSPVQQSLGPLQDLVANISRTISGQPPLKIPIPGNR  331

Query  355  AESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
            + SWLL TYLD +LRISRG+ G +FVL ++ SPLL+
Sbjct  332  SSSWLLITYLDEDLRISRGDGG-LFVLARQGSPLLE  366



>ref|XP_010235051.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic 
[Brachypodium distachyon]
Length=351

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 98/149 (66%), Gaps = 1/149 (1%)
 Frame = -2

Query  694  RVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLT  515
            +VE+I Q IDS S T+ N+   S P A+ S S  A FEV+S  R++++F+EG    P+++
Sbjct  202  KVEKISQEIDSRSMTIVNASTISTPFASFSFSATASFEVQSSSRIEVQFKEGSFQPPEIS  261

Query  514  DSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSL-ANSNAESWLL  338
             S+ LP  +   GQKI L P + L+  LQ   + +  SIS QPPLK  +  N+ A+SWLL
Sbjct  262  SSVKLPAQIAIFGQKISLGPVQQLLNPLQQAFAGIAGSISGQPPLKVPIPGNNRAKSWLL  321

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD +LRISRG+ G +FVL KE SPLL
Sbjct  322  TTYLDKDLRISRGDGGGLFVLAKEGSPLL  350



>ref|XP_010518909.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic-like 
[Tarenaya hassleriana]
Length=371

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 105/151 (70%), Gaps = 1/151 (1%)
 Frame = -2

Query  700  WVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  521
            +++V+ I Q+ID+++ +V+NS+  SGPLA  S S +A FEVRSP R+Q+ F+EG +  P+
Sbjct  221  FLKVKRITQSIDTKNLSVENSITLSGPLADFSFSASATFEVRSPSRIQVSFKEGTLRPPE  280

Query  520  LTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWL  341
            +  S+ LPENVE  GQ+++L+  K  +  LQ+ A+++ ++IS Q PL      +   SWL
Sbjct  281  IKSSLDLPENVELFGQQVNLSLLKQSLNPLQEIAANISRAISGQQPLSLPFPGNRGSSWL  340

Query  340  LTTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
            L TYLD +LRISRG+ G IFVL +E S LL+
Sbjct  341  LITYLDKDLRISRGDGG-IFVLAREGSSLLE  370



>ref|XP_006352897.1| PREDICTED: plastoglobulin-1, chloroplastic-like [Solanum tuberosum]
Length=411

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 102/149 (68%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++VE+I Q +++ S T++N+   S P+AT S S  A FEVRSP R+Q++F+EG    P++
Sbjct  263  LKVEKISQDVNTNSLTIENATTLSSPVATLSFSATATFEVRSPSRIQVEFKEGNFKPPEI  322

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              +I LPE V+  GQKI L+P +  +  L++  + + ++IS QPPLK  +     +SWLL
Sbjct  323  KSNIDLPETVDLFGQKISLSPVQQSLGPLENAVAGIARTISGQPPLKIPIPGERTKSWLL  382

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD ++RISRG+ G +FVL+KE S LL
Sbjct  383  TTYLDKDMRISRGDGG-LFVLVKEGSSLL  410



>ref|XP_004245973.1| PREDICTED: plastoglobulin-1, chloroplastic [Solanum lycopersicum]
Length=344

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 102/149 (68%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++VE+I Q +++ S T++N+   S P+AT S S  A FEVRSP R+Q++F+EG    P++
Sbjct  196  LKVEKISQDVNTNSSTIENATTLSSPVATLSFSATATFEVRSPSRIQVEFKEGNFKPPEI  255

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              +I LPE V+  GQKI L+P +  +  L++  + + ++IS QPPLK  +     +SWLL
Sbjct  256  KSNINLPETVDLFGQKISLSPVQQSLGPLENAVAGIARTISGQPPLKIPIPGGRTKSWLL  315

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD ++RISRG+ G +FVL+KE S LL
Sbjct  316  TTYLDKDMRISRGDGG-LFVLVKEGSSLL  343



>ref|XP_010919972.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic 
[Elaeis guineensis]
Length=402

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 102/149 (68%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            +++++I Q IDS++ T+ N+   S P AT S S  A FEV +P R+Q++F+EG    P++
Sbjct  251  LKIKKISQAIDSKNMTIVNATTLSSPFATFSFSATASFEVLNPSRIQVQFKEGTFQPPEI  310

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            + ++ LPE V   GQ IDL P +  +  +Q+  +++ ++IS QPPLK  +  ++A+SWLL
Sbjct  311  SSTVDLPEKVNIFGQSIDLKPVQQALNPIQEAIANITRAISGQPPLKVPVPGNSAQSWLL  370

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD + RISRG+ G +FVL KE SPLL
Sbjct  371  TTYLDQDFRISRGDGG-LFVLAKEGSPLL  398



>gb|KJB37720.1| hypothetical protein B456_006G217700 [Gossypium raimondii]
Length=368

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 109/156 (70%), Gaps = 3/156 (2%)
 Frame = -2

Query  715  GAHSLWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  536
            GA  L ++V+ I Q+ID+ S ++ NS   SGP A  S S +A FEVRSP R+Q++F+EGI
Sbjct  215  GATPL-LKVKSISQSIDTASQSIVNSTTLSGPFADLSFSASATFEVRSPSRIQVEFKEGI  273

Query  535  IGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSN  356
            +  P++  S+ LP +++  GQ+I L+P +  +  LQD  +++ ++IS QPPLK  + N +
Sbjct  274  VQPPEIKPSVDLPADIDVFGQRISLSPVQQSLGPLQDLVANISRTISGQPPLKIPIGNRS  333

Query  355  AESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
            + SWLL TYLD +LRISRG+ G +FVL ++ SPLL+
Sbjct  334  S-SWLLITYLDEDLRISRGDGG-LFVLARQGSPLLE  367



>gb|KJB37719.1| hypothetical protein B456_006G217700 [Gossypium raimondii]
Length=375

 Score =   142 bits (358),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 109/156 (70%), Gaps = 3/156 (2%)
 Frame = -2

Query  715  GAHSLWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  536
            GA  L ++V+ I Q+ID+ S ++ NS   SGP A  S S +A FEVRSP R+Q++F+EGI
Sbjct  222  GATPL-LKVKSISQSIDTASQSIVNSTTLSGPFADLSFSASATFEVRSPSRIQVEFKEGI  280

Query  535  IGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSN  356
            +  P++  S+ LP +++  GQ+I L+P +  +  LQD  +++ ++IS QPPLK  + N +
Sbjct  281  VQPPEIKPSVDLPADIDVFGQRISLSPVQQSLGPLQDLVANISRTISGQPPLKIPIGNRS  340

Query  355  AESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
            + SWLL TYLD +LRISRG+ G +FVL ++ SPLL+
Sbjct  341  S-SWLLITYLDEDLRISRGDGG-LFVLARQGSPLLE  374



>ref|XP_010516724.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic 
[Camelina sativa]
Length=378

 Score =   142 bits (358),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 100/150 (67%), Gaps = 1/150 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V+ I Q+IDS + T+ NS   S P A  S S  A FEVRSP RV++ F+EG +  P++
Sbjct  229  LKVKSISQSIDSNNLTIDNSTTLSSPFADFSFSATASFEVRSPSRVEVSFKEGTLKPPEI  288

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              S+ LPE+V   GQ+I L   K  +  LQD A+++ +++S QPPLK  +  + A SWLL
Sbjct  289  KSSVDLPESVGVFGQQISLALLKQSLNPLQDVAANISRALSGQPPLKLPIPGNRASSWLL  348

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
            TTYLD +LRISRG+ G +FVL +E S LL+
Sbjct  349  TTYLDKDLRISRGDGG-LFVLAREGSSLLE  377



>gb|EMT01216.1| Putative plastid-lipid-associated protein 3, chloroplastic [Aegilops 
tauschii]
Length=360

 Score =   141 bits (356),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 99/151 (66%), Gaps = 1/151 (1%)
 Frame = -2

Query  700  WVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  521
            + RV++I Q IDS S T+ N+   S P A+ S S  A FEV++P R++++F+EG    P+
Sbjct  209  FTRVDKISQEIDSRSMTIINASTISTPFASFSFSATASFEVQTPSRIEVQFKEGSFQPPE  268

Query  520  LTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSN-AESW  344
            ++ S+ LPE +   GQK  L   K L+  LQ   +S+  SIS QPPLK  +   N A+SW
Sbjct  269  ISSSVNLPEQIAIFGQKFSLGTVKELLEPLQRAFASIAGSISGQPPLKVPIPGDNKAKSW  328

Query  343  LLTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            LLTTYLD +LRIS+G+ G +F+L KE SPLL
Sbjct  329  LLTTYLDKDLRISKGDGGGVFILAKEGSPLL  359



>emb|CDP18539.1| unnamed protein product [Coffea canephora]
Length=370

 Score =   142 bits (357),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 106/149 (71%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VE+I Q+++S S T+ NS   SGP+A+ S S +A FEVRSP R+Q++F+EG +  P++
Sbjct  221  VKVEKISQSVNSSSLTIDNSTTISGPVASLSFSASAAFEVRSPSRIQVQFKEGTLNPPEI  280

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              SI LPE+V+  GQKI+L+P +  +  LQ+  + + ++IS QPPLK  +    A+SWLL
Sbjct  281  KSSIDLPEDVDIFGQKINLSPVQQSLNPLQNAVAGIGRAISGQPPLKIPIPGERAKSWLL  340

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
             TYLD +LRISRG+ G +FVL KE S LL
Sbjct  341  ITYLDKDLRISRGDGG-LFVLAKEGSTLL  368



>ref|XP_010509611.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic 
[Camelina sativa]
Length=375

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 98/150 (65%), Gaps = 1/150 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V+ I Q+IDS + T+ NS   S P A  S S  A FEVRSP RV++ F+EG +  P++
Sbjct  226  LKVKSISQSIDSNNLTIDNSTTLSSPFADFSFSATASFEVRSPSRVEVSFKEGTLKPPEI  285

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              S+ LPE+V   GQ+I L   K  +  LQD A+++ +++S QPPLK     +   SWLL
Sbjct  286  KSSVDLPESVGVFGQQISLALLKQSLNPLQDVAANISRALSGQPPLKLPFPGNRGSSWLL  345

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
            TTYLD +LRISRG+ G +FVL +E S LL+
Sbjct  346  TTYLDKDLRISRGDGG-LFVLAREGSSLLE  374



>ref|XP_010505057.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic 
[Camelina sativa]
Length=378

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 99/150 (66%), Gaps = 1/150 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V+ I Q+IDS + TV N    S P A  S S +A FEVRSP RV++ F+EG +  P++
Sbjct  229  LKVKSISQSIDSNNLTVDNFTTLSSPFADFSFSASASFEVRSPSRVEVSFKEGTLKPPEI  288

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              S+ LPE+V   GQ+I L   K  +  LQD A+++ +++S QPPLK     + A SWLL
Sbjct  289  KSSVDLPESVGVFGQQISLALLKQSLNPLQDVAANISRALSGQPPLKLPFPGNRASSWLL  348

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
            TTYLD +LRISRG+ G +FVL +E S LL+
Sbjct  349  TTYLDKDLRISRGDGG-LFVLAREGSSLLE  377



>ref|XP_010677363.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=411

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 99/149 (66%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V++I Q ID+ + TV+NS   S P AT + S  A F+VRSP R+Q++F+E     PQ+
Sbjct  262  LKVQQISQAIDTTNQTVENSTTLSSPFATFTFSATATFDVRSPSRIQVRFKEATFKPPQI  321

