BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF012H22

Length=738
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAK19067.1|  GIGANTEA                                               304   7e-92   Ipomoea nil [qian niu]
gb|AEK05861.1|  gigantea-5                                              230   2e-72   Populus balsamifera [balsam poplar]
gb|AEK05881.1|  gigantea-5                                              229   6e-72   Populus balsamifera [balsam poplar]
gb|AEK05816.1|  gigantea-5                                              227   4e-71   Populus balsamifera [balsam poplar]
ref|XP_007019604.1|  Gigantea protein isoform 4                         244   3e-70   
ref|XP_007019601.1|  Gigantea protein isoform 1                         244   3e-70   
ref|XP_007019603.1|  Gigantea protein isoform 3                         244   3e-70   
gb|AEK26576.1|  gigantea 5                                              224   6e-70   Populus tremula [European aspen]
ref|XP_007199688.1|  hypothetical protein PRUPE_ppa000556mg             238   2e-68   
ref|XP_008237480.1|  PREDICTED: protein GIGANTEA                        239   2e-68   
ref|XP_011100590.1|  PREDICTED: protein GIGANTEA-like                   238   2e-68   Sesamum indicum [beniseed]
gb|AJC01622.1|  gigantea                                                238   3e-68   Prunus dulcis [sweet almond]
ref|XP_006473108.1|  PREDICTED: protein GIGANTEA-like                   222   3e-68   Citrus sinensis [apfelsine]
ref|XP_002524341.1|  Protein GIGANTEA, putative                         238   4e-68   
emb|CDP11443.1|  unnamed protein product                                238   4e-68   Coffea canephora [robusta coffee]
dbj|BAJ22595.1|  GIGANTEA                                               237   9e-68   Glycine max [soybeans]
ref|XP_004290483.1|  PREDICTED: protein GIGANTEA                        237   9e-68   Fragaria vesca subsp. vesca
gb|ACJ65312.1|  GI1 protein                                             236   1e-67   Glycine max [soybeans]
ref|XP_003556164.1|  PREDICTED: protein GIGANTEA isoformX1              236   1e-67   
ref|XP_009631435.1|  PREDICTED: protein GIGANTEA-like isoform X6        235   1e-67   Nicotiana tomentosiformis
ref|XP_009631436.1|  PREDICTED: protein GIGANTEA-like isoform X7        235   1e-67   Nicotiana tomentosiformis
ref|XP_008386373.1|  PREDICTED: protein GIGANTEA-like                   236   2e-67   
ref|XP_009335139.1|  PREDICTED: protein GIGANTEA-like                   236   2e-67   Pyrus x bretschneideri [bai li]
ref|XP_009772049.1|  PREDICTED: protein GIGANTEA-like                   236   2e-67   Nicotiana sylvestris
gb|KHN46389.1|  Protein GIGANTEA                                        235   3e-67   Glycine soja [wild soybean]
ref|XP_006359039.1|  PREDICTED: protein GIGANTEA-like isoform X1        235   4e-67   Solanum tuberosum [potatoes]
ref|XP_006359040.1|  PREDICTED: protein GIGANTEA-like isoform X2        235   4e-67   Solanum tuberosum [potatoes]
ref|XP_011042897.1|  PREDICTED: protein GIGANTEA-like                   234   5e-67   Populus euphratica
ref|XP_009631431.1|  PREDICTED: protein GIGANTEA-like isoform X2        234   5e-67   Nicotiana tomentosiformis
ref|XP_009631429.1|  PREDICTED: protein GIGANTEA-like isoform X1        234   5e-67   Nicotiana tomentosiformis
ref|XP_009631434.1|  PREDICTED: protein GIGANTEA-like isoform X5        234   6e-67   Nicotiana tomentosiformis
ref|XP_009631432.1|  PREDICTED: protein GIGANTEA-like isoform X3        234   6e-67   Nicotiana tomentosiformis
gb|KJB59489.1|  hypothetical protein B456_009G258800                    232   6e-67   Gossypium raimondii
ref|XP_009631433.1|  PREDICTED: protein GIGANTEA-like isoform X4        234   6e-67   Nicotiana tomentosiformis
ref|XP_004237832.1|  PREDICTED: protein GIGANTEA                        234   7e-67   Solanum lycopersicum
ref|XP_006588466.1|  PREDICTED: uncharacterized protein LOC100800...    234   9e-67   Glycine max [soybeans]
gb|KHN17039.1|  Protein GIGANTEA                                        234   9e-67   Glycine soja [wild soybean]
ref|NP_001239995.1|  uncharacterized protein LOC100800578               234   9e-67   
dbj|BAN82589.1|  gigantea                                               234   1e-66   Glycine max [soybeans]
dbj|BAN82581.1|  gigantea                                               234   1e-66   Glycine max [soybeans]
