BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF012K19

Length=803
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009778545.1|  PREDICTED: nucleolar protein 14                    202   8e-56   Nicotiana sylvestris
ref|XP_009597551.1|  PREDICTED: nucleolar protein 14                    202   2e-55   Nicotiana tomentosiformis
gb|KHM99344.1|  Nucleolar protein 14                                    197   3e-55   Glycine soja [wild soybean]
gb|KHN15381.1|  Nucleolar protein 14                                    198   5e-55   Glycine soja [wild soybean]
ref|XP_006574504.1|  PREDICTED: nucleolar protein 14-like isoform X2    198   1e-54   
gb|KHN00285.1|  Nucleolar protein 14                                    199   2e-54   Glycine soja [wild soybean]
ref|XP_006574503.1|  PREDICTED: nucleolar protein 14-like isoform X1    199   3e-54   Glycine max [soybeans]
ref|XP_006588546.1|  PREDICTED: nucleolar protein 14-like               199   3e-54   Glycine max [soybeans]
ref|XP_010320847.1|  PREDICTED: nucleolar protein 14 isoform X2         194   4e-53   Solanum lycopersicum
ref|XP_006348659.1|  PREDICTED: nucleolar protein 14-like               195   4e-53   Solanum tuberosum [potatoes]
ref|XP_010320846.1|  PREDICTED: nucleolar protein 14 isoform X1         194   1e-52   Solanum lycopersicum
emb|CAN71711.1|  hypothetical protein VITISV_013458                     193   1e-52   Vitis vinifera
emb|CBI27323.3|  unnamed protein product                                193   2e-52   Vitis vinifera
ref|XP_010650046.1|  PREDICTED: nucleolar protein 14                    193   3e-52   Vitis vinifera
emb|CDP00465.1|  unnamed protein product                                190   2e-51   Coffea canephora [robusta coffee]
ref|XP_007045792.1|  Nop14, putative isoform 2                          189   8e-51   
ref|XP_007045791.1|  Nop14, putative isoform 1                          189   8e-51   
gb|KHG15298.1|  Nucleolar 14                                            189   8e-51   Gossypium arboreum [tree cotton]
gb|KEH42218.1|  Nop14 nucleolar-like protein                            186   2e-50   Medicago truncatula
gb|KJB78310.1|  hypothetical protein B456_012G185400                    187   2e-50   Gossypium raimondii
gb|KEH41125.1|  Nop14 nucleolar-like protein                            187   4e-50   Medicago truncatula
gb|KEH42220.1|  Nop14 nucleolar-like protein                            186   7e-50   Medicago truncatula
ref|XP_009379407.1|  PREDICTED: probable nucleolar complex protei...    175   1e-49   
ref|XP_010932890.1|  PREDICTED: nucleolar protein 14 isoform X1         185   2e-49   Elaeis guineensis
ref|XP_010932892.1|  PREDICTED: nucleolar protein 14 isoform X2         185   2e-49   Elaeis guineensis
ref|XP_010044381.1|  PREDICTED: nucleolar protein 14                    183   1e-48   Eucalyptus grandis [rose gum]
gb|KCW86470.1|  hypothetical protein EUGRSUZ_B03138                     183   1e-48   Eucalyptus grandis [rose gum]
ref|XP_011009745.1|  PREDICTED: nucleolar protein 14 isoform X1         182   3e-48   Populus euphratica
ref|XP_011009760.1|  PREDICTED: nucleolar protein 14 isoform X3         182   3e-48   Populus euphratica
ref|XP_011009752.1|  PREDICTED: nucleolar protein 14 isoform X2         182   3e-48   Populus euphratica
ref|XP_011009770.1|  PREDICTED: nucleolar protein 14 isoform X4         182   3e-48   Populus euphratica
ref|XP_007145864.1|  hypothetical protein PHAVU_007G274500g             181   6e-48   Phaseolus vulgaris [French bean]
ref|XP_002316014.2|  hypothetical protein POPTR_0010s15000g             181   7e-48   
ref|XP_002517429.1|  nop14, putative                                    179   1e-47   
ref|XP_006856350.1|  hypothetical protein AMTR_s00047p00175730          179   1e-47   
ref|XP_010551353.1|  PREDICTED: nucleolar protein 14                    180   1e-47   Tarenaya hassleriana [spider flower]
ref|XP_008243808.1|  PREDICTED: nucleolar protein 14                    180   2e-47   Prunus mume [ume]
ref|XP_007225494.1|  hypothetical protein PRUPE_ppa000919mg             180   2e-47   Prunus persica
ref|XP_010091617.1|  hypothetical protein L484_026465                   179   2e-47   
ref|XP_008777148.1|  PREDICTED: nucleolar protein 14 isoform X2         177   3e-47   Phoenix dactylifera
ref|XP_008777146.1|  PREDICTED: nucleolar protein 14 isoform X1         177   3e-47   Phoenix dactylifera
ref|XP_004144162.1|  PREDICTED: nucleolar protein 14-like               177   7e-47   
ref|XP_004165503.1|  PREDICTED: nucleolar protein 14-like               177   7e-47   
gb|KGN47665.1|  hypothetical protein Csa_6G367110                       178   8e-47   Cucumis sativus [cucumbers]
ref|XP_009356445.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    176   3e-46   
gb|KDP45433.1|  hypothetical protein JCGZ_09682                         175   7e-46   Jatropha curcas
gb|KDO70293.1|  hypothetical protein CISIN_1g012881mg                   170   8e-46   Citrus sinensis [apfelsine]
ref|XP_006437873.1|  hypothetical protein CICLE_v10030646mg             174   1e-45   Citrus clementina [clementine]
ref|XP_010470881.1|  PREDICTED: nucleolar protein 14-like               174   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_011462988.1|  PREDICTED: nucleolar protein 14 isoform X1         173   3e-45   Fragaria vesca subsp. vesca
ref|XP_004297213.1|  PREDICTED: nucleolar protein 14 isoform X2         173   3e-45   Fragaria vesca subsp. vesca
ref|NP_001050609.1|  Os03g0598200                                       173   4e-45   
gb|EAZ27697.1|  hypothetical protein OsJ_11647                          173   4e-45   Oryza sativa Japonica Group [Japonica rice]
gb|AAN08225.2|  unknown protein                                         173   5e-45   Oryza sativa Japonica Group [Japonica rice]
gb|ABF97462.1|  Nop14-like family protein, expressed                    172   6e-45   Oryza sativa Japonica Group [Japonica rice]
gb|EEC75694.1|  hypothetical protein OsI_12505                          172   7e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_008389390.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    171   1e-44   
ref|XP_004497865.1|  PREDICTED: nucleolar protein 14-like               171   2e-44   Cicer arietinum [garbanzo]
gb|ABR16783.1|  unknown                                                 159   3e-44   Picea sitchensis
ref|XP_006484246.1|  PREDICTED: nucleolar protein 14-like               170   4e-44   Citrus sinensis [apfelsine]
ref|XP_010681128.1|  PREDICTED: nucleolar protein 14                    169   1e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006651582.1|  PREDICTED: nucleolar protein 14-like               169   1e-43   Oryza brachyantha
ref|XP_011070910.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    167   6e-43   Sesamum indicum [beniseed]
ref|XP_008445433.1|  PREDICTED: nucleolar protein 14 isoform X1         167   7e-43   Cucumis melo [Oriental melon]
ref|XP_008445434.1|  PREDICTED: nucleolar protein 14 isoform X2         167   7e-43   Cucumis melo [Oriental melon]
ref|XP_010232878.1|  PREDICTED: nucleolar protein 14 isoform X1         165   3e-42   Brachypodium distachyon [annual false brome]
ref|XP_010232881.1|  PREDICTED: nucleolar protein 14 isoform X2         165   3e-42   Brachypodium distachyon [annual false brome]
ref|XP_008665059.1|  PREDICTED: nucleolar protein 14 isoform X1         164   5e-42   Zea mays [maize]
ref|XP_008665060.1|  PREDICTED: nucleolar protein 14 isoform X2         164   5e-42   Zea mays [maize]
ref|XP_002464264.1|  hypothetical protein SORBIDRAFT_01g015150          164   5e-42   Sorghum bicolor [broomcorn]
ref|XP_009402831.1|  PREDICTED: nucleolar protein 14                    160   9e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010257952.1|  PREDICTED: nucleolar protein 14                    160   1e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010415532.1|  PREDICTED: nucleolar protein 14-like isoform X1    159   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010415534.1|  PREDICTED: nucleolar protein 14-like isoform X3    159   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010511932.1|  PREDICTED: nucleolar protein 14-like               158   8e-40   Camelina sativa [gold-of-pleasure]
ref|XP_002888698.1|  hypothetical protein ARALYDRAFT_339148             157   1e-39   Arabidopsis lyrata subsp. lyrata
gb|KFK41333.1|  hypothetical protein AALP_AA2G116500                    157   1e-39   Arabis alpina [alpine rockcress]
gb|ACG60683.1|  unknown protein                                         154   1e-38   Brassica oleracea var. alboglabra [Chinese broccoli]
gb|EYU22573.1|  hypothetical protein MIMGU_mgv1a000929mg                153   4e-38   Erythranthe guttata [common monkey flower]
ref|XP_006300707.1|  hypothetical protein CARUB_v10019758mg             153   4e-38   Capsella rubella
ref|XP_004982473.1|  PREDICTED: nucleolar protein 14-like               153   5e-38   Setaria italica
ref|XP_001762011.1|  predicted protein                                  152   6e-38   
emb|CDY65810.1|  BnaA02g35820D                                          151   2e-37   Brassica napus [oilseed rape]
ref|XP_009127702.1|  PREDICTED: nucleolar protein 14                    151   2e-37   Brassica rapa
ref|XP_006391059.1|  hypothetical protein EUTSA_v10018096mg             151   2e-37   Eutrema salsugineum [saltwater cress]
ref|NP_177070.1|  uncharacterized protein                               147   4e-36   Arabidopsis thaliana [mouse-ear cress]
gb|AAF27073.1|AC008262_22  F4N2.4                                       147   5e-36   Arabidopsis thaliana [mouse-ear cress]
gb|EPS71081.1|  hypothetical protein M569_03678                         144   7e-36   Genlisea aurea
gb|AEX11449.1|  hypothetical protein 0_14259_01                         133   9e-35   Pinus taeda
gb|EMS51472.1|  hypothetical protein TRIUR3_21500                       130   3e-30   Triticum urartu
gb|EMT11619.1|  hypothetical protein F775_01391                         113   2e-24   
emb|CDY62485.1|  BnaCnng40370D                                        86.7    9e-18   Brassica napus [oilseed rape]
ref|XP_003081444.1|  Nucleolar protein involved in 40S ribosome b...  90.9    7e-17   
emb|CEF99253.1|  Nucleolar protein 14                                 90.9    7e-17   Ostreococcus tauri
ref|XP_004368115.1|  Nop14 family protein                             90.1    1e-16   Acanthamoeba castellanii str. Neff
ref|XP_001420056.1|  predicted protein                                89.7    2e-16   Ostreococcus lucimarinus CCE9901
ref|XP_011401646.1|  Nucleolar protein 14                             87.8    4e-16   Auxenochlorella protothecoides
ref|XP_007913126.1|  putative nop14-like family protein               86.3    2e-15   Phaeoacremonium minimum UCRPA7
ref|XP_005652081.1|  Nop14-like protein                               85.9    3e-15   Coccomyxa subellipsoidea C-169
ref|XP_007510128.1|  predicted protein                                85.9    3e-15   Bathycoccus prasinos
ref|XP_003064853.1|  predicted protein                                83.6    2e-14   Micromonas pusilla CCMP1545
ref|XP_001550943.1|  hypothetical protein BC1G_10502                  83.6    2e-14   Botrytis cinerea B05.10
emb|CCD54887.1|  similar to Nop14-like family protein                 83.6    2e-14   Botrytis cinerea T4
gb|ESZ97958.1|  hypothetical protein SBOR_1629                        82.8    2e-14   Sclerotinia borealis F-4128
gb|EIE77069.1|  hypothetical protein RO3G_01773                       82.8    3e-14   Rhizopus delemar RA 99-880
dbj|GAD92660.1|  rRNA maturation protein (Nop14), putative            82.4    4e-14   Byssochlamys spectabilis No. 5
gb|EKD02613.1|  nucleolar protein, Nop14p                             82.0    4e-14   Trichosporon asahii var. asahii CBS 8904
gb|EJT51859.1|  nucleolar protein, Nop14p                             80.9    1e-13   Trichosporon asahii var. asahii CBS 2479
ref|XP_002541971.1|  conserved hypothetical protein                   80.5    1e-13   Uncinocarpus reesii 1704
ref|XP_003652387.1|  hypothetical protein THITE_2113840               80.5    1e-13   Thielavia terrestris NRRL 8126
gb|EQB53783.1|  Nop14-like family protein                             80.5    1e-13   Colletotrichum gloeosporioides Cg-14
ref|XP_007279832.1|  rRNA maturation protein                          80.5    2e-13   
ref|XP_007412912.1|  hypothetical protein MELLADRAFT_37772            80.5    2e-13   Melampsora larici-populina 98AG31
gb|EHK15639.1|  hypothetical protein TRIVIDRAFT_123214                80.1    2e-13   Trichoderma virens Gv29-8
gb|EHK40857.1|  hypothetical protein TRIATDRAFT_172421                80.1    2e-13   Trichoderma atroviride IMI 206040
gb|EEH06589.1|  nucleolar complex protein                             80.1    2e-13   Histoplasma capsulatum G186AR
ref|XP_003659212.1|  hypothetical protein MYCTH_2295937               79.7    3e-13   Thermothelomyces thermophila ATCC 42464
ref|XP_001826654.1|  rRNA maturation protein (Nop14)                  79.7    3e-13   Aspergillus oryzae RIB40
gb|EIT73795.1|  nucleolar protein involved in 40S ribosome biogen...  79.7    3e-13   Aspergillus oryzae 3.042
gb|KIW07965.1|  hypothetical protein PV09_01865                       79.3    3e-13   Verruconis gallopava
ref|XP_002385435.1|  rRNA maturation protein (Nop14), putative        79.7    3e-13   Aspergillus flavus NRRL3357
ref|XP_001248475.1|  hypothetical protein CIMG_02246                  79.3    3e-13   Coccidioides immitis RS
ref|XP_001543783.1|  conserved hypothetical protein                   79.3    3e-13   Histoplasma capsulatum NAm1
emb|CCF32351.1|  Nop14-like family protein                            79.3    3e-13   Colletotrichum higginsianum
emb|CDM29234.1|  Nop14-like protein                                   79.0    4e-13   Penicillium roqueforti FM164
ref|XP_003051701.1|  hypothetical protein NECHADRAFT_37909            79.0    5e-13   [Nectria] haematococca mpVI 77-13-4
ref|XP_003070785.1|  Nop14-like family protein                        78.6    5e-13   Coccidioides posadasii C735 delta SOWgp
ref|XP_009855934.1|  hypothetical protein NEUTE1DRAFT_149856          78.6    6e-13   Neurospora tetrasperma FGSC 2508
ref|XP_007827194.1|  hypothetical protein PFICI_00422                 78.6    6e-13   Pestalotiopsis fici W106-1
gb|ELQ33066.1|  nucleolar complex protein 14                          78.6    6e-13   Magnaporthe oryzae Y34
ref|XP_003710991.1|  hypothetical protein MGG_04470                   78.6    6e-13   Magnaporthe oryzae 70-15
emb|CCE31017.1|  related to NOP14-nuclear and nucleolar protein w...  78.6    6e-13   Claviceps purpurea 20.1
ref|XP_568888.1|  hypothetical protein CNB03110                       78.6    7e-13   Cryptococcus neoformans var. neoformans JEC21
gb|AFR93321.2|  nucleolar protein 14                                  78.6    7e-13   Cryptococcus neoformans var. grubii H99
gb|EGZ77113.1|  Nop14-like protein                                    78.6    7e-13   Neurospora tetrasperma FGSC 2509
ref|XP_003351797.1|  hypothetical protein SMAC_00342                  78.6    7e-13   Sordaria macrospora k-hell
gb|KIR94784.1|  nucleolar protein 14                                  78.2    7e-13   Cryptococcus gattii VGII CBS 10090
gb|KIY54636.1|  nucleolar protein 14                                  78.2    7e-13   Cryptococcus gattii VGII 99/473
gb|KGB75700.1|  nucleolar protein 14                                  78.2    7e-13   
gb|KIR71038.1|  nucleolar protein 14                                  78.2    8e-13   Cryptococcus gattii VGII CA1014
gb|KIR25432.1|  nucleolar protein 14                                  78.2    8e-13   Cryptococcus gattii VGII LA55
gb|KFA61435.1|  hypothetical protein S40285_03442                     78.2    8e-13   Stachybotrys chlorohalonata IBT 40285
gb|KIR39361.1|  nucleolar protein 14                                  78.2    8e-13   Cryptococcus gattii VGII Ram5
ref|XP_001594332.1|  hypothetical protein SS1G_04139                  78.2    8e-13   Sclerotinia sclerotiorum 1980 UF-70
ref|XP_009269619.1|  putative nucleolar complex protein 14            78.2    8e-13   Wallemia ichthyophaga EXF-994
gb|KDQ64193.1|  hypothetical protein JAAARDRAFT_116740                78.2    8e-13   Jaapia argillacea MUCL 33604
ref|XP_006957635.1|  Nop14-like protein                               78.2    8e-13   Wallemia mellicola CBS 633.66
gb|EPS26010.1|  hypothetical protein PDE_00946                        78.2    9e-13   Penicillium oxalicum 114-2
ref|XP_958477.3|  rRNA maturation protein                             78.2    9e-13   Neurospora crassa OR74A
gb|KFA76612.1|  hypothetical protein S40288_08124                     78.2    9e-13   Stachybotrys chartarum IBT 40288
gb|KFA54889.1|  hypothetical protein S40293_08555                     78.2    9e-13   Stachybotrys chartarum IBT 40293
gb|KIL90840.1|  nop14-nuclear and nucleolar protein with possible...  77.8    1e-12   Fusarium avenaceum
gb|KEY70595.1|  hypothetical protein S7711_02199                      77.8    1e-12   Stachybotrys chartarum IBT 7711
gb|EPB82072.1|  hypothetical protein HMPREF1544_11200                 77.8    1e-12   Mucor circinelloides f. circinelloides 1006PhL
gb|KIR46489.1|  nucleolar protein 14                                  77.8    1e-12   Cryptococcus gattii CA1280
gb|KIR59974.1|  nucleolar protein 14                                  77.8    1e-12   Cryptococcus gattii CA1873
ref|XP_002844066.1|  nucleolar complex protein 14                     77.8    1e-12   Microsporum canis CBS 113480
gb|EKV11174.1|  RRNA maturation protein (Nop14), putative             77.4    1e-12   Penicillium digitatum Pd1
ref|XP_002568148.1|  Pc21g11160                                       77.4    1e-12   Penicillium rubens Wisconsin 54-1255
ref|XP_006963586.1|  hypothetical protein TRIREDRAFT_46607            77.4    1e-12   Trichoderma reesei QM6a
ref|XP_007798795.1|  putative nucleolar complex protein               77.4    1e-12   
gb|ETS03928.1|  putative rRNA maturation protein                      77.4    1e-12   Trichoderma reesei RUT C-30
gb|KDE05828.1|  hypothetical protein MVLG_03772                       77.4    1e-12   Microbotryum lychnidis-dioicae p1A1 Lamole
dbj|GAA89375.1|  rRNA maturation protein                              77.4    2e-12   Aspergillus kawachii IFO 4308
emb|CCA76325.1|  related to NOP14-nuclear and nucleolar protein w...  77.0    2e-12   Serendipita indica DSM 11827
ref|XP_001908693.1|  hypothetical protein                             77.0    2e-12   Podospora anserina S mat+
gb|KIR85614.1|  nucleolar protein 14                                  77.0    2e-12   Cryptococcus gattii VGIV IND107
emb|CCU78989.1|  rRNA maturation protein/Nop14                        77.0    2e-12   Blumeria graminis f. sp. hordei DH14
gb|KGO43856.1|  Nop14-like protein                                    77.0    2e-12   Penicillium expansum
ref|XP_011326664.1|  hypothetical protein FGSG_13033                  76.6    2e-12   Fusarium graminearum PH-1
gb|EER40770.1|  nucleolar complex protein                             76.6    2e-12   Histoplasma capsulatum H143
ref|XP_003005157.1|  nucleolar complex protein                        76.6    3e-12   Verticillium alfalfae VaMs.102
gb|KFH47867.1|  nucleolar complex protein-like protein                76.6    3e-12   Acremonium chrysogenum ATCC 11550
ref|XP_009649045.1|  nucleolar complex protein                        76.6    3e-12   Verticillium dahliae VdLs.17
ref|XP_009256128.1|  hypothetical protein FPSE_04735                  76.6    3e-12   Fusarium pseudograminearum CS3096
gb|EYE95936.1|  putative rRNA maturation protein                      76.6    3e-12   Aspergillus ruber CBS 135680
emb|CEF83827.1|  unnamed protein product                              76.6    3e-12   Fusarium graminearum
gb|EYB23853.1|  hypothetical protein FG05_13033                       76.6    3e-12   Fusarium graminearum
ref|XP_007862084.1|  Nop14-like protein                               76.6    3e-12   Gloeophyllum trabeum ATCC 11539
gb|EPQ64768.1|  hypothetical protein BGT96224_504                     76.6    3e-12   Blumeria graminis f. sp. tritici 96224
ref|XP_002793148.1|  nucleolar complex protein                        76.3    3e-12   Paracoccidioides lutzii Pb01
gb|ERS98599.1|  hypothetical protein HMPREF1624_05386                 76.6    3e-12   Sporothrix schenckii ATCC 58251
ref|XP_002392233.1|  hypothetical protein MPER_08226                  72.8    3e-12   
ref|XP_010758451.1|  hypothetical protein PADG_02435                  76.3    3e-12   Paracoccidioides brasiliensis Pb18
gb|KGO72282.1|  Nop14-like protein                                    76.3    3e-12   Penicillium italicum
gb|KDN66972.1|  putative Nop14-like family protein                    76.3    3e-12   Colletotrichum sublineola
emb|CEP08449.1|  hypothetical protein                                 76.3    3e-12   Parasitella parasitica
gb|EEH17482.1|  hypothetical protein PABG_00045                       76.3    3e-12   Paracoccidioides brasiliensis Pb03
gb|KFZ16950.1|  hypothetical protein V501_01989                       76.3    3e-12   Pseudogymnoascus sp. VKM F-4519 (FW-2642)
gb|EZF31560.1|  hypothetical protein H101_04828                       76.3    3e-12   Trichophyton interdigitale H6
gb|EQL31424.1|  hypothetical protein BDFG_06246                       76.3    3e-12   Blastomyces dermatitidis ATCC 26199
gb|KIH87812.1|  nucleolar protein 14                                  76.3    3e-12   Sporothrix brasiliensis 5110
ref|XP_002628096.1|  rRNA maturation protein                          76.3    3e-12   Blastomyces gilchristii SLH14081
gb|EFQ26355.1|  Nop14-like family protein                             76.3    4e-12   Colletotrichum graminicola M1.001
gb|EGE81696.1|  rRNA maturation protein                               76.3    4e-12   Blastomyces dermatitidis ATCC 18188
gb|KFY73048.1|  hypothetical protein V499_06866                       76.3    4e-12   Pseudogymnoascus sp. VKM F-103
gb|EEQ88893.1|  rRNA maturation protein                               76.3    4e-12   Blastomyces dermatitidis ER-3
gb|KIR54334.1|  nucleolar protein 14                                  75.9    4e-12   Cryptococcus gattii Ru294
gb|KFY01512.1|  hypothetical protein V490_00869                       75.9    4e-12   Pseudogymnoascus sp. VKM F-3557
ref|XP_007594811.1|  Nop14-like family protein                        75.9    4e-12   
gb|KFY49104.1|  hypothetical protein V495_00752                       75.9    4e-12   Pseudogymnoascus sp. VKM F-4514 (FW-929)
ref|XP_003024461.1|  hypothetical protein TRV_01424                   75.9    4e-12   Trichophyton verrucosum HKI 0517
ref|XP_003191327.1|  nucleolar protein; Nop14p                        75.9    4e-12   Cryptococcus gattii WM276
emb|CEJ95036.1|  hypothetical protein VHEMI10539                      75.9    4e-12   Torrubiella hemipterigena
emb|CEG64233.1|  hypothetical protein RMATCC62417_01246               75.9    4e-12   Rhizopus microsporus
ref|XP_009154417.1|  hypothetical protein HMPREF1120_02135            75.9    4e-12   Exophiala dermatitidis NIH/UT8656
emb|CCL98246.1|  predicted protein                                    75.9    5e-12   Fibroporia radiculosa
gb|KFX96344.1|  hypothetical protein O988_05381                       75.9    5e-12   Pseudogymnoascus sp. VKM F-3808
ref|XP_003237090.1|  rRNA maturation protein                          75.5    5e-12   Trichophyton rubrum CBS 118892
gb|ELR10502.1|  hypothetical protein GMDG_04780                       75.5    6e-12   Pseudogymnoascus destructans 20631-21
ref|XP_003015214.1|  hypothetical protein ARB_06337                   75.5    6e-12   Trichophyton benhamiae CBS 112371
gb|KDB23490.1|  hypothetical protein H109_04618                       75.5    6e-12   Trichophyton interdigitale MR816
ref|XP_003172323.1|  nucleolar complex protein 14                     75.5    7e-12   Nannizzia gypsea CBS 118893
gb|KIP10347.1|  hypothetical protein PHLGIDRAFT_125555                75.5    7e-12   Phlebiopsis gigantea 11061_1 CR5-6
gb|EGD95886.1|  rRNA maturation protein                               75.1    7e-12   Trichophyton tonsurans CBS 112818
gb|ENH88361.1|  rRNA maturation protein                               75.1    7e-12   
gb|KDR84100.1|  hypothetical protein GALMADRAFT_236756                75.1    8e-12   Galerina marginata CBS 339.88
gb|KFY39506.1|  hypothetical protein V494_03939                       75.1    9e-12   Pseudogymnoascus sp. VKM F-4513 (FW-928)
gb|KFY08736.1|  hypothetical protein V492_05940                       74.7    9e-12   Pseudogymnoascus sp. VKM F-4246
gb|KFY53389.1|  hypothetical protein V496_07651                       74.7    1e-11   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
emb|CCX30130.1|  Similar to Probable nucleolar complex protein 14...  74.7    1e-11   Pyronema omphalodes CBS 100304
gb|KFY94531.1|  hypothetical protein V500_03177                       74.7    1e-11   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
ref|XP_009219726.1|  hypothetical protein GGTG_03680                  74.3    1e-11   Gaeumannomyces tritici R3-111a-1
emb|CAK47083.1|  unnamed protein product                              74.3    1e-11   Aspergillus niger
dbj|GAM82652.1|  hypothetical protein ANO11243_006340                 74.3    1e-11   fungal sp. No.11243
gb|EQL00077.1|  nucleolar protein                                     74.3    1e-11   Ophiocordyceps sinensis CO18
ref|XP_001398184.2|  rRNA maturation protein (Nop14)                  74.3    1e-11   Aspergillus niger CBS 513.88
gb|EFW99913.1|  rRNA maturation protein                               74.3    1e-11   Grosmannia clavigera kw1407
gb|KFY24396.1|  hypothetical protein V493_05255                       74.3    1e-11   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
ref|XP_007004410.1|  hypothetical protein TREMEDRAFT_20830            74.3    2e-11   Tremella mesenterica DSM 1558
gb|EHA21586.1|  hypothetical protein ASPNIDRAFT_51257                 74.3    2e-11   Aspergillus niger ATCC 1015
gb|KFH69990.1|  hypothetical protein MVEG_04793                       74.3    2e-11   Mortierella verticillata NRRL 6337
gb|KEQ86111.1|  Nop14-like protein                                    73.9    2e-11   Aureobasidium pullulans EXF-150
ref|XP_002150848.1|  rRNA maturation protein (Nop14), putative        73.9    2e-11   Talaromyces marneffei ATCC 18224
ref|XP_001261970.1|  rRNA maturation protein (Nop14), putative        73.9    2e-11   Aspergillus fischeri NRRL 181
gb|KFZ24138.1|  hypothetical protein V502_01389                       73.9    2e-11   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
emb|CEI92865.1|  hypothetical protein RMCBS344292_07113               73.9    2e-11   Rhizopus microsporus
ref|XP_006695656.1|  hypothetical protein CTHT_0053180                73.9    2e-11   Chaetomium thermophilum var. thermophilum DSM 1495
gb|KEQ65436.1|  Nop14-like protein                                    73.9    2e-11   Aureobasidium melanogenum CBS 110374
ref|XP_001210121.1|  conserved hypothetical protein                   73.9    2e-11   Aspergillus terreus NIH2624
gb|EWY98757.1|  hypothetical protein FOYG_03083                       73.9    2e-11   Fusarium oxysporum FOSC 3-a
gb|EXL85972.1|  hypothetical protein FOPG_02227                       73.9    2e-11   Fusarium oxysporum f. sp. conglutinans race 2 54008
gb|EXA50105.1|  hypothetical protein FOVG_02951                       73.9    2e-11   Fusarium oxysporum f. sp. pisi HDV247
gb|KIM46535.1|  hypothetical protein M413DRAFT_441625                 73.6    2e-11   Hebeloma cylindrosporum h7
dbj|GAN00582.1|  nop14-like protein                                   73.6    2e-11   Mucor ambiguus
gb|EGU81827.1|  hypothetical protein FOXB_07622                       73.6    2e-11   Fusarium oxysporum Fo5176
gb|KIY66708.1|  Nop14-like protein                                    73.6    2e-11   Cylindrobasidium torrendii FP15055 ss-10
emb|CCT65890.1|  related to NOP14-nuclear and nucleolar protein w...  73.6    2e-11   Fusarium fujikuroi IMI 58289
gb|KEQ76791.1|  Nop14-like protein                                    73.6    2e-11   Aureobasidium namibiae CBS 147.97
gb|EPE04064.1|  nop14-like family protein                             73.6    3e-11   Ophiostoma piceae UAMH 11346
gb|KEQ98818.1|  hypothetical protein AUEXF2481DRAFT_1650              73.2    3e-11   Aureobasidium subglaciale EXF-2481
gb|KEY80821.1|  rRNA maturation protein Nop14                         73.2    3e-11   Aspergillus fumigatus var. RP-2014
ref|XP_747229.1|  rRNA maturation protein (Nop14)                     73.2    3e-11   Aspergillus fumigatus Af293
gb|KIJ56486.1|  hypothetical protein M422DRAFT_150207                 73.2    3e-11   Sphaerobolus stellatus SS14
ref|XP_002483256.1|  rRNA maturation protein (Nop14), putative        73.2    3e-11   Talaromyces stipitatus ATCC 10500
ref|XP_007701070.1|  hypothetical protein COCSADRAFT_38102            73.2    3e-11   Bipolaris sorokiniana ND90Pr
ref|XP_007365055.1|  Nop14-like protein                               73.2    3e-11   Dichomitus squalens LYAD-421 SS1
gb|EWZ98282.1|  hypothetical protein FOWG_02460                       73.2    3e-11   Fusarium oxysporum f. sp. lycopersici MN25
emb|CDH56927.1|  nop14-like protein                                   73.2    3e-11   Lichtheimia corymbifera JMRC:FSU:9682
gb|EXK42212.1|  hypothetical protein FOMG_05257                       73.2    3e-11   Fusarium oxysporum f. sp. melonis 26406
gb|EXM08463.1|  hypothetical protein FOIG_03117                       73.2    3e-11   Fusarium oxysporum f. sp. cubense tropical race 4 54006
gb|EMT65396.1|  Putative nucleolar complex protein 14                 73.2    3e-11   Fusarium oxysporum f. sp. cubense race 4
ref|XP_007292715.1|  Nop14-like family protein                        72.8    4e-11   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gb|EMD94247.1|  hypothetical protein COCHEDRAFT_1202024               72.8    5e-11   Bipolaris maydis C5
emb|CCO30039.1|  putative nucleolar complex protein 14                72.4    5e-11   Rhizoctonia solani AG-1 IB
emb|CEL59285.1|  putative nucleolar complex protein 14 OS=Schizos...  72.4    6e-11   Rhizoctonia solani AG-1 IB
ref|XP_001276527.1|  rRNA maturation protein (Nop14), putative        72.4    6e-11   Aspergillus clavatus NRRL 1
gb|ENH64666.1|  Putative nucleolar complex protein 14                 72.4    6e-11   Fusarium oxysporum f. sp. cubense race 1
gb|EWZ44838.1|  hypothetical protein FOZG_05424                       72.4    7e-11   Fusarium oxysporum Fo47
ref|XP_003329082.2|  hypothetical protein PGTG_10822                  72.4    7e-11   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gb|EGE01268.1|  nucleolar complex protein 14                          72.0    7e-11   Trichophyton equinum CBS 127.97
gb|KIY52622.1|  Nop14-like protein                                    72.0    7e-11   Fistulina hepatica ATCC 64428
gb|EMS23473.1|  nucleolar protein 14                                  72.0    8e-11   Rhodotorula toruloides NP11
gb|KDN48010.1|  hypothetical protein RSAG8_03026                      71.6    9e-11   Rhizoctonia solani AG-8 WAC10335
ref|XP_008026056.1|  hypothetical protein SETTUDRAFT_151047           71.6    9e-11   Exserohilum turcica Et28A
gb|EWG48421.1|  hypothetical protein FVEG_08204                       71.6    1e-10   Fusarium verticillioides 7600
gb|KID80162.1|  Nop14-like protein                                    71.6    1e-10   Metarhizium brunneum ARSEF 3297
ref|XP_007732254.1|  hypothetical protein A1O3_03930                  71.6    1e-10   Capronia epimyces CBS 606.96
gb|KID99982.1|  Nop14-like protein                                    71.6    1e-10   Metarhizium majus ARSEF 297
ref|XP_659038.1|  hypothetical protein AN1434.2                       71.6    1e-10   
gb|KID91195.1|  Nop14-like protein                                    71.2    1e-10   
ref|XP_007708271.1|  hypothetical protein COCCADRAFT_33373            71.2    1e-10   
gb|EMD40503.1|  hypothetical protein CERSUDRAFT_148572                71.2    1e-10   
gb|KFG80481.1|  putative rRNA maturation protein (Nop14)              71.2    1e-10   
gb|EUN28832.1|  hypothetical protein COCVIDRAFT_14450                 71.2    1e-10   
gb|KIK03170.1|  hypothetical protein K443DRAFT_677013                 71.2    1e-10   
gb|EPS98760.1|  hypothetical protein FOMPIDRAFT_1051197               71.2    1e-10   
ref|XP_007685836.1|  hypothetical protein COCMIDRAFT_24528            71.2    1e-10   
ref|XP_001876966.1|  predicted protein                                70.9    2e-10   
gb|EMF13919.1|  Nop14-like protein                                    70.9    2e-10   
gb|ESA18304.1|  hypothetical protein GLOINDRAFT_20852                 70.1    2e-10   
gb|EXV04306.1|  Nop14-like family protein                             70.9    2e-10   
ref|XP_007382587.1|  Nop14-like protein                               70.9    2e-10   
gb|EME38264.1|  hypothetical protein DOTSEDRAFT_75732                 70.5    2e-10   
ref|XP_008076886.1|  hypothetical protein GLAREA_05406                70.5    2e-10   
gb|KIM76408.1|  hypothetical protein PILCRDRAFT_826416                70.5    2e-10   
ref|XP_007821880.2|  rRNA maturation protein                          70.5    2e-10   
gb|KEP53049.1|  Nop14 family protein                                  70.5    3e-10   
gb|KIK56355.1|  hypothetical protein GYMLUDRAFT_47128                 70.5    3e-10   
emb|CDS10064.1|  hypothetical protein LRAMOSA02741                    70.5    3e-10   
ref|XP_003304453.1|  hypothetical protein PTT_17051                   70.1    3e-10   
gb|KFY19413.1|  hypothetical protein V491_04446                       70.1    3e-10   
gb|KDB13372.1|  nucleolar protein                                     70.1    3e-10   
gb|EUC56175.1|  Nop14 family protein                                  70.1    3e-10   
ref|XP_001937853.1|  nucleolar protein 14                             70.1    3e-10   
dbj|GAM38772.1|  hypothetical protein TCE0_033r09779                  69.7    4e-10   
gb|EXX58796.1|  Nop14p                                                69.7    4e-10   
ref|XP_003036590.1|  hypothetical protein SCHCODRAFT_80297            69.7    4e-10   
ref|XP_007879798.1|  hypothetical protein PFL1_04083                  69.7    4e-10   
gb|EXX58795.1|  Nop14p                                                69.7    5e-10   
gb|KIX01776.1|  hypothetical protein Z518_09503                       69.7    5e-10   
ref|XP_007337998.1|  Nop14-like protein                               69.3    6e-10   
ref|XP_007807382.1|  nucleolar protein                                69.3    6e-10   
ref|XP_001696589.1|  nucleolar protein                                69.3    6e-10   
gb|KDO27185.1|  hypothetical protein SPRG_07434                       69.3    6e-10   
gb|KHN96308.1|  nucleolar protein                                     68.9    8e-10   
gb|EGO02218.1|  hypothetical protein SERLA73DRAFT_104611              68.9    8e-10   
ref|XP_009543824.1|  hypothetical protein HETIRDRAFT_458040           68.9    9e-10   
ref|XP_007930016.1|  hypothetical protein MYCFIDRAFT_167141           68.6    9e-10   
gb|KIM26787.1|  hypothetical protein M408DRAFT_16831                  68.6    9e-10   
ref|XP_007305207.1|  Nop14-like protein                               68.6    9e-10   
ref|XP_001837568.2|  nucleolar protein 14                             68.6    9e-10   
gb|KII94640.1|  hypothetical protein PLICRDRAFT_148681                68.6    9e-10   
emb|CDO73803.1|  hypothetical protein BN946_scf185015.g132            68.6    1e-09   
ref|XP_001795085.1|  hypothetical protein SNOG_04672                  68.6    1e-09   
ref|XP_007851317.1|  nucleolar protein 14                             68.2    1e-09   
gb|KIW65743.1|  hypothetical protein PV04_07969                       68.2    1e-09   
gb|KIO12491.1|  hypothetical protein M404DRAFT_958692                 68.2    1e-09   
gb|KIM63659.1|  hypothetical protein SCLCIDRAFT_1214045               67.8    2e-09   
dbj|BAK06061.1|  predicted protein                                    67.8    2e-09   
ref|XP_007677474.1|  hypothetical protein BAUCODRAFT_35421            67.4    2e-09   
gb|KEF59995.1|  hypothetical protein A1O9_04844                       67.4    2e-09   
ref|XP_008608121.1|  hypothetical protein SDRG_04235                  67.4    3e-09   
ref|XP_002946166.1|  hypothetical protein VOLCADRAFT_102784           67.4    3e-09   
ref|XP_008035521.1|  Nop14-like protein                               67.0    3e-09   
ref|XP_008593503.1|  Nop14-like family protein                        67.0    3e-09   
gb|KGQ11955.1|  putative nucleolar complex protein 14                 67.0    3e-09   
gb|KJA29642.1|  hypothetical protein HYPSUDRAFT_31595                 67.0    3e-09   
emb|CDK26395.1|  unnamed protein product                              67.0    4e-09   
ref|XP_007724183.1|  hypothetical protein A1O1_05106                  66.6    4e-09   
gb|KIW92070.1|  hypothetical protein Z519_07053                       66.6    5e-09   
ref|XP_005894494.1|  PREDICTED: nucleolar protein 14                  66.2    5e-09   
ref|XP_005208306.1|  PREDICTED: nucleolar protein 14 isoform X1       66.2    6e-09   
ref|XP_008878698.1|  hypothetical protein H310_13105                  66.2    6e-09   
gb|ELR57296.1|  Nucleolar protein 14                                  66.2    6e-09   
ref|XP_005208307.1|  PREDICTED: nucleolar protein 14 isoform X2       66.2    6e-09   
ref|XP_010846260.1|  PREDICTED: nucleolar protein 14                  65.9    7e-09   
ref|NP_001092466.1|  nucleolar protein 14                             65.9    8e-09   
gb|KIV90231.1|  hypothetical protein PV10_07560                       65.9    8e-09   
ref|XP_001220201.1|  hypothetical protein CHGG_00980                  65.9    8e-09   
ref|XP_009052365.1|  hypothetical protein LOTGIDRAFT_115358           65.9    8e-09   
dbj|GAA97776.1|  hypothetical protein E5Q_04455                       65.9    8e-09   
ref|XP_006074689.1|  PREDICTED: nucleolar protein 14                  65.9    9e-09   
ref|XP_005831196.1|  hypothetical protein GUITHDRAFT_140040           65.5    1e-08   
gb|KIW47620.1|  hypothetical protein PV06_00299                       65.5    1e-08   
ref|XP_007268627.1|  Nop14-like protein                               65.5    1e-08   
gb|KIW16946.1|  hypothetical protein PV08_04136                       65.1    1e-08   
ref|XP_003853158.1|  hypothetical protein MYCGRDRAFT_100069           65.1    1e-08   
ref|XP_007741327.1|  hypothetical protein A1O5_02522                  65.1    1e-08   
ref|XP_011107336.1|  hypothetical protein H072_1344                   65.1    2e-08   
gb|KIW57095.1|  hypothetical protein PV05_05694                       64.7    2e-08   
gb|KDQ08229.1|  hypothetical protein BOTBODRAFT_118835                64.7    2e-08   
gb|KIW23265.1|  hypothetical protein PV07_11476                       64.7    2e-08   
gb|ETO81960.1|  hypothetical protein F444_03806                       64.7    2e-08   
ref|XP_007779488.1|  hypothetical protein W97_03401                   64.7    2e-08   
ref|XP_003838866.1|  similar to nucleolar protein 14                  64.3    2e-08   
ref|XP_002841037.1|  hypothetical protein                             64.3    3e-08   
ref|XP_006134804.1|  PREDICTED: nucleolar protein 14-like             63.9    3e-08   
ref|XP_637176.1|  U3 snoRNP protein                                   63.9    3e-08   
ref|XP_007773479.1|  Nop14-like protein                               63.9    3e-08   
gb|KIY03316.1|  hypothetical protein Z520_00006                       63.9    3e-08   
gb|EJU06534.1|  Nop14-like protein                                    63.9    3e-08   
gb|KIW83589.1|  hypothetical protein Z517_02834                       63.9    4e-08   
gb|EWC45217.1|  hypothetical protein DRE_05944                        63.9    4e-08   
ref|XP_007328983.1|  hypothetical protein AGABI1DRAFT_72702           63.5    4e-08   
ref|XP_010740964.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...  63.5    5e-08   
gb|KIK29147.1|  hypothetical protein PISMIDRAFT_672561                63.5    5e-08   
gb|EKG22003.1|  Nop14-like protein                                    63.5    5e-08   
ref|XP_006893679.1|  PREDICTED: nucleolar protein 14                  63.5    5e-08   
ref|XP_006671601.1|  rRNA maturation protein                          63.2    6e-08   
ref|XP_003455004.1|  PREDICTED: nucleolar protein 14                  63.2    6e-08   
gb|ETM52835.1|  hypothetical protein L914_03599                       63.2    7e-08   
ref|XP_008900944.1|  hypothetical protein PPTG_08575                  63.2    7e-08   
ref|XP_011372092.1|  PREDICTED: nucleolar protein 14                  63.2    7e-08   
gb|ETP51079.1|  hypothetical protein F442_03713                       63.2    7e-08   
gb|KDQ29639.1|  hypothetical protein PLEOSDRAFT_1037986               63.2    7e-08   
gb|ETI53273.1|  hypothetical protein F443_03736                       63.2    7e-08   
ref|XP_007759693.1|  hypothetical protein A1O7_07504                  62.8    8e-08   
ref|XP_006456712.1|  hypothetical protein AGABI2DRAFT_228781          62.8    8e-08   
ref|XP_536223.3|  PREDICTED: nucleolar protein 14                     62.8    9e-08   
gb|KIL70330.1|  hypothetical protein M378DRAFT_183871                 62.8    9e-08   
ref|XP_006919086.1|  PREDICTED: nucleolar protein 14                  62.8    9e-08   
gb|ERE89773.1|  nucleolar protein 14                                  62.8    9e-08   
ref|XP_003773477.1|  PREDICTED: nucleolar protein 14                  62.8    1e-07   
ref|XP_007587922.1|  putative rrna maturation protein                 62.8    1e-07   
ref|XP_004847426.1|  PREDICTED: nucleolar protein 14                  62.8    1e-07   
ref|XP_005608991.1|  PREDICTED: nucleolar protein 14 isoform X2       62.4    1e-07   
ref|XP_004890977.1|  PREDICTED: nucleolar protein 14                  62.4    1e-07   
ref|XP_008053974.1|  PREDICTED: nucleolar protein 14                  62.4    1e-07   
ref|XP_001489859.1|  PREDICTED: nucleolar protein 14 isoform X1       62.4    1e-07   
gb|ERE89774.1|  nucleolar protein 14                                  62.4    1e-07   
gb|KHJ34986.1|  putative nop14-like family protein                    62.4    1e-07   
ref|XP_007392447.1|  hypothetical protein PHACADRAFT_86191            62.4    1e-07   
gb|KIN03991.1|  hypothetical protein OIDMADRAFT_143455                62.4    1e-07   
ref|XP_007496879.1|  PREDICTED: nucleolar protein 14                  62.4    1e-07   
ref|XP_008725154.1|  hypothetical protein G647_02585                  62.4    1e-07   
gb|EHB06980.1|  Nucleolar protein 14                                  62.0    1e-07   
ref|XP_452930.1|  hypothetical protein                                62.0    1e-07   
gb|ETL99681.1|  hypothetical protein L917_03495                       62.0    2e-07   
gb|ETP23084.1|  hypothetical protein F441_03718                       62.0    2e-07   
ref|XP_004624659.1|  PREDICTED: nucleolar protein 14                  62.0    2e-07   
gb|ETK93124.1|  hypothetical protein L915_03632                       62.0    2e-07   
gb|ETL46548.1|  hypothetical protein L916_03572                       62.0    2e-07   
emb|CCI50370.1|  unnamed protein product                              61.6    2e-07   
ref|XP_005408814.1|  PREDICTED: nucleolar protein 14                  61.6    2e-07   
ref|XP_009829396.1|  hypothetical protein H257_06028                  61.6    2e-07   
gb|KIK40765.1|  hypothetical protein CY34DRAFT_24670                  61.6    2e-07   
ref|XP_010382694.1|  PREDICTED: nucleolar protein 14                  61.6    2e-07   
ref|XP_011121692.1|  hypothetical protein AOL_s00078g127              61.2    3e-07   
ref|XP_008016256.1|  PREDICTED: nucleolar protein 14 isoform X2       61.2    3e-07   
gb|ESW96529.1|  Nucleolar protein, forms a complex with Noc4p         61.2    3e-07   
ref|XP_006032396.1|  PREDICTED: nucleolar protein 14                  60.8    3e-07   
ref|XP_005229872.1|  PREDICTED: nucleolar protein 14                  60.8    3e-07   
ref|XP_005446467.1|  PREDICTED: nucleolar protein 14                  60.8    3e-07   
gb|ELW62764.1|  Nucleolar protein 14                                  60.8    3e-07   
ref|XP_007559019.1|  PREDICTED: nucleolar protein 14                  60.8    3e-07   
dbj|BAA19121.1|  unnamed protein product                              60.8    4e-07   
ref|XP_003279063.1|  PREDICTED: nucleolar protein 14                  60.8    4e-07   
gb|AAB97011.1|  unknown protein IT12                                  60.8    4e-07   
ref|XP_006262702.1|  PREDICTED: nucleolar protein 14                  60.8    4e-07   
gb|EHH49415.1|  Nucleolar complex protein 14                          60.8    4e-07   
gb|KIK96407.1|  hypothetical protein PAXRUDRAFT_825971                60.8    4e-07   
gb|EHH14174.1|  Nucleolar complex protein 14                          60.8    4e-07   
ref|XP_003890919.1|  PREDICTED: nucleolar protein 14                  60.8    4e-07   
gb|KIJ20460.1|  hypothetical protein PAXINDRAFT_174825                60.8    4e-07   
ref|XP_005554397.1|  PREDICTED: nucleolar protein 14                  60.8    4e-07   
ref|XP_006152995.1|  PREDICTED: nucleolar protein 14                  60.8    4e-07   
ref|NP_003694.1|  nucleolar protein 14 isoform 1                      60.8    4e-07   
ref|XP_002814567.1|  PREDICTED: nucleolar protein 14                  60.5    4e-07   
gb|EAW82489.1|  chromosome 4 open reading frame 9, isoform CRA_a      60.5    5e-07   
dbj|BAF85628.1|  unnamed protein product                              60.5    5e-07   
ref|XP_008016255.1|  PREDICTED: nucleolar protein 14 isoform X1       60.5    5e-07   
ref|XP_009972232.1|  PREDICTED: nucleolar protein 14                  60.5    5e-07   
gb|KFV59916.1|  Nucleolar protein 14                                  60.5    5e-07   
ref|XP_004038394.1|  PREDICTED: nucleolar protein 14                  60.5    5e-07   
ref|XP_003813002.1|  PREDICTED: nucleolar protein 14 isoform X1       60.5    5e-07   
ref|XP_008422663.1|  PREDICTED: nucleolar protein 14 isoform X1       60.5    5e-07   
ref|XP_005931265.1|  PREDICTED: nucleolar protein 14-like isoform X1  60.5    5e-07   
ref|XP_008422664.1|  PREDICTED: nucleolar protein 14 isoform X2       60.5    5e-07   
gb|EGA59404.1|  Nop14p                                                60.5    5e-07   
ref|XP_009445537.1|  PREDICTED: nucleolar protein 14 isoform X1       60.5    5e-07   
ref|XP_003648190.1|  hypothetical protein Ecym_8077                   60.5    5e-07   
dbj|GAA22099.1|  K7_Nop14p                                            60.5    5e-07   
gb|EEU08522.1|  Nop14p                                                60.5    5e-07   
gb|EDN60209.1|  U3 snoRNP protein                                     60.5    5e-07   
ref|XP_002416603.1|  nop14, putative                                  60.5    6e-07   
gb|EGA79637.1|  Nop14p                                                60.5    6e-07   
ref|NP_010133.1|  Nop14p                                              60.5    6e-07   
ref|XP_008576198.1|  PREDICTED: nucleolar protein 14                  60.1    6e-07   
gb|EDV08418.1|  nucleolar complex protein 14                          60.1    6e-07   
ref|XP_007799871.1|  hypothetical protein EPUS_03925                  60.1    6e-07   
gb|EDZ73369.1|  YDL148Cp-like protein                                 60.1    6e-07   
gb|EHN03387.1|  Nop14p                                                60.1    6e-07   
ref|XP_004656062.1|  PREDICTED: nucleolar protein 14                  60.1    6e-07   
ref|XP_009814608.1|  PREDICTED: nucleolar protein 14                  60.1    7e-07   
ref|XP_009327089.1|  PREDICTED: nucleolar protein 14                  60.1    7e-07   
ref|XP_006181203.1|  PREDICTED: nucleolar protein 14-like             60.1    7e-07   
gb|EDL37465.1|  RIKEN cDNA 2610033H07, isoform CRA_c                  58.9    7e-07   
ref|XP_008324317.1|  PREDICTED: nucleolar protein 14                  60.1    7e-07   
ref|XP_005016237.1|  PREDICTED: nucleolar protein 14 isoform X1       60.1    7e-07   
emb|CAG12449.1|  unnamed protein product                              60.1    7e-07   
ref|XP_009699167.1|  PREDICTED: nucleolar protein 14                  60.1    7e-07   
ref|XP_005016238.1|  PREDICTED: nucleolar protein 14 isoform X2       60.1    7e-07   
gb|KFP65386.1|  Nucleolar protein 14                                  60.1    7e-07   
gb|KFQ50030.1|  Nucleolar protein 14                                  60.1    7e-07   
gb|KFV44585.1|  Nucleolar protein 14                                  60.1    8e-07   
ref|XP_009477825.1|  PREDICTED: nucleolar protein 14                  60.1    8e-07   
gb|KFW70458.1|  Nucleolar protein 14                                  60.1    8e-07   
ref|XP_009528572.1|  hypothetical protein PHYSODRAFT_351449           60.1    8e-07   
emb|CDJ82379.1|  Nop14 protein domain containing protein              60.1    8e-07   
ref|XP_008840089.1|  PREDICTED: nucleolar protein 14                  59.7    8e-07   
gb|KFR03907.1|  Nucleolar protein 14                                  59.7    8e-07   
ref|XP_005498506.1|  PREDICTED: nucleolar protein 14                  59.7    8e-07   
ref|XP_005720460.1|  PREDICTED: nucleolar protein 14-like isoform X1  59.7    8e-07   
ref|XP_010164276.1|  PREDICTED: nucleolar protein 14-like             59.3    9e-07   
ref|XP_007060093.1|  PREDICTED: nucleolar protein 14                  59.7    9e-07   
ref|XP_010139826.1|  PREDICTED: nucleolar protein 14                  59.7    9e-07   
ref|XP_007871991.1|  hypothetical protein PNEG_00131                  59.7    9e-07   
ref|XP_009469430.1|  PREDICTED: nucleolar protein 14                  59.7    9e-07   
ref|XP_010957526.1|  PREDICTED: nucleolar protein 14                  59.7    9e-07   
ref|XP_010187452.1|  PREDICTED: nucleolar protein 14                  59.7    9e-07   
ref|XP_010008419.1|  PREDICTED: nucleolar protein 14                  59.7    9e-07   
ref|XP_010995891.1|  PREDICTED: nucleolar protein 14                  59.7    9e-07   
gb|KFQ46286.1|  Nucleolar protein 14                                  59.7    9e-07   
gb|KFQ38938.1|  Nucleolar protein 14                                  59.7    1e-06   
gb|KFO93083.1|  Nucleolar protein 14                                  59.7    1e-06   
ref|XP_505158.1|  YALI0F08371p                                        59.7    1e-06   
gb|KFR15697.1|  Nucleolar protein 14                                  59.7    1e-06   
ref|XP_010147382.1|  PREDICTED: nucleolar protein 14                  59.7    1e-06   
gb|KDR08721.1|  Nucleolar protein 14                                  59.7    1e-06   