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
               I LPE+V+  GQK+ L P +  ++ LQD A+S+ +++   PPLK S+      SWLL
Sbjct  322  KSQIDLPESVDVFGQKVTLPPVQQFLSPLQDAATSISRALYGLPPLKISIPGERTASWLL  381

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
             TY+D + RISRG+ G +FVL++E SPLL
Sbjct  382  FTYVDEDFRISRGDGG-LFVLVREGSPLL  409



>ref|XP_002467442.1| hypothetical protein SORBIDRAFT_01g028150 [Sorghum bicolor]
 gb|EER94440.1| hypothetical protein SORBIDRAFT_01g028150 [Sorghum bicolor]
Length=381

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 104/156 (67%), Gaps = 3/156 (2%)
 Frame = -2

Query  715  GAHSLWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  536
            GA  L V+V++I Q IDS+S T+ N+   + P A+ S S  A FEV+SP R++++F+EG 
Sbjct  225  GATPL-VKVKQISQEIDSKSMTIVNASTLTTPFASFSFSATASFEVQSPSRIEVQFKEGS  283

Query  535  IGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSL-ANS  359
               P ++ S+ LP+ ++  GQKI L P +  +  LQ   +S+  SIS QPPLK  +  N+
Sbjct  284  FQPPVISSSVDLPQQIDIFGQKISLGPVQQALNPLQQAFASIAGSISGQPPLKVPIPGNN  343

Query  358  NAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
             A SWLLTTYLD +LRISRG+ G +F+L KE SPLL
Sbjct  344  RARSWLLTTYLDKDLRISRGDGG-LFILAKEGSPLL  378



>ref|XP_002518975.1| Plastid lipid-associated protein 3, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF43508.1| Plastid lipid-associated protein 3, chloroplast precursor, putative 
[Ricinus communis]
Length=367

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 100/149 (67%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++VE+I Q +D+ + ++ NS   S P AT S S +A FEVRS  R+Q++F EG +  P++
Sbjct  219  LKVEKISQEVDTSNLSIVNSTTLSSPFATFSFSASASFEVRSSSRIQVEFREGSLQPPEI  278

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
               I LP NV+  GQ I+L+P +  +  LQ+  +++ ++IS QPPLK  +    + SWLL
Sbjct  279  NSKIDLPVNVDVFGQNINLSPLQQSLNPLQELVANISRTISGQPPLKVPIPGDRSRSWLL  338

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
             TYLD +LRISRG+ G +FVL+KE SPLL
Sbjct  339  ITYLDEDLRISRGDGG-LFVLVKEGSPLL  366



>ref|XP_009143664.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic 
[Brassica rapa]
Length=360

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 101/150 (67%), Gaps = 1/150 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V+ I Q+ID++S ++ NS   S P A  S S  A FEVR+P R+++ F+EG +  P++
Sbjct  211  LKVKSISQSIDTKSLSIDNSTTLSSPFADFSFSATASFEVRTPSRIEVSFKEGTLKPPEI  270

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              S+ LPE+V   GQ+I+L+  K  +  LQD A+++ ++IS QPPLK     +   SWLL
Sbjct  271  KSSVDLPESVGVFGQEINLSFLKQSLNPLQDVAANISRAISGQPPLKLPFPGNRGSSWLL  330

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
            TTYLD +LRISRG+ G +FVL +E S LL+
Sbjct  331  TTYLDKDLRISRGDGG-LFVLAREGSSLLE  359



>emb|CDY31692.1| BnaA05g08550D [Brassica napus]
Length=360

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 101/150 (67%), Gaps = 1/150 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V+ I Q+ID++S ++ NS   S P A  S S  A FEVR+P R+++ F+EG +  P++
Sbjct  211  LKVKSISQSIDTKSLSIDNSTTLSSPFADFSFSATASFEVRTPSRIEVSFKEGTLKPPEI  270

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              S+ LPE+V   GQ+I+L+  K  +  LQD A+++ ++IS QPPLK     +   SWLL
Sbjct  271  KSSVDLPESVGVFGQEINLSFLKQSLNPLQDVAANISRAISGQPPLKLPFPGNRGSSWLL  330

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
            TTYLD +LRISRG+ G +FVL +E S LL+
Sbjct  331  TTYLDKDLRISRGDGG-LFVLAREGSSLLE  359



>sp|Q94KU5.1|PAP3_BRACM RecName: Full=Plastid lipid-associated protein 3, chloroplastic; 
Flags: Precursor [Brassica rapa]
 gb|AAK57566.1|AF290568_1 plastid-lipid associated protein PAP3 [Brassica rapa subsp. oleifera]
Length=360

 Score =   139 bits (351),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 101/150 (67%), Gaps = 1/150 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V+ I Q+ID++S ++ NS   S P A  S S  A FEVR+P R+++ F+EG +  P++
Sbjct  211  LKVKSISQSIDTKSLSIDNSTTLSSPFADFSFSATASFEVRTPSRIEVSFKEGTLKPPEI  270

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              S+ LPE+V   GQ+I+L+  K  +  LQD A+++ ++IS QPPLK     +   SWLL
Sbjct  271  KSSVDLPESVGVFGQEINLSFLKQSLNPLQDVAANISRAISGQPPLKLPFPGNRGSSWLL  330

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
            TTYLD +LRISRG+ G +FVL +E S LL+
Sbjct  331  TTYLDKDLRISRGDGG-LFVLAREGSSLLE  359



>gb|AAK57563.1| plastid-lipid associated protein PAP3 [Brassica rapa subsp. oleifera]
Length=360

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 101/150 (67%), Gaps = 1/150 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V+ I Q+ID++S ++ NS   S P A  S S  A FEVR+P R+++ F+EG +  P++
Sbjct  211  LKVKSISQSIDTKSLSIDNSTTLSSPFADFSFSATASFEVRTPSRIEVSFKEGTLKPPEI  270

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              S+ LPE+V   GQ+I+L+  K  +  LQD A+++ ++IS QPPLK     +   SWLL
Sbjct  271  KSSVDLPESVGVFGQEINLSFLKQSLNPLQDVAANISRAISGQPPLKLPFPGNRGSSWLL  330

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
            TTYLD +LRISRG+ G +FVL +E S LL+
Sbjct  331  TTYLDKDLRISRGDGG-LFVLAREGSSLLE  359



>ref|XP_006294405.1| hypothetical protein CARUB_v10023422mg [Capsella rubella]
 gb|EOA27303.1| hypothetical protein CARUB_v10023422mg [Capsella rubella]
Length=381

 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 100/150 (67%), Gaps = 1/150 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V+ I Q+IDS + T+ N+   S P A  S S +A FEVRSP R+++ F+EG +  P++
Sbjct  232  LKVKSISQSIDSNNLTIDNATTLSSPFADFSFSASASFEVRSPSRIEVSFKEGTLKPPEI  291

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              S+ LPE+V   GQ+I L+  K  +  LQD A+++ +++S QPPLK     +   SWLL
Sbjct  292  KSSVDLPESVGVFGQQISLSLLKQSLNPLQDVAANISRALSGQPPLKLPFPGNRGSSWLL  351

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
            TTYLD +LRISRG+ G +FVL +E S LL+
Sbjct  352  TTYLDKDLRISRGDGG-LFVLAREGSSLLE  380



>ref|XP_004983554.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic-like 
[Setaria italica]
Length=385

 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 101/151 (67%), Gaps = 2/151 (1%)
 Frame = -2

Query  700  WVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  521
            +V+V++I Q IDS+S T+ N+   + P A+ S S  A FEV+SP R++++F+EG    P 
Sbjct  233  FVKVKQISQEIDSKSMTIVNASTLTTPFASFSFSATASFEVQSPSRIEVQFKEGSFQPPA  292

Query  520  LTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSL-ANSNAESW  344
            ++ ++ LPE V+  GQKI L P + ++  LQ T +S+  SIS QPPLK  +  N+   SW
Sbjct  293  ISSTVDLPEQVDIFGQKISLGPVQQVLNPLQQTFASIAGSISGQPPLKVQIPGNNRGRSW  352

Query  343  LLTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            LLTTYLD + RISRG+ G +F+L KE SP L
Sbjct  353  LLTTYLDKDFRISRGDGG-LFILAKEGSPFL  382



>gb|KIZ02337.1| hypothetical protein MNEG_5623 [Monoraphidium neglectum]
Length=266

 Score =   137 bits (344),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 99/152 (65%), Gaps = 7/152 (5%)
 Frame = -2

Query  700  WVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  521
            +V + +I Q +D  + TV+N    S PL+ T++ST A FEVRSPKR+ I+FE G I TPQ
Sbjct  88   FVTIGDITQRVDVLNNTVENKAQISVPLSRTAVSTTASFEVRSPKRLAIRFERGAIATPQ  147

Query  520  LTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKS----ISSQPPLKFSL---AN  362
            L   + +P+++  LGQ +DLT  +GL+  ++   S ++ S    IS QP L F L   A 
Sbjct  148  LLSDLSIPDSISVLGQSVDLTAVRGLLQPVESGLSGLISSVGSLISQQPDLSFPLPGAAG  207

Query  361  SNAESWLLTTYLDSELRISRGEAGSIFVLIKE  266
               E+WLLTTYLD + RI+RG+ GS+F+L+KE
Sbjct  208  ERGETWLLTTYLDDDTRITRGDGGSVFILVKE  239



>ref|XP_002881399.1| hypothetical protein ARALYDRAFT_902655 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57658.1| hypothetical protein ARALYDRAFT_902655 [Arabidopsis lyrata subsp. 
lyrata]
Length=375

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 99/150 (66%), Gaps = 1/150 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V+ I Q+ID+++ T+ NS   S P A  S S +A FEVRSP R+++ F+EG +  P++
Sbjct  226  LKVKSISQSIDTKNLTIDNSTTLSSPFADFSFSASASFEVRSPSRIEVSFKEGTLKPPEI  285

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              S+ LPE+V   GQ+I L   K  +  LQD A+++ + +S QPPLK     +   SWLL
Sbjct  286  KSSVDLPESVGVFGQQISLALLKQSLNPLQDVAANISRGLSGQPPLKLPFPGNRGSSWLL  345

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
            TTYLD +LRISRG+ G +FVL +E S LL+
Sbjct  346  TTYLDKDLRISRGDGG-LFVLAREGSSLLE  374



>ref|NP_001149315.1| fibrillin1 [Zea mays]
 gb|ACG34995.1| plastid-lipid associated protein 3 [Zea mays]
Length=382

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 103/156 (66%), Gaps = 3/156 (2%)
 Frame = -2

Query  715  GAHSLWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  536
            GA  L V+V++I Q IDS+  T+ N+   + P A+ S S  A FEV+SP R++++F+EG 
Sbjct  226  GATPL-VKVKQISQEIDSKIMTIVNASTLTTPFASFSFSATASFEVQSPSRIEVQFKEGS  284

Query  535  IGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSL-ANS  359
               P ++ S+ LP+ V+  GQKI L P +  +  LQ   +S+  SIS QPPLK  +  N+
Sbjct  285  FQPPAISSSVDLPQQVDIFGQKISLGPVQQALNPLQQAFASIAGSISGQPPLKVPIPGNN  344

Query  358  NAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
             A SWLLTTYLD +LRISRG+ G +F+L KE SPLL
Sbjct  345  RARSWLLTTYLDKDLRISRGDGG-LFILAKEGSPLL  379



>gb|ACG41445.1| plastid-lipid associated protein 3 [Zea mays]
Length=382

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 103/156 (66%), Gaps = 3/156 (2%)
 Frame = -2