dbj|BAN82586.1|  gigantea                                               234   1e-66   Glycine max [soybeans]
gb|AII99806.1|  gigantea                                                234   1e-66   Dimocarpus longan [longan]
ref|XP_008381855.1|  PREDICTED: protein GIGANTEA-like                   233   2e-66   
gb|KJB59490.1|  hypothetical protein B456_009G258800                    232   2e-66   Gossypium raimondii
ref|XP_004173921.1|  PREDICTED: protein GIGANTEA-like                   214   2e-66   
ref|XP_011074103.1|  PREDICTED: protein GIGANTEA-like isoform X1        233   2e-66   Sesamum indicum [beniseed]
gb|KJB59494.1|  hypothetical protein B456_009G258800                    233   3e-66   Gossypium raimondii
ref|XP_002307516.1|  GIGANTEA family protein                            232   5e-66   
gb|AFK37980.1|  unknown                                                 219   7e-66   Lotus japonicus
emb|CAJ38396.1|  photoperiodic response / GIGANTEA                      216   7e-66   Plantago major [cart-track plant]
ref|XP_004252566.1|  PREDICTED: protein GIGANTEA-like isoform X1        231   7e-66   Solanum lycopersicum
ref|XP_010314472.1|  PREDICTED: protein GIGANTEA-like isoform X2        231   7e-66   
ref|XP_006386299.1|  hypothetical protein POPTR_0002s06490g             231   2e-65   
ref|XP_002300901.2|  GIGANTEA family protein                            231   2e-65   
ref|XP_009336496.1|  PREDICTED: protein GIGANTEA-like                   231   2e-65   Pyrus x bretschneideri [bai li]
ref|XP_010097648.1|  hypothetical protein L484_023788                   231   2e-65   
gb|KDP36552.1|  hypothetical protein JCGZ_08319                         230   2e-65   Jatropha curcas
ref|XP_011044276.1|  PREDICTED: protein GIGANTEA-like                   229   4e-65   Populus euphratica
ref|XP_009802612.1|  PREDICTED: protein GIGANTEA-like                   229   7e-65   Nicotiana sylvestris
ref|XP_007143577.1|  hypothetical protein PHAVU_007G083500g             227   3e-64   Phaseolus vulgaris [French bean]
emb|CAN81809.1|  hypothetical protein VITISV_032939                     227   3e-64   Vitis vinifera
ref|XP_009610493.1|  PREDICTED: protein GIGANTEA-like                   226   4e-64   Nicotiana tomentosiformis
ref|XP_002264755.1|  PREDICTED: protein GIGANTEA                        227   4e-64   
ref|XP_004496436.1|  PREDICTED: protein GIGANTEA-like isoform X2        226   5e-64   
ref|XP_006361617.1|  PREDICTED: protein GIGANTEA-like isoform X2        226   7e-64   Solanum tuberosum [potatoes]
ref|XP_006361616.1|  PREDICTED: protein GIGANTEA-like isoform X1        226   8e-64   Solanum tuberosum [potatoes]
ref|XP_004496435.1|  PREDICTED: protein GIGANTEA-like isoform X1        226   8e-64   Cicer arietinum [garbanzo]
ref|XP_003592047.1|  Protein GIGANTEA                                   221   6e-63   
ref|XP_006434519.1|  hypothetical protein CICLE_v10004044mg             223   6e-63   
gb|KGN44456.1|  hypothetical protein Csa_7G293740                       221   7e-63   Cucumis sativus [cucumbers]
gb|KDO83806.1|  hypothetical protein CISIN_1g001216mg                   222   1e-62   Citrus sinensis [apfelsine]
ref|XP_006473104.1|  PREDICTED: protein GIGANTEA-like isoform X1        222   2e-62   Citrus sinensis [apfelsine]
gb|AES62299.2|  gigantea protein 1B                                     221   4e-62   Medicago truncatula
ref|XP_003592048.1|  Protein GIGANTEA                                   221   4e-62   
ref|XP_003592046.1|  Protein GIGANTEA                                   221   5e-62   
gb|ABP81863.1|  LATE BLOOMER 1                                          221   5e-62   Pisum sativum [garden pea]
gb|AFK65758.1|  GIGANTEA                                                220   8e-62   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_004139688.1|  PREDICTED: protein GIGANTEA-like                   220   1e-61   
dbj|BAM67030.1|  gigantea-like                                          219   2e-61   Chrysanthemum seticuspe f. boreale
gb|AGL61504.1|  gigantea-like protein                                   219   2e-61   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_008461914.1|  PREDICTED: protein GIGANTEA-like isoform X3        216   9e-61   
ref|XP_010062090.1|  PREDICTED: protein GIGANTEA isoform X2             216   1e-60   Eucalyptus grandis [rose gum]
ref|XP_004140955.1|  PREDICTED: protein GIGANTEA-like                   216   2e-60   Cucumis sativus [cucumbers]