>ref|XP_009778545.1| PREDICTED: nucleolar protein 14, partial [Nicotiana sylvestris]
Length=792

 Score =   202 bits (513),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            FMPI KLL +LA +NH+PD L+EKIK+V QLI+ K +E+H LRQPL+MRK+KPVPI+M+N
Sbjct  640  FMPISKLLCKLAGENHIPDALREKIKDVSQLIDTKAQEHHMLRQPLKMRKKKPVPIRMLN  699

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRERAE++KLKKR+KQEAKGAARE+ KDN FL   KE+EKA LA 
Sbjct  700  PKFEENFVKGRDYDPDRERAEMKKLKKRLKQEAKGAARELVKDNRFLAEAKEREKALLAA  759

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            E++EK+GK LAFLQEQEHAFKSGQLG
Sbjct  760  EKAEKHGKNLAFLQEQEHAFKSGQLG  785



>ref|XP_009597551.1| PREDICTED: nucleolar protein 14 [Nicotiana tomentosiformis]
Length=947

 Score =   202 bits (513),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            FMPI KLL +LA +NH+PD L+EKIK+V QLI+ K +E+H LRQPL+MRK+KPVPI+M+N
Sbjct  795  FMPISKLLCKLAGENHIPDALREKIKDVSQLIDTKAQEHHMLRQPLKMRKKKPVPIRMLN  854

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRERAE++KLKKR+KQEAKGAARE+ KDN FL   KE+EKA LA 
Sbjct  855  PKFEENFVKGRDYDPDRERAEMKKLKKRLKQEAKGAARELVKDNRFLAEAKEREKALLAA  914

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            E+SEK+GK LAFLQEQEHAFKSGQLG
Sbjct  915  EKSEKHGKNLAFLQEQEHAFKSGQLG  940



>gb|KHM99344.1| Nucleolar protein 14 [Glycine soja]
Length=556

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI KLLNE+A Q +MP+ L++KIK+V +LI+ KV+E+H LR+PL+MRKQKPVPIK++N
Sbjct  404  FLPIFKLLNEIAEQKNMPNALRDKIKDVAELIKLKVDEHHTLRRPLQMRKQKPVPIKLLN  463

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+N++KGRDYDPDRE+AE+RKLKK++K EAKGAARE+RKDN+FL  VKEKE++   +
Sbjct  464  PKFEENYVKGRDYDPDREQAELRKLKKQLKCEAKGAARELRKDNYFLLEVKEKERSLQEK  523

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            +R+EKYG+A AFLQEQEHAFKSGQLG
Sbjct  524  DRAEKYGRAKAFLQEQEHAFKSGQLG  549



>gb|KHN15381.1| Nucleolar protein 14, partial [Glycine soja]
Length=595

 Score =   198 bits (503),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI KLLNE+A Q +MP+ L++KIK+V +LI+ KV+E+H LR+PL+MRKQKPVPIK++N
Sbjct  443  FLPIFKLLNEIAEQKNMPNALRDKIKDVAELIKLKVDEHHTLRRPLQMRKQKPVPIKLLN  502

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+N++KGRDYDPDRE+AE+RKLKK++K+EAKGAARE+RKDN+FL  VKEKE++   +
Sbjct  503  PKFEENYVKGRDYDPDREQAELRKLKKQLKREAKGAARELRKDNYFLLEVKEKERSLQEK  562

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            +R+EKYG+A AFLQEQEHAFKSGQLG
Sbjct  563  DRAEKYGRAKAFLQEQEHAFKSGQLG  588



>ref|XP_006574504.1| PREDICTED: nucleolar protein 14-like isoform X2 [Glycine max]
Length=785

 Score =   198 bits (504),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI KLLNE+A Q +MP+ L++KIK+V +LI+ KV+E+H LR+PL+MRKQKPVPIK++N
Sbjct  633  FLPIFKLLNEIAEQKNMPNALRDKIKDVAELIKLKVDEHHTLRRPLQMRKQKPVPIKLLN  692

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+N++KGRDYDPDRE+AE+RKLKK++K+EAKGAARE+RKDN+FL  VKEKE++   +
Sbjct  693  PKFEENYVKGRDYDPDREQAELRKLKKQLKREAKGAARELRKDNYFLLEVKEKERSLQEK  752

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            +R+EKYG+A AFLQEQEHAFKSGQLG
Sbjct  753  DRAEKYGRAKAFLQEQEHAFKSGQLG  778



>gb|KHN00285.1| Nucleolar protein 14 [Glycine soja]
Length=925

 Score =   199 bits (505),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PILKLLNE+A Q +M + L++KIK+V +LI+ KV+E+H LR+PL+MRKQKPVPIK++N
Sbjct  773  FLPILKLLNEIAEQKNMSNALRDKIKDVAELIKLKVDEHHTLRRPLQMRKQKPVPIKLLN  832

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+N++KGRDYDPDRERAE+RKLKK +K+EAKGAARE+RKDN+FL  VKEKE++   +
Sbjct  833  PKFEENYVKGRDYDPDRERAELRKLKKHLKREAKGAARELRKDNYFLLEVKEKERSLQEK  892

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            +R+EKYG+A AFLQEQEHAFKSGQLG
Sbjct  893  DRAEKYGRAKAFLQEQEHAFKSGQLG  918



>ref|XP_006574503.1| PREDICTED: nucleolar protein 14-like isoform X1 [Glycine max]
Length=947

 Score =   199 bits (505),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI KLLNE+A Q +MP+ L++KIK+V +LI+ KV+E+H LR+PL+MRKQKPVPIK++N
Sbjct  795  FLPIFKLLNEIAEQKNMPNALRDKIKDVAELIKLKVDEHHTLRRPLQMRKQKPVPIKLLN  854

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+N++KGRDYDPDRE+AE+RKLKK++K+EAKGAARE+RKDN+FL  VKEKE++   +
Sbjct  855  PKFEENYVKGRDYDPDREQAELRKLKKQLKREAKGAARELRKDNYFLLEVKEKERSLQEK  914

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            +R+EKYG+A AFLQEQEHAFKSGQLG
Sbjct  915  DRAEKYGRAKAFLQEQEHAFKSGQLG  940



>ref|XP_006588546.1| PREDICTED: nucleolar protein 14-like [Glycine max]
Length=954

 Score =   199 bits (505),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PILKLLNE+A Q +M + L++KIK+V +LI+ KV+E+H LR+PL+MRKQKPVPIK++N
Sbjct  802  FLPILKLLNEIAEQKNMSNALRDKIKDVAELIKLKVDEHHTLRRPLQMRKQKPVPIKLLN  861

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+N++KGRDYDPDRERAE+RKLKK +K+EAKGAARE+RKDN+FL  VKEKE++   +
Sbjct  862  PKFEENYVKGRDYDPDRERAELRKLKKHLKREAKGAARELRKDNYFLLEVKEKERSLQEK  921

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            +R+EKYG+A AFLQEQEHAFKSGQLG
Sbjct  922  DRAEKYGRAKAFLQEQEHAFKSGQLG  947



>ref|XP_010320847.1| PREDICTED: nucleolar protein 14 isoform X2 [Solanum lycopersicum]
Length=754

 Score =   194 bits (493),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F PI KLL +LA +NH+P+ L+EK+K+V + I+ K +E+H LRQPL+MRK+KPVPI+MVN
Sbjct  600  FTPISKLLYKLAGENHIPEALREKMKDVSEFIDTKCQEHHMLRQPLKMRKKKPVPIRMVN  659

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+N++KGRDYDPDRERAE +KL+KR+K+EAKGA RE+RKDN FL   KE+E+A LA 
Sbjct  660  PKFEENYVKGRDYDPDRERAEKKKLRKRIKEEAKGAVRELRKDNEFLSKAKERERALLAA  719

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            E++EKYGK LAFLQEQEHAFKSGQLG
Sbjct  720  EKAEKYGKDLAFLQEQEHAFKSGQLG  745



>ref|XP_006348659.1| PREDICTED: nucleolar protein 14-like [Solanum tuberosum]
Length=940

 Score =   195 bits (496),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F PI KLL +LA +NH+P+ L+EK+K+V QLI+ + +E+H LRQPL+MRK+KPVPI+MVN
Sbjct  786  FTPISKLLCKLAGENHIPEALREKMKDVSQLIDTESQEHHMLRQPLKMRKKKPVPIRMVN  845

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+N++KGRDYDPDRERAE +KL+KR+K+EAKGA RE+RKDN FL   KE+E+A LA 
Sbjct  846  PKFEENYVKGRDYDPDRERAEKKKLRKRIKEEAKGAVRELRKDNEFLSKAKERERALLAA  905

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            E++EKYGK LAFLQEQEHAFKSGQLG
Sbjct  906  EKAEKYGKDLAFLQEQEHAFKSGQLG  931



>ref|XP_010320846.1| PREDICTED: nucleolar protein 14 isoform X1 [Solanum lycopersicum]
Length=940

 Score =   194 bits (493),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F PI KLL +LA +NH+P+ L+EK+K+V + I+ K +E+H LRQPL+MRK+KPVPI+MVN
Sbjct  786  FTPISKLLYKLAGENHIPEALREKMKDVSEFIDTKCQEHHMLRQPLKMRKKKPVPIRMVN  845

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+N++KGRDYDPDRERAE +KL+KR+K+EAKGA RE+RKDN FL   KE+E+A LA 
Sbjct  846  PKFEENYVKGRDYDPDRERAEKKKLRKRIKEEAKGAVRELRKDNEFLSKAKERERALLAA  905

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            E++EKYGK LAFLQEQEHAFKSGQLG
Sbjct  906  EKAEKYGKDLAFLQEQEHAFKSGQLG  931