Query  715  GAHSLWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  536
            GA  L V+V++I Q IDS+  T+ N+   + P A+ S S  A FEV+SP R++++F+EG 
Sbjct  226  GATPL-VKVKQISQEIDSKIMTIVNASTLTTPFASFSFSATASFEVQSPSRIEVQFKEGS  284

Query  535  IGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSL-ANS  359
               P ++ S+ LP+ V+  GQKI L P +  +  LQ   +S+  SIS QPPLK  +  N+
Sbjct  285  FQPPAISSSVDLPQQVDIFGQKISLGPVQQALNPLQQAFASIAGSISGQPPLKVPIPGNN  344

Query  358  NAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
             A SWLLTTYLD +LRISRG+ G +F+L KE SPLL
Sbjct  345  RARSWLLTTYLDKDLRISRGDGG-LFILAKEGSPLL  379



>ref|XP_008676981.1| PREDICTED: fibrillin1 isoform X1 [Zea mays]
 tpg|DAA46452.1| TPA: plastid-lipid associated protein 3 isoform 1 [Zea mays]
 tpg|DAA46453.1| TPA: plastid-lipid associated protein 3 isoform 2 [Zea mays]
Length=382

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 103/156 (66%), Gaps = 3/156 (2%)
 Frame = -2

Query  715  GAHSLWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  536
            GA  L V+V++I Q IDS+  T+ N+   + P A+ S S  A FEV+SP R++++F+EG 
Sbjct  226  GATPL-VKVKQISQEIDSKIMTIVNASTLTTPFASFSFSATASFEVQSPSRIEVQFKEGS  284

Query  535  IGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSL-ANS  359
               P ++ S+ LP+ V+  GQKI L P +  +  LQ   +S+  SIS QPPLK  +  N+
Sbjct  285  FQPPTISSSVDLPQQVDIFGQKISLGPVQQALNPLQQAFASIAGSISGQPPLKVPIPGNN  344

Query  358  NAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
             A SWLLTTYLD +LRISRG+ G +F+L KE SPLL
Sbjct  345  RARSWLLTTYLDKDLRISRGDGG-LFILAKEGSPLL  379



>ref|XP_006432747.1| hypothetical protein CICLE_v10002003mg [Citrus clementina]
 ref|XP_006432748.1| hypothetical protein CICLE_v10002003mg [Citrus clementina]
 ref|XP_006432749.1| hypothetical protein CICLE_v10002003mg [Citrus clementina]
 ref|XP_006471524.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic-like 
isoform X1 [Citrus sinensis]
 ref|XP_006471525.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic-like 
isoform X2 [Citrus sinensis]
 gb|ESR45987.1| hypothetical protein CICLE_v10002003mg [Citrus clementina]
 gb|ESR45988.1| hypothetical protein CICLE_v10002003mg [Citrus clementina]
 gb|ESR45989.1| hypothetical protein CICLE_v10002003mg [Citrus clementina]
 gb|KDO50349.1| hypothetical protein CISIN_1g016935mg [Citrus sinensis]
 gb|KDO50350.1| hypothetical protein CISIN_1g016935mg [Citrus sinensis]
 gb|KDO50351.1| hypothetical protein CISIN_1g016935mg [Citrus sinensis]
Length=380

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 101/149 (68%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++VE+ICQ ID+ S T++NS   S P A+ S S  A FEVRSP R+Q++F+EG +  P +
Sbjct  231  LKVEKICQKIDTSSLTIENSTTLSSPFASFSFSATASFEVRSPSRIQVQFKEGTLQPPDI  290

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              ++ LP N+   GQ I+L+P +  ++ LQ+   S+ +++S QPPLK  +     +SWLL
Sbjct  291  KSTVDLPGNLNIFGQNINLSPVQQTLSPLQEAVGSISRAVSGQPPLKVPIPGERTQSWLL  350

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
             TYLD + RISRG+ G +FVL+KE SPLL
Sbjct  351  ITYLDEDFRISRGDGG-LFVLVKEGSPLL  378



>emb|CDX84202.1| BnaC04g09640D [Brassica napus]
Length=362

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 101/150 (67%), Gaps = 1/150 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V+ I Q+ID+++ ++ NS   S P A  S S  A FEVR+P R+++ F+EG +  P++
Sbjct  213  LKVKSISQSIDTKNLSIDNSTTLSTPFADFSFSATASFEVRTPSRIEVSFKEGTLKPPEI  272

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              S+ LPE+V   GQ+++L+  K  +  LQD A+++ ++IS QPPLK     +   SWLL
Sbjct  273  KSSVDLPESVGVFGQEVNLSFLKQSLNPLQDVAANISRAISGQPPLKLPFPGNRGSSWLL  332

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
            TTYLD +LRISRG+ G +FVL +E S LL+
Sbjct  333  TTYLDKDLRISRGDGG-LFVLAREGSSLLE  361



>gb|KFK36419.1| hypothetical protein AALP_AA4G121600 [Arabis alpina]
Length=376

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 96/144 (67%), Gaps = 1/144 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V+ I Q+ID++S ++ NS   S P A  S S  A FEVRSP R+++ F+EG +  P++
Sbjct  220  LKVKSITQSIDTKSLSIDNSTTLSSPFADFSFSATASFEVRSPSRIEVSFKEGTLKPPEI  279

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              S+ LPE+V   GQ+I L+  K  +  LQD A+++ ++I+ QPPLK     +   SWLL
Sbjct  280  KSSVDLPESVGVFGQQISLSLLKQSLNPLQDVAANISRAITGQPPLKLPFPGNRGSSWLL  339

Query  337  TTYLDSELRISRGEAGSIFVLIKE  266
            TTYLD +LRISRG+ G +FVL KE
Sbjct  340  TTYLDKDLRISRGDGG-LFVLAKE  362



>ref|XP_009373486.1| PREDICTED: plastoglobulin-1, chloroplastic [Pyrus x bretschneideri]
Length=355

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 101/149 (68%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V +I Q I+S S T+ NS   SGP A+ S S +A FEVRSP R+Q++F+EG    P++
Sbjct  206  LKVNKITQAINSSSLTILNSTTLSGPFASFSFSASASFEVRSPSRIQVEFKEGSFQPPEI  265

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              S+ LP+ VE  GQKI+L+P +  +  LQD  + + ++IS QPPLK  +     +SWLL
Sbjct  266  KSSVDLPQEVEVFGQKINLSPVQQTLNPLQDAVAGISRTISGQPPLKVPVPGERTKSWLL  325

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
             TYLD +LRISRG+ G +FVL +E SPLL
Sbjct  326  ITYLDEDLRISRGDGG-LFVLAREGSPLL  353



>ref|XP_006368003.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic-like 
[Solanum tuberosum]
Length=418

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 99/149 (66%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++VE+I QTI   S T++NS   S P+AT+S S  A FEV+SP R+QI+F+EG    P++
Sbjct  269  LKVEKISQTISMSSLTIENSTTLSSPVATSSFSATAVFEVQSPSRIQIEFKEGTFKPPEI  328

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
               I LPEN++  GQ I L+P +  +  L++    + ++IS  P LK  +     +SWL+
Sbjct  329  KSKIDLPENMDIFGQNISLSPLQQSLGPLENAMVGIARTISGLPLLKVPIPGERTKSWLI  388

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLDS+LRISRG+ G IFVL+KE S LL
Sbjct  389  TTYLDSDLRISRGDGG-IFVLVKEKSSLL  416



>ref|XP_007040679.1| Plastid-lipid associated protein PAP / fibrillin family protein 
isoform 1 [Theobroma cacao]
 ref|XP_007040680.1| Plastid-lipid associated protein PAP / fibrillin family protein 
isoform 1 [Theobroma cacao]
 gb|EOY25180.1| Plastid-lipid associated protein PAP / fibrillin family protein 
isoform 1 [Theobroma cacao]
 gb|EOY25181.1| Plastid-lipid associated protein PAP / fibrillin family protein 
isoform 1 [Theobroma cacao]
Length=367

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 99/150 (66%), Gaps = 1/150 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V+ I QTID+E  ++ NS   + P    S S +A FEVR+P R+Q++F+EG +  P++
Sbjct  218  LKVKSISQTIDTERLSIVNSTTLASPFVNFSFSASAAFEVRTPSRIQVEFKEGTLQPPEI  277

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              SI LP +V+  GQKI L P +  +  LQ+  +++  +IS QPPLK  +    + SWLL
Sbjct  278  KPSIDLPADVDVFGQKISLLPVQQSLNPLQELVANISTAISGQPPLKIPIPGERSGSWLL  337

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
             TYLD +LRISRG+ G +FVL ++ SPLL+
Sbjct  338  ITYLDEDLRISRGDGG-LFVLARQGSPLLE  366



>ref|XP_006410707.1| hypothetical protein EUTSA_v10016800mg [Eutrema salsugineum]
 gb|ESQ52160.1| hypothetical protein EUTSA_v10016800mg [Eutrema salsugineum]
Length=380

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 100/150 (67%), Gaps = 1/150 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V+ I Q+ID+++  + NS   S P A  S S +A FEVRSP R+++ F+EG +  P++
Sbjct  231  LKVKSISQSIDTKNLCIDNSTTLSSPFADFSFSASASFEVRSPSRIEVSFKEGTLRPPEI  290

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              ++ LPE+V   GQ+I L+  K  +  LQD A+++ ++IS QPPLK     +   SWLL
Sbjct  291  KSTVDLPESVGVFGQQISLSFLKQSLDPLQDVAANISRAISGQPPLKLPFPGNRGSSWLL  350

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
            TTYLD +LRISRG+ G +FVL +E S LL+
Sbjct  351  TTYLDKDLRISRGDGG-LFVLGREGSSLLE  379



>ref|XP_005846413.1| hypothetical protein CHLNCDRAFT_11571, partial [Chlorella variabilis]
 gb|EFN54311.1| hypothetical protein CHLNCDRAFT_11571, partial [Chlorella variabilis]
Length=228

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 91/143 (64%), Gaps = 3/143 (2%)
 Frame = -2

Query  694  RVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLT  515
            RV EI Q+ID    TV+N V    PL+ TS+S  A FEVRS K +Q+ FEEG + TPQL 
Sbjct  89   RVGEITQSIDPMGQTVENRVELEAPLSKTSLSATATFEVRSSKLLQVSFEEGRVATPQLL  148

Query  514  DSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLT  335
              + LP +++ LGQ+IDL P +G + S   T   ++  +   P L+  + N  A SWLL 
Sbjct  149  ADLQLPASLDLLGQQIDLAPLQGPLRSALGTLGGLLSQV---PDLRIPVRNVQASSWLLN  205

Query  334  TYLDSELRISRGEAGSIFVLIKE  266
            TYLD  LRI+RG+ GS+FVL+++
Sbjct  206  TYLDDSLRITRGDGGSVFVLVRD  228



>ref|NP_181092.1| putative plastid-lipid-associated protein 3 [Arabidopsis thaliana]
 sp|O82291.1|PAP3_ARATH RecName: Full=Probable plastid-lipid-associated protein 3, chloroplastic; 
Short=AtPap3; AltName: Full=Fibrillin-2; AltName: 
Full=Plastoglobulin 40; Short=AtPGL40; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC36172.1| putative fibrillin [Arabidopsis thaliana]
 gb|AAM65369.1| putative fibrillin [Arabidopsis thaliana]
 gb|AEC09113.1| putative plastid-lipid-associated protein 3 [Arabidopsis thaliana]
Length=376