ref|XP_008461913.1|  PREDICTED: protein GIGANTEA-like isoform X2        215   2e-60   
ref|XP_010477543.1|  PREDICTED: protein GIGANTEA-like isoform X1        216   3e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010477546.1|  PREDICTED: protein GIGANTEA-like isoform X4        216   3e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010477545.1|  PREDICTED: protein GIGANTEA-like isoform X3        216   3e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010477544.1|  PREDICTED: protein GIGANTEA-like isoform X2        216   3e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010062087.1|  PREDICTED: protein GIGANTEA isoform X1             216   3e-60   Eucalyptus grandis [rose gum]
gb|KCW69153.1|  hypothetical protein EUGRSUZ_F02686                     216   3e-60   Eucalyptus grandis [rose gum]
ref|XP_008456743.1|  PREDICTED: protein GIGANTEA-like                   216   4e-60   Cucumis melo [Oriental melon]
ref|XP_010462850.1|  PREDICTED: protein GIGANTEA-like                   215   5e-60   Camelina sativa [gold-of-pleasure]
ref|XP_002890532.1|  hypothetical protein ARALYDRAFT_889789             215   5e-60   Arabidopsis lyrata subsp. lyrata
ref|XP_008461912.1|  PREDICTED: protein GIGANTEA-like isoform X1        215   5e-60   Cucumis melo [Oriental melon]
ref|XP_006306336.1|  hypothetical protein CARUB_v10012213mg             215   5e-60   Capsella rubella
gb|KFK44368.1|  gigantea                                                215   5e-60   Arabis alpina [alpine rockcress]
ref|XP_010498761.1|  PREDICTED: protein GIGANTEA                        214   1e-59   Camelina sativa [gold-of-pleasure]
gb|KJB28961.1|  hypothetical protein B456_005G077100                    214   2e-59   Gossypium raimondii
gb|ABP96481.1|  GIGANTEA                                                213   3e-59   Arabidopsis lyrata subsp. petraea
ref|XP_010681263.1|  PREDICTED: protein GIGANTEA                        213   3e-59   
gb|ABR26000.1|  gigantea protein                                        196   4e-59   Oryza sativa Indica Group [Indian rice]
gb|AEK05793.1|  gigantea 2                                              211   1e-58   Populus balsamifera [balsam poplar]
gb|AEK05801.1|  gigantea 2                                              211   1e-58   Populus balsamifera [balsam poplar]
gb|AEK05795.1|  gigantea 2                                              211   1e-58   Populus balsamifera [balsam poplar]
gb|AEK05790.1|  gigantea 2                                              211   1e-58   Populus balsamifera [balsam poplar]
gb|AEK05807.1|  gigantea 2                                              211   1e-58   Populus balsamifera [balsam poplar]
gb|AEK05799.1|  gigantea 2                                              211   1e-58   Populus balsamifera [balsam poplar]
gb|AEK05791.1|  gigantea 2                                              211   1e-58   Populus balsamifera [balsam poplar]
gb|AEK05802.1|  gigantea 2                                              211   1e-58   Populus balsamifera [balsam poplar]
gb|AAF00023.1|  GIGANTEA                                                210   3e-58   Arabidopsis thaliana [mouse-ear cress]
emb|CAA72908.1|  hypothetical protein                                   210   3e-58   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96483.1|  GIGANTEA                                                210   3e-58   Arabidopsis thaliana [mouse-ear cress]
gb|EYU30283.1|  hypothetical protein MIMGU_mgv1a000455mg                210   3e-58   Erythranthe guttata [common monkey flower]
gb|ABP96496.1|  GIGANTEA                                                210   3e-58   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96484.1|  GIGANTEA                                                210   3e-58   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96485.1|  GIGANTEA                                                210   3e-58   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564180.1|  protein GIGANTEA                                      210   3e-58   Arabidopsis thaliana [mouse-ear cress]
gb|AAT97404.1|  gigantea                                                210   3e-58   Arabidopsis thaliana [mouse-ear cress]