>emb|CAN71711.1| hypothetical protein VITISV_013458 [Vitis vinifera]
Length=815

 Score =   193 bits (490),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL  LA Q +MP+ L+EKI+ V  LI+ K  E+H LRQPL+MRKQKPVPIK+ N
Sbjct  663  FLPISTLLLALAEQENMPNALKEKIRGVEVLIKEKTHEHHMLRQPLQMRKQKPVPIKLFN  722

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRERAE RKLKK +KQEAKGAARE+RKDN+FLF VK+++KA   E
Sbjct  723  PKFEENFVKGRDYDPDRERAEQRKLKKLIKQEAKGAARELRKDNYFLFEVKKRDKAMQEE  782

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+EKYGKA AFLQEQEHAFKSGQLG
Sbjct  783  ERAEKYGKARAFLQEQEHAFKSGQLG  808



>emb|CBI27323.3| unnamed protein product [Vitis vinifera]
Length=899

 Score =   193 bits (490),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL  LA Q +MP+ L+EKI+ V  LI+ K  E+H LRQPL+MRKQKPVPIK+ N
Sbjct  747  FLPISTLLLALAEQENMPNALKEKIRGVEVLIKEKTHEHHMLRQPLQMRKQKPVPIKLFN  806

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRERAE RKLKK +KQEAKGAARE+RKDN+FLF VK+++KA   E
Sbjct  807  PKFEENFVKGRDYDPDRERAEQRKLKKLIKQEAKGAARELRKDNYFLFEVKKRDKAMQEE  866

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+EKYGKA AFLQEQEHAFKSGQLG
Sbjct  867  ERAEKYGKARAFLQEQEHAFKSGQLG  892



>ref|XP_010650046.1| PREDICTED: nucleolar protein 14 [Vitis vinifera]
Length=959

 Score =   193 bits (490),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL  LA Q +MP+ L+EKI+ V  LI+ K  E+H LRQPL+MRKQKPVPIK+ N
Sbjct  807  FLPISTLLLALAEQENMPNALKEKIRGVEVLIKEKTHEHHMLRQPLQMRKQKPVPIKLFN  866

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRERAE RKLKK +KQEAKGAARE+RKDN+FLF VK+++KA   E
Sbjct  867  PKFEENFVKGRDYDPDRERAEQRKLKKLIKQEAKGAARELRKDNYFLFEVKKRDKAMQEE  926

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+EKYGKA AFLQEQEHAFKSGQLG
Sbjct  927  ERAEKYGKARAFLQEQEHAFKSGQLG  952



>emb|CDP00465.1| unnamed protein product [Coffea canephora]
Length=906

 Score =   190 bits (482),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI K+L++LA Q+ MP++L++K+++V Q IE K +E+H LRQPL+MRKQKPVPIKM+N
Sbjct  754  FLPISKVLHKLAGQHCMPEMLKDKLRDVAQFIEKKADEHHVLRQPLQMRKQKPVPIKMLN  813

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFEDNF+KGRDYDPDRERAE RKLKK +K+EAKGAARE+RKDN+FLF VKEK+K  L +
Sbjct  814  PKFEDNFVKGRDYDPDRERAERRKLKKLLKREAKGAARELRKDNYFLFEVKEKDKKLLED  873

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+EKYGKA AFLQEQEHAFKSGQLG
Sbjct  874  ERAEKYGKARAFLQEQEHAFKSGQLG  899



>ref|XP_007045792.1| Nop14, putative isoform 2 [Theobroma cacao]
 gb|EOY01624.1| Nop14, putative isoform 2 [Theobroma cacao]
Length=984

 Score =   189 bits (480),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL E++ Q H+P+ L++K  +V QLI+ K +E HRLR+PL++RKQKPVPIK++N
Sbjct  832  FLPIATLLLEVSQQKHIPEALKDKFNDVAQLIKQKADEAHRLRRPLQIRKQKPVPIKLLN  891

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRE+AE RKL+K +K+EAKGAARE+RKDN+FL+ VK+K+KA   +
Sbjct  892  PKFEENFVKGRDYDPDREQAERRKLQKLIKREAKGAARELRKDNYFLYEVKQKDKALQEK  951

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+  YG+A+AFLQEQEHAFKSGQLG
Sbjct  952  ERAANYGRAIAFLQEQEHAFKSGQLG  977



>ref|XP_007045791.1| Nop14, putative isoform 1 [Theobroma cacao]
 gb|EOY01623.1| Nop14, putative isoform 1 [Theobroma cacao]
Length=983

 Score =   189 bits (480),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL E++ Q H+P+ L++K  +V QLI+ K +E HRLR+PL++RKQKPVPIK++N
Sbjct  831  FLPIATLLLEVSQQKHIPEALKDKFNDVAQLIKQKADEAHRLRRPLQIRKQKPVPIKLLN  890

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRE+AE RKL+K +K+EAKGAARE+RKDN+FL+ VK+K+KA   +
Sbjct  891  PKFEENFVKGRDYDPDREQAERRKLQKLIKREAKGAARELRKDNYFLYEVKQKDKALQEK  950

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+  YG+A+AFLQEQEHAFKSGQLG
Sbjct  951  ERAANYGRAIAFLQEQEHAFKSGQLG  976



>gb|KHG15298.1| Nucleolar 14 [Gossypium arboreum]
Length=945

 Score =   189 bits (479),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL E++ Q HMP  L++K  NV QLI+ K +E H LR+PL++RKQKP PIK++N
Sbjct  792  FLPIATLLVEVSEQKHMPKALKDKFNNVSQLIKKKADETHTLRRPLQLRKQKPAPIKLLN  851

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRERAE RKL+K +K+EAKGAARE+RKDN+FL+  K++++  + +
Sbjct  852  PKFEENFVKGRDYDPDRERAERRKLQKLIKREAKGAARELRKDNYFLYEAKQRDRELVEK  911

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+  YG+A+AFLQEQEHAFKSGQLG
Sbjct  912  ERAANYGRAIAFLQEQEHAFKSGQLG  937



>gb|KEH42218.1| Nop14 nucleolar-like protein [Medicago truncatula]
Length=758

 Score =   186 bits (473),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PIL+LL E+A Q +MP+ L++KIK+V +LI+ KV+E+H LR+PL+MRKQK VPIK++N
Sbjct  606  FLPILRLLLEIAEQKNMPNALRDKIKDVAELIKLKVDEHHTLRRPLQMRKQKLVPIKLLN  665

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+N++KGRDYDPDR RAE +KLK+ V++EAKGAAREIRKDN+FL  VKEKE++ + +
Sbjct  666  PKFEENYVKGRDYDPDRVRAERKKLKREVRREAKGAAREIRKDNYFLLDVKEKERSLMEK  725

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
             R+EKYG+  AFLQEQEHAFKSGQLG
Sbjct  726  TRAEKYGRTKAFLQEQEHAFKSGQLG  751



>gb|KJB78310.1| hypothetical protein B456_012G185400 [Gossypium raimondii]
Length=945

 Score =   187 bits (476),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL E++ Q HMP  L++K  NV QLI+ K  E H LR+PL++RKQKP PIK++N
Sbjct  792  FLPIATLLVEVSEQKHMPKALKDKFNNVSQLIKKKAGETHTLRRPLQLRKQKPAPIKLLN  851

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRERAE RKL+K +K+EAKGAARE+RKDN+FL+  K+++K  + +
Sbjct  852  PKFEENFVKGRDYDPDRERAERRKLQKLIKREAKGAARELRKDNYFLYEAKQRDKELVEK  911

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+  YG+A+AFLQEQEHAFKSGQLG
Sbjct  912  ERAANYGRAIAFLQEQEHAFKSGQLG  937



>gb|KEH41125.1| Nop14 nucleolar-like protein [Medicago truncatula]
Length=946

 Score =   187 bits (475),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PIL+LL E+A Q +MP+ L++KIK+V +LI+ KV+E+H LR+PL+MRKQK VPIK++N
Sbjct  794  FLPILRLLLEIAEQKNMPNALRDKIKDVAELIKLKVDEHHTLRRPLQMRKQKQVPIKLLN  853

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+N++KGRDYDPDR RAE +KLK+ V++EAKGAAREIRKDN+FL  VKEKE++ + +
Sbjct  854  PKFEENYVKGRDYDPDRVRAERKKLKREVRREAKGAAREIRKDNYFLLDVKEKERSLMEK  913

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
             R+EKYG+  AFLQEQEHAFKSGQLG
Sbjct  914  TRAEKYGRTKAFLQEQEHAFKSGQLG  939



>gb|KEH42220.1| Nop14 nucleolar-like protein [Medicago truncatula]
Length=964

 Score =   186 bits (473),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PIL+LL E+A Q +MP+ L++KIK+V +LI+ KV+E+H LR+PL+MRKQK VPIK++N
Sbjct  812  FLPILRLLLEIAEQKNMPNALRDKIKDVAELIKLKVDEHHTLRRPLQMRKQKLVPIKLLN  871

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+N++KGRDYDPDR RAE +KLK+ V++EAKGAAREIRKDN+FL  VKEKE++ + +
Sbjct  872  PKFEENYVKGRDYDPDRVRAERKKLKREVRREAKGAAREIRKDNYFLLDVKEKERSLMEK  931

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
             R+EKYG+  AFLQEQEHAFKSGQLG
Sbjct  932  TRAEKYGRTKAFLQEQEHAFKSGQLG  957



>ref|XP_009379407.1| PREDICTED: probable nucleolar complex protein 14 [Pyrus x bretschneideri]
Length=244

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL E+A Q +MP +L +++K+V +LI+ K +++H LRQPL+MRKQKPV IKM+N
Sbjct  90   FLPISVLLLEVAEQENMPQVLTDRLKDVAELIKTKADKHHILRQPLQMRKQKPVAIKMLN  149

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRE+AE RK+KK +KQEAKGA RE+RKDN FL+ VK ++KA + E
Sbjct  150  PKFEENFVKGRDYDPDREQAERRKMKKLLKQEAKGAIRELRKDNSFLYEVKARDKALMEE  209

Query  443  erseKYGKALAFLQEQEHAFKSGQL  369
            E++EKYGK   FLQEQEHA KSGQL
Sbjct  210  EKAEKYGKVRLFLQEQEHAMKSGQL  234



>ref|XP_010932890.1| PREDICTED: nucleolar protein 14 isoform X1 [Elaeis guineensis]
 ref|XP_010932891.1| PREDICTED: nucleolar protein 14 isoform X1 [Elaeis guineensis]
Length=945

 Score =   185 bits (469),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL+EL  +  +P +L+  ++++I LI+ K +E+H LRQPL+MRKQKPVPIK++N
Sbjct  793  FLPISALLHELLQKAKLPGMLRGNMEDIIDLIKKKTDEHHVLRQPLQMRKQKPVPIKLLN  852

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRERAE +K+KKR+K E KGA RE+RKDNHF+F +KE+++    E
Sbjct  853  PKFEENFVKGRDYDPDRERAERKKMKKRLKSEKKGAVRELRKDNHFIFELKERDRMLEEE  912

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+E+YGKA+AFLQEQEHAFKSGQLG
Sbjct  913  ERAERYGKAMAFLQEQEHAFKSGQLG  938



>ref|XP_010932892.1| PREDICTED: nucleolar protein 14 isoform X2 [Elaeis guineensis]
Length=944

 Score =   185 bits (469),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL+EL  +  +P +L+  ++++I LI+ K +E+H LRQPL+MRKQKPVPIK++N
Sbjct  792  FLPISALLHELLQKAKLPGMLRGNMEDIIDLIKKKTDEHHVLRQPLQMRKQKPVPIKLLN  851

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRERAE +K+KKR+K E KGA RE+RKDNHF+F +KE+++    E
Sbjct  852  PKFEENFVKGRDYDPDRERAERKKMKKRLKSEKKGAVRELRKDNHFIFELKERDRMLEEE  911

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+E+YGKA+AFLQEQEHAFKSGQLG
Sbjct  912  ERAERYGKAMAFLQEQEHAFKSGQLG  937



>ref|XP_010044381.1| PREDICTED: nucleolar protein 14 [Eucalyptus grandis]
Length=956

 Score =   183 bits (464),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            FMPI  LL E+A Q ++P+ L+ K ++V Q+I+ K +E+  LRQPL++RK KPVPIK +N
Sbjct  804  FMPISTLLLEVAQQQNLPNELRNKFEDVAQVIKRKADEHQTLRQPLQLRKHKPVPIKQLN  863

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRERAE RKLKK +KQEAKGA RE+RKDN+FLF VKE++KA L +
Sbjct  864  PKFEENFVKGRDYDPDRERAERRKLKKLIKQEAKGAVRELRKDNYFLFEVKERDKALLEQ  923

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ERSEKYG+A AFLQEQEHAFKSGQLG
Sbjct  924  ERSEKYGRAKAFLQEQEHAFKSGQLG  949



>gb|KCW86470.1| hypothetical protein EUGRSUZ_B03138 [Eucalyptus grandis]
Length=955

 Score =   183 bits (464),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            FMPI  LL E+A Q ++P+ L+ K ++V Q+I+ K +E+  LRQPL++RK KPVPIK +N
Sbjct  803  FMPISTLLLEVAQQQNLPNELRNKFEDVAQVIKRKADEHQTLRQPLQLRKHKPVPIKQLN  862

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRERAE RKLKK +KQEAKGA RE+RKDN+FLF VKE++KA L +
Sbjct  863  PKFEENFVKGRDYDPDRERAERRKLKKLIKQEAKGAVRELRKDNYFLFEVKERDKALLEQ  922

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ERSEKYG+A AFLQEQEHAFKSGQLG
Sbjct  923  ERSEKYGRAKAFLQEQEHAFKSGQLG  948



>ref|XP_011009745.1| PREDICTED: nucleolar protein 14 isoform X1 [Populus euphratica]
Length=959

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL E+A Q +MP  LQ+K K+V +LI  K  ++H +R+PL+M+K+KPVPIK+V 
Sbjct  805  FLPISMLLLEVAQQENMPATLQDKFKDVAELINKKANKHHMMRKPLQMQKKKPVPIKLVA  864

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRERAE RKLKK VK+EAKGAARE+RKDN+FLF VKEK+KA L +
Sbjct  865  PKFEENFVKGRDYDPDRERAERRKLKKLVKREAKGAARELRKDNYFLFEVKEKDKALLED  924

Query  443  erseKYGKALAFLQEQEHAFKSGQL  369
            ER+E YGKA AFLQEQEHAFKSGQL
Sbjct  925  ERAENYGKARAFLQEQEHAFKSGQL  949



>ref|XP_011009760.1| PREDICTED: nucleolar protein 14 isoform X3 [Populus euphratica]
Length=958

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL E+A Q +MP  LQ+K K+V +LI  K  ++H +R+PL+M+K+KPVPIK+V 
Sbjct  804  FLPISMLLLEVAQQENMPATLQDKFKDVAELINKKANKHHMMRKPLQMQKKKPVPIKLVA  863

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRERAE RKLKK VK+EAKGAARE+RKDN+FLF VKEK+KA L +
Sbjct  864  PKFEENFVKGRDYDPDRERAERRKLKKLVKREAKGAARELRKDNYFLFEVKEKDKALLED  923

Query  443  erseKYGKALAFLQEQEHAFKSGQL  369
            ER+E YGKA AFLQEQEHAFKSGQL
Sbjct  924  ERAENYGKARAFLQEQEHAFKSGQL  948



>ref|XP_011009752.1| PREDICTED: nucleolar protein 14 isoform X2 [Populus euphratica]
Length=958

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL E+A Q +MP  LQ+K K+V +LI  K  ++H +R+PL+M+K+KPVPIK+V 
Sbjct  804  FLPISMLLLEVAQQENMPATLQDKFKDVAELINKKANKHHMMRKPLQMQKKKPVPIKLVA  863

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRERAE RKLKK VK+EAKGAARE+RKDN+FLF VKEK+KA L +
Sbjct  864  PKFEENFVKGRDYDPDRERAERRKLKKLVKREAKGAARELRKDNYFLFEVKEKDKALLED  923

Query  443  erseKYGKALAFLQEQEHAFKSGQL  369
            ER+E YGKA AFLQEQEHAFKSGQL
Sbjct  924  ERAENYGKARAFLQEQEHAFKSGQL  948



>ref|XP_011009770.1| PREDICTED: nucleolar protein 14 isoform X4 [Populus euphratica]
Length=957

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL E+A Q +MP  LQ+K K+V +LI  K  ++H +R+PL+M+K+KPVPIK+V 
Sbjct  803  FLPISMLLLEVAQQENMPATLQDKFKDVAELINKKANKHHMMRKPLQMQKKKPVPIKLVA  862

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRERAE RKLKK VK+EAKGAARE+RKDN+FLF VKEK+KA L +
Sbjct  863  PKFEENFVKGRDYDPDRERAERRKLKKLVKREAKGAARELRKDNYFLFEVKEKDKALLED  922

Query  443  erseKYGKALAFLQEQEHAFKSGQL  369
            ER+E YGKA AFLQEQEHAFKSGQL
Sbjct  923  ERAENYGKARAFLQEQEHAFKSGQL  947



>ref|XP_007145864.1| hypothetical protein PHAVU_007G274500g [Phaseolus vulgaris]
 gb|ESW17858.1| hypothetical protein PHAVU_007G274500g [Phaseolus vulgaris]
Length=955

 Score =   181 bits (459),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PIL++LNE+  Q +MP+ L++KIK+V ++I+ KV+E H LR+PL+MRKQKPVPIKM+N
Sbjct  803  FLPILRILNEIEEQKNMPNSLRDKIKDVAEIIKLKVDELHTLRRPLQMRKQKPVPIKMLN  862

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+N++KGRDYDPDRERAE++KLKK++K+EAKGAARE+RKDN+FL  VK+KEK+ L +
Sbjct  863  PKFEENYVKGRDYDPDRERAELKKLKKQLKREAKGAARELRKDNYFLLDVKDKEKSLLEK  922

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            +R+EKYG+A AFLQ+QEHAFKSGQLG
Sbjct  923  DRAEKYGRAKAFLQDQEHAFKSGQLG  948



>ref|XP_002316014.2| hypothetical protein POPTR_0010s15000g [Populus trichocarpa]
 gb|EEF02185.2| hypothetical protein POPTR_0010s15000g [Populus trichocarpa]
Length=961

 Score =   181 bits (459),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL E+A Q +MP  LQ+K K+V +LI  K  ++H +R+PL+M+K+KPVPIK+V 
Sbjct  807  FLPISMLLLEVAQQENMPATLQDKFKDVAELINKKANKHHMMRKPLQMQKKKPVPIKLVA  866

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRERAE RKLKK VK+EAKGAARE+RKDN FLF VKEK+KA L +
Sbjct  867  PKFEENFVKGRDYDPDRERAERRKLKKLVKREAKGAARELRKDNSFLFEVKEKDKALLED  926

Query  443  erseKYGKALAFLQEQEHAFKSGQL  369
            ER+E YGKA AFLQEQEHAFKSGQL
Sbjct  927  ERAENYGKARAFLQEQEHAFKSGQL  951



>ref|XP_002517429.1| nop14, putative [Ricinus communis]
 gb|EEF44971.1| nop14, putative [Ricinus communis]
Length=865

 Score =   179 bits (455),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL E+A Q ++  ILQ+K K+V QLI+ K +E+H LR+PL+MRKQKPVPIK++N
Sbjct  713  FLPISTLLLEVAKQQNLSAILQDKFKDVAQLIKKKADEHHMLRRPLQMRKQKPVPIKLLN  772

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRER E +KL K +++EAKGAARE+RKDN+FL  VKEK+KA + E
Sbjct  773  PKFEENFVKGRDYDPDRERVERKKLNKLLRREAKGAARELRKDNYFLTEVKEKDKALVEE  832

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ERS+KYGKA AFLQEQE AFKSGQLG
Sbjct  833  ERSDKYGKARAFLQEQESAFKSGQLG  858



>ref|XP_006856350.1| hypothetical protein AMTR_s00047p00175730 [Amborella trichopoda]
 gb|ERN17817.1| hypothetical protein AMTR_s00047p00175730 [Amborella trichopoda]
Length=870

 Score =   179 bits (455),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F  +  LL++L  Q +MPD++   ++ +IQ IE K  E+ +LRQPL+MRKQKPVPIK  N
Sbjct  715  FSSVSALLHDLIKQEYMPDLVVSSMQEIIQRIEEKSIEHQKLRQPLQMRKQKPVPIKEFN  774

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRERAE RKL++++K+E KGAARE+RKDN+FLF VK KEKA   E
Sbjct  775  PKFEENFVKGRDYDPDRERAERRKLERQMKRETKGAARELRKDNYFLFEVKAKEKALEEE  834

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+EKYGKA+AFLQEQEHAFKSGQLG
Sbjct  835  ERAEKYGKAMAFLQEQEHAFKSGQLG  860



>ref|XP_010551353.1| PREDICTED: nucleolar protein 14 [Tarenaya hassleriana]
Length=947

 Score =   180 bits (456),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL+E++ Q   P+ L++   NV QLI+ K   +H  R+PL MRK KPVPIKMVN
Sbjct  793  FLPISPLLHEISKQGKFPEALKKNFDNVAQLIDEKAGAHHVKREPLVMRKHKPVPIKMVN  852

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDR+RAE+RKLKK +KQEAKGA RE+RKD++F+  VK KE+    +
Sbjct  853  PKFEENFVKGRDYDPDRQRAEVRKLKKLIKQEAKGAIRELRKDSYFMSEVKAKERVEHEQ  912

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER++KYGKALAFLQEQEHAFKSGQLG
Sbjct  913  ERADKYGKALAFLQEQEHAFKSGQLG  938



>ref|XP_008243808.1| PREDICTED: nucleolar protein 14 [Prunus mume]
Length=966

 Score =   180 bits (456),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL E+A Q++MP +L +K ++V QLI+ K +E+H LRQPL+MRKQKPV IKM+N
Sbjct  814  FLPISILLVEVAEQDNMPQVLTDKFQDVAQLIKTKADEHHILRQPLQMRKQKPVAIKMLN  873

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KG DYDPDRERAE RKLKK +KQEAKGA RE+RKDN FL+ VK +EK  + E
Sbjct  874  PKFEENFVKGIDYDPDRERAERRKLKKVLKQEAKGAIRELRKDNSFLYEVKAREKVLMEE  933

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            E++EKYGK   FLQEQEHA KSGQLG
Sbjct  934  EKAEKYGKVRLFLQEQEHAMKSGQLG  959



>ref|XP_007225494.1| hypothetical protein PRUPE_ppa000919mg [Prunus persica]
 gb|EMJ26693.1| hypothetical protein PRUPE_ppa000919mg [Prunus persica]
Length=962

 Score =   180 bits (456),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL E+A Q++MP +L +K ++V QLI+ K +E+H LRQPL+MRKQKPV IKM+N
Sbjct  810  FLPISILLVEVAEQDNMPQVLTDKFQDVAQLIKTKADEHHILRQPLQMRKQKPVAIKMLN  869

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KG DYDPDRERAE RKLKK +KQEAKGA RE+RKDN FL+ VK +EK  + E
Sbjct  870  PKFEENFVKGIDYDPDRERAERRKLKKVLKQEAKGAIRELRKDNSFLYEVKAREKVLMEE  929

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            E++EKYGK   FLQEQEHA KSGQLG
Sbjct  930  EKAEKYGKVRLFLQEQEHAMKSGQLG  955



>ref|XP_010091617.1| hypothetical protein L484_026465 [Morus notabilis]
 gb|EXB44883.1| hypothetical protein L484_026465 [Morus notabilis]
Length=969

 Score =   179 bits (455),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL E+A Q +M   LQ+K+K+V QLIE KV E H LR+PL+MR+QK VPI+M+N
Sbjct  817  FLPISVLLREVAQQENMVGPLQDKLKDVAQLIETKVNERHMLRKPLQMRRQKLVPIRMLN  876

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRERAE RKLKKR+K+EAKGA RE+RKDN+FL  VK ++KAA+ E
Sbjct  877  PKFEENFVKGRDYDPDRERAERRKLKKRLKEEAKGAIRELRKDNYFLQEVKARDKAAMEE  936

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            E+++KY K  AFL EQEHAFKSGQLG
Sbjct  937  EKTQKYNKVKAFLDEQEHAFKSGQLG  962



>ref|XP_008777148.1| PREDICTED: nucleolar protein 14 isoform X2 [Phoenix dactylifera]
Length=760

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL+EL  +  +P IL+  +++VI LI+ K   +H LRQPL+MRKQK VPIK++N
Sbjct  608  FLPISALLHELLQKAKLPGILRGNMEDVIDLIKKKTISHHVLRQPLQMRKQKRVPIKLLN  667

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRERAE +K+KKR+K E KGA RE+RKDNHF+F +KE+++    E
Sbjct  668  PKFEENFVKGRDYDPDRERAERKKMKKRLKSEKKGAIRELRKDNHFIFELKERDRMLEEE  727

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+E+YGKA+AFLQEQEHAFKSGQLG
Sbjct  728  ERAERYGKAMAFLQEQEHAFKSGQLG  753



>ref|XP_008777146.1| PREDICTED: nucleolar protein 14 isoform X1 [Phoenix dactylifera]
 ref|XP_008777147.1| PREDICTED: nucleolar protein 14 isoform X1 [Phoenix dactylifera]
Length=761

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL+EL  +  +P IL+  +++VI LI+ K   +H LRQPL+MRKQK VPIK++N
Sbjct  609  FLPISALLHELLQKAKLPGILRGNMEDVIDLIKKKTISHHVLRQPLQMRKQKRVPIKLLN  668

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRERAE +K+KKR+K E KGA RE+RKDNHF+F +KE+++    E
Sbjct  669  PKFEENFVKGRDYDPDRERAERKKMKKRLKSEKKGAIRELRKDNHFIFELKERDRMLEEE  728

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+E+YGKA+AFLQEQEHAFKSGQLG
Sbjct  729  ERAERYGKAMAFLQEQEHAFKSGQLG  754



>ref|XP_004144162.1| PREDICTED: nucleolar protein 14-like [Cucumis sativus]
Length=913

 Score =   177 bits (450),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  +L+ELA Q +MPD+LQ K + V + IE K EE++  RQPLRMRKQK  PIK++N
Sbjct  761  FLPISTILHELAQQENMPDVLQNKFRKVAEAIEAKTEEHYMGRQPLRMRKQKTAPIKLLN  820

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF++GRDYDPDRERAE RK++K +K+E KGAARE+RKDNHFL  VK ++KA   E
Sbjct  821  PKFEENFVRGRDYDPDRERAERRKMQKLLKRETKGAARELRKDNHFLSEVKARDKAKQDE  880

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+EKY KA  FL+ QEHAFKSGQLG
Sbjct  881  ERAEKYKKARTFLEAQEHAFKSGQLG  906



>ref|XP_004165503.1| PREDICTED: nucleolar protein 14-like [Cucumis sativus]
Length=914

 Score =   177 bits (450),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  +L+ELA Q +MPD+LQ K + V + IE K EE++  RQPLRMRKQK  PIK++N
Sbjct  762  FLPISTILHELAQQENMPDVLQNKFRKVAEAIEAKTEEHYMGRQPLRMRKQKTAPIKLLN  821

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF++GRDYDPDRERAE RK++K +K+E KGAARE+RKDNHFL  VK ++KA   E
Sbjct  822  PKFEENFVRGRDYDPDRERAERRKMQKLLKRETKGAARELRKDNHFLSEVKARDKAKQDE  881

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+EKY KA  FL+ QEHAFKSGQLG
Sbjct  882  ERAEKYKKARTFLEAQEHAFKSGQLG  907



>gb|KGN47665.1| hypothetical protein Csa_6G367110 [Cucumis sativus]
Length=947

 Score =   178 bits (451),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  +L+ELA Q +MPD+LQ K + V + IE K EE++  RQPLRMRKQK  PIK++N
Sbjct  795  FLPISTILHELAQQENMPDVLQNKFRKVAEAIEAKTEEHYMGRQPLRMRKQKTAPIKLLN  854

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF++GRDYDPDRERAE RK++K +K+E KGAARE+RKDNHFL  VK ++KA   E
Sbjct  855  PKFEENFVRGRDYDPDRERAERRKMQKLLKRETKGAARELRKDNHFLSEVKARDKAKQDE  914

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+EKY KA  FL+ QEHAFKSGQLG
Sbjct  915  ERAEKYKKARTFLEAQEHAFKSGQLG  940



>ref|XP_009356445.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar protein 14 [Pyrus x 
bretschneideri]
Length=934

 Score =   176 bits (446),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL E+A Q+ MP +L +K+K+V +LI++K +++H LRQPL+MRKQKPV IKM+N
Sbjct  780  FLPISVLLLEVAEQDSMPQVLTDKLKDVAELIKSKADKHHILRQPLQMRKQKPVAIKMLN  839

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRERAE  K+KK +KQEAKGA RE+RKDN FL+ VK ++KA + E
Sbjct  840  PKFEENFVKGRDYDPDRERAERIKMKKLLKQEAKGAIRELRKDNSFLYEVKARDKAMMEE  899

Query  443  erseKYGKALAFLQEQEHAFKSGQL  369
            E++EKYGK   FLQEQEHA KSGQL
Sbjct  900  EKAEKYGKVRLFLQEQEHAMKSGQL  924



>gb|KDP45433.1| hypothetical protein JCGZ_09682 [Jatropha curcas]
Length=959

 Score =   175 bits (444),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 123/150 (82%), Gaps = 4/150 (3%)
 Frame = -1

Query  803  FMPILKLLNEL----AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPI  636
            F  I  LL+EL    A Q  +P  LQ+K K+V ++I  K +E++ LR+PL+MRKQKPVPI
Sbjct  803  FPEIFSLLSELLLDVAKQEKIPAALQDKFKDVAEVIRKKTDEHYMLRRPLQMRKQKPVPI  862

Query  635  KMVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekeka  456
            K++NPKFE+N++KGRDYDPDRER E RKLKK +K+EAKGAARE+RKDN+FLF VKEK+KA
Sbjct  863  KLLNPKFEENYVKGRDYDPDRERVETRKLKKLIKREAKGAARELRKDNYFLFEVKEKDKA  922

Query  455  alaeerseKYGKALAFLQEQEHAFKSGQLG  366
             L EER+EKYG+A AFLQEQEHAF SGQLG
Sbjct  923  LLEEERAEKYGRAKAFLQEQEHAFISGQLG  952



>gb|KDO70293.1| hypothetical protein CISIN_1g012881mg [Citrus sinensis]
Length=454

 Score =   170 bits (431),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = -1

Query  770  AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKFEDNFIKGR  591
            A Q +MP  LQEK K+  ++I+ KV+E+H +R+PL+M K+ PVPIK++NPKFE+NF+KGR
Sbjct  313  AQQENMPAALQEKFKDAAEVIKKKVDEHHMVRRPLQMHKKNPVPIKLLNPKFEENFVKGR  372

Query  590  DYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalaeerseKYGKALA  411
            DYDPDRERAE RKLKK +K+EAKGAARE+RKDN+FL  VKEKEKA LAEE++EK+GKA A
Sbjct  373  DYDPDRERAEARKLKKLIKREAKGAARELRKDNYFLSQVKEKEKAMLAEEKAEKFGKAKA  432

Query  410  FLQEQEHAFKSGQLG  366
            FLQEQEHAFKSGQLG
Sbjct  433  FLQEQEHAFKSGQLG  447



>ref|XP_006437873.1| hypothetical protein CICLE_v10030646mg [Citrus clementina]
 gb|ESR51113.1| hypothetical protein CICLE_v10030646mg [Citrus clementina]
Length=939

 Score =   174 bits (442),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = -1

Query  770  AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKFEDNFIKGR  591
            A Q +MP  LQEK K+  ++I+ KV+E+H +RQPL+M K+KPVPIK++NPKFE+NF+KGR
Sbjct  798  AQQENMPAALQEKFKDAAEVIKKKVDEHHMVRQPLQMCKKKPVPIKLLNPKFEENFVKGR  857

Query  590  DYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalaeerseKYGKALA  411
            DYDPDRERAE RKLKK +K+EAKGAARE+RKDN+FL  VKEKEKA LAEE++EK+GKA A
Sbjct  858  DYDPDRERAEARKLKKLIKREAKGAARELRKDNYFLSQVKEKEKAVLAEEKAEKFGKAKA  917