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 97/150 (65%), Gaps = 1/150 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V+ I Q+ID+ +  + NS   S P A  S S  A FEVRSP R+++ F+EG +  P +
Sbjct  227  LKVKSISQSIDTNNLIIDNSTTLSSPFADFSFSATASFEVRSPSRIEVSFKEGTLKPPVI  286

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              S+ LPE+V   GQ+I L+  K  +  LQD A+++ +++S QPPLK     +   SWLL
Sbjct  287  KSSVDLPESVGVFGQQISLSLLKQSLNPLQDVAANISRALSGQPPLKLPFPGNRGSSWLL  346

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
            TTYLD +LRISRG+ G +FVL +E S LL+
Sbjct  347  TTYLDKDLRISRGDGG-LFVLAREGSSLLE  375



>gb|AAK68845.1| putative fibrillin [Arabidopsis thaliana]
 gb|AAM10011.1| putative fibrillin [Arabidopsis thaliana]
Length=376

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 97/150 (65%), Gaps = 1/150 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V+ I Q+ID+ +  + NS   S P A  S S  A FEVRSP R+++ F+EG +  P +
Sbjct  227  LKVKSISQSIDTNNLIIDNSTTLSSPFADFSFSATASFEVRSPSRIEVSFKEGTLKPPVI  286

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              S+ LPE+V   GQ+I L+  K  +  LQD A+++ +++S QPPLK     +   SWLL
Sbjct  287  KSSVDLPESVGVFGQQISLSLLKQSLNPLQDVAANISRALSGQPPLKLPFPGNRGSSWLL  346

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLLK  248
            TTYLD +LRISRG+ G +FVL +E S LL+
Sbjct  347  TTYLDKDLRISRGDGG-LFVLAREGSSLLE  375



>ref|XP_004244405.1| PREDICTED: plastoglobulin-1, chloroplastic [Solanum lycopersicum]
Length=418

 Score =   135 bits (340),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 101/149 (68%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++VE+I QTI + S T++NS   S P+AT+S S  A FEV+S  R+Q++ +EG    P++
Sbjct  269  LKVEKISQTISTSSLTIENSTTLSSPVATSSFSATAIFEVQSSSRIQVEIKEGTFKPPEI  328

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
               I LPEN++  GQ I L+P +  +  L++  + + ++IS  PPLK  +     +SWL+
Sbjct  329  KSKIDLPENMDIFGQNISLSPLQQSLGPLENVVAGIARTISGLPPLKVPIPGERTKSWLI  388

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTY+DS+LRISRG+ G +FVL+KE+S LL
Sbjct  389  TTYVDSDLRISRGDGG-LFVLVKEESSLL  416


 Score = 34.3 bits (77),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = -1

Query  785  LTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            + L +G W+L +T+F  L PLL+ GT+PL
Sbjct  240  VELLDGNWILVFTAFSELLPLLAVGTIPL  268



>gb|KDO78379.1| hypothetical protein CISIN_1g020639mg [Citrus sinensis]
Length=248

 Score =   110 bits (276),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  521
             RVEEI QTIDSE+FTVQNS+ F+GPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ
Sbjct  173  ARVEEISQTIDSENFTVQNSIRFAGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  231


 Score = 58.9 bits (141),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPLGQ  693
            TEALTL N KW+L YTSF GLFPLLSRGTLPL +
Sbjct  141  TEALTLLNAKWILVYTSFSGLFPLLSRGTLPLAR  174



>ref|XP_007158264.1| hypothetical protein PHAVU_002G137800g [Phaseolus vulgaris]
 gb|ESW30258.1| hypothetical protein PHAVU_002G137800g [Phaseolus vulgaris]
Length=366

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 98/149 (66%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V+ I QTID+ SFT+ NS   S P A+ S S +A FEVRSP R+Q+ F+EG +  P++
Sbjct  217  LKVDRISQTIDTSSFTIINSTTLSSPFASLSFSASASFEVRSPARIQVTFKEGSVQPPEI  276

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
               + LPENV+  GQK+ L P +  +  LQ    ++ + IS QPPLK  +      SWLL
Sbjct  277  KSKVELPENVDIFGQKLSLQPLQQSLGPLQGLVENISRVISGQPPLKIPIPGERTSSWLL  336

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD +LRISRG+ G +F+L +E SPLL
Sbjct  337  TTYLDQDLRISRGDGG-LFILAREGSPLL  364



>ref|XP_004512496.1| PREDICTED: plastoglobulin-1, chloroplastic-like [Cicer arietinum]
Length=354

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 101/149 (68%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V++I QTID +SFT+ NS   S P A+ S S +A FEVRSP RVQ+ F+EG +  P++
Sbjct  205  LKVDKITQTIDIDSFTIINSTTLSSPFASLSFSASASFEVRSPARVQVTFKEGSLQPPEI  264

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
               I LP N++  GQK+ L P +  +  L++  +++ ++IS QPPLK  +      SWLL
Sbjct  265  KSRIDLPGNIDIFGQKLSLGPLQQSLGPLENVVANISRAISGQPPLKIPIPGERTSSWLL  324

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD +LRISRG+ G +FVL +E SPLL
Sbjct  325  TTYLDKDLRISRGDGG-LFVLAREGSPLL  352



>ref|XP_009403116.1| PREDICTED: LOW QUALITY PROTEIN: probable plastid-lipid-associated 
protein 3, chloroplastic [Musa acuminata subsp. malaccensis]
Length=422

 Score =   133 bits (334),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 96/149 (64%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++++ I Q ID ++  + N+   S P A  + S +A F VRS  R+Q++F+EG    P++
Sbjct  272  LKIKRISQAIDCKTMEIVNATTLSSPFANFAFSVSASFGVRSSSRIQVQFKEGTFQPPEI  331

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
            + ++ LPE  +  GQ I+L P +  +  +Q+  ++V +SIS QPPLK  L  + AESWLL
Sbjct  332  SSTLDLPEKFDIFGQSINLKPVQQTLNPVQEAVANVTRSISGQPPLKVPLPGNRAESWLL  391

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
             TYLD + RISRG+ G +FVL KE SPLL
Sbjct  392  ITYLDEDFRISRGDGG-LFVLAKEGSPLL  419


 Score = 34.3 bits (77),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TEA  L +G W+L YT+   L PLL+ GT PL
Sbjct  240  TEAPELLDGNWILLYTASSELLPLLAVGTTPL  271



>ref|XP_005645631.1| hypothetical protein COCSUDRAFT_17945 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21087.1| hypothetical protein COCSUDRAFT_17945 [Coccomyxa subellipsoidea 
C-169]
Length=296

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 98/147 (67%), Gaps = 4/147 (3%)
 Frame = -2

Query  700  WVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  521
            +V V +I Q I++ +FTVQ +V    P + TS ST A FEVRSPKR+Q++FE G + TP+
Sbjct  84   FVSVGDITQKIEASTFTVQLTV----PFSRTSFSTTASFEVRSPKRLQVRFERGTVATPE  139

Query  520  LTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWL  341
            L   + LP +V  LGQ IDL+  K   ++ Q+    + + +S QP L+F + +  A++WL
Sbjct  140  LLQDVELPSSVSVLGQPIDLSSLKPAQSAAQEAIQRLARLVSQQPDLQFPITSDKAQAWL  199

Query  340  LTTYLDSELRISRGEAGSIFVLIKEDS  260
            + T+LD + RI+RG+ GS+FVL+K+ S
Sbjct  200  INTFLDEDTRITRGDGGSVFVLVKDVS  226



>ref|XP_003516983.1| PREDICTED: plastoglobulin-1, chloroplastic-like [Glycine max]
Length=370

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 99/149 (66%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V++I QTID+ S T+ NS   S P A+ S S +A FEVR+P R+Q+ F+EG I  P++
Sbjct  221  LKVDKITQTIDTSSSTIINSTTLSSPFASLSFSASASFEVRTPTRIQVTFKEGSIQPPEI  280

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              ++ LPENV+  GQK+ L P +  +  LQ    ++ + IS QPPLK  +      SWLL
Sbjct  281  KSNVELPENVDIFGQKLSLQPLQQSLGPLQGLVENISRVISGQPPLKIPIPGERTSSWLL  340

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD +LRISRG+ G +FVL +E SPLL
Sbjct  341  TTYLDKDLRISRGDGG-LFVLAREGSPLL  368



>ref|XP_002505473.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO66731.1| predicted protein, partial [Micromonas sp. RCC299]
Length=251

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 96/158 (61%), Gaps = 11/158 (7%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            + V +I QTID     V+N V FS P+  +S+S NA FEVRSPKR+Q+KF+E  + TP +
Sbjct  88   LNVGDITQTIDGVGGRVENRVAFSAPMLESSVSANASFEVRSPKRLQVKFDEAGVETPTI  147

Query  517  TDSIV----LPENVEFLGQKIDLTPFKGLI----TSLQDTASSVVKSISSQPPLKFSL--  368
               +     LP  V+ +GQ ID  P   L+    + L D  + V  ++S  P LK  L  
Sbjct  148  VADVFQYMSLPMTVDVMGQSIDTAPLADLMQPFQSGLTDALNGVKSAVSGLPSLKVPLPE  207

Query  367  -ANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSP  257
             A+  +E+WLLTTYLD +LRI+RG+ GS+FVL K + P
Sbjct  208  SASPGSEAWLLTTYLDGDLRIARGDGGSVFVLTKVNDP  245



>sp|Q7XBW5.1|PAP3_ORYSJ RecName: Full=Probable plastid-lipid-associated protein 3, chloroplastic; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|AAL67595.1|AC018929_17 putative plastid-lipid associated protein [Oryza sativa Japonica 
Group]
 gb|AAP55143.1| plastid-lipid associated protein 3, chloroplast precursor, putative, 
expressed [Oryza sativa Japonica Group]
Length=374

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 105/156 (67%), Gaps = 3/156 (2%)
 Frame = -2

Query  715  GAHSLWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  536
            GA  L+ +V+EI Q ID+ S T+ N+   S P A+ S S  A F+V+SP R++++F+EG 
Sbjct  218  GAAPLF-KVDEISQEIDTNSMTIVNASTISSPFASFSFSATASFDVQSPSRIEVQFKEGS  276

Query  535  IGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSL-ANS  359
               P+++ S+ LP  V+  GQKI L P + ++  LQ   +S+  SIS QPPLK  +  N+
Sbjct  277  FQPPKISSSVDLPAEVDIFGQKISLGPVQQVLNPLQQAFASIAGSISGQPPLKLPIPGNN  336

Query  358  NAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
             A SWLLTTYLD +LRISRG+ G +F+L+KE SPLL
Sbjct  337  RARSWLLTTYLDKDLRISRGDGG-LFILVKEGSPLL  371



>gb|EEE51456.1| hypothetical protein OsJ_32570 [Oryza sativa Japonica Group]
Length=374

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 105/156 (67%), Gaps = 3/156 (2%)
 Frame = -2

Query  715  GAHSLWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  536
            GA  L+ +V+EI Q ID+ S T+ N+   S P A+ S S  A F+V+SP R++++F+EG 
Sbjct  218  GAAPLF-KVDEISQEIDTNSMTIVNASTISSPFASFSFSATASFDVQSPSRIEVQFKEGS  276

Query  535  IGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSL-ANS  359
               P+++ S+ LP  V+  GQKI L P + ++  LQ   +S+  SIS QPPLK  +  N+
Sbjct  277  FQPPKISSSVDLPAEVDIFGQKISLGPVQQVLNPLQQAFASIAGSISGQPPLKLPIPGNN  336

Query  358  NAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
             A SWLLTTYLD +LRISRG+ G +F+L+KE SPLL
Sbjct  337  RARSWLLTTYLDKDLRISRGDGG-LFILVKEGSPLL  371