gb|AAT80910.1|  GIGANTEA                                                210   3e-58   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96488.1|  GIGANTEA                                                210   3e-58   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96498.1|  GIGANTEA                                                210   3e-58   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96482.1|  GIGANTEA                                                210   3e-58   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96497.1|  GIGANTEA                                                210   3e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006416159.1|  hypothetical protein EUTSA_v10006603mg             209   5e-58   
dbj|BAD68053.1|  putative gigantea                                      196   6e-58   Oryza sativa Japonica Group [Japonica rice]
gb|AEK05803.1|  gigantea 2                                              208   2e-57   Populus balsamifera [balsam poplar]
emb|CBI22759.3|  unnamed protein product                                194   3e-57   Vitis vinifera
gb|ACJ65314.1|  GI3 protein                                             206   9e-57   Glycine max [soybeans]
gb|KHN41309.1|  Protein GIGANTEA                                        206   1e-56   Glycine soja [wild soybean]
ref|XP_010261024.1|  PREDICTED: protein GIGANTEA-like isoform X1        203   1e-55   Nelumbo nucifera [Indian lotus]
ref|XP_010261025.1|  PREDICTED: protein GIGANTEA-like isoform X2        202   1e-55   Nelumbo nucifera [Indian lotus]
ref|XP_009115601.1|  PREDICTED: protein GIGANTEA                        203   1e-55   Brassica rapa
emb|CDY21388.1|  BnaA09g30390D                                          202   1e-55   Brassica napus [oilseed rape]
ref|NP_001288824.1|  protein GIGANTEA                                   202   2e-55   Brassica rapa
emb|CDY04787.1|  BnaC05g18020D                                          202   3e-55   
gb|ACF84482.1|  unknown                                                 193   2e-54   Zea mays [maize]
ref|NP_001042220.1|  Os01g0182600                                       197   9e-54   
gb|ABZ81992.1|  gigantea                                                197   9e-54   Zea mays [maize]
ref|NP_001288586.1|  gigantea like1a                                    197   9e-54   Zea mays [maize]
gb|AGM20686.1|  GI1-2                                                   197   1e-53   Populus tomentosa [Chinese white poplar]
gb|EEE54000.1|  hypothetical protein OsJ_00641                          197   1e-53   Oryza sativa Japonica Group [Japonica rice]
gb|EEC70061.1|  hypothetical protein OsI_00663                          197   1e-53   Oryza sativa Indica Group [Indian rice]
ref|XP_010535090.1|  PREDICTED: protein GIGANTEA                        197   1e-53   Tarenaya hassleriana [spider flower]
gb|AGW52153.1|  GI                                                      197   1e-53   Populus tomentosa [Chinese white poplar]
gb|EYU36555.1|  hypothetical protein MIMGU_mgv1a000427mg                197   1e-53   Erythranthe guttata [common monkey flower]
emb|CAB56058.1|  gigantea homologue                                     195   3e-53   Oryza sativa [red rice]
ref|XP_007151935.1|  hypothetical protein PHAVU_004G088300g             195   5e-53   Phaseolus vulgaris [French bean]
ref|XP_006643836.1|  PREDICTED: protein GIGANTEA-like isoform X1        195   6e-53   Oryza brachyantha
gb|ADZ72836.1|  GIGANTEA-like protein                                   191   1e-52   Aquilegia formosa
ref|XP_006842209.1|  hypothetical protein AMTR_s00078p00173230          194   2e-52   
ref|XP_010915066.1|  PREDICTED: protein GIGANTEA-like                   193   4e-52   Elaeis guineensis
ref|XP_008672375.1|  PREDICTED: uncharacterized protein LOC100272...    192   6e-52   Zea mays [maize]
ref|NP_001140728.1|  uncharacterized protein LOC100272803               192   6e-52   
ref|XP_008793464.1|  PREDICTED: protein GIGANTEA-like                   192   6e-52   Phoenix dactylifera
ref|XP_009380419.1|  PREDICTED: protein GIGANTEA-like isoform X1        191   1e-51   
gb|AIC83986.1|  gigantea-like protein                                   190   4e-51   Festuca pratensis [meadow ryegrass]
gb|KJB28962.1|  hypothetical protein B456_005G077100                    190   5e-51   Gossypium raimondii
ref|XP_004968438.1|  PREDICTED: protein GIGANTEA-like                   190   5e-51   Setaria italica
emb|CAY26028.1|  GIGANTEA                                               188   1e-50   Lolium perenne [perennial ryegrass]
gb|AAL08497.2|  gigantea-like protein                                   186   2e-50   Hordeum vulgare [barley]