Query  410  FLQEQEHAFKSGQLG  366
            FLQEQEHAFKSGQLG
Sbjct  918  FLQEQEHAFKSGQLG  932



>ref|XP_010470881.1| PREDICTED: nucleolar protein 14-like [Camelina sativa]
Length=907

 Score =   174 bits (440),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL+++  Q ++P  L++K+++V +LIE K EE+H+ R+PL MRK KPVPIKMVN
Sbjct  753  FIPISTLLHQIGNQENIPQTLKDKLEDVAKLIETKTEEHHKERKPLSMRKHKPVPIKMVN  812

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF++GRDYDPD+ R++++KLK+++KQEAKGA RE+RKDN F+  VK KEKA   +
Sbjct  813  PKFEENFVQGRDYDPDKYRSDVKKLKRKLKQEAKGAVRELRKDNEFMSTVKAKEKAVHEQ  872

Query  443  erseKYGKALAFLQEQEHAFKSGQL  369
            ER+EK+GK  AFLQEQEHAFKSGQL
Sbjct  873  ERAEKHGKNWAFLQEQEHAFKSGQL  897



>ref|XP_011462988.1| PREDICTED: nucleolar protein 14 isoform X1 [Fragaria vesca subsp. 
vesca]
Length=953

 Score =   173 bits (439),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  L+ EL+ Q +MP  L +K K V QLI+ K +++   RQPL+MRKQKPV IKM+N
Sbjct  800  FLPISTLVLELSEQENMPSALTDKFKEVAQLIKTKADKHCLRRQPLQMRKQKPVAIKMLN  859

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRER E +KLKKR+ QEAKGA RE+RKDN+FL  VK ++KA + +
Sbjct  860  PKFEENFVKGRDYDPDRERVERKKLKKRLTQEAKGAVRELRKDNYFLQEVKSRDKALMEQ  919

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+EKYGKA  FLQEQEHA KSGQLG
Sbjct  920  ERAEKYGKARLFLQEQEHAMKSGQLG  945



>ref|XP_004297213.1| PREDICTED: nucleolar protein 14 isoform X2 [Fragaria vesca subsp. 
vesca]
Length=952

 Score =   173 bits (439),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  L+ EL+ Q +MP  L +K K V QLI+ K +++   RQPL+MRKQKPV IKM+N
Sbjct  799  FLPISTLVLELSEQENMPSALTDKFKEVAQLIKTKADKHCLRRQPLQMRKQKPVAIKMLN  858

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRER E +KLKKR+ QEAKGA RE+RKDN+FL  VK ++KA + +
Sbjct  859  PKFEENFVKGRDYDPDRERVERKKLKKRLTQEAKGAVRELRKDNYFLQEVKSRDKALMEQ  918

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+EKYGKA  FLQEQEHA KSGQLG
Sbjct  919  ERAEKYGKARLFLQEQEHAMKSGQLG  944



>ref|NP_001050609.1| Os03g0598200 [Oryza sativa Japonica Group]
 dbj|BAF12523.1| Os03g0598200 [Oryza sativa Japonica Group]
Length=912

 Score =   173 bits (438),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  L+ E+  ++ +P +LQ  +  VI+LI+N+ +E H  RQPL+MRKQKP PI+ +N
Sbjct  760  FLPISSLMQEIMDKSDLPGLLQYILHEVIELIKNRSDEVHASRQPLQMRKQKPEPIRQLN  819

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+N+IKG DYDPDRERA+++K+KKR+K E KGA RE+RKDN+FL  VKEKE+    +
Sbjct  820  PKFEENYIKGLDYDPDRERAQMKKMKKRLKSEKKGAMRELRKDNYFLSAVKEKERIKQEQ  879

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+EKYGKA+AFLQEQEHAFKSGQLG
Sbjct  880  ERAEKYGKAMAFLQEQEHAFKSGQLG  905



>gb|EAZ27697.1| hypothetical protein OsJ_11647 [Oryza sativa Japonica Group]
Length=951

 Score =   173 bits (438),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  L+ E+  ++ +P +LQ  +  VI+LI+N+ +E H  RQPL+MRKQKP PI+ +N
Sbjct  799  FLPISSLMQEIMDKSDLPGLLQYILHEVIELIKNRSDEVHASRQPLQMRKQKPEPIRQLN  858

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+N+IKG DYDPDRERA+++K+KKR+K E KGA RE+RKDN+FL  VKEKE+    +
Sbjct  859  PKFEENYIKGLDYDPDRERAQMKKMKKRLKSEKKGAMRELRKDNYFLSAVKEKERIKQEQ  918

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+EKYGKA+AFLQEQEHAFKSGQLG
Sbjct  919  ERAEKYGKAMAFLQEQEHAFKSGQLG  944



>gb|AAN08225.2| unknown protein [Oryza sativa Japonica Group]
 gb|AAO59991.1| unknown protein [Oryza sativa Japonica Group]
Length=952

 Score =   173 bits (438),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  L+ E+  ++ +P +LQ  +  VI+LI+N+ +E H  RQPL+MRKQKP PI+ +N
Sbjct  800  FLPISSLMQEIMDKSDLPGLLQYILHEVIELIKNRSDEVHASRQPLQMRKQKPEPIRQLN  859

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+N+IKG DYDPDRERA+++K+KKR+K E KGA RE+RKDN+FL  VKEKE+    +
Sbjct  860  PKFEENYIKGLDYDPDRERAQMKKMKKRLKSEKKGAMRELRKDNYFLSAVKEKERIKQEQ  919

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+EKYGKA+AFLQEQEHAFKSGQLG
Sbjct  920  ERAEKYGKAMAFLQEQEHAFKSGQLG  945



>gb|ABF97462.1| Nop14-like family protein, expressed [Oryza sativa Japonica Group]
Length=929

 Score =   172 bits (437),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  L+ E+  ++ +P +LQ  +  VI+LI+N+ +E H  RQPL+MRKQKP PI+ +N
Sbjct  777  FLPISSLMQEIMDKSDLPGLLQYILHEVIELIKNRSDEVHASRQPLQMRKQKPEPIRQLN  836

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+N+IKG DYDPDRERA+++K+KKR+K E KGA RE+RKDN+FL  VKEKE+    +
Sbjct  837  PKFEENYIKGLDYDPDRERAQMKKMKKRLKSEKKGAMRELRKDNYFLSAVKEKERIKQEQ  896

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+EKYGKA+AFLQEQEHAFKSGQLG
Sbjct  897  ERAEKYGKAMAFLQEQEHAFKSGQLG  922



>gb|EEC75694.1| hypothetical protein OsI_12505 [Oryza sativa Indica Group]
Length=947

 Score =   172 bits (436),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  L+ E+  ++ +P +LQ     VI+LI+N+ +E H  RQPL+MRKQKP PI+ +N
Sbjct  795  FLPISSLMQEIMDKSDLPGLLQYIFHEVIELIKNRSDEVHASRQPLQMRKQKPEPIRQLN  854

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+N+IKG DYDPDRERA+++K+KKR+K E KGA RE+RKDN+FL  VKEKE+    +
Sbjct  855  PKFEENYIKGLDYDPDRERAQMKKMKKRLKSEKKGAMRELRKDNYFLSAVKEKERIKQEQ  914

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+EKYGKA+AFLQEQEHAFKSGQLG
Sbjct  915  ERAEKYGKAMAFLQEQEHAFKSGQLG  940



>ref|XP_008389390.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar protein 14-like [Malus 
domestica]
Length=921

 Score =   171 bits (434),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL E+A Q+++P +L +K+K+V +LI+ K +++H LRQPL++RKQKPV IKM+N
Sbjct  767  FLPISVLLLEVAEQDNIPQVLTDKLKDVAELIKTKADKHHILRQPLQLRKQKPVAIKMLN  826

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRE AE RK+KK +KQEAK A RE+RKDN FL+  K ++KA + E
Sbjct  827  PKFEENFVKGRDYDPDREXAEXRKMKKLLKQEAKXAIRELRKDNSFLYEXKARDKALMEE  886

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            E++EKYGK   FLQEQEHA KSGQLG
Sbjct  887  EKAEKYGKVRLFLQEQEHAMKSGQLG  912



>ref|XP_004497865.1| PREDICTED: nucleolar protein 14-like [Cicer arietinum]
Length=946

 Score =   171 bits (433),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+P+LKLL E+A Q++ P+ L+EKI  V  +I+ K +E H LR+PL+MRKQKPVPIK++N
Sbjct  794  FLPVLKLLTEIAEQSNTPNALREKINVVAGVIKLKADECHALRRPLQMRKQKPVPIKLLN  853

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            P + +N+ KG DYDPD ERAE RKL+K VK+EAKGAARE+RKDN+FL  VK+K++A   +
Sbjct  854  PVYRENYFKGIDYDPDFERAERRKLEKEVKREAKGAARELRKDNYFLLEVKDKQRAIQEK  913

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+EK+GK  AFLQEQEHAFKSGQLG
Sbjct  914  ERAEKHGKTKAFLQEQEHAFKSGQLG  939



>gb|ABR16783.1| unknown [Picea sitchensis]
Length=198

 Score =   159 bits (403),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F   + LL+E+  +N +P+ LQ K+ ++  LI+ K++E+ +LRQPLRMR +KPVPIK  N
Sbjct  46   FTSFVPLLHEIVKENKIPESLQLKMTSIASLIKGKIDEHEKLRQPLRMRMKKPVPIKQFN  105

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            P+FE+NF+ G++YDPDRERA+ +KL++++KQEAKGAARE+RKDN+FL  VK +E+A   E
Sbjct  106  PRFEENFVHGKNYDPDRERAQRKKLERQIKQEAKGAARELRKDNYFLQEVKARERAVAEE  165

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER++KY KA+AFLQEQE  FKSGQLG
Sbjct  166  ERADKYRKAMAFLQEQESNFKSGQLG  191



>ref|XP_006484246.1| PREDICTED: nucleolar protein 14-like [Citrus sinensis]
Length=939

 Score =   170 bits (431),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = -1

Query  770  AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKFEDNFIKGR  591
            A Q +M   LQEK K+  ++I+ KV+E+H +RQPL+M K+KPVPIK++NPKFE+NF+KGR
Sbjct  798  AQQENMLAALQEKFKDAAEVIKKKVDEHHMVRQPLQMCKKKPVPIKLLNPKFEENFVKGR  857

Query  590  DYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalaeerseKYGKALA  411
            DYDPDRERAE RKLKK +K+EAKGAARE+RKDN+FL  VKEKEKA LAEE++EK+GKA A
Sbjct  858  DYDPDRERAEARKLKKLIKREAKGAARELRKDNYFLSQVKEKEKAVLAEEKAEKFGKAKA  917

Query  410  FLQEQEHAFKSGQLG  366
            FLQEQEHAFKSGQLG
Sbjct  918  FLQEQEHAFKSGQLG  932



>ref|XP_010681128.1| PREDICTED: nucleolar protein 14 [Beta vulgaris subsp. vulgaris]
Length=937

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL E+A Q + P    +K+++V +LI  K EE H LRQPL+MRK+KPVPIK++N
Sbjct  785  FLPISALLGEVAEQQNEPGPFGDKLRHVRELITIKAEEYHELRQPLQMRKRKPVPIKLLN  844

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            P+FE+NF+KGRDYDPDR RAE RK+KK +++EA+GA RE+RKDN+FL  VKEKEK  L E
Sbjct  845  PQFEENFVKGRDYDPDRIRAENRKMKKLLRKEARGAVRELRKDNYFLQEVKEKEKQRLEE  904

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+EKYGKA AFLQEQEH FKSGQLG
Sbjct  905  ERAEKYGKAKAFLQEQEHTFKSGQLG  930



>ref|XP_006651582.1| PREDICTED: nucleolar protein 14-like [Oryza brachyantha]
Length=941

 Score =   169 bits (427),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  L+ E+  ++ +P ++Q+    VI+LI+N+ +E H  R+PL+MRKQKP PI+ +N
Sbjct  789  FLPISCLMKEIMDKSDLPGLVQDIFHEVIELIKNRSDEVHASREPLQMRKQKPEPIRQLN  848

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+N+IKG DYDPDRERA+++KLKKR+K E KGA RE+RKDN+FL  VKEK++    +
Sbjct  849  PKFEENYIKGLDYDPDRERAQMKKLKKRLKSEKKGAVRELRKDNYFLSAVKEKDRMKQEQ  908

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+EKYGKA+AFLQEQE+AFKSGQLG
Sbjct  909  ERAEKYGKAMAFLQEQENAFKSGQLG  934



>ref|XP_011070910.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar protein 14 [Sesamum 
indicum]
Length=944

 Score =   167 bits (422),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 121/146 (83%), Gaps = 2/146 (1%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI ++L+ L  ++ +PD L+ +I++V   IE+K +E++ LRQPLR+RKQK   IK   
Sbjct  794  FLPISEILHGLVEEDQIPDALKVEIRDVAGRIESKSQEHNLLRQPLRLRKQKI--IKTAV  851

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRERAE++KLKKR+KQEAKGA RE+RKDNHFL  VKE++KA + E
Sbjct  852  PKFEENFVKGRDYDPDRERAEMKKLKKRLKQEAKGAVRELRKDNHFLLEVKERDKARMDE  911

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            E++EKYGK  AFLQEQEHAFKSGQLG
Sbjct  912  EKAEKYGKYRAFLQEQEHAFKSGQLG  937



>ref|XP_008445433.1| PREDICTED: nucleolar protein 14 isoform X1 [Cucumis melo]
Length=947

 Score =   167 bits (422),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  +L+ELA Q +MPD+LQ K + V + IE K EE++  RQPLRMRKQK VPIK++N
Sbjct  795  FLPISTILHELAKQENMPDVLQNKFRKVAEAIEAKAEEHYMGRQPLRMRKQKAVPIKLLN  854

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF++GRDYDPDRERAE RK++K +K+E KGAARE+RKDNHFL  VK ++KA   E
Sbjct  855  PKFEENFVRGRDYDPDRERAERRKMQKLLKRETKGAARELRKDNHFLSEVKARDKAREDE  914

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+EKY KA  FL+ QEHAFKSGQLG
Sbjct  915  ERAEKYKKARTFLEAQEHAFKSGQLG  940



>ref|XP_008445434.1| PREDICTED: nucleolar protein 14 isoform X2 [Cucumis melo]
Length=946

 Score =   167 bits (422),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  +L+ELA Q +MPD+LQ K + V + IE K EE++  RQPLRMRKQK VPIK++N
Sbjct  794  FLPISTILHELAKQENMPDVLQNKFRKVAEAIEAKAEEHYMGRQPLRMRKQKAVPIKLLN  853

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF++GRDYDPDRERAE RK++K +K+E KGAARE+RKDNHFL  VK ++KA   E
Sbjct  854  PKFEENFVRGRDYDPDRERAERRKMQKLLKRETKGAARELRKDNHFLSEVKARDKAREDE  913

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+EKY KA  FL+ QEHAFKSGQLG
Sbjct  914  ERAEKYKKARTFLEAQEHAFKSGQLG  939



>ref|XP_010232878.1| PREDICTED: nucleolar protein 14 isoform X1 [Brachypodium distachyon]
Length=940

 Score =   165 bits (417),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL ++  ++ +P +LQ     VI LI+ + +E+H  R+PL+MRKQKP PIK++N
Sbjct  788  FLPISSLLQQILEKSALPTLLQNIFHEVIDLIKKRSDEHHASREPLQMRKQKPEPIKLLN  847

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+N+IKG DYDPDRERA+++KLKKR+K E KGA RE+RKDN+FL  VKEKE+    +
Sbjct  848  PKFEENYIKGLDYDPDRERAQMKKLKKRLKSEKKGAVRELRKDNYFLSAVKEKERIKQEQ  907

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+EK+GK +AFLQEQE AFKSGQLG
Sbjct  908  ERAEKHGKVMAFLQEQESAFKSGQLG  933



>ref|XP_010232881.1| PREDICTED: nucleolar protein 14 isoform X2 [Brachypodium distachyon]
Length=939

 Score =   165 bits (417),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL ++  ++ +P +LQ     VI LI+ + +E+H  R+PL+MRKQKP PIK++N
Sbjct  787  FLPISSLLQQILEKSALPTLLQNIFHEVIDLIKKRSDEHHASREPLQMRKQKPEPIKLLN  846

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+N+IKG DYDPDRERA+++KLKKR+K E KGA RE+RKDN+FL  VKEKE+    +
Sbjct  847  PKFEENYIKGLDYDPDRERAQMKKLKKRLKSEKKGAVRELRKDNYFLSAVKEKERIKQEQ  906

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+EK+GK +AFLQEQE AFKSGQLG
Sbjct  907  ERAEKHGKVMAFLQEQESAFKSGQLG  932



>ref|XP_008665059.1| PREDICTED: nucleolar protein 14 isoform X1 [Zea mays]
Length=922

 Score =   164 bits (415),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL E+  ++ +P  LQ+    VI LI+ + +E++  R+PLRMRK+KP PIK +N
Sbjct  768  FLPISSLLQEILDRSELPGSLQDIFHEVIDLIKKRSDEHYASREPLRMRKKKPEPIKQLN  827

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+N+IKG DYDPDRERA+++KL+KRVK E KGA RE++KDN+FL  VKEKE+    E
Sbjct  828  PKFEENYIKGLDYDPDRERAQMKKLRKRVKSEMKGAKRELQKDNYFLSAVKEKERRKRDE  887

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+E YGKA+AFLQEQE AFKSGQLG
Sbjct  888  ERAEMYGKAMAFLQEQESAFKSGQLG  913



>ref|XP_008665060.1| PREDICTED: nucleolar protein 14 isoform X2 [Zea mays]
 tpg|DAA50242.1| TPA: hypothetical protein ZEAMMB73_053356 [Zea mays]
Length=921

 Score =   164 bits (415),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL E+  ++ +P  LQ+    VI LI+ + +E++  R+PLRMRK+KP PIK +N
Sbjct  767  FLPISSLLQEILDRSELPGSLQDIFHEVIDLIKKRSDEHYASREPLRMRKKKPEPIKQLN  826

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+N+IKG DYDPDRERA+++KL+KRVK E KGA RE++KDN+FL  VKEKE+    E
Sbjct  827  PKFEENYIKGLDYDPDRERAQMKKLRKRVKSEMKGAKRELQKDNYFLSAVKEKERRKRDE  886

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+E YGKA+AFLQEQE AFKSGQLG
Sbjct  887  ERAEMYGKAMAFLQEQESAFKSGQLG  912



>ref|XP_002464264.1| hypothetical protein SORBIDRAFT_01g015150 [Sorghum bicolor]
 gb|EER91262.1| hypothetical protein SORBIDRAFT_01g015150 [Sorghum bicolor]
Length=925

 Score =   164 bits (415),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL E+  ++ +PD LQ+    +I L++   +E+H  R+PLRMRK+KP PIK +N
Sbjct  771  FLPISSLLQEILERSELPDSLQDIFHEIIDLVKKISDEHHASREPLRMRKKKPEPIKQLN  830

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+N+IKG DYDPDRERA+++KL+KRVK E KGA RE++KDN+FL  VKEKE+    E
Sbjct  831  PKFEENYIKGLDYDPDRERAQMKKLRKRVKSEMKGAKRELQKDNYFLSAVKEKERMKRDE  890

Query  443  erseKYGKALAFLQEQEHAFKSGQL  369
            ER+E YGKA+AFLQEQE AFKSGQL
Sbjct  891  ERAEMYGKAMAFLQEQESAFKSGQL  915



>ref|XP_009402831.1| PREDICTED: nucleolar protein 14 [Musa acuminata subsp. malaccensis]
Length=944

 Score =   160 bits (406),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F PI  LL+E+    ++P +L++K+++V+ LI+ K +E+H  R+PL+MRKQKPVPIK++N
Sbjct  792  FSPISNLLHEVLQNPNLPGLLRDKMQDVLDLIKKKTDEHHMFRKPLQMRKQKPVPIKLLN  851

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRERAE++KLKK +K E KGA RE+RKD+ F+ G+KE  +    E
Sbjct  852  PKFEENFVKGRDYDPDRERAEMKKLKKLLKSEKKGAIRELRKDSQFVSGLKETGRLMQEE  911

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+EKYGKA+AFLQEQE+AFKSGQLG
Sbjct  912  ERAEKYGKAMAFLQEQEYAFKSGQLG  937



>ref|XP_010257952.1| PREDICTED: nucleolar protein 14 [Nelumbo nucifera]
Length=947

 Score =   160 bits (405),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            FMP+  LL  +A Q  +PD+LQE   NV +LI+NK  E+  LRQPL+MRKQKPVP K + 
Sbjct  795  FMPVSTLLYGVAKQEFLPDVLQENFGNVAELIKNKANEHQMLRQPLQMRKQKPVPNKQLT  854

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRERAE +KLKK +K+EAKGAARE+RKDN+FL  VKEKE+A L E
Sbjct  855  PKFEENFVKGRDYDPDRERAERKKLKKLLKREAKGAARELRKDNYFLSEVKEKERAILEE  914

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER+EKYGKA  FLQEQEHAFKSGQLG
Sbjct  915  ERAEKYGKAWNFLQEQEHAFKSGQLG  940



>ref|XP_010415532.1| PREDICTED: nucleolar protein 14-like isoform X1 [Camelina sativa]
 ref|XP_010415533.1| PREDICTED: nucleolar protein 14-like isoform X2 [Camelina sativa]
Length=906

 Score =   159 bits (403),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            FMPI  LLN++  Q  +P  L+EK+++V +LI+ K +E+H+ R+PL MRK KPV IKMVN
Sbjct  752  FMPISTLLNQIGDQEKIPQTLKEKLEDVAKLIQTKTKEHHKERKPLSMRKYKPVAIKMVN  811

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+ GRDYDPD+ R++++KLK+++KQEAKGAARE+RKDN F+  VK KEKA   +
Sbjct  812  PKFEENFVHGRDYDPDKYRSDLKKLKRKLKQEAKGAARELRKDNEFMSTVKAKEKAVHEQ  871

Query  443  erseKYGKALAFLQEQEHAFKSGQL  369
            ER+EK+GK  AFLQEQEHAFKSGQL
Sbjct  872  ERAEKHGKNWAFLQEQEHAFKSGQL  896



>ref|XP_010415534.1| PREDICTED: nucleolar protein 14-like isoform X3 [Camelina sativa]
Length=906

 Score =   159 bits (403),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            FMPI  LLN++  Q  +P  L+EK+++V +LI+ K +E+H+ R+PL MRK KPV IKMVN
Sbjct  752  FMPISTLLNQIGDQEKIPQTLKEKLEDVAKLIQTKTKEHHKERKPLSMRKYKPVAIKMVN  811

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+ GRDYDPD+ R++++KLK+++KQEAKGAARE+RKDN F+  VK KEKA   +
Sbjct  812  PKFEENFVHGRDYDPDKYRSDLKKLKRKLKQEAKGAARELRKDNEFMSTVKAKEKAVHEQ  871

Query  443  erseKYGKALAFLQEQEHAFKSGQL  369
            ER+EK+GK  AFLQEQEHAFKSGQL
Sbjct  872  ERAEKHGKNWAFLQEQEHAFKSGQL  896



>ref|XP_010511932.1| PREDICTED: nucleolar protein 14-like [Camelina sativa]
Length=905

 Score =   158 bits (399),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            FMPI  LL+++  Q  +P  L+EK+ +V +LIE K +E+H+ R+PL MRK KPVPI+MVN
Sbjct  751  FMPISTLLHQIGNQEKIPQTLKEKLVDVAKLIETKTKEHHKERKPLSMRKHKPVPIRMVN  810

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+ GRDYDPD+ R++++KLKK++KQEAKGA RE+RKDN F+  VK KEKA   +
Sbjct  811  PKFEENFVNGRDYDPDKYRSDLKKLKKKLKQEAKGAQRELRKDNEFMSTVKAKEKAVHEQ  870

Query  443  erseKYGKALAFLQEQEHAFKSGQL  369
            ER+EK+GK  AFLQEQEHAFKSGQL
Sbjct  871  ERAEKHGKNWAFLQEQEHAFKSGQL  895



>ref|XP_002888698.1| hypothetical protein ARALYDRAFT_339148 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64957.1| hypothetical protein ARALYDRAFT_339148 [Arabidopsis lyrata subsp. 
lyrata]
Length=901

 Score =   157 bits (398),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            FMPI  LL+++  Q  +P  L+EK+++V +LIE K +E+H+ R+PL MRK KPV I+MVN
Sbjct  747  FMPISTLLHQIGNQEKIPQTLKEKLEDVAKLIETKTDEHHKERKPLSMRKHKPVAIRMVN  806

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF  GRDYDPD+ R++++KLK+++KQEAKGA RE+RKD++F+  VK KEKAA  +
Sbjct  807  PKFEENFAPGRDYDPDKYRSDLKKLKRKLKQEAKGAVRELRKDSYFMSSVKAKEKAAHEQ  866

Query  443  erseKYGKALAFLQEQEHAFKSGQL  369
            ER+EK+GKA AFLQEQEHAFKSGQL
Sbjct  867  ERAEKHGKAWAFLQEQEHAFKSGQL  891



>gb|KFK41333.1| hypothetical protein AALP_AA2G116500 [Arabis alpina]
Length=909

 Score =   157 bits (397),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            FMPI  LL+++  Q  +P  L+EK+++V QLIE K +E  + R+PL MRK KPVPI+MVN
Sbjct  755  FMPISTLLHQVGNQEKIPQTLKEKLEDVAQLIEKKTDEYQKQRKPLTMRKHKPVPIRMVN  814

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFEDNF + RDYDPD+ R++I+KLKK++KQEAKGA RE+RKD++++  VK KEKA   +
Sbjct  815  PKFEDNFDRHRDYDPDKYRSDIKKLKKKLKQEAKGAIRELRKDSYYMSSVKAKEKAVQEQ  874

Query  443  erseKYGKALAFLQEQEHAFKSGQL  369
            ER+EK+GKA AFLQEQEHAFKSGQL
Sbjct  875  ERAEKHGKAWAFLQEQEHAFKSGQL  899



>gb|ACG60683.1| unknown protein [Brassica oleracea var. alboglabra]
Length=879

 Score =   154 bits (389),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            FMPI  LL+++  Q  +P  L+EK+ +  QLIE K EE+H+ R+PL MRKQKPV I+MVN
Sbjct  724  FMPISALLHQVGNQEKIPQTLREKLVDAAQLIEKKTEEHHKQRKPLAMRKQKPVAIRMVN  783

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF KGRDYDPD+ R++++KLKK++ +E KG  RE+RKD++F+  VK KEKA   +
Sbjct  784  PKFEENFAKGRDYDPDKYRSDMKKLKKKLNEERKGVVRELRKDSYFMSDVKAKEKAVQEQ  843

Query  443  erseKYGKALAFLQEQEHAFKSGQL  369
            ER+EK+GK LAFLQEQEHAFKSGQL
Sbjct  844  ERAEKHGKNLAFLQEQEHAFKSGQL  868



>gb|EYU22573.1| hypothetical protein MIMGU_mgv1a000929mg [Erythranthe guttata]
Length=940

 Score =   153 bits (386),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 118/145 (81%), Gaps = 2/145 (1%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI K+L+EL  ++ +PD L+ ++K++ Q I++K +E + LRQPLR+RK K   IK   
Sbjct  788  FLPISKVLHELEEEDLVPDALKGELKSIAQHIQDKSQEYYLLRQPLRLRKVKI--IKTAV  845

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPDRER+E++KL+KR+++EAKGA RE+RKDN+FL  VK ++KA + +
Sbjct  846  PKFEENFVKGRDYDPDRERSEMKKLRKRLRKEAKGAVRELRKDNYFLSVVKARDKAHVEQ  905

Query  443  erseKYGKALAFLQEQEHAFKSGQL  369
            E++EK GK  AFLQEQEHAFKSGQL
Sbjct  906  EKAEKSGKTRAFLQEQEHAFKSGQL  930



>ref|XP_006300707.1| hypothetical protein CARUB_v10019758mg [Capsella rubella]
 gb|EOA33605.1| hypothetical protein CARUB_v10019758mg [Capsella rubella]
Length=900

 Score =   153 bits (386),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            FMPI  LLN++  Q  +P  L+EK+++V  LI+ K +E+H+ R+PL +RK KPV I+MVN
Sbjct  746  FMPISTLLNQIGNQEKIPQSLKEKLEDVANLIQKKTDEHHKERKPLSIRKLKPVAIRMVN  805

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF++GRDYDPD+ R++++KLK+++KQEAKGA RE+RKDN F+  VK KEKA   +
Sbjct  806  PKFEENFVQGRDYDPDKYRSDLKKLKRKLKQEAKGAIRELRKDNEFMSTVKAKEKAVHEQ  865

Query  443  erseKYGKALAFLQEQEHAFKSGQL  369
            ER+EK+G+  AFLQEQEHAFKSGQL
Sbjct  866  ERAEKHGRNWAFLQEQEHAFKSGQL  890



>ref|XP_004982473.1| PREDICTED: nucleolar protein 14-like [Setaria italica]
Length=931

 Score =   153 bits (386),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 112/145 (77%), Gaps = 0/145 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F+PI  LL E+  ++ +  +L++    VI LI+ + +E+H  R+PL+MRK+ P PIK +N
Sbjct  777  FLPISSLLQEILDKSEVSGLLRDIFHEVIDLIKKRSDEHHASREPLQMRKKLPEPIKQLN  836

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+N+IKG DYDPDR+RA+ +K+ KR+K E KGAARE+RKDNHFL+ VKEKE+    +
Sbjct  837  PKFEENYIKGLDYDPDRDRAQRKKMNKRLKSEKKGAARELRKDNHFLYAVKEKERIKQEQ  896

Query  443  erseKYGKALAFLQEQEHAFKSGQL  369
            E++E+ GK LAFLQEQE AFKSGQL
Sbjct  897  EKAEQLGKNLAFLQEQESAFKSGQL  921



>ref|XP_001762011.1| predicted protein [Physcomitrella patens]
 gb|EDQ73115.1| predicted protein [Physcomitrella patens]
Length=942

 Score =   152 bits (385),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 105/146 (72%), Gaps = 0/146 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F P   LL+ L   N +P+ L      V Q I  KV+E+   R PL MR  KPVPIK  N
Sbjct  788  FSPFASLLDALKNNNALPEALMVLTTEVSQFIAEKVKEHETTRLPLLMRMSKPVPIKTYN  847

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            P+FE+N++KGRDYDPDRERAE +KLKK++K+EAKGAARE+RKDN FL   K KE A L +
Sbjct  848  PQFEENYVKGRDYDPDRERAETKKLKKQLKREAKGAARELRKDNWFLAEEKAKENAVLQQ  907

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            ER EKY KA++FLQ+QE AFKSGQLG
Sbjct  908  EREEKYNKAMSFLQQQESAFKSGQLG  933



>emb|CDY65810.1| BnaA02g35820D [Brassica napus]
Length=892

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            FMPI  LL+++  Q  +P  L+EK+++  +LIE K EE+ + R+PL MRKQKPV I+MVN
Sbjct  737  FMPISTLLHQVGNQEKIPQTLREKLEDAAELIEKKTEEHQKQRKPLAMRKQKPVAIRMVN  796

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF KGRDYDPD+ R++++KLKK++ +E KG  RE+RKD++F+  VK KEKA   +
Sbjct  797  PKFEENFAKGRDYDPDKYRSDMKKLKKKLNEERKGVVRELRKDSYFMSDVKAKEKAVHEQ  856

Query  443  erseKYGKALAFLQEQEHAFKSGQL  369
            ER+EK+GK LAFLQEQEHAFKSGQL
Sbjct  857  ERAEKHGKNLAFLQEQEHAFKSGQL  881



>ref|XP_009127702.1| PREDICTED: nucleolar protein 14 [Brassica rapa]
Length=904

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            FMPI  LL+++  Q  +P  L+EK+++  +LIE K EE+ + R+PL MRKQKPV I+MVN
Sbjct  749  FMPISTLLHQVGNQEKIPQTLREKLEDAAELIEKKTEEHQKQRKPLAMRKQKPVAIRMVN  808