>gb|ADK79127.1| astaxanthin vesicles associated protein [Haematococcus pluvialis]
Length=306

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 94/151 (62%), Gaps = 7/151 (5%)
 Frame = -2

Query  700  WVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  521
            +V V ++ QTI+    TV+N VV SGPL+ T+++T A FEVRSPKR+Q+K E G I TP+
Sbjct  155  FVTVGDLTQTINVAEQTVENKVVLSGPLSRTALTTRASFEVRSPKRLQLKLERGSIATPE  214

Query  520  LTDSIVLPENVEFLGQKIDLTPFKG----LITSLQDTAS---SVVKSISSQPPLKFSLAN  362
            L   + +P ++  LGQ +DLT  K     L  SLQ   S   SV+ S +    L   L  
Sbjct  215  LLSDVEIPSSISLLGQAVDLTQLKDALVPLSNSLQGVVSQVNSVINSTAGPAGLSVPLQG  274

Query  361  SNAESWLLTTYLDSELRISRGEAGSIFVLIK  269
             NA++W LTTY D +LRI+RG+ GS+FV  +
Sbjct  275  ENAQTWQLTTYADDDLRITRGDGGSVFVYCR  305



>ref|XP_008373508.1| PREDICTED: plastoglobulin-1, chloroplastic [Malus domestica]
Length=355

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 100/149 (67%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V +I Q I+S S T+ NS   S P A+ S S +A FEVRSP R+Q++F+EG    P++
Sbjct  206  LKVNKITQAINSSSLTILNSTTLSSPFASFSFSASASFEVRSPSRIQVEFKEGSFQPPEI  265

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              S+ LP+ VE  GQKI+L+P +  +  LQD  + + ++IS QPPLK  +     +SWLL
Sbjct  266  KSSVDLPQEVEIFGQKINLSPVQQTLNPLQDAVAGISRTISGQPPLKVPVPGERTKSWLL  325

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
             TYLD +LRISRG+ G +FVL +E SPLL
Sbjct  326  ITYLDEDLRISRGDGG-LFVLAREGSPLL  353



>ref|XP_006588307.1| PREDICTED: plastoglobulin-1, chloroplastic-like [Glycine max]
Length=291

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 95/144 (66%), Gaps = 1/144 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++V++I QTID+ S T+ NS   S P A+ S S ++ FEV+SP R+Q+ F+EG I  P +
Sbjct  147  LKVDKITQTIDTSSSTIINSTTLSSPFASLSFSASSSFEVQSPTRIQVAFKEGSIQAPDI  206

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
              ++ LPENV+  GQK++L P +  +  LQ    ++ + IS QPPLK  +      SWLL
Sbjct  207  KSNVELPENVDIFGQKLNLQPLQQSLGPLQGLVENISRVISGQPPLKIPIPGEKTSSWLL  266

Query  337  TTYLDSELRISRGEAGSIFVLIKE  266
            TTYLD +LRISRG+ G +FVL +E
Sbjct  267  TTYLDKDLRISRGDGG-LFVLARE  289



>ref|XP_008802537.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Phoenix dactylifera]
Length=190

 Score =   119 bits (298),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -2

Query  559  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPL  380
            QIKFEEGIIGTPQ+TDSIV+PE VEFLGQ IDL+PFKG+ITS+QD ASSV ++IS +PP 
Sbjct  115  QIKFEEGIIGTPQITDSIVIPEKVEFLGQNIDLSPFKGVITSVQDAASSVARTISERPPW  174

Query  379  KFSLANSNAESWLLTT  332
            K  ++N+N +SWLLTT
Sbjct  175  KIPISNNNTQSWLLTT  190



>gb|ACJ84215.1| unknown [Medicago truncatula]
Length=355

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 99/149 (66%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V++I QTID+ S TV NSV  S P A++S S +A FEVRSP R+Q+ F+EG +  P++
Sbjct  207  VKVDKILQTIDTYSSTVVNSVTLSSPFASSSFSASASFEVRSPTRIQVTFKEGSLQPPEI  266

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
               I LPEN+   GQ + L P +  +  L++  +++ + IS Q PLK  +      SWLL
Sbjct  267  KSKIDLPENINIFGQNLSLGPLQQSLGPLENVVANISRVISGQSPLKIPIPGERTSSWLL  326

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD +LRISRG+ G +FVL +E SP+L
Sbjct  327  TTYLDKDLRISRGDGG-LFVLAREGSPIL  354



>ref|XP_003612834.1| Plastoglobulin-1 [Medicago truncatula]
 gb|AES95792.1| plastid fibrillin [Medicago truncatula]
Length=355

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 99/149 (66%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V++I QTID+ S TV NSV  S P A++S S +A FEVRSP R+Q+ F+EG +  P++
Sbjct  207  VKVDKILQTIDTYSSTVVNSVTLSSPFASSSFSASASFEVRSPTRIQVTFKEGSLQPPEI  266

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
               I LPEN+   GQ + L P +  +  L++  +++ + IS Q PLK  +      SWLL
Sbjct  267  KSKIDLPENINIFGQNLSLGPLQQSLGPLENVVANISRVISGQSPLKIPIPGERTSSWLL  326

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD +LRISRG+ G +FVL +E SP+L
Sbjct  327  TTYLDKDLRISRGDGG-LFVLAREGSPIL  354



>ref|XP_009349223.1| PREDICTED: plastoglobulin-1, chloroplastic-like [Pyrus x bretschneideri]
Length=353

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 103/150 (69%), Gaps = 1/150 (1%)
 Frame = -2

Query  700  WVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  521
            +++V +I Q I++ S T+ NS  FS P A+ S S +A FEVRSP R+Q++F+EG    P+
Sbjct  203  FLKVNKITQAINTSSLTILNSTTFSSPFASFSFSASASFEVRSPLRIQVEFKEGSFQPPE  262

Query  520  LTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWL  341
            +  SI LP+ V+  GQK++L+P +  ++ LQD  + + ++IS QPPLK S+     +SWL
Sbjct  263  IKSSIDLPQEVDVFGQKVNLSPVQQTLSPLQDAVAGISRTISGQPPLKVSIPGERTKSWL  322

Query  340  LTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            + TYLD +LRISRG+ G +FVL +E S LL
Sbjct  323  VITYLDEDLRISRGDGG-LFVLAREGSVLL  351



>sp|Q9ZP40.1|PG1_PEA RecName: Full=Plastoglobulin-1, chloroplastic; Flags: Precursor 
[Pisum sativum]
 gb|AAD02288.1| plastoglobule associated protein PG1 precursor [Pisum sativum]
Length=358

 Score =   117 bits (293),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 98/149 (66%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            +++++I QTID++SFTV NS   S P A+ S S +A FEVRSP R+Q+ F+EG +  P++
Sbjct  209  LKLDKISQTIDTDSFTVVNSTTLSSPFASFSFSVSASFEVRSPTRIQVTFKEGSLQPPEI  268

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
               I LPEN+   GQ++ L P    +  L++  +++ + IS Q PLK  +      SWL+
Sbjct  269  KSKIDLPENINIFGQQLSLGPLLQSLGPLENVVANISRVISGQSPLKIPIPGERTSSWLI  328

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD +LRISRG+ G +FVL +E S LL
Sbjct  329  TTYLDKDLRISRGDGG-LFVLAREGSSLL  356


 Score = 34.3 bits (77),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = -1

Query  791  EALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            E   L NG WVL YT+   L PLL+ G+LPL
Sbjct  178  EEPDLLNGNWVLLYTASSELLPLLAAGSLPL  208



>gb|AFK33388.1| unknown [Medicago truncatula]
Length=355

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 96/149 (64%), Gaps = 1/149 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+V++I QTID+ S TV NSV  S P A++S S +A FEVRSP R+Q+ F+EG +  P++
Sbjct  207  VKVDKILQTIDTYSSTVVNSVTLSSPFASSSFSASASFEVRSPTRIQVTFKEGSLQPPEI  266

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
               I LPEN+   GQ   L P +     L++  +++ + IS Q P K  +      SWLL
Sbjct  267  KSKIDLPENINIFGQNFSLGPLQQFFGPLENVVANISRVISGQSPFKIPIPGERTSSWLL  326

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            TTYLD +LRISRG+ G +FVL +E SP+L
Sbjct  327  TTYLDKDLRISRGDGG-LFVLAREGSPIL  354



>ref|XP_001760672.1| predicted protein [Physcomitrella patens]
 gb|EDQ74411.1| predicted protein, partial [Physcomitrella patens]
Length=251

 Score =   112 bits (280),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 82/134 (61%), Gaps = 2/134 (1%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V + EI Q ID++S T+ N+V F+GP   T+ +  A F+VRSPKR+Q+ +EE  I T Q+
Sbjct  75   VNITEIAQDIDADSLTIDNTVSFTGPYMKTTFTKCASFDVRSPKRLQMMYEESFIATSQV  134

Query  517  TDSIVL--PENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESW  344
             + +V   PE  +F+G KI+L   K L+  ++D    V K  +S PPL+     +  +SW
Sbjct  135  DEEVVDNGPEMTDFMGHKINLRGLKSLLQPIEDVTKQVTKQAASHPPLRIPYPANTVQSW  194

Query  343  LLTTYLDSELRISR  302
             + TY+D  +RI+R
Sbjct  195  QVITYVDDCVRIAR  208


 Score = 35.0 bits (79),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLPL  699
            TE L   NGKW++AYTS     P ++   LPL
Sbjct  43   TENLETINGKWIMAYTSVEEFLPFIAAKYLPL  74



>ref|NP_001065482.2| Os10g0575700 [Oryza sativa Japonica Group]
 dbj|BAF27319.2| Os10g0575700 [Oryza sativa Japonica Group]
Length=409

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 105/191 (55%), Gaps = 38/191 (20%)
 Frame = -2

Query  715  GAHSLWVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQ-------  557
            GA  L+ +V+EI Q ID+ S T+ N+   S P A+ S S  A F+V+SP R++       
Sbjct  218  GAAPLF-KVDEISQEIDTNSMTIVNASTISSPFASFSFSATASFDVQSPSRIEKLEMCIE  276

Query  556  ----------------------------IKFEEGIIGTPQLTDSIVLPENVEFLGQKIDL  461
                                        ++F+EG    P+++ S+ LP  V+  GQKI L
Sbjct  277  IIEISDHQLSCANMYIDQTDMLMVIPMKVQFKEGSFQPPKISSSVDLPAEVDIFGQKISL  336

Query  460  TPFKGLITSLQDTASSVVKSISSQPPLKFSL-ANSNAESWLLTTYLDSELRISRGEAGSI  284
             P + ++  LQ   +S+  SIS QPPLK  +  N+ A SWLLTTYLD +LRISRG+ G +
Sbjct  337  GPVQQVLNPLQQAFASIAGSISGQPPLKLPIPGNNRARSWLLTTYLDKDLRISRGDGG-L  395

Query  283  FVLIKEDSPLL  251
            F+L+KE SPLL
Sbjct  396  FILVKEGSPLL  406



>ref|XP_001692028.1| plastid lipid associated protein [Chlamydomonas reinhardtii]
 gb|EDP04518.1| plastid lipid associated protein [Chlamydomonas reinhardtii]
Length=314

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 88/150 (59%), Gaps = 7/150 (5%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V++  + QTI+S   TV+NS+    PL  TS+ST + + V SPKR+Q   E G++ TP +
Sbjct  158  VKIGAVTQTINSTDRTVENSLELQLPLIITSLSTVSNYNVASPKRLQFTVERGVLHTPSI  217