ref|XP_003564357.1|  PREDICTED: protein GIGANTEA                        188   2e-50   
emb|CDM81775.1|  unnamed protein product                                187   3e-50   Triticum aestivum [Canadian hard winter wheat]
gb|KHN00736.1|  Protein GIGANTEA                                        173   4e-50   Glycine soja [wild soybean]
ref|XP_010925341.1|  PREDICTED: protein GIGANTEA-like                   187   5e-50   Elaeis guineensis
gb|EMS55238.1|  hypothetical protein TRIUR3_30834                       186   6e-50   Triticum urartu
gb|EMT06342.1|  hypothetical protein F775_28583                         186   7e-50   
gb|AAT79486.1|  gigantea 2                                              186   1e-49   Triticum aestivum [Canadian hard winter wheat]
gb|AAQ11738.1|  gigantea                                                186   1e-49   Triticum aestivum [Canadian hard winter wheat]
gb|AAW66945.1|  gigantea-like protein                                   186   1e-49   Hordeum vulgare [barley]
gb|AAT79487.1|  gigantea 3                                              186   1e-49   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008786518.1|  PREDICTED: protein GIGANTEA-like                   179   2e-47   
gb|ADR51711.1|  GI                                                      179   2e-47   Secale cereale
dbj|BAD97869.1|  GI homologue                                           176   3e-46   Lemna gibba
dbj|BAD97864.1|  GI homologue 1                                         175   7e-46   Lemna aequinoctialis
ref|XP_009408933.1|  PREDICTED: protein GIGANTEA-like isoform X1        174   1e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408935.1|  PREDICTED: protein GIGANTEA-like isoform X2        174   2e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADP92454.1|  GIGANTEA 1                                              173   3e-45   x Doritaenopsis hybrid cultivar
ref|XP_009381150.1|  PREDICTED: protein GIGANTEA-like                   173   3e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACY30446.1|  gigantea-like protein                                   168   2e-43   Liriodendron tulipifera
ref|XP_011074106.1|  PREDICTED: protein GIGANTEA-like isoform X2        165   2e-42   
gb|AIR93790.1|  gigantea                                                163   8e-42   Kalanchoe fedtschenkoi [lavender-scallops]
gb|ACT22764.1|  GIGANTEA                                                160   2e-40   Allium cepa
gb|ACT22765.1|  GIGANTEA                                                159   2e-40   Allium cepa
ref|XP_004169554.1|  PREDICTED: protein GIGANTEA-like                   130   3e-34   
dbj|BAP76055.1|  putative GI                                            137   1e-32   Cryptomeria japonica
gb|AGH20049.1|  GI                                                      128   1e-29   Picea abies
gb|ABR18021.1|  unknown                                                 128   2e-29   Picea sitchensis
gb|AAP80607.1|AF469490_1  gigantea-like protein                         117   1e-28   Triticum aestivum [Canadian hard winter wheat]
gb|AFV79301.1|  gigantea                                                115   8e-28   Pinus sylvestris [Scotch pine]
gb|AFV79206.1|  gigantea                                                113   3e-27   Pinus sylvestris [Scotch pine]
gb|AFV79552.1|  gigantea                                                113   3e-27   Pinus pinaster [cluster pine]
gb|AFV79241.1|  gigantea                                                113   4e-27   Pinus sylvestris [Scotch pine]
gb|AFV79204.1|  gigantea                                                113   4e-27   Pinus sylvestris [Scotch pine]
gb|AFV79222.1|  gigantea                                                113   5e-27   Pinus sylvestris [Scotch pine]
gb|AFV79207.1|  gigantea                                                111   2e-26   Pinus sylvestris [Scotch pine]
gb|AFV79294.1|  gigantea                                                110   7e-26   Pinus sylvestris [Scotch pine]
dbj|BAO74118.1|  GIGANTEA                                               112   2e-24   Lotus japonicus
dbj|BAO74110.1|  GIGANTEA                                               112   2e-24   Lotus japonicus
gb|ACF74296.1|  gigantea                                              95.5    5e-21   Arachis hypogaea [goober]
emb|CAJ38397.1|  photoperiodic response / GIGANTEA                    94.4    5e-21   Plantago major [cart-track plant]