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF KGRDYDPD+ R++++KLKK++ +E KG  RE+RKD++F+  VK KEKA   +
Sbjct  809  PKFEENFAKGRDYDPDKYRSDMKKLKKKLNEERKGVVRELRKDSYFMSDVKAKEKAVHEQ  868

Query  443  erseKYGKALAFLQEQEHAFKSGQL  369
            ER+EK+GK LAFLQEQEHAFKSGQL
Sbjct  869  ERAEKHGKNLAFLQEQEHAFKSGQL  893



>ref|XP_006391059.1| hypothetical protein EUTSA_v10018096mg [Eutrema salsugineum]
 gb|ESQ28345.1| hypothetical protein EUTSA_v10018096mg [Eutrema salsugineum]
Length=911

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            FMPI  L +++  Q  +P  L+EK+++V QLIE K +E+ + R+PL MRK KP+ I+MVN
Sbjct  757  FMPISTLSHQVGNQEKIPQTLKEKLEDVAQLIEKKTDEHRKQRKPLAMRKHKPIAIRMVN  816

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+KGRDYDPD+ R+E +KLKK +KQE KGA RE+RKD++F+  VK KEKAA  +
Sbjct  817  PKFEENFVKGRDYDPDKARSEHKKLKKLLKQERKGAGRELRKDSYFMSEVKAKEKAAREQ  876

Query  443  erseKYGKALAFLQEQEHAFKSGQL  369
            ER+EK+GK  AFLQEQEHAFKSGQL
Sbjct  877  ERAEKHGKNWAFLQEQEHAFKSGQL  901



>ref|NP_177070.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE34882.1| uncharacterized protein AT1G69070 [Arabidopsis thaliana]
Length=901

 Score =   147 bits (371),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            FMPI  LL+++  Q  +P  L+EK+++V +LIE K +++H+ R+PL MRK KPV I+MVN
Sbjct  747  FMPISTLLHQIGNQEKIPQTLKEKLEDVAKLIEKKTDDHHKERKPLSMRKHKPVAIRMVN  806

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+ G D DPD+ R++++KLK+++K+EA+GA RE+RKD++F+  VK KEKAA  +
Sbjct  807  PKFEENFVPGMDNDPDKYRSDLKKLKRKLKREARGAVRELRKDSYFMSTVKAKEKAAHEQ  866

Query  443  erseKYGKALAFLQEQEHAFKSGQL  369
            ER+EK+GKA AFLQEQEHAFKSGQL
Sbjct  867  ERAEKHGKAWAFLQEQEHAFKSGQL  891



>gb|AAF27073.1|AC008262_22 F4N2.4 [Arabidopsis thaliana]
Length=891

 Score =   147 bits (370),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            FMPI  LL+++  Q  +P  L+EK+++V +LIE K +++H+ R+PL MRK KPV I+MVN
Sbjct  737  FMPISTLLHQIGNQEKIPQTLKEKLEDVAKLIEKKTDDHHKERKPLSMRKHKPVAIRMVN  796

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE+NF+ G D DPD+ R++++KLK+++K+EA+GA RE+RKD++F+  VK KEKAA  +
Sbjct  797  PKFEENFVPGMDNDPDKYRSDLKKLKRKLKREARGAVRELRKDSYFMSTVKAKEKAAHEQ  856

Query  443  erseKYGKALAFLQEQEHAFKSGQL  369
            ER+EK+GKA AFLQEQEHAFKSGQL
Sbjct  857  ERAEKHGKAWAFLQEQEHAFKSGQL  881



>gb|EPS71081.1| hypothetical protein M569_03678 [Genlisea aurea]
Length=600

 Score =   144 bits (363),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 108/146 (74%), Gaps = 2/146 (1%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F P+ K L  L   + +P+ L+  I+   +LIE K  E H  R+PLR +K K   +K   
Sbjct  449  FSPVSKTLQRLVNDDLLPEKLRAGIEEACRLIEQKSRETHTERRPLRYQKVKI--LKTFA  506

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            PKFE++F+KGRDYDPDR+RAE RKLKKR+KQEAKGAARE+RKDN FL  VKE+E+A   E
Sbjct  507  PKFEESFVKGRDYDPDRDRAERRKLKKRLKQEAKGAARELRKDNQFLLEVKERERAEREE  566

Query  443  erseKYGKALAFLQEQEHAFKSGQLG  366
            E++E++GK  AFLQEQEHAF+SGQLG
Sbjct  567  EKAERFGKFKAFLQEQEHAFRSGQLG  592



>gb|AEX11449.1| hypothetical protein 0_14259_01, partial [Pinus taeda]
 gb|AEX11450.1| hypothetical protein 0_14259_01, partial [Pinus taeda]
 gb|AEX11451.1| hypothetical protein 0_14259_01, partial [Pinus taeda]
 gb|AEX11452.1| hypothetical protein 0_14259_01, partial [Pinus taeda]
 gb|AEX11453.1| hypothetical protein 0_14259_01, partial [Pinus taeda]
 gb|AEX11454.1| hypothetical protein 0_14259_01, partial [Pinus taeda]
Length=139

 Score =   133 bits (334),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F   + LLNE+  +N +P+ L+ K+ ++  LI+ K++E+ +LRQPLRMR +KP+PIK  N
Sbjct  9    FASFVPLLNEIVKENKIPETLRLKMTSIASLIKGKIDEHEKLRQPLRMRMKKPMPIKQFN  68

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalae  444
            P+FE+NF+ G+DYDPDRERA+ +KL++++KQEAKGAARE+RKDN+FL   K +E+A   E
Sbjct  69   PRFEENFVHGKDYDPDRERAQRKKLERQIKQEAKGAARELRKDNYFLQEEKARERAVAEE  128

Query  443  erseKYGKALA  411
            ER+++Y KA+A
Sbjct  129  ERADRYKKAMA  139



>gb|EMS51472.1| hypothetical protein TRIUR3_21500 [Triticum urartu]
Length=1042

 Score =   130 bits (328),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            FMP+  LL ++  ++ +P +LQE  ++VI LI+ + +E+H  R+PL+MRKQKP PIK +N
Sbjct  838  FMPVSSLLQQIMEKSELPALLQEIFQDVIDLIKKRSDEHHASREPLQMRKQKPEPIKQLN  897

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGV  474
            PKFE+N++KG DYDPDRERA ++KLKK+VK E +GA  E+RKD++F+  V
Sbjct  898  PKFEENYVKGLDYDPDRERARLKKLKKQVKSEKRGAMSELRKDSYFMAAV  947



>gb|EMT11619.1| hypothetical protein F775_01391 [Aegilops tauschii]
Length=950

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            FMP+  LL ++  ++ +P +LQE  ++VI LI+ K +E+H  R+PL+MRKQKP PIK +N
Sbjct  791  FMPVSSLLQQIMEKSELPALLQEIFQDVIDLIKKKSDEHHASREPLQMRKQKPEPIKQLN  850

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQE  528
            PKFE+N++KG DYDPDRERA ++KLKK+VK E
Sbjct  851  PKFEENYVKGLDYDPDRERARLKKLKKQVKSE  882



>emb|CDY62485.1| BnaCnng40370D [Brassica napus]
Length=103

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -1

Query  608  NFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalaeerseK  429
            +F KGRDYDPD+ R++I+KL K++ +E KG  RE+RKD +F+  VK KEKA   +ER+EK
Sbjct  13   SFAKGRDYDPDKYRSDIKKLNKKLNEERKGVVRELRKDIYFMSDVKAKEKAVQEQERAEK  72

Query  428  YGKALAFLQEQEHAFKSGQL  369
            +GK LAFLQEQEHAFKSGQL
Sbjct  73   HGKNLAFLQEQEHAFKSGQL  92



>ref|XP_003081444.1| Nucleolar protein involved in 40S ribosome biogenesis (ISS) [Ostreococcus 
tauri]
Length=954

 Score = 90.9 bits (224),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 73/107 (68%), Gaps = 1/107 (1%)
 Frame = -1

Query  680  LRQPLRMRKQKPVPIKMVNPKFE-DNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREI  504
            ++ PL    +    IK  NP +E D + KGRDYDP+RERAE RKLKK++KQEA+GA RE+
Sbjct  831  VKTPLAYHTKAAEAIKTYNPMYEEDGYQKGRDYDPNRERAEARKLKKQLKQEARGAMREL  890

Query  503  RKDNHFLFGVkekekaalaeerseKYGKALAFLQEQEHAFKSGQLGG  363
            RKDN F+   + KE+A  AEER  +    L+FL++QE  FKSG  GG
Sbjct  891  RKDNRFMADARAKEQAQAAEERGARQRDVLSFLEKQESDFKSGGQGG  937



>emb|CEF99253.1| Nucleolar protein 14 [Ostreococcus tauri]
Length=975

 Score = 90.9 bits (224),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 73/107 (68%), Gaps = 1/107 (1%)
 Frame = -1

Query  680  LRQPLRMRKQKPVPIKMVNPKFE-DNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREI  504
            ++ PL    +    IK  NP +E D + KGRDYDP+RERAE RKLKK++KQEA+GA RE+
Sbjct  852  VKTPLAYHTKAAEAIKTYNPMYEEDGYQKGRDYDPNRERAEARKLKKQLKQEARGAMREL  911

Query  503  RKDNHFLFGVkekekaalaeerseKYGKALAFLQEQEHAFKSGQLGG  363
            RKDN F+   + KE+A  AEER  +    L+FL++QE  FKSG  GG
Sbjct  912  RKDNRFMADARAKEQAQAAEERGARQRDVLSFLEKQESDFKSGGQGG  958



>ref|XP_004368115.1| Nop14 family protein [Acanthamoeba castellanii str. Neff]
 gb|ELR25360.1| Nop14 family protein [Acanthamoeba castellanii str. Neff]
Length=938

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 71/110 (65%), Gaps = 4/110 (4%)
 Frame = -1

Query  803  FMP---ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P   + KLL  +A +  +P  L+ +++ V   +   ++     R PLR R+ KPVPI+
Sbjct  779  FTPYAIVAKLLRAVAGRRVLPAQLEAQLQEVKTKLGTGIQRKVDQRLPLRQRR-KPVPIR  837

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            M+NP+F+DNF  GRD DPDRERAE +K ++  K+E KGA RE+RKD  FL
Sbjct  838  MLNPRFKDNFKVGRDNDPDRERAEKKKFERMYKKELKGAMRELRKDTAFL  887



>ref|XP_001420056.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98349.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=975

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = -1

Query  680  LRQPLRMRKQKPVPIKMVNPKFE-DNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREI  504
            ++ PL    +    IK  NP +E D + KGRDYDP+RERAE RKLKK+VKQE +GA RE+
Sbjct  852  VKTPLAYHTKTAEAIKTFNPMYEEDGYQKGRDYDPNRERAEARKLKKQVKQETRGAMREL  911

Query  503  RKDNHFLFGVkekekaalaeerseKYGKALAFLQEQEHAFKSGQLGG  363
            RKDN F+   + KE+   AEER  +    L+FL++QE  FKSG  GG
Sbjct  912  RKDNRFMADARSKEQFQAAEERGARQKDILSFLEKQEADFKSGGQGG  958



>ref|XP_011401646.1| Nucleolar protein 14 [Auxenochlorella protothecoides]
 gb|KFM28610.1| Nucleolar protein 14 [Auxenochlorella protothecoides]
Length=613

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = -1

Query  635  KMVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekeka  456
            +  NP+FED ++  +DYDPDRER+E RKL+++V++E +GAARE+RKD  F+  V++KEKA
Sbjct  515  RQYNPRFEDGYVATKDYDPDRERSERRKLQRQVRKEQRGAARELRKDGAFMAAVRDKEKA  574

Query  455  alaeerseKYGKALAFLQEQEHAFKSGQLGG  363
                   +   +A++FLQ+QE  FKSG  GG
Sbjct  575  TKQAALDKSAKRAMSFLQKQESDFKSGGQGG  605



>ref|XP_007913126.1| putative nop14-like family protein [Togninia minima UCRPA7]
 gb|EOO02034.1| putative nop14-like family protein [Togninia minima UCRPA7]
Length=914

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNELAAQ---NHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P LK L  L ++   NH+P+ L +  +    L+E  ++     R+PL +   KP+ IK
Sbjct  754  FEPALKTLKHLVSKPCRNHLPESLIQDTERSTVLLERMLKIAQLSRRPLELHHHKPLAIK  813

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFED+F   + YDPDRERAE+ KLK   K+E KGA RE+RKD +F+
Sbjct  814  TYIPKFEDSFDPNKHYDPDRERAELAKLKAEHKKERKGAMRELRKDANFM  863



>ref|XP_005652081.1| Nop14-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE27537.1| Nop14-like protein [Coccomyxa subellipsoidea C-169]
Length=983

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 89/154 (58%), Gaps = 7/154 (5%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPL-RMRKQKPVPIKMV  627
              P    L +L +   +P  L+E+   V++++     E    R+PL R    K   +K+ 
Sbjct  817  LAPAQSALEDLCSAEGLPKALEEQRAEVLEVVRRARAEALASRRPLVRKGAVKNAEVKLF  876

Query  626  NPKFEDNFIKGRDYDPDR------ERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkek  465
            NP+FE++F+ G++YDPDR      ERAE +KL+++V++E +GA RE+RKD  FL   ++ 
Sbjct  877  NPRFEEDFVTGKNYDPDRRGPASLERAEQKKLRRQVQKEKRGAMRELRKDAVFLGAARDA  936

Query  464  ekaalaeerseKYGKALAFLQEQEHAFKSGQLGG  363
            + AA  +ER  K     AFL+ QE  FKSG  GG
Sbjct  937  DAAAEKKERRTKLRANFAFLEGQEADFKSGGQGG  970



>ref|XP_007510128.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18473.1| predicted protein [Bathycoccus prasinos]
Length=1083

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 83/126 (66%), Gaps = 3/126 (2%)
 Frame = -1

Query  731   IKNVIQLIENKVEENHR--LRQPLRMRKQKPVPIKMVNPKFE-DNFIKGRDYDPDRERAE  561
             I  + + + N++ E  +  +R  L    +    IK  NP +E D F KGRDYDP+RERAE
Sbjct  936   ILKMCETMHNEICETKKSSVRLSLAWHTKSVEAIKQFNPMYEEDGFQKGRDYDPNRERAE  995

Query  560   IRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalaeerseKYGKALAFLQEQEHAFK  381
              RKLKK +++EA+G  RE+RKDN F+   +E+EKAA AEER  K+ + L+FL++QE  FK
Sbjct  996   NRKLKKELRKEARGTVRELRKDNQFMHHAREQEKAAEAEERDAKHKEVLSFLEKQESDFK  1055

Query  380   SGQLGG  363
             SG  GG
Sbjct  1056  SGGQGG  1061



>ref|XP_003064853.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51187.1| predicted protein [Micromonas pusilla CCMP1545]
Length=1084

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 54/106 (51%), Positives = 74/106 (70%), Gaps = 1/106 (1%)
 Frame = -1

Query  677   RQPLRMRKQKPVPIKMVNPKFE-DNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIR  501
             R PL  R +K   IK+ NP +E + + KGRDYDP+RERAE +KL++++K+EA+GA RE+R
Sbjct  948   RPPLTWRLKKVEAIKVYNPMYEIEGYQKGRDYDPNRERAEAKKLRRQLKKEARGAVRELR  1007

Query  500   KDNHFLFGVkekekaalaeerseKYGKALAFLQEQEHAFKSGQLGG  363
             KDN FL   + KE +A A+ER E+    LAFL++ E   KSG  GG
Sbjct  1008  KDNRFLAEERHKESSAAADERGERQRDTLAFLEKLEGDLKSGGQGG  1053



>ref|XP_001550943.1| hypothetical protein BC1G_10502 [Botrytis cinerea B05.10]
 gb|EMR82536.1| putative nop14-like family protein [Botrytis cinerea BcDW1]
Length=915

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 65/106 (61%), Gaps = 0/106 (0%)
 Frame = -1

Query  800  MPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNP  621
            + ILK L   + ++ +P+  Q  I+  I   +  ++  H  R+PL +   KP+ IK   P
Sbjct  761  LTILKHLGSKSCRSKLPESSQTLIRKSISKFQTMLQLAHLARRPLELHHHKPLAIKTSIP  820

Query  620  KFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            KFED++   + YDPDRERAE  KLK   K+E KGA RE+RKD++F+
Sbjct  821  KFEDSYNPDKHYDPDRERAETAKLKAEHKKERKGAMRELRKDSNFI  866



>emb|CCD54887.1| similar to Nop14-like family protein [Botrytis cinerea T4]
Length=916

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 65/106 (61%), Gaps = 0/106 (0%)
 Frame = -1

Query  800  MPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNP  621
            + ILK L   + ++ +P+  Q  I+  I   +  ++  H  R+PL +   KP+ IK   P
Sbjct  762  LTILKHLGSKSCRSKLPESSQTLIRKSISKFQTMLQLAHLARRPLELHHHKPLAIKTSIP  821

Query  620  KFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            KFED++   + YDPDRERAE  KLK   K+E KGA RE+RKD++F+
Sbjct  822  KFEDSYNPDKHYDPDRERAETAKLKAEHKKERKGAMRELRKDSNFI  867



>gb|ESZ97958.1| hypothetical protein SBOR_1629 [Sclerotinia borealis F-4157]
Length=915

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 64/106 (60%), Gaps = 0/106 (0%)
 Frame = -1

Query  800  MPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNP  621
            + ILK L   + ++ +P+  Q  I+     ++  +   H  R+PL +   KP+ IK   P
Sbjct  761  LAILKHLGGKSCRSKLPESTQTSIRKSTSKLQTMLSLAHLARRPLELHHHKPLAIKTSIP  820

Query  620  KFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            KFED++   + YDPDRERA+  KL+   KQE KGA RE+RKD++F+
Sbjct  821  KFEDSYNPDKHYDPDRERADTAKLRAEHKQERKGAMRELRKDSNFI  866



>gb|EIE77069.1| hypothetical protein RO3G_01773 [Rhizopus delemar RA 99-880]
Length=898

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 67/107 (63%), Gaps = 5/107 (5%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F  +L+++ +L+  N   DI   +++  I+    K     R + PLRM++ +PVPI    
Sbjct  754  FESLLEIIEQLSLLNWHQDIKASRLERQIKFCIEK-----RTKTPLRMQQHRPVPIAQHL  808

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            PKFE  +   R YDPD ER+++RKL+ +VK+E KGA RE+RKDN F+
Sbjct  809  PKFEKAYSVDRHYDPDHERSQLRKLESQVKKEKKGALRELRKDNQFM  855



>dbj|GAD92660.1| rRNA maturation protein (Nop14), putative [Byssochlamys spectabilis 
No. 5]
Length=901

 Score = 82.4 bits (202),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 62/96 (65%), Gaps = 0/96 (0%)
 Frame = -1

Query  770  AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKFEDNFIKGR  591
            +  N +P  +Q++++ +I  ++N + +    R+PL +   +P+ IK   PKFE+NF   R
Sbjct  758  SCSNKVPVAVQDRVQTLIDKLDNLISQATLKRRPLLLHNHRPLAIKTSIPKFEENFNPDR  817

Query  590  DYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
             YDPDRERAE  +LK   K+E KGA RE+RKD +F+
Sbjct  818  HYDPDRERAESNRLKAEYKREKKGAMRELRKDANFI  853



>gb|EKD02613.1| nucleolar protein, Nop14p [Trichosporon asahii var. asahii CBS 
8904]
Length=930

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 63/107 (59%), Gaps = 1/107 (1%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F P+ KL+ E+      P  L+ +I++    +  ++    + R PL ++  KPVPI    
Sbjct  777  FTPLQKLMTEIRVAKLAP-ALKAQIESATTQLGKQLMFAKQARAPLMLQDHKPVPIATYA  835

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            PKFE +F  G+ YDPD ER  + KLK + K+E KGA RE+RKDN FL
Sbjct  836  PKFEADFAPGKHYDPDVERNAVAKLKAQYKKEKKGAMRELRKDNRFL  882



>gb|EJT51859.1| nucleolar protein, Nop14p [Trichosporon asahii var. asahii CBS 
2479]
Length=930

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 62/107 (58%), Gaps = 1/107 (1%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F P+ KL+ ++      P  L+ +I+     +  ++    + R PL ++  KPVPI    
Sbjct  777  FTPLQKLMTDIRVAKLAP-ALKAQIETATTQLGKQLMFAKQARAPLMLQDHKPVPIATYA  835

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            PKFE +F  G+ YDPD ER  + KLK + K+E KGA RE+RKDN FL
Sbjct  836  PKFEADFAPGKHYDPDVERNAVAKLKAQYKKEKKGAMRELRKDNRFL  882



>ref|XP_002541971.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gb|EEP76638.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
Length=896

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 65/109 (60%), Gaps = 2/109 (2%)
 Frame = -1

Query  803  FMPILKLLNELAAQ--NHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKM  630
            F P   +L  L A     +P +L + I+ V   ++ ++ E    R+PL +   KP+ IK 
Sbjct  740  FDPAQAVLKHLMASCAGKLPTVLSDHIQQVYSDVKLRLSEARHSRRPLLLHNHKPLAIKT  799

Query  629  VNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
              PKFE++F   + YDPDRERAE+ KLK   K+E KGA RE+RKD +F+
Sbjct  800  AIPKFEESFNPDKHYDPDRERAELNKLKAEHKRERKGAMRELRKDANFI  848



>ref|XP_003652387.1| hypothetical protein THITE_2113840 [Thielavia terrestris NRRL 
8126]
 gb|AEO66051.1| hypothetical protein THITE_2113840 [Thielavia terrestris NRRL 
8126]
Length=923

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 63/110 (57%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNELAAQ---NHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P L +L  LA+     H+P  L  ++ +    I   ++     R+PL +   +P+ I+
Sbjct  762  FQPALAVLQHLASTPNATHLPPPLTTRLTDTASAIARLLQLARLSRRPLELHHHRPLAIR  821

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFED+F   + YDPDRERAE+ +L+   K+E KGA RE+RKD  FL
Sbjct  822  TYVPKFEDSFDPDKHYDPDRERAELARLRAEHKRERKGALRELRKDAAFL  871



>gb|EQB53783.1| Nop14-like family protein [Colletotrichum gloeosporioides Cg-14]
Length=908

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 65/110 (59%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKL---LNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P L L   LN  A ++  P+ L E+++     ++  ++     R+PL +   KP+ IK
Sbjct  749  FQPALNLVAHLNSKACRSKFPEALGEQVEKSKVKLDRMLKIAQLSRRPLELHHHKPLAIK  808

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFED+F   + YDPDRERAE+ KLK   K+E KGA RE+RKD  F+
Sbjct  809  TFIPKFEDSFDPNKHYDPDRERAEMAKLKAEHKKERKGAMRELRKDAQFM  858



>ref|XP_007279832.1| rRNA maturation protein [Colletotrichum gloeosporioides Nara 
gc5]
 gb|ELA31119.1| rRNA maturation protein [Colletotrichum gloeosporioides Nara 
gc5]
Length=906

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 65/110 (59%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKL---LNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P L L   LN  A ++  P+ L E+++     ++  ++     R+PL +   KP+ IK
Sbjct  747  FQPALNLVAHLNSKACRSKFPEALGEQVEKSKVKLDRMLKIAQLSRRPLELHHHKPLAIK  806

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFED+F   + YDPDRERAE+ KLK   K+E KGA RE+RKD  F+
Sbjct  807  TFIPKFEDSFDPNKHYDPDRERAEMAKLKAEHKKERKGAMRELRKDAQFM  856



>ref|XP_007412912.1| hypothetical protein MELLADRAFT_37772 [Melampsora larici-populina 
98AG31]
 gb|EGG03798.1| hypothetical protein MELLADRAFT_37772 [Melampsora larici-populina 
98AG31]
Length=952

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 69/110 (63%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQ--PLRMRKQKPVPIKM  630
            F  +L L+  +     + ++ + ++K +I+ IE ++    R+RQ  PLR++  +P+PIK 
Sbjct  789  FSTVLSLIKSIDCHTLICEVTKMRLKELIETIETQLATAKRIRQLNPLRLQLHRPIPIKP  848

Query  629  VNPKFEDNFI-KGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
              P+FE  F  K ++++PD  + E+ KLK  +K+E KGA RE+RKDN FL
Sbjct  849  QTPQFESTFTPKQKEFNPDSAQVEVNKLKSLIKKEKKGAMRELRKDNKFL  898



>gb|EHK15639.1| hypothetical protein TRIVIDRAFT_123214, partial [Trichoderma 
virens Gv29-8]
Length=909

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 65/104 (63%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +LK +N  A++ H+P  + EK + + + ++     +   R+PL +   KP+ IK   PKF
Sbjct  760  VLKHVNSKASREHLPVAVSEKAERLEEKLKRMSRVSQLSRRPLELHHHKPLAIKTYIPKF  819

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            E+ F   + YDPDRERAE+ KLK   K+E KGA RE+RKD +F+
Sbjct  820  EETFDPDKHYDPDRERAEMAKLKAEHKKERKGAMRELRKDANFM  863



>gb|EHK40857.1| hypothetical protein TRIATDRAFT_172421, partial [Trichoderma 
atroviride IMI 206040]
Length=901

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 64/104 (62%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +L  +N   ++ H+P    EK++ + + ++     +   R+PL +   KP+ IK   PKF
Sbjct  751  VLGHVNSKPSREHLPAAASEKVERLEEKLKRMSRVSQLSRRPLELHHHKPLSIKTYIPKF  810

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            ED +   + YDPDRERAE+ KLKK  K+E KGA RE+RKD +F+
Sbjct  811  EDTYDPDKHYDPDRERAEMAKLKKEHKKERKGAMRELRKDANFM  854



>gb|EEH06589.1| nucleolar complex protein [Histoplasma capsulatum G186AR]
Length=904

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 69/109 (63%), Gaps = 2/109 (2%)
 Frame = -1

Query  803  FMPILKLLNEL--AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKM  630
            F+P  ++L  L  +  N  P  L ++++ ++  ++  ++++   R+PL +   +P+ IK 
Sbjct  748  FVPANRVLKHLNHSLNNKFPSALSDQLQRILDKLQVLLKQSDLARRPLLLHNHRPLAIKT  807

Query  629  VNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
              PKFE++F   R YDPDRERAE+ KLK   K+E KGA RE+RKD +F+
Sbjct  808  AIPKFEESFNPSRHYDPDRERAELNKLKAEHKRERKGAMRELRKDANFI  856



>ref|XP_003659212.1| hypothetical protein MYCTH_2295937 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO53967.1| hypothetical protein MYCTH_2295937 [Myceliophthora thermophila 
ATCC 42464]
Length=916

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 62/104 (60%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +L+ L   A   H+P+ L  K+ +V   I   ++     R+PL +   +P+ I+   PKF
Sbjct  762  VLQHLTGKANSVHLPEALTSKLTDVNSAITRLLQLARLSRRPLELHHHRPLAIRTYIPKF  821

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            ED+F   + YDPDRERAE+ KLK   K+E KGA RE+RKD  F+
Sbjct  822  EDSFDPDKHYDPDRERAELAKLKAEHKRERKGALRELRKDAAFM  865



>ref|XP_001826654.1| rRNA maturation protein (Nop14) [Aspergillus oryzae RIB40]
 dbj|BAE65521.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=913

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 79/134 (59%), Gaps = 1/134 (1%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +L+ LN  + +  +P ++Q+ +++ +  ++    +    R+PL +   +P+ IK   PKF
Sbjct  763  VLRFLNR-SCKGKIPSVVQDTLQSTLDKLDGHTSKARLTRRPLLLHDHRPLAIKTAIPKF  821

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalaeers  435
            ED F   + YDP+RERAE  +LK   K+E KGA RE+RKD +F+   K +EK     E  
Sbjct  822  EDTFNPDKHYDPNRERAEANRLKAEYKRERKGAMRELRKDANFIAREKLREKKERDAEYE  881

Query  434  eKYGKALAFLQEQE  393
            +KY + +A +Q QE
Sbjct  882  KKYKRLVAEVQNQE  895



>gb|EIT73795.1| nucleolar protein involved in 40S ribosome biogenesis [Aspergillus 
oryzae 3.042]
 gb|KDE75517.1| nucleolar protein [Aspergillus oryzae 100-8]
Length=913

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 79/134 (59%), Gaps = 1/134 (1%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +L+ LN  + +  +P ++Q+ +++ +  ++    +    R+PL +   +P+ IK   PKF
Sbjct  763  VLRFLNR-SCKGKIPSVVQDTLQSTLDKLDGHTSKARLTRRPLLLHDHRPLAIKTAIPKF  821

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalaeers  435
            ED F   + YDP+RERAE  +LK   K+E KGA RE+RKD +F+   K +EK     E  
Sbjct  822  EDTFNPDKHYDPNRERAEANRLKAEYKRERKGAMRELRKDANFIAREKLREKKERDAEYE  881

Query  434  eKYGKALAFLQEQE  393
            +KY + +A +Q QE
Sbjct  882  KKYKRLVAEVQNQE  895



>gb|KIW07965.1| hypothetical protein PV09_01865 [Verruconis gallopava]
Length=834

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 59/86 (69%), Gaps = 3/86 (3%)
 Frame = -1

Query  740  QEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKFEDNFIKGRDYDPDRERAE  561
            Q K+ N +QL+ N+ +     R+PL +   +P+PIK + PKFE++F   R YDPDR+RA+
Sbjct  704  QAKLSNHLQLLLNQSQSK---RRPLALHNHRPLPIKSLVPKFEESFNPDRHYDPDRQRAD  760

Query  560  IRKLKKRVKQEAKGAAREIRKDNHFL  483
              +LKK  K+E KGA RE+RKD +FL
Sbjct  761  TARLKKEYKREKKGAIRELRKDANFL  786



>ref|XP_002385435.1| rRNA maturation protein (Nop14), putative [Aspergillus flavus 
NRRL3357]
 gb|EED45306.1| rRNA maturation protein (Nop14), putative [Aspergillus flavus 
NRRL3357]
Length=913

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 79/134 (59%), Gaps = 1/134 (1%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +L+ LN  + +  +P ++Q+ +++ +  ++    +    R+PL +   +P+ IK   PKF
Sbjct  763  VLRFLNR-SCKGKIPSVVQDTLQSTLDKLDGHTSKARLTRRPLLLHDHRPLAIKTAIPKF  821

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalaeers  435
            ED F   + YDP+RERAE  +LK   K+E KGA RE+RKD +F+   K +EK     E  
Sbjct  822  EDTFNPDKHYDPNRERAEANRLKAEYKRERKGAMRELRKDANFIAREKLREKKERDAEYE  881

Query  434  eKYGKALAFLQEQE  393
            +KY + +A +Q QE
Sbjct  882  KKYKRLVAEVQNQE  895



>ref|XP_001248475.1| hypothetical protein CIMG_02246 [Coccidioides immitis RS]
 gb|EAS36892.3| rRNA maturation protein [Coccidioides immitis RS]
Length=895

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 63/109 (58%), Gaps = 2/109 (2%)
 Frame = -1

Query  803  FMPILKLLNEL--AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKM  630
            F P   +L  L  +    +P  L + ++     +  ++ E  R R+PL +   +P+ IK 
Sbjct  739  FEPARAVLKHLIRSCAGKVPTALSDHMQRTCHSMNAQLAEARRARRPLLLHNHRPLAIKT  798

Query  629  VNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
              PKFE++F   R YDPDRERAE+ KLK   K+E KGA RE+RKD +F+
Sbjct  799  AIPKFEESFNPDRHYDPDRERAELNKLKAEHKRERKGAMRELRKDANFI  847



>ref|XP_001543783.1| conserved hypothetical protein [Histoplasma capsulatum NAm1]
 gb|EDN02965.1| conserved hypothetical protein [Histoplasma capsulatum NAm1]
Length=904

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 67/104 (64%), Gaps = 1/104 (1%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +LK LN  +  N  P  L ++++ ++  ++  ++++   R+PL +   +P+ IK   PKF
Sbjct  754  VLKHLNH-SLNNKSPSTLSDQLQRILDKLQVLLKQSDLARRPLLLHNHRPLAIKTAIPKF  812