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISS----QPPLKF---SLANS  359
              ++ LP ++  +GQ +DL P +  +  LQD    +  S S      P L+    SL  +
Sbjct  218  EGNLELPASITVMGQTLDLAPLRDAVKPLQDATKGLAASASDLLGQAPDLELPLQSLGQA  277

Query  358  NAESWLLTTYLDSELRISRGEAGSIFVLIK  269
            N + W LTTYLD ELR++RG+ G++++  K
Sbjct  278  NTQGWQLTTYLDPELRVTRGDGGAVYIFKK  307



>gb|AFW58455.1| hypothetical protein ZEAMMB73_538731 [Zea mays]
Length=230

 Score = 87.0 bits (214),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKF  548
            V+VEEI QTIDS++FTVQN + FSGPLATTS+STNAKFE+RSPKRVQ++F
Sbjct  165  VKVEEISQTIDSKNFTVQNCIKFSGPLATTSVSTNAKFEIRSPKRVQVRF  214


 Score = 50.1 bits (118),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLP  702
            TEALTL NGKW+LAYTSF  LFPLL  G LP
Sbjct  132  TEALTLLNGKWILAYTSFSQLFPLLEFGKLP  162



>gb|EEC67495.1| hypothetical protein OsI_34766 [Oryza sativa Indica Group]
Length=254

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 73/105 (70%), Gaps = 2/105 (2%)
 Frame = -2

Query  562  VQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPP  383
            ++++F+EG    P+++ S+ LP  V+  GQKI L P + ++  LQ   +S+  SIS QPP
Sbjct  148  MKVQFKEGSFQPPKISSSVDLPAEVDIFGQKISLGPVQQVLNPLQQAFASIAGSISGQPP  207

Query  382  LKFSL-ANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  251
            LK  +  N+ A SWLLTTYLD +LRISRG+ G +F+L+KE SPLL
Sbjct  208  LKLPIPGNNRARSWLLTTYLDKDLRISRGDGG-LFILVKEGSPLL  251



>gb|EPS69991.1| hypothetical protein M569_04771 [Genlisea aurea]
Length=325

 Score = 88.2 bits (217),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 93/149 (62%), Gaps = 12/149 (8%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V+VE I Q+ID+ S  ++NS   S PL+T+S +++A FEVR+P R+Q++F+E     P++
Sbjct  188  VKVERIVQSIDTNSLAIENSATISTPLSTSSFTSSASFEVRTPFRIQVQFKEATFKPPEI  247

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
               I LP      GQ I+L   + ++  L+    ++ + +S   PL   +  ++  SWLL
Sbjct  248  KSRIDLP------GQNINL---QQILAPLEGGLENLARIVSGLSPLTVPVPRTS--SWLL  296

Query  337  TTYLDSELRISRGEAGSIFVLIKEDSPLL  251
             TYLD ++RISRG+ G +FVL+KE S LL
Sbjct  297  ITYLDEDVRISRGDGG-LFVLVKEGSSLL  324


 Score = 33.5 bits (75),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTLP  702
            TEA  L +G W+L +T+F  L PLL+   +P
Sbjct  156  TEAAALLDGNWILVFTAFSELLPLLAVNAIP  186



>gb|AFG70455.1| hypothetical protein 0_2632_01, partial [Pinus taeda]
 gb|AFG70456.1| hypothetical protein 0_2632_01, partial [Pinus taeda]
Length=74

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -2

Query  466  DLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGS  287
            DL    G +  LQ+ A+++ + IS QPPLK  +    A+SWLL TYLD +LRISRG+ G 
Sbjct  1    DLISLLGSLHPLQEAATNISRVISGQPPLKLPIGRDGAQSWLLITYLDKDLRISRGDGGG  60

Query  286  IFVLIKEDSPLL  251
            IFVL+KE SPLL
Sbjct  61   IFVLVKEGSPLL  72



>ref|XP_003059745.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH55697.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=238

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 84/160 (53%), Gaps = 19/160 (12%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            V + +I QTID  + TV+N V    PL  TS+   A FE  SPKR+++KF +  + TP +
Sbjct  79   VTIGDITQTIDVVAGTVENRVNVRAPLIDTSLIATADFEATSPKRIRVKFTDAGVVTPSI  138

Query  517  TDS-----IVLPENVEFLGQKIDLTPFKGLITSLQDTA----SSVVKSISSQPP-LKF--  374
              S     I LP  ++  GQ ID T     +  L+  A      + +++ + PP LK   
Sbjct  139  DTSSVLQYIDLPPTIDVAGQIIDTTAASEALEPLRKAAEGALGGLAEAVKTLPPALKVPL  198

Query  373  -------SLANSNAESWLLTTYLDSELRISRGEAGSIFVL  275
                   + A     +WLLTTYLD + R++RG+ GS+FV+
Sbjct  199  PGGGLGAAGAEGAESTWLLTTYLDEDTRVARGDGGSVFVM  238



>ref|XP_001698968.1| plastid lipid associated protein [Chlamydomonas reinhardtii]
 gb|EDO99022.1| plastid lipid associated protein [Chlamydomonas reinhardtii]
Length=320

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 94/169 (56%), Gaps = 26/169 (15%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFE----EGIIG  530
            V V ++CQTID  + T  N +  + P+   S+   A  EVRSP++ +++F     +  I 
Sbjct  139  VDVGDVCQTIDPVTLTATNKIDIAVPV-LLSLRAEAGLEVRSPRQFKVQFTRVGLDTFIR  197

Query  529  TPQLTDSIVLPENVEFLGQKIDLTPFKGLITSL-----------QDTASSVV-KSIS---  395
            TPQLT ++ +PE+V  LG  +DL P + L+  +           ++ A  ++ +++S   
Sbjct  198  TPQLTAALEIPESVTVLGATLDLGPLRRLVEPINSGLEVRVGGRREAAQDLLGRAVSPEF  257

Query  394  --SQPPLKFSLA----NSNAESWLLTTYLDSELRISRGEAGSIFVLIKE  266
              SQ P+   ++    +S A  W+LTTYLD  LRISR + G +FV++K+
Sbjct  258  GVSQVPMPPGISPGALSSAASLWMLTTYLDDNLRISRDDEGRVFVMLKD  306



>gb|AEW07488.1| hypothetical protein 0_2632_01, partial [Pinus radiata]
 gb|AFG70451.1| hypothetical protein 0_2632_01, partial [Pinus taeda]
 gb|AFG70452.1| hypothetical protein 0_2632_01, partial [Pinus taeda]
 gb|AFG70459.1| hypothetical protein 0_2632_01, partial [Pinus taeda]
 gb|AFG70462.1| hypothetical protein 0_2632_01, partial [Pinus taeda]
Length=74

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -2

Query  466  DLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGS  287
            DL    G +  LQ+ A+++ + IS QPPLK  +    A+SWLL TYLD +LRISRG+ G 
Sbjct  1    DLISLLGSLHPLQEAATNISRVISGQPPLKLPIGRDGAQSWLLITYLDKDLRISRGDGGG  60

Query  286  IFVLIKEDSPLL  251
            +FVL+KE SPLL
Sbjct  61   LFVLVKEGSPLL  72



>ref|XP_001698965.1| plastid lipid associated protein [Chlamydomonas reinhardtii]
 gb|EDO99019.1| plastid lipid associated protein [Chlamydomonas reinhardtii]
Length=419

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 88/160 (55%), Gaps = 18/160 (11%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKR--------VQIKFE-  545
            V V ++CQTID  + T  N V  + P+   S+   +  EVRSP++         Q++   
Sbjct  250  VDVGDVCQTIDPVTLTATNKVDLAVPM-MLSLRAESGLEVRSPRQFKSLTMHQTQVRLTK  308

Query  544  ---EGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQD---TASSVVKSISSQPP  383
               +  I TPQL  ++ +PE+V  LG  +DL P + L+  + +    A  ++  +++ P 
Sbjct  309  VGLDTFISTPQLLAALEIPESVTVLGATLDLGPLRRLVEPINNGLEAAQDLMNRVTA-PE  367

Query  382  LKFSLANSNAES-WLLTTYLDSELRISRGEAGSIFVLIKE  266
            L    + S+A S W+LTTYLD  LRISR + G +FV++K+
Sbjct  368  LPLGPSMSSAASLWMLTTYLDDNLRISRDDEGRVFVMLKD  407



>emb|CAA75658.1| Plastid-lipid-Associated Protein [Solanum lycopersicum]
Length=146

 Score = 60.5 bits (145),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  703  LWVRVEEICQTIDSESFTVQNSVVFSGPLATTSIST  596
            L VRVEEI QTIDSESFTVQ+S VF+GPL+TTSIST
Sbjct  111  LLVRVEEISQTIDSESFTVQDSAVFAGPLSTTSIST  146


 Score = 53.5 bits (127),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  794  TEALTLXNGKWVLAYTSFIGLFPLLSRGTL  705
            TEALTL NGKW+LAYTSF GLFP LSRG L
Sbjct  81   TEALTLLNGKWILAYTSFSGLFPSLSRGNL  110



>gb|AFG70460.1| hypothetical protein 0_2632_01, partial [Pinus taeda]
Length=74

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -2

Query  466  DLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGS  287
            DL    G +  LQ+ A+++ + +S QPPLK  +    A+SWLL TYLD +LRISRG+ G 
Sbjct  1    DLISLLGSLHPLQEAATNISRVMSGQPPLKLPIGRDGAQSWLLITYLDKDLRISRGDGGG  60

Query  286  IFVLIKEDSPLL  251
            +FVL+KE SPLL
Sbjct  61   LFVLVKEGSPLL  72



>gb|AFG70450.1| hypothetical protein 0_2632_01, partial [Pinus taeda]
 gb|AFG70453.1| hypothetical protein 0_2632_01, partial [Pinus taeda]
 gb|AFG70454.1| hypothetical protein 0_2632_01, partial [Pinus taeda]
 gb|AFG70457.1| hypothetical protein 0_2632_01, partial [Pinus taeda]
 gb|AFG70458.1| hypothetical protein 0_2632_01, partial [Pinus taeda]
 gb|AFG70461.1| hypothetical protein 0_2632_01, partial [Pinus taeda]
Length=74

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -2

Query  466  DLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGS  287
            DL    G +  LQ+ A+++ + IS QPPLK  +     +SWLL TYLD +LRISRG+ G 
Sbjct  1    DLISLLGSLHPLQEAATNISRVISGQPPLKLPIGRDGGQSWLLITYLDKDLRISRGDGGG  60

Query  286  IFVLIKEDSPLL  251
            +FVL+KE SPLL
Sbjct  61   LFVLVKEGSPLL  72



>ref|XP_002950467.1| hypothetical protein VOLCADRAFT_104724 [Volvox carteri f. nagariensis]
 gb|EFJ48668.1| hypothetical protein VOLCADRAFT_104724 [Volvox carteri f. nagariensis]
Length=302

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/155 (34%), Positives = 88/155 (57%), Gaps = 15/155 (10%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            VR+  + QTI++ + TV+NSV    PL  TS+ST + + + SPKR+Q   + GI+ TP +
Sbjct  153  VRIGAVRQTINAANSTVENSVQLEFPLVHTSVSTVSSYNIASPKRLQFTVQRGILHTPSI  212

Query  517  TDSIVLPENVEFLGQKIDLTPF--------KGLITSLQDTASSVVKSISSQPPLKFSLAN  362
              ++ LP ++  LGQ +DL           +G  +     +  + ++ + + PL+     
Sbjct  213  EGNLELPASITVLGQTLDLALLRDALAPLTRGAASLAASASDLLGQAPNLEVPLQ-----  267

Query  361  SNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSP  257
               ++W LTTYLDS LRI+RG+ G+++V  K  +P
Sbjct  268  --TQTWQLTTYLDSTLRITRGDGGTVYVFKKVAAP  300



>ref|XP_002945997.1| hypothetical protein VOLCADRAFT_46017 [Volvox carteri f. nagariensis]
 gb|EFJ52992.1| hypothetical protein VOLCADRAFT_46017 [Volvox carteri f. nagariensis]
Length=247

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 57/184 (31%), Positives = 84/184 (46%), Gaps = 28/184 (15%)
 Frame = -2

Query  751  TRLLLGCSHCYQGAHSLWVRVEEICQTIDSESFTVQNSVVFSGP------LAT---TSIS  599
            T LLLG            V V ++ Q ID E  T  N     G       LA     S+ 
Sbjct  63   TLLLLGALDGMP-----LVDVGDVVQIIDPEGLTATNKARGRGKKKERIDLAVPVLLSLR  117

Query  598  TNAKFEVRSPKRVQIKFE----EGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSL  431
              +  EVRSP++ +++      +  + TPQL  ++ +P +V  LG  +DLTP + L+  +
Sbjct  118  AESGLEVRSPRQFKVRLTRVGLDTYVATPQLLAALEVPPSVTLLGATLDLTPLRKLLEPI  177

Query  430  QDTASSVV----------KSISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIF  281
                 S+V           S+   P L     +  A  W+LTTYLD  LRISR + G +F
Sbjct  178  NSGLESIVSRAVAPEISMDSVPVPPGLTRGSVSEAASLWMLTTYLDDTLRISRDDEGRVF  237

Query  280  VLIK  269
            V++K
Sbjct  238  VMLK  241



>ref|XP_002945995.1| hypothetical protein VOLCADRAFT_46047 [Volvox carteri f. nagariensis]
 gb|EFJ52990.1| hypothetical protein VOLCADRAFT_46047 [Volvox carteri f. nagariensis]
Length=249

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 57/184 (31%), Positives = 84/184 (46%), Gaps = 28/184 (15%)
 Frame = -2

Query  751  TRLLLGCSHCYQGAHSLWVRVEEICQTIDSESFTVQNSVVFSGP------LATT---SIS  599
            T LLLG            V V ++ Q ID E  T  N     G       LA     S+ 
Sbjct  65   TLLLLGALDGMP-----LVDVGDVVQIIDPEGLTATNKARERGKKKERIDLAVPVLLSLR  119

Query  598  TNAKFEVRSPKRVQIKFE----EGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSL  431
              +  EVRSP++ +++      +  + TPQL  ++ +P +V  LG  +DLTP + L+  +
Sbjct  120  AESGLEVRSPRQFKVRLTRVGLDTYVATPQLLAALEVPPSVTLLGATLDLTPLRKLLEPI  179

Query  430  QDTASSVV----------KSISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIF  281
                 S+V           S+   P L     +  A  W+LTTYLD  LRISR + G +F
Sbjct  180  NSGLESIVSRAVAPEISMDSVPVPPGLTRGSVSEAASLWMLTTYLDDTLRISRDDEGRVF  239

Query  280  VLIK  269
            V++K
Sbjct  240  VMLK  243



>ref|WP_016862318.1| fibrillin [Fischerella muscicola]
Length=194

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 71/143 (50%), Gaps = 25/143 (17%)
 Frame = -2

Query  694  RVEEICQTIDSESFTVQN-SVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++ +I Q I  +S +V N + ++  P     +S  AKFE  S +RVQ+KFE  I+G  +L
Sbjct  75   KLGQIYQCIRVKSNSVYNIAEIYGLPFLEGIVSVAAKFEPVSGRRVQVKFERSIVGFQRL  134

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
             D                   +K     +Q      ++S    P + FSL ++  + WL 
Sbjct  135  ID-------------------YKSPDKYIQQ-----IESGQKFPAIDFSLNSNEQQGWLD  170

Query  337  TTYLDSELRISRGEAGSIFVLIK  269
             TYLDSELRI RG  GS+FVL K
Sbjct  171  ITYLDSELRIGRGNEGSVFVLTK  193



>ref|XP_010279319.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Nelumbo nucifera]
Length=179

 Score = 60.8 bits (146),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  700  WVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRV  560
             V+VEEI Q+IDS +F V+N V F+GPLATT++STNAKFE++  K V
Sbjct  133  LVKVEEISQSIDSSNFMVENVVQFTGPLATTTLSTNAKFEIQRSKCV  179


 Score = 35.4 bits (80),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 15/18 (83%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = -1

Query  752  YTSFIGLFPLLSRGTLPL  699
            YTSF+GLFPL  RGTLPL
Sbjct  116  YTSFMGLFPLFPRGTLPL  133



>ref|WP_008274287.1| fibrillin [Cyanothece sp. CCY0110]
 gb|EAZ92714.1| fibrillin [Cyanothece sp. CCY0110]
Length=196

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 73/166 (44%), Gaps = 32/166 (19%)
 Frame = -2

Query  748  RLLLGCSHCYQGAHSLWV-RVEEICQTIDSESFTVQNSVVFSG-PLATTSISTNAKFEVR  575
            RLL   S    G     V ++ +I Q I  E   + N     G PL    +S  A+FE  
Sbjct  56   RLLYTTSKGILGLDKFPVLQLGQIYQCIRVEEAKLYNIAEIVGVPLLEGLVSVAARFEPT  115

Query  574  SPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSIS  395
            S KRVQ+KFE  I G  +            FLG +               + + ++K I 
Sbjct  116  SDKRVQVKFERYIAGLQK------------FLGYQ---------------SPNKLIKEIE  148

Query  394  SQP---PLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKE  266
                  PL FSL N   + WL  TYLD +LRI RG  GS+FVL +E
Sbjct  149  KGKKFFPLDFSLENREQQGWLEITYLDDDLRIGRGNEGSVFVLSRE  194



>ref|WP_039742995.1| fibrillin [Hassallia byssoidea]
 gb|KIF35617.1| fibrillin [Hassallia byssoidea VB512170]
Length=194

 Score = 65.9 bits (159),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 69/143 (48%), Gaps = 25/143 (17%)
 Frame = -2

Query  694  RVEEICQTIDSESFTVQN-SVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            +V +I Q I  E+ +V N + ++  PL    +S  AKFEV S +RV++KFE  IIG   L
Sbjct  75   KVGQIYQCIRVETNSVYNIAEIYGLPLLQGLVSVAAKFEVVSERRVKVKFERSIIGLKNL  134

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
                    N E   Q+I+              A     +I       F + +   + WL 
Sbjct  135  IGY----SNPETFIQQIE--------------AGKKFTAID------FPIKSGEQQGWLD  170

Query  337  TTYLDSELRISRGEAGSIFVLIK  269
             TYLD++LRI RG  GS+FVL K
Sbjct  171  ITYLDNDLRIGRGNEGSVFVLTK  193


 Score = 27.7 bits (60),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -1

Query  791  EALTLXNGKWVLAYTSFIGLFPL  723
            EA+ L NG W L YT+ IGL  L
Sbjct  46   EAVHLLNGNWRLLYTTSIGLLNL  68



>ref|WP_009545266.1| MULTISPECIES: fibrillin [Cyanothece]
Length=196

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 74/166 (45%), Gaps = 32/166 (19%)
 Frame = -2

Query  748  RLLLGCSHCYQGAHSLWV-RVEEICQTIDSESFTVQNSVVFSG-PLATTSISTNAKFEVR  575
            RLL   S    G     V ++ +I Q I  E   + N     G PL    +S  A+FE  
Sbjct  56   RLLYTTSKGILGLDRFPVLQLGQIYQCIRIEEAKLYNIAEIVGVPLLEGIVSVAARFEAT  115

Query  574  SPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSIS  395
            S KRVQ+KFE  I G  +L            LG +               + S ++K I 
Sbjct  116  SDKRVQVKFERYIAGLQRL------------LGYQ---------------SPSKLIKEIE  148

Query  394  SQP---PLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKE  266
            +     PL FSL +   + WL  TYLD +LR+ RG  GS+FVL KE
Sbjct  149  TGKKFFPLDFSLESREQQGWLEITYLDDDLRVGRGNEGSVFVLAKE  194



>gb|ACB52918.1| fibrillin [Cyanothece sp. ATCC 51142]
Length=212

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 69/148 (47%), Gaps = 31/148 (21%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSG-PLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  521
            +++ +I Q I  E   + N     G PL    +S  A+FE  S KRVQ+KFE  I G  +
Sbjct  90   LQLGQIYQCIRIEEAKLYNIAEIVGVPLLEGIVSVAARFEATSDKRVQVKFERYIAGLQR  149

Query  520  LTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQP---PLKFSLANSNAE  350
            L            LG +               + S ++K I +     PL FSL +   +
Sbjct  150  L------------LGYQ---------------SPSKLIKEIETGKKFFPLDFSLESREQQ  182

Query  349  SWLLTTYLDSELRISRGEAGSIFVLIKE  266
             WL  TYLD +LR+ RG  GS+FVL KE
Sbjct  183  GWLEITYLDDDLRVGRGNEGSVFVLAKE  210



>ref|WP_002797657.1| fibrillin [Microcystis aeruginosa]
 dbj|BAG00106.1| fibrillin [Microcystis aeruginosa NIES-843]
 emb|CCI25916.1| Fibrillin [Microcystis aeruginosa PCC 9809]
Length=196

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 72/165 (44%), Gaps = 26/165 (16%)
 Frame = -2

Query  748  RLLLGCSHCYQGAHSL-WVRVEEICQTIDSESFTVQNSVVFSG-PLATTSISTNAKFEVR  575
            RLL   S    G   L ++++ +I Q +D     + N     G P    ++  +A FE  
Sbjct  56   RLLFTSSRNILGIDRLPFLQLGQIYQYLDLNKAKLYNIAEIIGVPWLEGAVIVSATFEPT  115

Query  574  SPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSIS  395
            S +RV +KFE  I+G  +L +     E +E                         ++S  
Sbjct  116  SERRVMVKFERSILGLQRLLNYHSPQEFIE------------------------AIESGK  151

Query  394  SQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDS  260
              PPL FS  N     WL  TYLD +LRI RG  GS+F+L KE +
Sbjct  152  KFPPLDFSFNNRQQTGWLDITYLDEDLRIGRGSEGSVFILAKEKT  196



>ref|WP_002736482.1| fibrillin [Microcystis aeruginosa]
 emb|CCI22466.1| Similar to tr|Q4C252|Q4C252_CROWT PAP fibrillin [Microcystis 
aeruginosa PCC 9808]
 gb|ELP54043.1| PAP_fibrillin family protein [Microcystis aeruginosa TAIHU98]
Length=196

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 71/165 (43%), Gaps = 26/165 (16%)
 Frame = -2

Query  748  RLLLGCSHCYQGAHSL-WVRVEEICQTIDSESFTVQNSVVFSG-PLATTSISTNAKFEVR  575
            RLL   S    G   L + ++ +I Q +D     + N    +G P    ++   A FE  
Sbjct  56   RLLFTSSRDILGLDRLPFFQLGQIYQYLDLNKAKLYNIAEITGVPWLEGAVIVAATFEPT  115

Query  574  SPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSIS  395
            S +RV +KFE  I+G  +  +     E +E                         ++S  
Sbjct  116  SERRVMVKFERSILGLQRFLNYHSPQEFIE------------------------AIESGK  151