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            E++F   R YDPDRERAE+ KLK   K+E KGA RE+RKD +F+
Sbjct  813  EESFNPSRHYDPDRERAELNKLKAEHKRERKGAMRELRKDANFI  856



>emb|CCF32351.1| Nop14-like family protein [Colletotrichum higginsianum]
Length=912

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 68/110 (62%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNELAAQ---NHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P L ++ +L+++   + +P++L +++      +E  +      R+PL +   +P+ IK
Sbjct  753  FQPALDIVTQLSSKPGRSKLPEVLGDQLDKSKLKLERMLRIAQLSRRPLELHHHRPLSIK  812

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFED++   + YDPDRERAE+ KLKK  K+E KGA RE+RKD  F+
Sbjct  813  TYIPKFEDSYDPNKHYDPDRERAEMAKLKKEHKKERKGAMRELRKDAQFM  862



>emb|CDM29234.1| Nop14-like protein [Penicillium roqueforti FM164]
Length=912

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 81/139 (58%), Gaps = 2/139 (1%)
 Frame = -1

Query  803  FMPILKLLNEL--AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKM  630
            F P+  +L  L  + +  +    +E I++ +  I++ + +   +R+PL +   KP+ IK 
Sbjct  760  FTPVRAVLQHLHQSLRGKVYSAAREPIQSTLNKIDSHLAQARLVRRPLFLHDHKPLAIKT  819

Query  629  VNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaal  450
              PKFE+NF   + YDPDRERAE  +LKK  K+E KGA RE+RKD  F+   + +EK   
Sbjct  820  AIPKFEENFNPDKHYDPDRERAESNRLKKEFKRERKGAMRELRKDASFVAREQLREKKER  879

Query  449  aeerseKYGKALAFLQEQE  393
              E  +KY + +A +Q QE
Sbjct  880  DSEYEKKYKRLVAEIQSQE  898



>ref|XP_003051701.1| hypothetical protein NECHADRAFT_37909 [Nectria haematococca mpVI 
77-13-4]
 gb|EEU45988.1| hypothetical protein NECHADRAFT_37909 [Nectria haematococca mpVI 
77-13-4]
Length=907

 Score = 79.0 bits (193),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 63/104 (61%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +LK LN    ++ +P  L E+++ +    E  ++     R+ L +   KP+ IK   PKF
Sbjct  754  VLKHLNSKGCRSRLPPALTERVEKIQAKFERMLKVAQLSRRNLELHHHKPLAIKTYVPKF  813

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            E+ F   + YDPDRERAE+ KLKK  K+E KGA RE+RKD +F+
Sbjct  814  EETFDPDKHYDPDRERAELAKLKKEHKKERKGAMRELRKDANFM  857



>ref|XP_003070785.1| Nop14-like family protein [Coccidioides posadasii C735 delta 
SOWgp]
 gb|EER28640.1| Nop14-like family protein [Coccidioides posadasii C735 delta 
SOWgp]
 gb|EFW22197.1| nucleolar protein 14 [Coccidioides posadasii str. Silveira]
Length=896

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 63/109 (58%), Gaps = 2/109 (2%)
 Frame = -1

Query  803  FMPILKLLNEL--AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKM  630
            F P   +L  L  +    +P  L + ++     +  ++ E  R R+PL +   +P+ IK 
Sbjct  740  FEPARAVLEHLIKSCAGKVPTALSDHMQRTCHNMNAQLAEARRARRPLLLHNHRPLAIKT  799

Query  629  VNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
              PKFE++F   R YDPDRERAE+ KLK   K+E KGA RE+RKD +F+
Sbjct  800  AIPKFEESFNPDRHYDPDRERAELNKLKAEHKRERKGAMRELRKDANFI  848



>ref|XP_009855934.1| hypothetical protein NEUTE1DRAFT_149856 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGO52294.1| hypothetical protein NEUTE1DRAFT_149856 [Neurospora tetrasperma 
FGSC 2508]
Length=928

 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 65/110 (59%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNELAAQNH---MPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P  ++L  L  +++   +P  L +++K+    I   ++     R+PL +   KP+ IK
Sbjct  769  FQPAQRVLQHLTTKSNAAQLPAALVKQLKDTTTSISRLLQLAQVSRRPLELHHHKPLAIK  828

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFED+F   + YDPDRERAE+ KL+   K+E KGA RE+RKD  F+
Sbjct  829  TYVPKFEDSFDPNKHYDPDRERAELAKLRAEHKKERKGALRELRKDAAFM  878



>ref|XP_007827194.1| hypothetical protein PFICI_00422 [Pestalotiopsis fici W106-1]
 gb|ETS86594.1| hypothetical protein PFICI_00422 [Pestalotiopsis fici W106-1]
Length=901

 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 64/110 (58%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNEL---AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P L +LN L   A ++H P  L ++I      +E  ++     R+ L +   +P+ IK
Sbjct  741  FQPALAVLNHLSDKACRSHFPKALNQQIGRSKAKLEGLLQLARMERRNLELHHHRPLAIK  800

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFED+F   + YDPDRERAE  KLK   K+E KGA RE+RKD +F+
Sbjct  801  THVPKFEDSFDPDKHYDPDRERAEANKLKAEHKKERKGAMRELRKDANFM  850



>gb|ELQ33066.1| nucleolar complex protein 14 [Magnaporthe oryzae Y34]
 gb|ELQ61696.1| nucleolar complex protein 14 [Magnaporthe oryzae P131]
Length=885

 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 62/104 (60%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +L  L   A ++H+P  + ++   + + +   +      R+PL +   KPV I+   PKF
Sbjct  733  VLSHLTSKACKSHLPPSIVKEATRLQKHLTASLNSARLSRRPLELHHHKPVAIRTYVPKF  792

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            ED+F   + YDPDRERAE+ KL+   K+E KGA RE+RKD +F+
Sbjct  793  EDSFDPNKHYDPDRERAELAKLRAEHKKERKGAMRELRKDANFM  836



>ref|XP_003710991.1| hypothetical protein MGG_04470 [Magnaporthe oryzae 70-15]
 gb|EHA58379.1| hypothetical protein MGG_04470 [Magnaporthe oryzae 70-15]
Length=897

 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 62/104 (60%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +L  L   A ++H+P  + ++   + + +   +      R+PL +   KPV I+   PKF
Sbjct  745  VLSHLTSKACKSHLPPSIVKEATRLQKHLTASLNSARLSRRPLELHHHKPVAIRTYVPKF  804

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            ED+F   + YDPDRERAE+ KL+   K+E KGA RE+RKD +F+
Sbjct  805  EDSFDPNKHYDPDRERAELAKLRAEHKKERKGAMRELRKDANFM  848



>emb|CCE31017.1| related to NOP14-nuclear and nucleolar protein with possible 
role in ribosome biogenesis [Claviceps purpurea 20.1]
Length=916

 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 64/110 (58%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNELAAQ---NHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P+  +L  + ++   +H+P  + EK + +   +          R+PL +   +P+ IK
Sbjct  755  FAPVTNVLKHVTSKTNRSHLPTSVLEKAEKLAAKLNRMTSLAQISRRPLELHHHRPLAIK  814

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFE+ F   + YDPDRERAE+ KLKK  K+E KGA RE+RKD +F+
Sbjct  815  TYIPKFEETFDPDKHYDPDRERAELAKLKKEHKKERKGAMRELRKDANFM  864



>ref|XP_568888.1| hypothetical protein CNB03110 [Cryptococcus neoformans var. neoformans 
JEC21]
 ref|XP_777274.1| hypothetical protein CNBB2590 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL22627.1| hypothetical protein CNBB2590 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW41581.1| hypothetical protein CNB03110 [Cryptococcus neoformans var. neoformans 
JEC21]
Length=933

 Score = 78.6 bits (192),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = -1

Query  731  IKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKFEDNFIKGRDYDPDRERAEIRK  552
            + + +  +  ++      R+PL ++  KP+PI    P+FE+NF  G+ YDPD ER    K
Sbjct  801  LTSTLTALSKRLSNTLSTRRPLTLQSHKPIPIASYAPRFEENFAPGKHYDPDTERNASAK  860

Query  551  LKKRVKQEAKGAAREIRKDNHFLFG  477
            LK   K+E KGA RE+RKDN FL G
Sbjct  861  LKALYKKERKGAMRELRKDNRFLAG  885



>gb|AFR93321.2| nucleolar protein 14 [Cryptococcus neoformans var. grubii H99]
Length=931

 Score = 78.6 bits (192),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = -1

Query  731  IKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKFEDNFIKGRDYDPDRERAEIRK  552
            + + +  +  ++      R+PL ++  KP+PI    P+FE+NF  G+ YDPD ER    K
Sbjct  799  LTSTLTALSKRLSNTLSTRRPLTLQSHKPIPIASYAPRFEENFAPGKHYDPDTERNASAK  858

Query  551  LKKRVKQEAKGAAREIRKDNHFLFG  477
            LK   K+E KGA RE+RKDN FL G
Sbjct  859  LKALYKKERKGAIRELRKDNRFLAG  883



>gb|EGZ77113.1| Nop14-like protein [Neurospora tetrasperma FGSC 2509]
Length=931

 Score = 78.6 bits (192),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 65/110 (59%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNELAAQNH---MPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P  ++L  L  +++   +P  L +++K+    I   ++     R+PL +   KP+ IK
Sbjct  772  FQPAQRVLQHLTTKSNAAQLPAALVKQLKDTTTSISRLLQLAQVSRRPLELHHHKPLAIK  831

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFED+F   + YDPDRERAE+ KL+   K+E KGA RE+RKD  F+
Sbjct  832  TYVPKFEDSFDPNKHYDPDRERAELAKLRAEHKKERKGALRELRKDAAFM  881



>ref|XP_003351797.1| hypothetical protein SMAC_00342 [Sordaria macrospora k-hell]
 emb|CCC06125.1| unnamed protein product [Sordaria macrospora k-hell]
Length=914

 Score = 78.6 bits (192),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 65/110 (59%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNELAAQNH---MPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P  ++L  L  +++   +P  L +++K+    I   ++     R+PL +   KP+ IK
Sbjct  751  FQPAQRVLQHLTTKSNAAQLPAALVKQLKDTTTSISRLLQLAQVSRRPLELHHHKPLAIK  810

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFED+F   + YDPDRERAE+ KL+   K+E KGA RE+RKD  F+
Sbjct  811  TYVPKFEDSFDPNKHYDPDRERAEMAKLRAEHKKERKGALRELRKDAAFM  860



>gb|KIR94784.1| nucleolar protein 14 [Cryptococcus gattii CBS 10090]
Length=920

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 59/109 (54%), Gaps = 0/109 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
             M  +K + E +    +   L   + + +  +  ++      R+PL ++  KP+PI    
Sbjct  776  MMSPVKQVLEQSKTKKLSSELNTVLTSTLTALSKRLSNTLSTRRPLTLQSHKPIPIASYA  835

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFG  477
            P+FE+NF  G+ YDPD ER    KLK   K+E KGA RE+RKDN FL G
Sbjct  836  PRFEENFAPGKHYDPDTERNASAKLKALYKKERKGAMRELRKDNRFLAG  884



>gb|KIY54636.1| nucleolar protein 14 [Cryptococcus gattii 99/473]
Length=932

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 59/109 (54%), Gaps = 0/109 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
             M  +K + E +    +   L   + + +  +  ++      R+PL ++  KP+PI    
Sbjct  776  MMSPVKQVLEQSKTKKLSSELNTVLTSTLTALSKRLSNTLSTRRPLTLQSHKPIPIASYA  835

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFG  477
            P+FE+NF  G+ YDPD ER    KLK   K+E KGA RE+RKDN FL G
Sbjct  836  PRFEENFAPGKHYDPDTERNASAKLKALYKKERKGAMRELRKDNRFLAG  884



>gb|KGB75700.1| nucleolar protein 14 [Cryptococcus gattii R265]
Length=921

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 59/109 (54%), Gaps = 0/109 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
             M  +K + E +    +   L   + + +  +  ++      R+PL ++  KP+PI    
Sbjct  765  MMSPVKQVLEQSKTKKLSSELNTVLTSTLTALSKRLSNTLSTRRPLTLQSHKPIPIASYA  824

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFG  477
            P+FE+NF  G+ YDPD ER    KLK   K+E KGA RE+RKDN FL G
Sbjct  825  PRFEENFAPGKHYDPDTERNASAKLKALYKKERKGAMRELRKDNRFLAG  873



>gb|KIR71038.1| nucleolar protein 14 [Cryptococcus gattii CA1014]
 gb|KIS00693.1| nucleolar protein 14 [Cryptococcus gattii 2001/935-1]
Length=932

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 59/109 (54%), Gaps = 0/109 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
             M  +K + E +    +   L   + + +  +  ++      R+PL ++  KP+PI    
Sbjct  776  MMSPVKQVLEQSKTKKLSSELNTVLTSTLTALSKRLSNTLSTRRPLTLQSHKPIPIASYA  835

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFG  477
            P+FE+NF  G+ YDPD ER    KLK   K+E KGA RE+RKDN FL G
Sbjct  836  PRFEENFAPGKHYDPDTERNASAKLKALYKKERKGAMRELRKDNRFLAG  884



>gb|KIR25432.1| nucleolar protein 14 [Cryptococcus gattii LA55]
 gb|KIR32709.1| nucleolar protein 14 [Cryptococcus gattii MMRL2647]
Length=932

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 59/109 (54%), Gaps = 0/109 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
             M  +K + E +    +   L   + + +  +  ++      R+PL ++  KP+PI    
Sbjct  776  MMSPVKQVLEQSKTKKLSSELNTVLTSTLTALSKRLSNTLSTRRPLTLQSHKPIPIASYA  835

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFG  477
            P+FE+NF  G+ YDPD ER    KLK   K+E KGA RE+RKDN FL G
Sbjct  836  PRFEENFAPGKHYDPDTERNASAKLKALYKKERKGAMRELRKDNRFLAG  884



>gb|KFA61435.1| hypothetical protein S40285_03442 [Stachybotrys chlorohalonata 
IBT 40285]
Length=912

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 65/111 (59%), Gaps = 5/111 (5%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRL----RQPLRMRKQKPVPI  636
            F P L LL  L   N  P + +E  +   +L ++K+E   RL    R+PL +   KP+ I
Sbjct  753  FKPTLDLLKHLGGPNCRPRLPKELCERTDKL-QSKLERMLRLSQLSRRPLELHHHKPLAI  811

Query  635  KMVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            K   PKFE+ F   + YDPDRERA + KLK   K+E KGA RE+RKD +F+
Sbjct  812  KTYIPKFEETFDPDKHYDPDRERAALAKLKAEHKKERKGAMRELRKDANFM  862



>gb|KIR39361.1| nucleolar protein 14 [Cryptococcus gattii Ram5]
Length=920

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 59/109 (54%), Gaps = 0/109 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
             M  +K + E +    +   L   + + +  +  ++      R+PL ++  KP+PI    
Sbjct  776  MMSPVKQVLEQSKTKKLSSELNTVLTSTLTALSKRLSNTLSTRRPLTLQSHKPIPIASYA  835

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFG  477
            P+FE+NF  G+ YDPD ER    KLK   K+E KGA RE+RKDN FL G
Sbjct  836  PRFEENFAPGKHYDPDTERNASAKLKALYKKERKGAMRELRKDNRFLAG  884



>ref|XP_001594332.1| hypothetical protein SS1G_04139 [Sclerotinia sclerotiorum 1980]
 gb|EDO01664.1| hypothetical protein SS1G_04139 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=915

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 65/110 (59%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNEL---AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P+L +L  L   + ++ + +  Q  I+      +  ++  H  R+PL +   KP+ IK
Sbjct  757  FEPVLTILKHLGSKSCRSKLSESSQTLIRKSRSKFQTMLQLAHLARRPLELHHHKPLAIK  816

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFED++   + YDPDRERAE  KLK   K+E KGA RE+RKD++F+
Sbjct  817  TSIPKFEDSYNPDKHYDPDRERAETAKLKAEHKKERKGAMRELRKDSNFI  866



>ref|XP_009269619.1| putative nucleolar complex protein 14 [Wallemia ichthyophaga 
EXF-994]
 gb|EOQ99631.1| putative nucleolar complex protein 14 [Wallemia ichthyophaga 
EXF-994]
Length=908

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 66/109 (61%), Gaps = 1/109 (1%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F P++  L  +  +  M   ++ K +N +Q + N+V+   + R+PLRM++ K + I  + 
Sbjct  754  FDPLVGSL-RMVEKRGMLGSVKNKTENTLQQLGNQVKFAKQSRRPLRMQQHKQIAINSLV  812

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFG  477
            PKFE+N+   R YDPD +RA   KLK  VK E KGA RE+RKD  F+ G
Sbjct  813  PKFEENYNADRRYDPDHDRAATSKLKAEVKAERKGAIRELRKDAKFIAG  861



>gb|KDQ64193.1| hypothetical protein JAAARDRAFT_116740 [Jaapia argillacea MUCL 
33604]
Length=900

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 71/111 (64%), Gaps = 6/111 (5%)
 Frame = -1

Query  797  PILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPK  618
            PIL++L  +  ++  PD L+ ++ +++  +   ++ + + RQPLR++  KP+PI    PK
Sbjct  746  PILEILQAVEHRSP-PDGLKSQLSSLVDKMSRLLKFSAQSRQPLRLQAHKPIPIPTYIPK  804

Query  617  FE---DNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGV  474
            FE    N+++ RD  PD+ER    KL+K+ KQE KGA RE+RKD  FL GV
Sbjct  805  FEWTSSNYLRNRD--PDQERNAASKLRKQYKQEKKGALRELRKDARFLAGV  853



>ref|XP_006957635.1| Nop14-like protein [Wallemia sebi CBS 633.66]
 gb|EIM22385.1| Nop14-like protein [Wallemia sebi CBS 633.66]
Length=907

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 67/107 (63%), Gaps = 0/107 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F P+++ L+ ++ ++     L+  ++   Q I N+V+   + R+PLRM++ K + I  + 
Sbjct  752  FQPLVEGLDVVSKKDVCGGKLKSHLEKTSQQIRNQVKFAKQARRPLRMQQHKQIAISSLI  811

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            PKFE+N+   + YDPDRERA   KLK  VK E KGA R++RKD  F+
Sbjct  812  PKFEENYNADKRYDPDRERAASSKLKAEVKAERKGALRDLRKDAKFI  858



>gb|EPS26010.1| hypothetical protein PDE_00946 [Penicillium oxalicum 114-2]
Length=910

 Score = 78.2 bits (191),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 63/109 (58%), Gaps = 2/109 (2%)
 Frame = -1

Query  803  FMPILKLLNEL--AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKM  630
            F P+  +L  L    +N +    ++ ++  I  IE  +  + R R+PL +   +P+ IK 
Sbjct  754  FTPVRTVLQHLRQCFKNKLFAAGRDSVQATIDKIEGHLATSSRARRPLLLHNHRPLAIKS  813

Query  629  VNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
              PKFE+NF   + YDPDRERAE  +LK   K+E KGA RE+RKD  F+
Sbjct  814  AIPKFEENFNPDKHYDPDRERAENNRLKAEYKREKKGAMRELRKDASFI  862



>ref|XP_958477.3| rRNA maturation protein [Neurospora crassa OR74A]
 gb|EAA29241.3| rRNA maturation protein [Neurospora crassa OR74A]
 gb|KHE82637.1| hypothetical protein GE21DRAFT_1618 [Neurospora crassa]
Length=911

 Score = 78.2 bits (191),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 65/110 (59%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNELAAQNH---MPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P  ++L  L  +++   +P  L +++K+    I   ++     R+PL +   KP+ IK
Sbjct  752  FQPAQRVLQHLTTKSNAAQLPAALVKQLKDATTSISRLLQLAQVSRRPLELHHHKPLAIK  811

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFED+F   + YDPDRERAE+ KL+   K+E KGA RE+RKD  F+
Sbjct  812  TYVPKFEDSFDPNKHYDPDRERAELAKLRAEHKKERKGALRELRKDAAFM  861



>gb|KFA76612.1| hypothetical protein S40288_08124 [Stachybotrys chartarum IBT 
40288]
Length=912

 Score = 78.2 bits (191),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 65/111 (59%), Gaps = 5/111 (5%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRL----RQPLRMRKQKPVPI  636
            F P L LL  L   N  P + +E  +   +L ++K+E   RL    R+PL +   KP+ I
Sbjct  753  FKPTLDLLKHLGGPNCRPRLPKEFCERTDKL-QSKLERMLRLSQLSRRPLELHHHKPLAI  811

Query  635  KMVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            K   PKFE+ F   + YDPDRERA + KLK   K+E KGA RE+RKD +F+
Sbjct  812  KTYIPKFEETFDPDKHYDPDRERAALAKLKAEHKKERKGAMRELRKDANFM  862



>gb|KFA54889.1| hypothetical protein S40293_08555 [Stachybotrys chartarum IBT 
40293]
Length=912

 Score = 78.2 bits (191),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 65/111 (59%), Gaps = 5/111 (5%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRL----RQPLRMRKQKPVPI  636
            F P L LL  L   N  P + +E  +   +L ++K+E   RL    R+PL +   KP+ I
Sbjct  753  FKPTLDLLKHLGGPNCRPRLPKEFCERTDKL-QSKLERMLRLSQLSRRPLELHHHKPLAI  811

Query  635  KMVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            K   PKFE+ F   + YDPDRERA + KLK   K+E KGA RE+RKD +F+
Sbjct  812  KTYIPKFEETFDPDKHYDPDRERAALAKLKAEHKKERKGAMRELRKDANFM  862



>gb|KIL90840.1| nop14-nuclear and nucleolar protein with possible role in ribosome 
biogenesis [Fusarium avenaceum]
Length=906

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 63/104 (61%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +LK L   A ++ +P    E+I+ +    +  ++     R+ +++   +P+ IK   PKF
Sbjct  751  VLKHLGSKACRSQLPAAFNERIEKLQTKFDRMLKIAQLSRRNVQLHHHRPLAIKTYVPKF  810

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            ED F   + YDPDRERAE+ KLKK  KQE KGA RE+RKD +F+
Sbjct  811  EDTFDPTKHYDPDRERAELAKLKKEHKQERKGAMRELRKDANFM  854



>gb|KEY70595.1| hypothetical protein S7711_02199 [Stachybotrys chartarum IBT 
7711]
Length=934

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 65/111 (59%), Gaps = 5/111 (5%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRL----RQPLRMRKQKPVPI  636
            F P L LL  L   N  P + +E  +   +L ++K+E   RL    R+PL +   KP+ I
Sbjct  775  FKPTLDLLKHLGGPNCRPRLPKEFCERTDKL-QSKLERMLRLSQLSRRPLELHHHKPLAI  833

Query  635  KMVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            K   PKFE+ F   + YDPDRERA + KLK   K+E KGA RE+RKD +F+
Sbjct  834  KTYIPKFEETFDPDKHYDPDRERAALAKLKAEHKKERKGAMRELRKDANFM  884



>gb|EPB82072.1| hypothetical protein HMPREF1544_11200 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=937

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 60/89 (67%), Gaps = 6/89 (7%)
 Frame = -1

Query  731  IKNVIQLIENKVE------ENHRLRQPLRMRKQKPVPIKMVNPKFEDNFIKGRDYDPDRE  570
            IKN++  ++N++E      +  R + PLRM++ +P+PI    PKFE  +   + YDPD E
Sbjct  806  IKNLMSTVKNRLERQIKFCKEKRTKTPLRMQQHRPIPIAQHLPKFEKAYSMDKHYDPDHE  865

Query  569  RAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            R+++ KL+ ++K+E KGA RE+RKDN F+
Sbjct  866  RSQMHKLESQIKKEKKGALRELRKDNQFI  894



>gb|KIR46489.1| nucleolar protein 14 [Cryptococcus gattii CA1280]
Length=932

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -1

Query  743  LQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKFEDNFIKGRDYDPDRERA  564
            L   + + +  +  ++      R+PL ++  KP+PI    P+FE+NF  G+ YDPD ER 
Sbjct  796  LNTVLTSTLTALSKRLNNTLSTRRPLTLQSHKPIPIASYAPRFEENFAPGKHYDPDTERN  855

Query  563  EIRKLKKRVKQEAKGAAREIRKDNHFLFG  477
               KLK   K+E KGA RE+RKDN FL G
Sbjct  856  ASAKLKALYKKERKGAMRELRKDNRFLAG  884



>gb|KIR59974.1| nucleolar protein 14 [Cryptococcus gattii CA1873]
Length=932

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -1

Query  743  LQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKFEDNFIKGRDYDPDRERA  564
            L   + + +  +  ++      R+PL ++  KP+PI    P+FE+NF  G+ YDPD ER 
Sbjct  796  LNTVLTSTLTALSKRLNNTLSTRRPLTLQSHKPIPIASYAPRFEENFAPGKHYDPDTERN  855

Query  563  EIRKLKKRVKQEAKGAAREIRKDNHFLFG  477
               KLK   K+E KGA RE+RKDN FL G
Sbjct  856  ASAKLKALYKKERKGAMRELRKDNRFLAG  884



>ref|XP_002844066.1| nucleolar complex protein 14 [Arthroderma otae CBS 113480]
 gb|EEQ35030.1| nucleolar complex protein 14 [Arthroderma otae CBS 113480]
Length=902

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 64/104 (62%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +L+ + E  ++  +P  L   ++  ++ I+  +    + R+PL +   +P+ IK   PKF
Sbjct  750  VLQHMAESCSKGSIPTALSGHLRQCLKTIKVLLATMKKSRRPLLLHNHRPLAIKSSIPKF  809

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            E++F   R YDPDRERAE+ KLK   K+E KGA RE+RKD +F+
Sbjct  810  EESFNPDRHYDPDRERAELSKLKAEHKRERKGAMRELRKDANFI  853



>gb|EKV11174.1| RRNA maturation protein (Nop14), putative [Penicillium digitatum 
Pd1]
 gb|EKV11876.1| RRNA maturation protein (Nop14), putative [Penicillium digitatum 
PHI26]
Length=909

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 82/139 (59%), Gaps = 2/139 (1%)
 Frame = -1

Query  803  FMPILKLLNEL--AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKM  630
            F P+  +L  L  + ++ +    +E +++ +  I++ + +   +R+PL +   KP+ IK 
Sbjct  757  FTPVRAVLQYLRQSLKSKVYAAAREPLQSTLDKIDSHLAQARLVRRPLFLHDHKPLAIKT  816

Query  629  VNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaal  450
              PKFE+NF   + YDPDRERAE  +LKK  K+E KGA RE+RKD  F+   + +EK   
Sbjct  817  AIPKFEENFNPDKHYDPDRERAESNRLKKEFKRERKGAMRELRKDASFIAREQLREKKER  876

Query  449  aeerseKYGKALAFLQEQE  393
              E  +KY + +A +Q QE
Sbjct  877  DSEYEKKYKRLVAEIQSQE  895



>ref|XP_002568148.1| Pc21g11160 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP96013.1| Pc21g11160 [Penicillium rubens Wisconsin 54-1255]
Length=908

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 81/139 (58%), Gaps = 2/139 (1%)
 Frame = -1

Query  803  FMPILKLLNEL--AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKM  630
            F P+  +L  L  + +  +    QE I++ +  I++ + +   +R+PL +   KP+ IK 
Sbjct  756  FTPVRAVLQYLRQSLKAKVYAAAQEPIQSNLDKIDSHLAQARLVRRPLFLHDHKPLAIKT  815

Query  629  VNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaal  450
              PKFE+NF   + YDPDRERAE  +LKK  K+E KGA RE+RKD  F+   + +EK   
Sbjct  816  AIPKFEENFNPDKHYDPDRERAESNRLKKEFKRERKGAMRELRKDASFVAREQLREKKER  875

Query  449  aeerseKYGKALAFLQEQE  393
              E  +KY + +A +Q QE
Sbjct  876  DAEYEKKYKRLVAEIQSQE  894



>ref|XP_006963586.1| hypothetical protein TRIREDRAFT_46607 [Trichoderma reesei QM6a]
 gb|EGR50209.1| hypothetical protein TRIREDRAFT_46607 [Trichoderma reesei QM6a]
Length=908

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 64/104 (62%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +L  +N  + + H+P  + E+ + + + ++     +   R+PL +   KP+ IK   PKF
Sbjct  760  VLNHINSKSQREHLPAAVSERSERLEEKLKRMSRVSQISRRPLELHHHKPLAIKTYIPKF  819

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            E+ F   + YDPDRERAE+ KLKK  K+E KGA RE+RKD +F+
Sbjct  820  EETFDPDKHYDPDRERAELAKLKKEHKKERKGAMRELRKDANFM  863



>ref|XP_007798795.1| putative nucleolar complex protein [Eutypa lata UCREL1]
 gb|EMR62121.1| putative nucleolar complex protein [Eutypa lata UCREL1]
Length=752

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = -1

Query  770  AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKFEDNFIKGR  591
            A +  +P+ + ++I  +   ++  +   H  R+ + +   +P+ IKM  PKFED F   R
Sbjct  605  ACRTELPEAMNDRIAKLHAKMQRMLRVAHMSRRTVELHHHRPLAIKMAVPKFEDTFDPNR  664

Query  590  DYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaalaeerseKYGKALA  411
             YDPDR+RAE+ KLKK  K+E KGA RE+RKD  F+   K + K        +KY + +A
Sbjct  665  HYDPDRDRAELAKLKKEHKKERKGAMRELRKDAQFVAREKLRAKKEKDAAYEKKYKRLVA  724

Query  410  FLQEQE  393
             +Q +E
Sbjct  725  EIQSEE  730



>gb|ETS03928.1| putative rRNA maturation protein [Trichoderma reesei RUT C-30]
Length=904

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 64/104 (62%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +L  +N  + + H+P  + E+ + + + ++     +   R+PL +   KP+ IK   PKF
Sbjct  750  VLNHINSKSQREHLPAAVSERSERLEEKLKRMSRVSQISRRPLELHHHKPLAIKTYIPKF  809

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            E+ F   + YDPDRERAE+ KLKK  K+E KGA RE+RKD +F+
Sbjct  810  EETFDPDKHYDPDRERAELAKLKKEHKKERKGAMRELRKDANFM  853



>gb|KDE05828.1| hypothetical protein MVLG_03772 [Microbotryum violaceum p1A1 
Lamole]
Length=1082

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 65/109 (60%), Gaps = 1/109 (1%)
 Frame = -1

Query  803   FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
             F P+ +++++  A+  +P  L+  +  +   ++  +  +   RQPL ++  KP+PI    
Sbjct  922   FDPVQQIVSKALAKP-LPKALETSLTTLQGSLKRMLNLSRSSRQPLTLQHHKPIPIATYI  980

Query  623   PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFG  477
             PKF++ F   R +DPD ER E  KL+  VK+E KGA RE+RKDN FL G
Sbjct  981   PKFDEGFNPNRRFDPDTERNEANKLRSLVKKEKKGAIRELRKDNRFLAG  1029



>dbj|GAA89375.1| rRNA maturation protein [Aspergillus kawachii IFO 4308]
Length=919

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 67/112 (60%), Gaps = 5/112 (4%)
 Frame = -1

Query  803  FMPILKLLNELAA-----QNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVP  639
            F P+  +LN L +     +  +P  +++ I++ +  +  ++ +    R+PL +   +P+ 
Sbjct  760  FTPVQNVLNHLRSSLKGNKKLIPTQVRDTIQSTLDKVTTQLSQAKLTRRPLLLHNHRPLA  819

Query  638  IKMVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            IK   PKFE++F   + YDPDRERAE  +LK   K+E KGA RE+RKD +F+
Sbjct  820  IKTAIPKFEESFNPDKHYDPDRERAESNRLKAEYKRERKGAMRELRKDANFI  871



>emb|CCA76325.1| related to NOP14-nuclear and nucleolar protein with possible 
role in ribosome biogenesis [Piriformospora indica DSM 11827]
Length=684

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 86/141 (61%), Gaps = 7/141 (5%)
 Frame = -1

Query  803  FMPILKLLNELAA--QNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKM  630
            + PIL++L+ + +  ++ + D  Q ++  V+  +   ++   + R+PL ++  KP+PI  
Sbjct  526  YDPILQILHSIQSNCRSRLSDTTQSRLDAVVDHVSRLLKFARQARRPLFLQDHKPIPIAT  585

Query  629  VNPKFE---DNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekek  459
              PKF+    ++I  R++DPD ERA++ KLK + ++E KGA RE+RKDN FL GV+++ +
Sbjct  586  YIPKFDAHSSSYI--RNHDPDAERAQLAKLKAQHRKEKKGAMRELRKDNRFLAGVQQERQ  643

Query  458  aalaeerseKYGKALAFLQEQ  396
                +E   +  KA A L+ +
Sbjct  644  EKKDQEYKARMAKAFAGLESE  664



>ref|XP_001908693.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP69366.1| unnamed protein product [Podospora anserina S mat+]
 emb|CDP23387.1| Putative nucleolar complex protein 14 [Podospora anserina S mat+]
Length=912

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -1

Query  761  NHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKFEDNFIKGRDYD  582
            + +P  L   I+++ Q +   ++ +   R+PL +   +P+ I+   PKFED+F   + YD
Sbjct  772  SSIPKSLSPAIQSLQQHLTRLLQISRLSRRPLELHHHRPLAIRTYIPKFEDSFDPNKHYD  831

Query  581  PDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            PDRERAE+ KLKK  K+E KGA RE+RKDN F+
Sbjct  832  PDRERAELAKLKKEHKRERKGALRELRKDNAFM  864



>gb|KIR85614.1| nucleolar protein 14 [Cryptococcus gattii IND107]
Length=932

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -1

Query  743  LQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKFEDNFIKGRDYDPDRERA  564
            L     + +  +  ++      R+PL ++  KP+PI    P+FE+NF  G+ YDPD ER 
Sbjct  796  LNTVFTSTLTALSKRLNNTLSTRRPLTLQSHKPIPIASYAPRFEENFAPGKHYDPDTERN  855

Query  563  EIRKLKKRVKQEAKGAAREIRKDNHFLFG  477
               KLK   K+E KGA RE+RKDN FL G
Sbjct  856  ASAKLKALYKKERKGAMRELRKDNRFLAG  884



>emb|CCU78989.1| rRNA maturation protein/Nop14 [Blumeria graminis f. sp. hordei 
DH14]
Length=900

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 67/111 (60%), Gaps = 5/111 (5%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEE---NHRL-RQPLRMRKQKPVPI  636
            F+P L+++  L+     P I  E I+N+I+ +  K+E      +L R+PL +   +P+ I
Sbjct  742  FLPTLEIVKHLSDHQCHP-IFPENIQNLIEKLHQKLETLINKAKLQRRPLELHHHRPLAI  800

Query  635  KMVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            K   PKFE+NF   R YDPD+ R E+ KLKK  K+E KGA RE+RKD   L
Sbjct  801  KTSLPKFEENFNPERHYDPDKTRTEMAKLKKEHKREKKGAIRELRKDAKIL  851



>gb|KGO43856.1| Nop14-like protein [Penicillium expansum]
 gb|KGO52179.1| Nop14-like protein [Penicillium expansum]
 gb|KGO63217.1| Nop14-like protein [Penicillium expansum]
Length=909

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 81/139 (58%), Gaps = 2/139 (1%)
 Frame = -1

Query  803  FMPILKLLNEL--AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKM  630
            F P+  +L  L  + +  +    +E I++ +  I++ + +   +R+PL +   KP+ IK 
Sbjct  757  FSPVRAVLQYLRQSLKGKVYAAAREPIQSTLGKIDSHLAQARLVRRPLFLHDHKPLAIKT  816

Query  629  VNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaal  450
              PKFE+NF   + YDPDRERAE  +LKK  K+E KGA RE+RKD  F+   + +EK   
Sbjct  817  AIPKFEENFNPDKHYDPDRERAESNRLKKEFKRERKGAMRELRKDASFVAREQLREKKER  876

Query  449  aeerseKYGKALAFLQEQE  393
              E  +KY + +A +Q QE
Sbjct  877  DSEYEKKYKRLVAEIQSQE  895



>ref|XP_011326664.1| hypothetical protein FGSG_13033 [Fusarium graminearum PH-1]
 gb|ESU13157.1| hypothetical protein FGSG_13033 [Fusarium graminearum PH-1]
Length=848

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 64/104 (62%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +LK LN  A +  +P  L E+++ ++   +  ++     R+ + +   +P+ IK   PKF
Sbjct  695  VLKHLNGKACRPQLPTALNERVEKLLAKFDRMLQVAQLSRRNVELHHHRPLAIKTYIPKF  754

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            E+ F   + YDPDRERAE+ KLKK  K+E KGA RE+RKD +F+
Sbjct  755  EETFDPDKHYDPDRERAEMAKLKKEHKRERKGALRELRKDANFM  798



>gb|EER40770.1| nucleolar complex protein [Histoplasma capsulatum H143]
 gb|EGC47391.1| nucleolar complex protein [Histoplasma capsulatum H88]
Length=904

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 68/112 (61%), Gaps = 8/112 (7%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHM-----PDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVP  639
            F P  ++L  L   NH      P  L ++++ ++  ++  ++++   R+PL +   +P+ 
Sbjct  748  FAPANRVLKHL---NHSLNIKSPSTLSDQMQRILNKLQVLLKQSDLARRPLLLHNHRPLA  804

Query  638  IKMVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            IK   PKFE++F   R YDPDRERAE+ KLK   K+E KGA RE+RKD +F+
Sbjct  805  IKTAIPKFEESFNPSRHYDPDRERAELNKLKAEHKRERKGAMRELRKDANFI  856



>ref|XP_003005157.1| nucleolar complex protein [Verticillium alfalfae VaMs.102]
 gb|EEY18654.1| nucleolar complex protein [Verticillium alfalfae VaMs.102]
Length=897

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 66/109 (61%), Gaps = 2/109 (2%)
 Frame = -1

Query  803  FMPILKLLNELAA--QNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKM  630
            F P L+++++L     + +P  L ++++ VI  +          R+PL +   +P+ IKM
Sbjct  738  FGPALEMISQLTKPKNSQLPPTLVDQLEKVILKLRILSNSARLARRPLELHHHRPLAIKM  797

Query  629  VNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
              PKFED+F   + YDPDR+RAE+ KL+   K+E KGA RE+RKD  F+
Sbjct  798  GIPKFEDSFDPNKHYDPDRDRAELAKLRAEHKRERKGAMRELRKDARFM  846



>gb|KFH47867.1| nucleolar complex protein-like protein [Acremonium chrysogenum 
ATCC 11550]
Length=908

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 62/106 (58%), Gaps = 0/106 (0%)
 Frame = -1

Query  800  MPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNP  621
            + + K L+    Q H+P  L ++ + +   +E  +      R+PL +   +P+ IK   P
Sbjct  753  LEVAKHLSSQKCQGHLPRQLSDRAEKLQTKLERMMRLATLARRPLELHHHRPLAIKTYIP  812

Query  620  KFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            KFED F   + YDPDRERAE+ KL+   K+E KGA RE+RKD +F+
Sbjct  813  KFEDQFDPDKHYDPDRERAELAKLRAEHKKERKGALRELRKDANFM  858



>ref|XP_009649045.1| nucleolar complex protein [Verticillium dahliae VdLs.17]
 gb|EGY22865.1| nucleolar complex protein [Verticillium dahliae VdLs.17]
Length=915

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 66/109 (61%), Gaps = 2/109 (2%)
 Frame = -1

Query  803  FMPILKLLNELAA--QNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKM  630
            F P L+++++L     + +P  L ++++ VI  +          R+PL +   +P+ IKM
Sbjct  756  FSPALEMISQLTKPKNSQLPPALVDQLEKVILKLRILSNSARLARRPLELHHHRPLAIKM  815

Query  629  VNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
              PKFED+F   + YDPDR+RAE+ KL+   K+E KGA RE+RKD  F+
Sbjct  816  GIPKFEDSFDPNKHYDPDRDRAELAKLRAEHKRERKGAMRELRKDARFM  864



>ref|XP_009256128.1| hypothetical protein FPSE_04735 [Fusarium pseudograminearum CS3096]
 gb|EKJ75023.1| hypothetical protein FPSE_04735 [Fusarium pseudograminearum CS3096]
Length=904

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 64/104 (62%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +LK LN  A +  +P  L E+++ ++   +  ++     R+ + +   +P+ IK   PKF
Sbjct  751  VLKHLNGKACRPQLPTALNERVEKLLAKFDRMLQVAQLSRRNVELHHHRPLAIKTYIPKF  810

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            E+ F   + YDPDRERAE+ KLKK  K+E KGA RE+RKD +F+
Sbjct  811  EETFDPDKHYDPDRERAEMAKLKKEHKRERKGALRELRKDANFM  854



>gb|EYE95936.1| putative rRNA maturation protein [Aspergillus ruber CBS 135680]
Length=909

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 63/109 (58%), Gaps = 3/109 (3%)
 Frame = -1

Query  803  FMPILKLLNELA--AQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKM  630
            F P    LN L     +  P I ++ +++ +  +   +  +H  R+PL +   KP+ IK 
Sbjct  754  FEPAQATLNHLCKFTTSSAPSI-RDTLQSTLDKLSTNLSNSHLSRRPLFLHNHKPLAIKT  812

Query  629  VNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
              PKFE++F   + YDPDRERAE  +L+   K+E KGA RE+RKD +F+
Sbjct  813  AIPKFEESFNPDKHYDPDRERAEANRLRTEYKRERKGALRELRKDANFV  861



>emb|CEF83827.1| unnamed protein product [Fusarium graminearum]
Length=904

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 64/104 (62%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +LK LN  A +  +P  L E+++ ++   +  ++     R+ + +   +P+ IK   PKF
Sbjct  751  VLKHLNGKACRPQLPTALNERVEKLLAKFDRMLQVAQLSRRNVELHHHRPLAIKTYIPKF  810

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            E+ F   + YDPDRERAE+ KLKK  K+E KGA RE+RKD +F+
Sbjct  811  EETFDPDKHYDPDRERAEMAKLKKEHKRERKGALRELRKDANFM  854



>gb|EYB23853.1| hypothetical protein FG05_13033 [Fusarium graminearum]
Length=894

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 64/104 (62%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +LK LN  A +  +P  L E+++ ++   +  ++     R+ + +   +P+ IK   PKF
Sbjct  741  VLKHLNGKACRPQLPTALNERVEKLLAKFDRMLQVAQLSRRNVELHHHRPLAIKTYIPKF  800

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            E+ F   + YDPDRERAE+ KLKK  K+E KGA RE+RKD +F+
Sbjct  801  EETFDPDKHYDPDRERAEMAKLKKEHKRERKGALRELRKDANFM  844



>ref|XP_007862084.1| Nop14-like protein [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ58971.1| Nop14-like protein [Gloeophyllum trabeum ATCC 11539]
Length=908

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 69/113 (61%), Gaps = 6/113 (5%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            + PIL++L  + +Q  +P  L+E++   I +    ++   + R+PL+++  KP+PI    
Sbjct  752  YDPILEVLQSVESQR-LPQSLKERLSTSIDMFTRLLKFARQARRPLQLQAHKPIPIPSYI  810

Query  623  PKFED---NFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGV  474
            PKFE    N+++ RD  PD ER E  KL+++ KQE KGA RE+RKD  FL  V
Sbjct  811  PKFESSSSNYLRNRD--PDHERNEAAKLRRQYKQEKKGALRELRKDTRFLAEV  861



>gb|EPQ64768.1| hypothetical protein BGT96224_504 [Blumeria graminis f. sp. tritici 
96224]
Length=903

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 66/110 (60%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNELAA-QNHM--PDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F+P L+++ +++  Q H+  P+  Q  IK + Q +E    +    R+PL +   +P+ IK
Sbjct  745  FLPALEIVQQISDYQCHLIFPETTQNLIKKLHQKLETLTNKAKLQRRPLELHHHRPLAIK  804

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFE+NF   R YDPD+ R E+ KLKK  K+E KGA RE+RKD   L
Sbjct  805  TSLPKFEENFNPERHYDPDKTRTEMAKLKKEHKREKKGAIRELRKDAKIL  854



>ref|XP_002793148.1| nucleolar complex protein [Paracoccidioides sp. 'lutzii' Pb01]
 gb|EEH33628.1| nucleolar complex protein [Paracoccidioides sp. 'lutzii' Pb01]
Length=906

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 67/104 (64%), Gaps = 1/104 (1%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +LK L+E +  N+    L ++++ +   ++  ++++   R+PL + K +P+ IK   PKF
Sbjct  756  VLKHLSE-SINNNFSSTLSDQLRRICDKLQALLKQSDLARRPLLLHKHRPLAIKTAIPKF  814

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            E++F   R YDPDRERAE+ KLK   K+E K A RE+RKD +F+
Sbjct  815  EESFNPHRHYDPDRERAELNKLKAEHKRERKWAMRELRKDANFI  858



>gb|ERS98599.1| hypothetical protein HMPREF1624_05386 [Sporothrix schenckii ATCC 
58251]
Length=981

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 59/101 (58%), Gaps = 0/101 (0%)
 Frame = -1

Query  785  LLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKFEDN  606
            L N  A ++ +P  L +++  +   I+      H  R+PL +   +P+ I+   P+FED 
Sbjct  834  LRNTTACRSQLPAPLNKEVDRLAAQIDAAQRLAHLARRPLELHHHRPLAIRTFVPRFEDA  893

Query  605  FIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            F   + YDP+RERAE  KL+   K+E KGA RE+RKD HF+
Sbjct  894  FDPDKHYDPNRERAEAAKLQAEFKRERKGALRELRKDAHFM  934



>ref|XP_002392233.1| hypothetical protein MPER_08226 [Moniliophthora perniciosa FA553]
 gb|EEB93163.1| hypothetical protein MPER_08226 [Moniliophthora perniciosa FA553]
Length=182

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 65/111 (59%), Gaps = 2/111 (2%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F P+L++   L       D+ Q K+ +V  +I   ++  H+ R+PL +++ KP+PI    
Sbjct  26   FEPLLEICQNLEIGKLGKDV-QTKLSSVTDMIARLLKFAHQSRRPLILQEHKPIPIPSYV  84

Query  623  PKFEDNFIKG-RDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGV  474
            P+FE       R  DPDRE+ E+ KL+ + K+E KGA RE+RKD  FL GV
Sbjct  85   PRFESTSSSYLRAQDPDREKNELNKLRAQYKKERKGAIRELRKDARFLAGV  135



>ref|XP_010758451.1| hypothetical protein PADG_02435 [Paracoccidioides brasiliensis 
Pb18]
 gb|EEH46337.1| hypothetical protein PADG_02435 [Paracoccidioides brasiliensis 
Pb18]
Length=906

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 68/109 (62%), Gaps = 2/109 (2%)
 Frame = -1

Query  803  FMPILKLLNELAAQ--NHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKM  630
            F P  ++L  L+    N++   L ++++ +   ++  ++++   R+PL +   +P+ IK 
Sbjct  750  FSPANRVLKHLSKSINNNLSSTLSDQLRRICDKLQALLKQSDLARRPLVLHNHRPLAIKT  809

Query  629  VNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
              PKFE++F   R YDPDRERA++ KLK   K+E KGA RE+RKD +F+
Sbjct  810  AIPKFEESFNPHRHYDPDRERAKLNKLKAEHKRERKGAMRELRKDANFI  858



>gb|KGO72282.1| Nop14-like protein [Penicillium italicum]
Length=910

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 81/139 (58%), Gaps = 2/139 (1%)
 Frame = -1

Query  803  FMPILKLLNEL--AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKM  630
            F P+  +L  L  + +  +    +E I++ +  I++ + +   +R+PL +   KP+ IK 
Sbjct  758  FTPVRAVLQYLRQSLKGKVYAAAREPIQSNLDKIDSHLAQARLVRRPLFLHDHKPLAIKT  817

Query  629  VNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaal  450
              PKFE+NF   + YDPDRERAE  +LKK  K+E KGA RE+RKD  F+   + +EK   
Sbjct  818  AIPKFEENFNPDKHYDPDRERAESNRLKKEFKRERKGAMRELRKDASFVAREQLREKKER  877

Query  449  aeerseKYGKALAFLQEQE  393
              E  +KY + +A +Q QE
Sbjct  878  DSEYEKKYKRLVAEIQSQE  896



>gb|KDN66972.1| putative Nop14-like family protein [Colletotrichum sublineola]
Length=912

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 66/110 (60%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNELAAQ---NHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P L ++  L ++   + +P+ L E++      ++  ++     R+PL +   +P+ IK
Sbjct  753  FQPALDVVAHLGSKVSRSKLPEALGEQLDKSKLKLDRMLKIAQLSRRPLELHHHRPLAIK  812

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFED++   + YDPDRERAE+ KLKK  K+E KGA RE+RKD  F+
Sbjct  813  TYIPKFEDSYDPNKHYDPDRERAEMAKLKKEHKKERKGAMRELRKDAQFM  862



>emb|CEP08449.1| hypothetical protein [Parasitella parasitica]
Length=936

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 63/106 (59%), Gaps = 6/106 (6%)
 Frame = -1

Query  782  LNELAAQNHMPDILQEKIKNVIQLIENKVE------ENHRLRQPLRMRKQKPVPIKMVNP  621
            L+ L   N+        I N++  I N++E      +  R + PLRM++ +P+PI    P
Sbjct  788  LDILECLNYQEIAWHSDITNLLNTINNRLERQVKFCKEKRTKTPLRMQQHRPIPIAQHLP  847

Query  620  KFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            KFE  +   + YDPD ER+++ KL+ ++K+E KGA RE+R+DN F+
Sbjct  848  KFEKAYSMDKHYDPDHERSQMHKLESQIKKEKKGALRELRRDNQFI  893



>gb|EEH17482.1| hypothetical protein PABG_00045 [Paracoccidioides brasiliensis 
Pb03]
Length=906

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 68/109 (62%), Gaps = 2/109 (2%)
 Frame = -1

Query  803  FMPILKLLNELAAQ--NHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKM  630
            F P  ++L  L+    N++   L ++++ +   ++  ++++   R+PL +   +P+ IK 
Sbjct  750  FSPANRVLKHLSKSINNNLSSTLSDQLRRICDKLQALLKQSDLARRPLVLHNHRPLAIKT  809

Query  629  VNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
              PKFE++F   R YDPDRERA++ KLK   K+E KGA RE+RKD +F+
Sbjct  810  AIPKFEESFNPHRHYDPDRERAKLNKLKAEHKRERKGAMRELRKDANFI  858



>gb|KFZ16950.1| hypothetical protein V501_01989 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=920

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 61/110 (55%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNEL---AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P LK+L  L   A + H+P      +      +   + +    R+PL +   KP+ IK
Sbjct  762  FSPALKVLKHLGSKACREHLPRSTTACVTRTSTKLTVLLNQARLSRRPLELHHHKPLAIK  821

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFE++F   + YDPDRERAE  KLK   K+E KGA RE+RKD +F+
Sbjct  822  TSIPKFEESFNPDKHYDPDRERAESSKLKAEHKRERKGAMRELRKDANFI  871



>gb|EZF31560.1| hypothetical protein H101_04828 [Trichophyton interdigitale H6]
Length=902

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 63/104 (61%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +LK + +   +  +P  L   ++  ++ I+  +    + R+PL +   +P+ IK   PKF
Sbjct  750  VLKHVIDSCPKTSLPSALSTHLRRSLKTIKALLVSCKKDRRPLLLHNHRPLAIKSSIPKF  809

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            E++F   R YDPDRERAE+ KLK   K+E KGA RE+RKD +F+
Sbjct  810  EESFNPDRHYDPDRERAELSKLKAEHKREKKGAMRELRKDANFI  853



>gb|EQL31424.1| hypothetical protein BDFG_06246 [Blastomyces dermatitidis ATCC 
26199]
Length=904

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 66/109 (61%), Gaps = 2/109 (2%)
 Frame = -1

Query  803  FMPILKLLNEL--AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKM  630
            F P  ++L  L  +  N  P  L ++++     ++  ++++   R+PL +   +P+ IK 
Sbjct  748  FAPANRVLKYLTKSLNNKTPRTLYDQLQRTCDKLQALLKQSDLGRRPLLLHNHRPLAIKT  807

Query  629  VNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
              PKFE++F   R YDPDRERAE+ KLK   K+E KGA RE+RKD +F+
Sbjct  808  AIPKFEESFNPSRHYDPDRERAELNKLKAEHKRERKGAMRELRKDANFI  856



>gb|KIH87812.1| nucleolar protein 14 [Sporothrix brasiliensis 5110]
Length=981

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 59/101 (58%), Gaps = 0/101 (0%)
 Frame = -1

Query  785  LLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKFEDN  606
            L N  A ++ +P  L +++  +   I+      H  R+PL +   +P+ I+   P+FED 
Sbjct  834  LRNTAACRSQLPAPLNKEVDRLAAQIDAAQRLAHLARRPLELHHHRPLAIRTFVPRFEDA  893

Query  605  FIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            F   + YDP+RERAE  KL+   K+E KGA RE+RKD HF+
Sbjct  894  FDPDKHYDPNRERAEAAKLQAEFKRERKGALRELRKDAHFM  934



>ref|XP_002628096.1| rRNA maturation protein [Blastomyces dermatitidis SLH14081]
 gb|EEQ72774.1| rRNA maturation protein [Blastomyces dermatitidis SLH14081]
Length=904

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 66/109 (61%), Gaps = 2/109 (2%)
 Frame = -1

Query  803  FMPILKLLNEL--AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKM  630
            F P  ++L  L  +  N  P  L ++++     ++  ++++   R+PL +   +P+ IK 
Sbjct  748  FAPANRVLKYLTKSLNNKTPRTLYDQLQRTCDKLQALLKQSDLGRRPLLLHNHRPLAIKT  807

Query  629  VNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
              PKFE++F   R YDPDRERAE+ KLK   K+E KGA RE+RKD +F+
Sbjct  808  AIPKFEESFNPSRHYDPDRERAELNKLKAEHKRERKGAMRELRKDANFI  856



>gb|EFQ26355.1| Nop14-like family protein [Colletotrichum graminicola M1.001]
Length=911

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 65/110 (59%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNELAAQNH---MPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P   ++  L +++    +P+ L E++      +E  ++     R+PL +   +P+ IK
Sbjct  752  FQPAFDIVAHLGSKSSRSKLPEALGEQLDKSKLKLERMLKIAQLSRRPLELHHHRPLAIK  811

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFED++   + YDPDRERAE+ KLKK  K+E KGA RE+RKD  F+
Sbjct  812  TYIPKFEDSYDPNKHYDPDRERAEMAKLKKEHKKERKGAMRELRKDAQFM  861



>gb|EGE81696.1| rRNA maturation protein [Blastomyces dermatitidis ATCC 18188]
Length=904

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 66/109 (61%), Gaps = 2/109 (2%)
 Frame = -1

Query  803  FMPILKLLNEL--AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKM  630
            F P  ++L  L  +  N  P  L ++++     ++  ++++   R+PL +   +P+ IK 
Sbjct  748  FAPANRVLKYLTKSLNNKTPRTLYDQLQRTCDKLQALLKQSDLGRRPLLLHNHRPLAIKT  807

Query  629  VNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
              PKFE++F   R YDPDRERAE+ KLK   K+E KGA RE+RKD +F+
Sbjct  808  AIPKFEESFNPSRHYDPDRERAELNKLKAEHKRERKGAMRELRKDANFI  856



>gb|KFY73048.1| hypothetical protein V499_06866 [Pseudogymnoascus pannorum VKM 
F-103]
Length=920

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 61/110 (55%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNEL---AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P LK+L  L   A + H+P      +      +   + +    R+PL +   KP+ IK
Sbjct  762  FSPALKVLKHLGSKACREHLPRSTTACVTRTSTKLTVLLNQARLSRRPLELHHHKPLAIK  821

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFE++F   + YDPDRERAE  KLK   K+E KGA RE+RKD +F+
Sbjct  822  TSIPKFEESFNPDKHYDPDRERAESSKLKAEHKRERKGAMRELRKDANFI  871



>gb|EEQ88893.1| rRNA maturation protein [Blastomyces dermatitidis ER-3]
Length=904

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 66/109 (61%), Gaps = 2/109 (2%)
 Frame = -1

Query  803  FMPILKLLNEL--AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKM  630
            F P  ++L  L  +  N  P  L ++++     ++  ++++   R+PL +   +P+ IK 
Sbjct  748  FAPANRVLKYLTKSLNNKTPRTLYDQLQRTCDKLQALLKQSDLGRRPLLLHNHRPLAIKT  807

Query  629  VNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
              PKFE++F   R YDPDRERAE+ KLK   K+E KGA RE+RKD +F+
Sbjct  808  AIPKFEESFNPSRHYDPDRERAELNKLKAEHKRERKGAMRELRKDANFI  856



>gb|KIR54334.1| nucleolar protein 14 [Cryptococcus gattii Ru294]
Length=932

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -1

Query  743  LQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKFEDNFIKGRDYDPDRERA  564
            L   + + +  +  ++      R+PL ++  KP+PI    P+FE++F  G+ YDPD ER 
Sbjct  796  LNTVLTSTLTALSKRLNNTLSTRRPLTLQSHKPIPIASYAPRFEESFAPGKHYDPDTERN  855

Query  563  EIRKLKKRVKQEAKGAAREIRKDNHFLFG  477
               KLK   K+E KGA RE+RKDN FL G
Sbjct  856  ASAKLKALYKKERKGAMRELRKDNRFLAG  884



>gb|KFY01512.1| hypothetical protein V490_00869 [Pseudogymnoascus pannorum VKM 
F-3557]
Length=919

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 61/110 (55%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNEL---AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P LK+L  L   A + H+P      +      +   + +    R+PL +   KP+ IK
Sbjct  761  FSPALKVLKHLGSKACREHLPRSTTALVTRTSTKLTVLLNQARLARRPLELHHHKPLAIK  820

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFE++F   + YDPDRERAE  KLK   K+E KGA RE+RKD +F+
Sbjct  821  TSIPKFEESFNPDKHYDPDRERAESSKLKAEHKRERKGAMRELRKDANFI  870



>ref|XP_007594811.1| Nop14-like family protein [Colletotrichum fioriniae PJ7]
 gb|EXF81536.1| Nop14-like family protein [Colletotrichum fioriniae PJ7]
Length=913

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 66/110 (60%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNELAAQNH---MPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P L ++  L++++     P+ L E++      +E  ++     ++PL +   +P+ IK
Sbjct  754  FQPALDIVAHLSSKSSRSKFPEALGEQLAKSKLKMERMLKIAQLSKRPLELHHHRPLAIK  813

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFED++   + YDPDRERAE+ KLKK  K+E KGA RE+RKD  F+
Sbjct  814  TFIPKFEDSYDPNKHYDPDRERAEMAKLKKEHKKERKGAMRELRKDAQFM  863



>gb|KFY49104.1| hypothetical protein V495_00752 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY55417.1| hypothetical protein V497_06971 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=919

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 61/110 (55%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNEL---AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P LK+L  L   A + H+P      +      +   + +    R+PL +   KP+ IK
Sbjct  761  FSPALKVLKHLGSKACREHLPRSTTALVTRTSTKLTVLLNQARLARRPLELHHHKPLAIK  820

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFE++F   + YDPDRERAE  KLK   K+E KGA RE+RKD +F+
Sbjct  821  TSIPKFEESFNPDKHYDPDRERAESSKLKAEHKRERKGAMRELRKDANFI  870



>ref|XP_003024461.1| hypothetical protein TRV_01424 [Trichophyton verrucosum HKI 0517]
 gb|EFE43850.1| hypothetical protein TRV_01424 [Trichophyton verrucosum HKI 0517]
Length=892

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 63/104 (61%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +++ + E   +  +P  L   ++  ++ I+  +    R R+PL +   +P+ IK   PKF
Sbjct  740  VIQHVIESCPKAALPSALSTHLRRSLKTIKALLASCKRDRRPLLLHNHRPLAIKSSIPKF  799

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            E++F   R YDPDRERAE+ KLK   K+E KGA RE+RKD +F+
Sbjct  800  EESFNPDRHYDPDRERAELSKLKAEHKREKKGAMRELRKDANFI  843



>ref|XP_003191327.1| nucleolar protein; Nop14p [Cryptococcus gattii WM276]
 gb|ADV19540.1| Nucleolar protein, putative; Nop14p [Cryptococcus gattii WM276]
 gb|KIR79875.1| nucleolar protein 14 [Cryptococcus gattii EJB2]
 gb|KIY34223.1| nucleolar protein 14 [Cryptococcus gattii E566]
 gb|KJE00970.1| nucleolar protein 14 [Cryptococcus gattii NT-10]
Length=932

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -1

Query  743  LQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKFEDNFIKGRDYDPDRERA  564
            L   + + +  +  ++      R+PL ++  KP+PI    P+FE++F  G+ YDPD ER 
Sbjct  796  LNTVLTSTLTALSKRLNNTLSTRRPLTLQSHKPIPIASYAPRFEESFAPGKHYDPDTERN  855

Query  563  EIRKLKKRVKQEAKGAAREIRKDNHFLFG  477
               KLK   K+E KGA RE+RKDN FL G
Sbjct  856  ASAKLKALYKKERKGAMRELRKDNRFLAG  884



>emb|CEJ95036.1| hypothetical protein VHEMI10539 [Torrubiella hemipterigena]
Length=903

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 62/106 (58%), Gaps = 0/106 (0%)
 Frame = -1

Query  800  MPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNP  621
            +  +K L   A ++H+P  L  K +     +   ++     R+PL +   +P+ IK   P
Sbjct  748  LDAIKHLTSKACRSHLPVALLSKAEKAETKLTRMLKLAELSRRPLELHHHRPLAIKTFIP  807

Query  620  KFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            KFE+ F   + YDPDRERAE+ KLKK  K+E KGA RE+RKD +F+
Sbjct  808  KFEETFDPDKHYDPDRERAELAKLKKEHKRERKGAMRELRKDANFM  853



>emb|CEG64233.1| hypothetical protein RMATCC62417_01246 [Rhizopus microsporus]
Length=917

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 59/89 (66%), Gaps = 6/89 (7%)
 Frame = -1

Query  731  IKNVIQLIENKVEEN------HRLRQPLRMRKQKPVPIKMVNPKFEDNFIKGRDYDPDRE  570
            IKN++  ++ ++E         R + PLR+++ +P+PI    PKFE  +   R YDPD+ 
Sbjct  786  IKNLLDTLKGRLERQIKFCIEKRTKTPLRLQQHRPIPIAQHLPKFEKAYSMDRHYDPDQA  845

Query  569  RAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            R+++RKL+ +VK+E KGA RE+RKDN F+
Sbjct  846  RSQLRKLESQVKKEKKGAMRELRKDNQFI  874



>ref|XP_009154417.1| hypothetical protein HMPREF1120_02135 [Exophiala dermatitidis 
NIH/UT8656]
 gb|EHY53956.1| hypothetical protein HMPREF1120_02135 [Exophiala dermatitidis 
NIH/UT8656]
Length=920

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 63/109 (58%), Gaps = 4/109 (4%)
 Frame = -1

Query  797  PILKLLNELAAQNHMPDILQEKI----KNVIQLIENKVEENHRLRQPLRMRKQKPVPIKM  630
            P+L++L  +AA       L + I     + +Q +E   + +   R+PL +   +P+ IK 
Sbjct  764  PLLRVLRHIAANQSSAKFLPKSIIAFVSDTVQTLEGLQKASLDARRPLLLHNHRPLAIKT  823

Query  629  VNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
              P F +N+   R YDPDR+RAEI KLK   K+E KGA RE+RKD +F+
Sbjct  824  SIPAFIENYNPDRHYDPDRQRAEISKLKAEYKKERKGAMRELRKDANFM  872