Query  394  SQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDS  260
              PPL FS  N   + WL  TYLD +LRI RG  GS+F+L KE +
Sbjct  152  KFPPLDFSFNNREQKGWLDITYLDEDLRIGRGSEGSVFILAKEKT  196



>ref|WP_017310080.1| fibrillin [Fischerella sp. PCC 9339]
Length=194

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 68/143 (48%), Gaps = 25/143 (17%)
 Frame = -2

Query  694  RVEEICQTIDSESFTVQN-SVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++ +I Q I  +S +V N + ++  P     +S  AKFE  S +RVQ+KFE  I+G  +L
Sbjct  75   KLGQIYQCIRVKSNSVYNIAEIYGLPFLEGIVSVAAKFEPVSGRRVQVKFERSIVGFQRL  134

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
                            ID       I  ++D              + FS+ ++  + WL 
Sbjct  135  ----------------IDYKSPDKYIQQIEDGQKFTA--------IDFSINSNEQQGWLD  170

Query  337  TTYLDSELRISRGEAGSIFVLIK  269
             TYLDSELRI RG  GS+FVL K
Sbjct  171  ITYLDSELRIGRGNEGSVFVLAK  193



>dbj|GAL94246.1| fibrillin [Microcystis aeruginosa NIES-44]
Length=196

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 71/165 (43%), Gaps = 26/165 (16%)
 Frame = -2

Query  748  RLLLGCSHCYQGAHSL-WVRVEEICQTIDSESFTVQNSVVFSG-PLATTSISTNAKFEVR  575
            RLL   S    G   L + ++ +I Q +D     + N     G P    ++  +A FE  
Sbjct  56   RLLFTSSRGILGLDRLPFFQLGQIYQYLDLNKAKLYNIAEIIGIPGLEGAVIVSATFEPT  115

Query  574  SPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSIS  395
            S +RV +KFE  I+G  +L +     E +E                         ++S  
Sbjct  116  SERRVMVKFERSILGLQRLLNYHSPQEFIE------------------------AIESGK  151

Query  394  SQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDS  260
              PPL FS  N     WL  TYLD +LRI RG  GS+F+L KE +
Sbjct  152  KFPPLDFSFNNRQQTGWLDITYLDEDLRIGRGSEGSVFILAKEKT  196



>ref|WP_044450060.1| fibrillin [Mastigocladus laminosus]
 gb|KIY13054.1| fibrillin [Mastigocladus laminosus UU774]
Length=194

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 68/143 (48%), Gaps = 25/143 (17%)
 Frame = -2

Query  694  RVEEICQTIDSESFTVQN-SVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++ +I Q I  +S +V N + ++  P     +S  AKFE  S +RVQ+KFE  I+G  +L
Sbjct  75   KLGQIYQCIRVKSNSVYNIAEIYGLPFLEGIVSVAAKFEPVSGRRVQVKFERSIVGFQRL  134

Query  517  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  338
                            ID       I  ++D              + FS+ ++  + WL 
Sbjct  135  ----------------IDYKSPDKYIQQIEDGQKFTA--------IDFSINSNEQQGWLD  170

Query  337  TTYLDSELRISRGEAGSIFVLIK  269
             TYLDSELRI RG  GS+FVL K
Sbjct  171  ITYLDSELRIGRGNEGSVFVLTK  193



>ref|WP_017296325.1| hypothetical protein [Geminocystis herdmanii]
Length=201

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 77/167 (46%), Gaps = 33/167 (20%)
 Frame = -2

Query  748  RLLLGCSHCYQGAHSL-WVRVEEICQTIDSESFTVQNSVVFSG-PLATTSISTNAKFEVR  575
            RLL   S    G  ++  V + EI Q I +++  + N     G P     +S +A FE  
Sbjct  56   RLLYTTSKSILGLDNIPLVHLGEIYQCIRTDATKIYNIAEIIGLPFLDGLVSVSANFETV  115

Query  574  SPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSIS  395
            SPKRV +KF+  I+G  +L            LG    L+P K LI  ++           
Sbjct  116  SPKRVNVKFQRSIVGLQKL------------LGY---LSP-KDLIKKMETGKYF------  153

Query  394  SQPPLKFS-------LANSNAESWLLTTYLDSELRISRGEAGSIFVL  275
              PP  F+       L N+N+  WL  TYLD  LRI+RG  G+IF+L
Sbjct  154  --PPFDFNFNWGDRILGNNNSLGWLEITYLDETLRIARGNQGNIFIL  198



>ref|WP_016878430.1| fibrillin [Chlorogloeopsis fritschii]
Length=194

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 70/144 (49%), Gaps = 25/144 (17%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQN-SVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  521
             ++ EI Q I  ++ +V N + ++  PL    +S  AKFE  S +RVQ+KFE  IIG  +
Sbjct  74   CKLGEIYQCIRVQTNSVYNIAEIYGLPLLEGIVSVAAKFEPVSERRVQVKFERSIIGLQR  133

Query  520  LTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWL  341
            L                     +K   T +Q      +++      + F L ++  + WL
Sbjct  134  LIS-------------------YKSSTTFIQQ-----IEAGQKFTAVDFPLNSNEQQGWL  169

Query  340  LTTYLDSELRISRGEAGSIFVLIK  269
              TYLDS+LRI RG  GS+FVL K
Sbjct  170  DITYLDSDLRIGRGNEGSVFVLAK  193



>ref|WP_002747500.1| fibrillin [Microcystis aeruginosa]
 emb|CAO88478.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 emb|CCH93763.1| Similar to tr|Q4C252|Q4C252_CROWT PAP fibrillin [Microcystis 
aeruginosa PCC 9432]
 emb|CCI06188.1| Similar to tr|Q4C252|Q4C252_CROWT PAP fibrillin [Microcystis 
aeruginosa PCC 7941]
 emb|CCI38375.1| Similar to tr|Q4C252|Q4C252_CROWT PAP fibrillin [Microcystis 
aeruginosa PCC 9701]
 gb|ELS45827.1| PAP_fibrillin family protein [Microcystis aeruginosa DIANCHI905]
 gb|EPF22379.1| PAP_fibrillin [Microcystis aeruginosa SPC777]
Length=196

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 71/165 (43%), Gaps = 26/165 (16%)
 Frame = -2

Query  748  RLLLGCSHCYQGAHSL-WVRVEEICQTIDSESFTVQNSVVFSG-PLATTSISTNAKFEVR  575
            RLL   S    G   L + ++ +I Q +D     + N    +G P    ++   A FE  
Sbjct  56   RLLFTSSRDILGLDRLPFFQLGQIYQYLDLNKAKLYNIAEITGVPWLEGAVIVAATFEPT  115

Query  574  SPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSIS  395
            S +RV +KFE  I+G  +  +     E ++                         ++S  
Sbjct  116  SERRVMVKFERSILGLQRFLNYHSPQEFID------------------------AIESGK  151

Query  394  SQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDS  260
              PPL FS  N   + WL  TYLD +LRI RG  GS+F+L KE +
Sbjct  152  KFPPLDFSFNNREQKGWLDITYLDEDLRIGRGSEGSVFILAKEKT  196



>ref|WP_008199162.1| fibrillin [Microcystis sp. T1-4]
 emb|CCI31446.1| Fibrillin [Microcystis sp. T1-4]
Length=196

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 71/167 (43%), Gaps = 30/167 (18%)
 Frame = -2

Query  748  RLLLGCSHCYQGAHSL-WVRVEEICQTIDSESFTVQNSVVFSG-PLATTSISTNAKFEVR  575
            RLL   S    G   L + ++ +I Q +D     + N     G P     +  +A FE  
Sbjct  56   RLLFTSSRGILGLDGLPFFQLGQIYQYLDLNKSKLYNIAEIIGLPWLEAVVIVSATFEPT  115

Query  574  SPKRVQIKFEEGIIGTPQLTDSIVLPENVEFL--GQKIDLTPFKGLITSLQDTASSVVKS  401
            S +RV +KFE  I+G  +L +     E +E +  GQK                       
Sbjct  116  SERRVMVKFERSILGLQRLLNYHSPQEFIEAIESGQKF----------------------  153

Query  400  ISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDS  260
                PPL FS  N     WL  TYLD +LRI RG  GS+F+L KE +
Sbjct  154  ----PPLDFSFNNRPQTGWLDITYLDEDLRIGRGSEGSVFILAKEKT  196



>ref|WP_006527167.1| fibrillin [Gloeocapsa sp. PCC 73106]
 gb|ELS00014.1| fibrillin [Gloeocapsa sp. PCC 73106]
Length=195

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/163 (28%), Positives = 78/163 (48%), Gaps = 26/163 (16%)
 Frame = -2

Query  748  RLLLGCSHCYQGAHSL-WVRVEEICQTIDSESFTVQNSVVFSG-PLATTSISTNAKFEVR  575
            RLL   S    G + L  +++ +I Q + +E   + N     G PL    +S  A+FEV 
Sbjct  56   RLLYTTSRGILGLNRLPLLQLGQIYQYLRAEQGILYNIAEIVGIPLLEGVVSVCARFEVV  115

Query  574  SPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSIS  395
            S +RV ++FE  +I   +L +                   ++  +  +++     ++   
Sbjct  116  SERRVNVRFERSVIVLQRLIN-------------------YRSPLNFIEE-----IEGGK  151

Query  394  SQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKE  266
              PP+ F+++N   + WL  TYLD ++R+ RG  G+IFVL KE
Sbjct  152  KFPPIDFNISNREQKGWLEITYLDEDIRLGRGNEGNIFVLAKE  194



>ref|WP_009455625.1| MULTISPECIES: fibrillin [Fischerella]
 gb|EHC18180.1| PAP fibrillin family protein [Fischerella sp. JSC-11]
Length=194

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/145 (34%), Positives = 73/145 (50%), Gaps = 29/145 (20%)
 Frame = -2

Query  694  RVEEICQTIDSESFTVQN-SVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  518
            ++ EI Q I   + +V N + ++  PL    IS  AKFE  S +RVQ+KFE  I+G  +L
Sbjct  75   KLGEIYQCIRVNTNSVYNIAEIYGLPLLEGLISVAAKFEPVSGRRVQVKFERSIVGFQRL  134

Query  517  TDSIVLPENVEFL--GQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESW  344
             +     + ++ +  GQK+              TA            + FSL ++  + W
Sbjct  135  INYKSPEKYIQQIEAGQKL--------------TA------------IDFSLNSNEQQGW  168

Query  343  LLTTYLDSELRISRGEAGSIFVLIK  269
            L  TYLD++LRI RG  GS+FVL K
Sbjct  169  LDITYLDNDLRIGRGNEGSVFVLTK  193



>ref|WP_019499433.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=200

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 69/149 (46%), Gaps = 29/149 (19%)
 Frame = -2

Query  697  VRVEEICQTIDSESFTVQNSVVFSG-PLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  521
            +++ +I Q I +    V N     G PL    +S  A F V S +RV +KFE  ++G  +
Sbjct  74   IKLGQIYQCIRANEGKVYNVAEILGLPLLEGFVSVCASFTVVSAQRVNVKFERAVVGLQR  133

Query  520  LTDSIVLPENVEFL--GQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAES  347
            L     + E V+ L  G+K+                            + F +   + + 
Sbjct  134  LIGYTNVDEFVQLLQSGRKLR--------------------------AIDFGIKERDRQG  167

Query  346  WLLTTYLDSELRISRGEAGSIFVLIKEDS  260
            WL TTYLD++LRISRG  GS+FVL K+ +
Sbjct  168  WLETTYLDTDLRISRGNEGSVFVLRKDRT  196



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1553719916385