>emb|CCL98246.1| predicted protein [Fibroporia radiculosa]
Length=884

 Score = 75.9 bits (185),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 70/110 (64%), Gaps = 6/110 (5%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            + PIL+LL+ + +Q+  P+ L E++ ++   I   ++ + + R+PL ++  KP+PI    
Sbjct  728  YDPILRLLDGVRSQS-FPEGLLERLTSIKDTIRRLLKFSRQARRPLMLQAHKPIPIPTYV  786

Query  623  PKFE---DNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            PKFE    N+++ RD  PD ER E  KL+++ KQE KGA RE+RKD  FL
Sbjct  787  PKFEQSSSNYLRNRD--PDHERNEAAKLRRQYKQEKKGAIRELRKDARFL  834



>gb|KFX96344.1| hypothetical protein O988_05381 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=919

 Score = 75.9 bits (185),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 61/110 (55%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNEL---AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P LK+L  L   A + H+P      +      +   + +    R+PL +   KP+ IK
Sbjct  761  FSPALKVLKHLGSKACREHLPRSTTALVTRTSTKLTVLLNQARLSRRPLELHHHKPLAIK  820

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFE++F   + YDPDRERAE  KLK   K+E KGA RE+RKD +F+
Sbjct  821  TSIPKFEESFNPDKHYDPDRERAESSKLKAEHKRERKGAMRELRKDANFI  870



>ref|XP_003237090.1| rRNA maturation protein [Trichophyton rubrum CBS 118892]
 gb|EGD85541.1| hypothetical protein TERG_01812 [Trichophyton rubrum CBS 118892]
 gb|EZF13028.1| hypothetical protein H100_06459 [Trichophyton rubrum MR850]
 gb|EZF39418.1| hypothetical protein H102_06425 [Trichophyton rubrum CBS 100081]
 gb|EZF50071.1| hypothetical protein H103_06453 [Trichophyton rubrum CBS 288.86]
 gb|EZF60649.1| hypothetical protein H104_06437 [Trichophyton rubrum CBS 289.86]
 gb|EZF71512.1| hypothetical protein H105_06464 [Trichophyton soudanense CBS 
452.61]
 gb|EZF81997.1| hypothetical protein H110_06448 [Trichophyton rubrum MR1448]
 gb|EZF92664.1| hypothetical protein H113_06498 [Trichophyton rubrum MR1459]
 gb|EZG03631.1| hypothetical protein H106_06294 [Trichophyton rubrum CBS 735.88]
 gb|EZG14197.1| hypothetical protein H107_06596 [Trichophyton rubrum CBS 202.88]
 gb|KDB31177.1| hypothetical protein H112_06445 [Trichophyton rubrum D6]
Length=903

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 62/104 (60%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +L+ + E   +  +P  L   +   ++ I+  +    + R+PL +   +P+ IK   PKF
Sbjct  751  VLQHVIESCPKTALPSALSTHLHRSLKTIKALLASRKKDRRPLLLHNHRPLAIKCSIPKF  810

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            E++F   R YDPDRERAE+ KLK   K+E KGA RE+RKD +F+
Sbjct  811  EESFNPDRHYDPDRERAELSKLKAEHKREKKGAMRELRKDANFI  854



>gb|ELR10502.1| hypothetical protein GMDG_04780 [Pseudogymnoascus destructans 
20631-21]
Length=920

 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 61/110 (55%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNEL---AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P LK+L  L   A + H+P      +      +   + +    R+PL +   KP+ IK
Sbjct  762  FSPALKVLKHLGSKACREHLPRSTTACVTRTSTKLTLLLNQARLSRRPLELHHHKPLAIK  821

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFE++F   + YDPDRERAE  KLK   K+E KGA RE+RKD +F+
Sbjct  822  TSIPKFEESFNPDKHYDPDRERAESSKLKAEHKRERKGAMRELRKDANFI  871



>ref|XP_003015214.1| hypothetical protein ARB_06337 [Arthroderma benhamiae CBS 112371]
 gb|EFE34574.1| hypothetical protein ARB_06337 [Arthroderma benhamiae CBS 112371]
Length=867

 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 63/104 (61%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +L+ + E   +  +P  L   ++  ++ I+  +    + R+PL +   +P+ IK   PKF
Sbjct  715  VLQHVIESCPKAALPSALSTHLRRSLKTIKALLASCKKDRRPLLLHNHRPLAIKSSIPKF  774

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            E++F   R YDPDRERAE+ KLK   K+E KGA RE+RKD +F+
Sbjct  775  EESFNPDRHYDPDRERAELSKLKAEHKREKKGAMRELRKDANFI  818



>gb|KDB23490.1| hypothetical protein H109_04618 [Trichophyton interdigitale MR816]
Length=902

 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 63/104 (61%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +LK + +   +  +P  L   ++  ++ I+  +    + R+PL +   +P+ IK   PKF
Sbjct  750  VLKHVIDSCPKASLPSALSTHLRRSLKTIKALLVSCKKDRRPLLLHNHRPLAIKSSIPKF  809

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            E++F   R YDPDRERAE+ KLK   K+E KGA RE+RKD +F+
Sbjct  810  EESFNPDRHYDPDRERAELSKLKAEHKREKKGAMRELRKDANFI  853



>ref|XP_003172323.1| nucleolar complex protein 14 [Microsporum gypseum CBS 118893]
 gb|EFR01912.1| nucleolar complex protein 14 [Microsporum gypseum CBS 118893]
Length=903

 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 63/104 (61%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +L+ L E   +  +P  L   ++  ++ I+  +    + R+PL +   +P+ IK   PKF
Sbjct  751  VLQQLIESCPKGTLPSSLSTHLRRSLKTIKALLITYRKDRRPLLLHNHRPLAIKSSIPKF  810

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            E++F   R YDPDRERAE+ KLK   K+E KGA RE+RKD +F+
Sbjct  811  EESFNPDRHYDPDRERAELSKLKAEHKRERKGAMRELRKDANFI  854



>gb|KIP10347.1| hypothetical protein PHLGIDRAFT_125555 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=911

 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 66/110 (60%), Gaps = 6/110 (5%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            + P+  LLN +  ++ +P  L  K  N+ + IE  ++ + + R+PL ++  KP+PI    
Sbjct  755  YEPVSTLLNGIK-RDALPTTLSTKFGNLEETIERLLKFSRQSRRPLALQAHKPIPIPTYV  813

Query  623  PKFE---DNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            P+FE    N+++ RD  PD ER E  KLK + KQE KGA RE+RKD  FL
Sbjct  814  PRFEHTTSNYLRNRD--PDHERNETSKLKAQYKQERKGAIRELRKDARFL  861



>gb|EGD95886.1| rRNA maturation protein [Trichophyton tonsurans CBS 112818]
Length=901

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 63/104 (61%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +LK + +   +  +P  L   ++  ++ I+  +    + R+PL +   +P+ IK   PKF
Sbjct  749  VLKHVIDSCPKASLPSALSTHLRRSLKTIKALLVSCKKDRRPLLLHNHRPLAIKSSIPKF  808

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            E++F   R YDPDRERAE+ KLK   K+E KGA RE+RKD +F+
Sbjct  809  EESFNPDRHYDPDRERAELSKLKAEHKREKKGAMRELRKDANFI  852



>gb|ENH88361.1| rRNA maturation protein [Colletotrichum orbiculare MAFF 240422]
Length=909

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 64/104 (62%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            I+  L+  + ++ +P+ L ++++     +E  ++     R+PL +   +P+ IK   PKF
Sbjct  756  IVAHLHSKSCRSKLPEALADQVEKSKAKLERMLKIAQLSRRPLELHHHRPLAIKTYIPKF  815

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            ED+F   + YDPDRERAE+ KLK   K+E KGA RE+R+D  F+
Sbjct  816  EDSFDPNKHYDPDRERAEMAKLKAEHKKERKGAMRELRRDAQFM  859



>gb|KDR84100.1| hypothetical protein GALMADRAFT_236756 [Galerina marginata CBS 
339.88]
Length=908

 Score = 75.1 bits (183),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 70/113 (62%), Gaps = 6/113 (5%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F PIL+++  +  +NH+ D  + ++  V+  ++  ++ + + R PLR++  KP+PI    
Sbjct  752  FEPILEVVEHIE-KNHLSDAHKVQVTKVVDSLQRLLKFSRQARTPLRLQAHKPIPIPTFI  810

Query  623  PKFED---NFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGV  474
            PKFE+   N++  R  DPD E+ +  KL+ + KQE KGA RE+RKD  FL GV
Sbjct  811  PKFENTTSNYL--RRQDPDHEKNQAAKLRNQYKQEKKGAIRELRKDARFLAGV  861



>gb|KFY39506.1| hypothetical protein V494_03939 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=920

 Score = 75.1 bits (183),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 62/110 (56%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNEL---AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P L++L  L   A + H+     + +K     +   + +    R+PL +   KP+ IK
Sbjct  762  FTPALRVLKHLGSKACREHLSRSTTDCLKRTSNKLTVLLNQARLTRRPLELHHHKPLAIK  821

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFE++F   + YDPDRERAE  KLK   K+E KGA RE+RKD +F+
Sbjct  822  TSIPKFEESFNPDKHYDPDRERAESSKLKAEHKRERKGAMRELRKDANFI  871



>gb|KFY08736.1| hypothetical protein V492_05940 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=920

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 62/110 (56%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNEL---AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P L++L  L   A + H+     + +K     +   + +    R+PL +   KP+ IK
Sbjct  762  FTPALRVLKHLGSKACREHLSRSTTDCLKRTSNKLTVLLNQARLTRRPLELHHHKPLAIK  821

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFE++F   + YDPDRERAE  KLK   K+E KGA RE+RKD +F+
Sbjct  822  TSIPKFEESFNPDKHYDPDRERAESSKLKAEHKRERKGAMRELRKDANFI  871



>gb|KFY53389.1| hypothetical protein V496_07651 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
 gb|KFY98106.1| hypothetical protein V498_01659 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=920

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 60/110 (55%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNELAAQN---HMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P LK L  L ++    H+P      +      +   + +    R+PL +   KP+ IK
Sbjct  762  FSPALKALKHLGSKTCREHLPRSTTASVMRTSTKLTVLLNQARLSRRPLELHHHKPLAIK  821

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFE++F   + YDPDRERAE  KLK   K+E KGA RE+RKD +F+
Sbjct  822  TSIPKFEESFNPDKHYDPDRERAESSKLKAEHKRERKGAMRELRKDANFI  871



>emb|CCX30130.1| Similar to Probable nucleolar complex protein 14; acc. no. O43051 
[Pyronema omphalodes CBS 100304]
Length=899

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 75/142 (53%), Gaps = 3/142 (2%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQL---IENKVEENHRLRQPLRMRKQKPVPIK  633
            F P L +L   + +     +  E  KNV      +E K+ +    R+PL +   KP+P+ 
Sbjct  743  FEPALSILKHFSTKACTAPLGAELKKNVTTFSKDLEGKLAQKKLARRPLELHHHKPLPLP  802

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaa  453
               PKFE+++   + YDP+ ER E  KLK   K+E K A REIRKDN F+  VK KE  A
Sbjct  803  SNVPKFEEDYSMDKHYDPNAERREASKLKAEHKREKKAATREIRKDNQFIASVKLKEDRA  862

Query  452  laeerseKYGKALAFLQEQEHA  387
             +E   +K  +  A +Q +E A
Sbjct  863  NSEAYHKKMARLTAMIQSEEGA  884



>gb|KFY94531.1| hypothetical protein V500_03177 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=916

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 60/110 (55%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNELAAQ---NHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P LK+L  L ++    H+P      +      +   + +    R+PL +   KP+ IK
Sbjct  758  FSPALKVLKHLGSKVCREHLPRSTTACVTRTSTKLTVLLNQARLSRRPLELHHHKPLAIK  817

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFE+ F   + YDPDRERAE  KLK   K+E KGA RE+RKD +F+
Sbjct  818  TSIPKFEETFNPDKHYDPDRERAESSKLKAEHKRERKGAMRELRKDANFI  867



>ref|XP_009219726.1| hypothetical protein GGTG_03680 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
 gb|EJT78581.1| hypothetical protein GGTG_03680 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
Length=919

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 65/110 (59%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNELAAQ---NHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P  ++L  L ++   N +P  + ++ +  +  ++  ++     R+PL +   +P+ I+
Sbjct  761  FEPTCRVLAHLCSKPCRNALPPAVVKETERFLARLKVSLQAARLSRRPLELHHHRPLAIR  820

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFED F   + YDPDRERAE+ KL+   K+E KGA RE+RKD +F+
Sbjct  821  TYVPKFEDTFDPNKHYDPDRERAEMAKLRAEHKRERKGAMRELRKDANFM  870



>emb|CAK47083.1| unnamed protein product [Aspergillus niger]
Length=880

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 65/112 (58%), Gaps = 5/112 (4%)
 Frame = -1

Query  803  FMPILKLLNEL-AAQNHMPDILQEKIKNVIQLIENKV----EENHRLRQPLRMRKQKPVP  639
            F P+  +LN L ++      ++  ++++ IQ   +KV     +    R+PL +   +P+ 
Sbjct  721  FTPVQNVLNHLRSSLKGNKKLISSQVRDTIQSTLDKVTTQLSQAKLTRRPLLLHNHRPLA  780

Query  638  IKMVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            IK   PKFE+ F   + YDPDRERAE  +LK   K+E KGA RE+RKD +F+
Sbjct  781  IKTAIPKFEETFNPDKHYDPDRERAESNRLKAEYKRERKGAMRELRKDANFI  832



>dbj|GAM82652.1| hypothetical protein ANO11243_006340 [fungal sp. No.11243]
Length=845

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = -1

Query  677  RQPLRMRKQKPVPIKMVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRK  498
            R+PL + K +P+PI+   PKFE++F  G+ YDPD+ER++  KL+K  K+E KGA RE+RK
Sbjct  733  RRPLTLHKHRPLPIRTSVPKFEESFAPGKHYDPDKERSDAAKLRKEYKRERKGAMRELRK  792

Query  497  DNHFL  483
            D +F+
Sbjct  793  DANFV  797



>gb|EQL00077.1| nucleolar protein [Ophiocordyceps sinensis CO18]
Length=1011

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 61/104 (59%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +L+ +   A + H+P  L +K + +   +   +      R+PL +   +P+ IK   PKF
Sbjct  858  VLRHMGGDACRAHLPAQLCDKTEKLEAKLARMLGLARLSRRPLELHHHRPLAIKTYIPKF  917

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            ED F   + YDPDRERAE+ KL+   K+E KGA RE+RKD +F+
Sbjct  918  EDTFDPDKHYDPDRERAELAKLRAEHKKERKGAMRELRKDANFM  961



>ref|XP_001398184.2| rRNA maturation protein (Nop14) [Aspergillus niger CBS 513.88]
Length=897

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 65/112 (58%), Gaps = 5/112 (4%)
 Frame = -1

Query  803  FMPILKLLNEL-AAQNHMPDILQEKIKNVIQLIENKV----EENHRLRQPLRMRKQKPVP  639
            F P+  +LN L ++      ++  ++++ IQ   +KV     +    R+PL +   +P+ 
Sbjct  738  FTPVQNVLNHLRSSLKGNKKLISSQVRDTIQSTLDKVTTQLSQAKLTRRPLLLHNHRPLA  797

Query  638  IKMVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            IK   PKFE+ F   + YDPDRERAE  +LK   K+E KGA RE+RKD +F+
Sbjct  798  IKTAIPKFEETFNPDKHYDPDRERAESNRLKAEYKRERKGAMRELRKDANFI  849



>gb|EFW99913.1| rRNA maturation protein [Grosmannia clavigera kw1407]
Length=863

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 61/109 (56%), Gaps = 2/109 (2%)
 Frame = -1

Query  803  FMPILKLLNELAAQ--NHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKM  630
              P +++L  LAA     +P  +++ +   +   E         R+PL +   +P+ I+ 
Sbjct  716  LAPAIEILRHLAASPVGSLPASVRQAVTRALTTAEAVGAAAQLARRPLELHHHRPLAIRT  775

Query  629  VNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            + P+FED F   + YDP+RERAE  KL+  +K+E KGA RE+RKD  F+
Sbjct  776  LVPRFEDEFDPDKHYDPNRERAEAAKLQAELKRERKGALRELRKDAAFM  824



>gb|KFY24396.1| hypothetical protein V493_05255 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=920

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 60/110 (55%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNEL---AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P L++L  L   A + H+P      +      +   + +    R+PL +   KP+ IK
Sbjct  762  FTPALRVLKHLGSKACREHLPRSTIACVTRTSTKLTVLLNQARLSRRPLELHHHKPLAIK  821

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFE+ F   + YDPDRERAE  KLK   K+E KGA RE+RKD +F+
Sbjct  822  TSIPKFEETFNPDKHYDPDRERAESSKLKAEHKRERKGAMRELRKDANFI  871



>ref|XP_007004410.1| hypothetical protein TREMEDRAFT_20830, partial [Tremella mesenterica 
DSM 1558]
 gb|EIW69706.1| hypothetical protein TREMEDRAFT_20830, partial [Tremella mesenterica 
DSM 1558]
Length=911

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -1

Query  728  KNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKFEDNFIKGRDYDPDRERAEIRKL  549
            + +I  +  ++   +  RQPL ++  KP+PI    PKFE +F  G+ YDPD ER    KL
Sbjct  780  QTIILTLTRQLHLANTSRQPLALQSHKPIPIPSYAPKFEADFTPGKHYDPDVERNAGAKL  839

Query  548  KKRVKQEAKGAAREIRKDNHFLFG  477
            +   K+E KGA RE+RKDN FL G
Sbjct  840  RALYKKERKGAIRELRKDNRFLAG  863



>gb|EHA21586.1| hypothetical protein ASPNIDRAFT_51257 [Aspergillus niger ATCC 
1015]
Length=920

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 65/112 (58%), Gaps = 5/112 (4%)
 Frame = -1

Query  803  FMPILKLLNEL-AAQNHMPDILQEKIKNVIQLIENKV----EENHRLRQPLRMRKQKPVP  639
            F P+  +LN L ++      ++  ++++ IQ   +KV     +    R+PL +   +P+ 
Sbjct  761  FTPVQNVLNHLRSSLKGNKKLISSQVRDTIQSTLDKVTTQLSQAKLTRRPLLLHNHRPLA  820

Query  638  IKMVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            IK   PKFE+ F   + YDPDRERAE  +LK   K+E KGA RE+RKD +F+
Sbjct  821  IKTAIPKFEETFNPDKHYDPDRERAESNRLKAEYKRERKGAMRELRKDANFI  872



>gb|KFH69990.1| hypothetical protein MVEG_04793 [Mortierella verticillata NRRL 
6337]
Length=980

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 63/107 (59%), Gaps = 0/107 (0%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F   +++L  +A+ +H+P+ L+ +I+     I          R PL+++  KPVPI    
Sbjct  824  FQGPIEVLKTIASSSHLPNSLKTQIEKAQDRISKLDMFATEGRTPLQLQAHKPVPIASYV  883

Query  623  PKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            PKFE+ +   + YDPD ER++  KL+ + K+E KGA RE+RKD  F+
Sbjct  884  PKFEEGYSLDKHYDPDVERSQAHKLQVQYKKEKKGAIRELRKDAQFV  930



>gb|KEQ86111.1| Nop14-like protein [Aureobasidium pullulans EXF-150]
Length=845

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -1

Query  677  RQPLRMRKQKPVPIKMVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRK  498
            R+PL +   +P+PI+   PKFE+NF   + YDPDRERA+  KLKK  K+E KGA RE+RK
Sbjct  733  RRPLELHHHRPLPIRTSIPKFEENFNPDKHYDPDRERADAAKLKKEYKRERKGAVRELRK  792

Query  497  DNHFL  483
            D +F+
Sbjct  793  DANFI  797



>ref|XP_002150848.1| rRNA maturation protein (Nop14), putative [Talaromyces marneffei 
ATCC 18224]
 gb|EEA22239.1| rRNA maturation protein (Nop14), putative [Talaromyces marneffei 
ATCC 18224]
 gb|KFX45826.1| putative nucleolar complex protein 14 [Talaromyces marneffei 
PM1]
Length=917

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 63/105 (60%), Gaps = 2/105 (2%)
 Frame = -1

Query  797  PILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPK  618
            PIL+ L +   ++  P  L  +I   +  ++    ++   R+PL +   +P+ IK   PK
Sbjct  767  PILQHLKKSFTKSSSP--LSTQITTTLHKLKTSSTQSQHTRRPLLLHNHRPLAIKQSIPK  824

Query  617  FEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            FE++F   + YDP+RERAE+ KLK   K+E KGA RE+RKD +F+
Sbjct  825  FEEDFNPDKHYDPNRERAELAKLKAEHKRERKGAMRELRKDANFV  869



>ref|XP_001261970.1| rRNA maturation protein (Nop14), putative [Neosartorya fischeri 
NRRL 181]
 gb|EAW20073.1| rRNA maturation protein (Nop14), putative [Neosartorya fischeri 
NRRL 181]
Length=914

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 60/96 (63%), Gaps = 0/96 (0%)
 Frame = -1

Query  770  AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKFEDNFIKGR  591
            +A+  +  ++Q+ +++ +  ++  +      R+PL +   +P+ IK   PKFE+ F   +
Sbjct  771  SAKGKLSSVVQDNLQSTLDKLDTHLSRARATRRPLLLHNHRPLAIKTAIPKFEETFNPDK  830

Query  590  DYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
             YDP+RERAE+ +LK   K+E KGA RE+RKD +F+
Sbjct  831  HYDPNRERAELNRLKAEFKRERKGAMRELRKDANFI  866



>gb|KFZ24138.1| hypothetical protein V502_01389 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=919

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 60/110 (55%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNELAAQ---NHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P LK+L  L ++    H+P      +      +   + +    R+PL +   KP+ IK
Sbjct  761  FSPALKVLKHLGSKVCREHLPRNTTACVTRTSTKLTVLLNQARLSRRPLELHHHKPLAIK  820

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFE+ F   + YDPDRERAE  KLK   K+E KGA RE+RKD +F+
Sbjct  821  TSIPKFEETFNPDKHYDPDRERAESSKLKAEHKRERKGAMRELRKDANFI  870



>emb|CEI92865.1| hypothetical protein RMCBS344292_07113 [Rhizopus microsporus]
Length=890

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = -1

Query  683  RLRQPLRMRKQKPVPIKMVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREI  504
            R + PLR+++ +P+PI    PKFE  +   R YDPD+ R+++RKL+ +VK+E KGA RE+
Sbjct  781  RTKTPLRLQQHRPIPIAQHLPKFEKAYSMDRHYDPDQARSQLRKLESQVKKEKKGAMREL  840

Query  503  RKDNHFL  483
            RKDN F+
Sbjct  841  RKDNQFI  847



>ref|XP_006695656.1| hypothetical protein CTHT_0053180 [Chaetomium thermophilum var. 
thermophilum DSM 1495]
 gb|EGS18711.1| hypothetical protein CTHT_0053180 [Chaetomium thermophilum var. 
thermophilum DSM 1495]
Length=907

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 64/110 (58%), Gaps = 3/110 (3%)
 Frame = -1

Query  803  FMPILKLLNELAAQ---NHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIK  633
            F P L +   L  +   +H+P  L  K+ ++   +   ++ +   R+PL +   +P+ IK
Sbjct  750  FQPALSVAQHLLTKPNASHLPSSLTSKLNDLASHLSRLLQLSRLSRRPLELHHHRPLAIK  809

Query  632  MVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
               PKFED+F   + YDP+RERAE+ KLK   K+E KGA RE+RKD  F+
Sbjct  810  TYIPKFEDDFDPDKHYDPNRERAELAKLKAEHKRERKGALRELRKDAQFI  859



>gb|KEQ65436.1| Nop14-like protein [Aureobasidium melanogenum CBS 110374]
Length=844

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -1

Query  677  RQPLRMRKQKPVPIKMVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRK  498
            R+PL +   +P+PI+   PKFE+NF   + YDPDRERA+  KLKK  K+E KGA RE+RK
Sbjct  732  RRPLELHHHRPLPIRTSIPKFEENFNPDKHYDPDRERADAAKLKKEYKRERKGAVRELRK  791

Query  497  DNHFL  483
            D +F+
Sbjct  792  DANFI  796



>ref|XP_001210121.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gb|EAU38681.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
Length=913

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -1

Query  803  FMPILKLLNEL--AAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKM  630
            F P   +L  L  + +  +   + + I++ +  I+  +    + R+PL +   +P+ IK 
Sbjct  757  FEPAQNVLRHLLQSCEGKVSSTVTDSIQSTLDKIDQHLSNARKTRRPLLLHNHRPLAIKS  816

Query  629  VNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGVkekekaal  450
              PKFE++F   + YDP+RERAE  +LK  +K+E KGA RE+RKD +F+   + +EK   
Sbjct  817  AIPKFEESFNPDKHYDPNRERAEANRLKTELKRERKGAMRELRKDANFIAREQLREKKER  876

Query  449  aeerseKYGKALAFLQEQE  393
              E   KY + +A +Q QE
Sbjct  877  DAEYERKYKRLVAEVQNQE  895



>gb|EWY98757.1| hypothetical protein FOYG_03083 [Fusarium oxysporum FOSC 3-a]
Length=901

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 62/104 (60%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            ILK L     ++ +P  L E+I+ +    +  ++     R+ + +   +P+ IK   PKF
Sbjct  748  ILKHLGSKTCRSQLPTALNERIEKLQVKFDRMLKVAQLSRRNVELHHHRPLAIKTYVPKF  807

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            E+ F   + YDPDRERAE+ KLKK  K+E KGA RE+RKD +F+
Sbjct  808  EETFDPDKHYDPDRERAELAKLKKEHKKERKGALRELRKDANFM  851



>gb|EXL85972.1| hypothetical protein FOPG_02227 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXM36452.1| hypothetical protein FOTG_00609 [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=901

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 63/104 (61%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +LK L+    ++ +P  L E+I+ +    +  ++     R+ + +   +P+ IK   PKF
Sbjct  748  VLKHLSSKTCRSQLPTALNERIEKLQVKFDRMLKVAQLSRRNVELHHHRPLAIKTYVPKF  807

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            E+ F   + YDPDRERAE+ KLKK  K+E KGA RE+RKD +F+
Sbjct  808  EETFDPDKHYDPDRERAELAKLKKEHKKERKGALRELRKDANFM  851



>gb|EXA50105.1| hypothetical protein FOVG_02951 [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXL00451.1| hypothetical protein FOQG_00626 [Fusarium oxysporum f. sp. raphani 
54005]
Length=901

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 63/104 (61%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +LK L+    ++ +P  L E+I+ +    +  ++     R+ + +   +P+ IK   PKF
Sbjct  748  VLKHLSSKTCRSQLPTALNERIEKLQVKFDRMLKVAQLSRRNVELHHHRPLAIKTYVPKF  807

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            E+ F   + YDPDRERAE+ KLKK  K+E KGA RE+RKD +F+
Sbjct  808  EETFDPDKHYDPDRERAELAKLKKEHKKERKGALRELRKDANFM  851



>gb|KIM46535.1| hypothetical protein M413DRAFT_441625 [Hebeloma cylindrosporum 
h7]
Length=910

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 71/113 (63%), Gaps = 6/113 (5%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            + P++ +LN +  +  + D  + ++  ++  ++  ++ +H+ R+PLR++  KP+PI    
Sbjct  754  YEPVVSILNNVETKK-LCDGHKTQLSKLVDTLQRLLKFSHQARRPLRLQAHKPIPIPTYI  812

Query  623  PKFE---DNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGV  474
            PKFE    N++  R  DPD+E+ +  KL+ + KQE KGA RE+RKD+ FL GV
Sbjct  813  PKFETSNSNYL--RRQDPDQEKNQASKLRNQYKQERKGAIRELRKDSRFLAGV  863



>dbj|GAN00582.1| nop14-like protein [Mucor ambiguus]
Length=938

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 59/89 (66%), Gaps = 6/89 (7%)
 Frame = -1

Query  731  IKNVIQLIENKVEEN------HRLRQPLRMRKQKPVPIKMVNPKFEDNFIKGRDYDPDRE  570
            IK+++  +++++E         R + PLRM++ +P+PI    PKFE  +   + YDPD E
Sbjct  807  IKSLMSTVKSRLERQIRFCIEKRTKTPLRMQQHRPIPIAQHLPKFEKAYSMDKHYDPDHE  866

Query  569  RAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            R+++ KL+ ++K+E KGA RE+RKDN F+
Sbjct  867  RSQMHKLESQIKKEKKGALRELRKDNQFV  895



>gb|EGU81827.1| hypothetical protein FOXB_07622 [Fusarium oxysporum Fo5176]
Length=1241

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 63/104 (61%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +LK L+    ++ +P  L E+I+ +    +  ++     R+ + +   +P+ IK   PKF
Sbjct  748  VLKHLSSKTCRSQLPTALNERIEKLQVKFDRMLKVAQLSRRNVELHHHRPLAIKTYVPKF  807

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            E+ F   + YDPDRERAE+ KLKK  K+E KGA RE+RKD +F+
Sbjct  808  EETFDPDKHYDPDRERAELAKLKKEHKKERKGALRELRKDANFM  851



>gb|KIY66708.1| Nop14-like protein [Cylindrobasidium torrendii FP15055 ss-10]
Length=893

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 67/113 (59%), Gaps = 5/113 (4%)
 Frame = -1

Query  803  FMPILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVN  624
            F PI  +L  ++ Q  + D LQ ++  +   ++  ++  ++ R+PL ++  KP+PI    
Sbjct  736  FTPISDVLKNVSKQKKLHDTLQAQLSALRDSLKRLLKFANQSRRPLALQAHKPIPIATYI  795

Query  623  PKFE---DNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFLFGV  474
            PKF+    ++I  R  DPD ER E  KL+ +VKQE KGA RE+RKD+ FL  V
Sbjct  796  PKFDGSSSSYI--RKQDPDHERNEAAKLRNQVKQERKGAIRELRKDSRFLANV  846



>emb|CCT65890.1| related to NOP14-nuclear and nucleolar protein with possible 
role in ribosome biogenesis [Fusarium fujikuroi IMI 58289]
Length=901

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 62/104 (60%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +LK L     ++ +P  L E+I+ +    +  ++     R+ + +   +P+ IK   PKF
Sbjct  748  VLKHLGSKTCRSQLPTTLNERIEKLQVKFDRMLKVAQLSRRNVELHHHRPLAIKTYVPKF  807

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            E+ F   + YDPDRERAE+ KLKK  K+E KGA RE+RKD +F+
Sbjct  808  EETFDPDKHYDPDRERAELAKLKKEHKKERKGALRELRKDANFM  851



>gb|KEQ76791.1| Nop14-like protein, partial [Aureobasidium pullulans var. namibiae 
CBS 147.97]
Length=842

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -1

Query  677  RQPLRMRKQKPVPIKMVNPKFEDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRK  498
            R+PL +   +P+P++   PKFE+NF   + YDPDRERA+  KLKK  K+E KGA RE+RK
Sbjct  730  RRPLELHHHRPLPVRTSIPKFEENFNPDKHYDPDRERADAAKLKKEYKRERKGAVRELRK  789

Query  497  DNHFL  483
            D +F+
Sbjct  790  DANFI  794



>gb|EPE04064.1| nop14-like family protein [Ophiostoma piceae UAMH 11346]
Length=1041

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 58/104 (56%), Gaps = 0/104 (0%)
 Frame = -1

Query  794  ILKLLNELAAQNHMPDILQEKIKNVIQLIENKVEENHRLRQPLRMRKQKPVPIKMVNPKF  615
            +L LL   A ++ +P    + I  V   ++      H  R+PL +   +P+ I+   P+F
Sbjct  891  VLTLLKTKACRSELPAGSAKDIDRVSTQVDAAQRFAHLARRPLELHHHRPMAIRTFVPRF  950

Query  614  EDNFIKGRDYDPDRERAEIRKLKKRVKQEAKGAAREIRKDNHFL  483
            E  +   + YDP+RERA+  KLK   K+E KGA RE+RKD HF+
Sbjct  951  EAEYDPDKHYDPNRERADASKLKAEFKRERKGAMRELRKDAHFM  994



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1593558888600