ref|XP_002969462.1|  hypothetical protein SELMODRAFT_170553           96.3    8e-19   
emb|CAK26429.1|  putative gigantea                                    89.4    1e-18   Picea abies
ref|XP_002961231.1|  hypothetical protein SELMODRAFT_140066           96.3    1e-18   
emb|CAK26465.1|  putative gigantea                                    89.0    1e-18   Picea abies
emb|CAK26422.1|  putative gigantea                                    89.0    1e-18   Picea abies
emb|CAK26423.1|  putative gigantea                                    89.0    1e-18   Picea abies
ref|XP_004163795.1|  PREDICTED: protein GIGANTEA-like                 94.4    3e-18   
gb|ADM74041.1|  gigantea-like protein                                 87.8    4e-18   Picea sitchensis
emb|CAK26456.1|  putative gigantea                                    87.4    4e-18   Picea abies
gb|KJB28964.1|  hypothetical protein B456_005G077100                  94.0    6e-18   Gossypium raimondii
dbj|BAO66507.1|  GIGANTEA                                             93.2    9e-18   Marchantia polymorpha
gb|ADM74042.1|  gigantea-like protein                                 86.3    1e-17   Picea sitchensis
emb|CAK26451.1|  putative gigantea                                    86.3    1e-17   Picea abies
emb|CAK26444.1|  putative gigantea                                    85.1    3e-17   Picea abies
gb|ADM74075.1|  gigantea-like protein                                 84.7    5e-17   Picea sitchensis
emb|CAK26425.1|  putative gigantea                                    84.3    6e-17   Picea abies
gb|AFW80282.1|  gigantea1A                                            87.0    1e-15   
gb|ADE32590.1|  putative gigantea                                     72.0    1e-12   Picea purpurea
gb|AIE55309.1|  gigantea                                              72.0    1e-12   Picea smithiana
gb|ADE32537.1|  putative gigantea                                     71.6    1e-12   Picea likiangensis [Likiang spruce]
gb|AGK38575.1|  putative gigantea protein                             71.6    2e-12   Picea wilsonii
gb|AHC92686.1|  putative gigantea                                     71.6    2e-12   Picea morrisonicola
gb|ADE32606.1|  putative gigantea                                     71.2    2e-12   Picea schrenkiana
gb|AGV41761.1|  gigantea                                              71.2    2e-12   Picea likiangensis var. linzhiensis
gb|ADE32551.1|  putative gigantea                                     70.5    3e-12   Picea likiangensis [Likiang spruce]
gb|ADE32622.1|  putative gigantea                                     70.5    4e-12   Picea wilsonii
gb|ADE32566.1|  putative gigantea                                     70.5    4e-12   Picea likiangensis [Likiang spruce]
gb|ADE32592.1|  putative gigantea                                     70.1    6e-12   Picea purpurea
gb|AGK39934.1|  putative gigantea                                     69.7    7e-12   Picea purpurea
gb|AGK39885.1|  putative gigantea                                     68.9    1e-11   Picea purpurea
gb|KJB59492.1|  hypothetical protein B456_009G258800                  40.0    5e-04   Gossypium raimondii



>dbj|BAK19067.1| GIGANTEA [Ipomoea nil]
Length=1166

 Score =   304 bits (779),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 147/147 (100%), Positives = 147/147 (100%), Gaps = 0/147 (0%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP
Sbjct  1020  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  1079

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE
Sbjct  1080  SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  1139

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHSQLANGMSAEFLDTAAKELGCTISV
Sbjct  1140  AHSQLANGMSAEFLDTAAKELGCTISV  1166



>gb|AEK05861.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05866.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05871.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05876.1| gigantea-5, partial [Populus balsamifera]
Length=173

 Score =   230 bits (587),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACTLPQLELLE TARAVQPVL+WGESG AVADGLSNLLKCR+PAT+RCLSHP
Sbjct  28   DGMLVDGEACTLPQLELLEATARAVQPVLQWGESGFAVADGLSNLLKCRLPATIRCLSHP  87

Query  556  SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
            SAHVRALS SVLR I H+GSIK  +K  + NGIHGP+YQ L     I+WQADIE+CL  E
Sbjct  88   SAHVRALSTSVLRDIQHTGSIKPASKLTHRNGIHGPSYQYLR-SDVINWQADIEKCLTWE  146

Query  376  AHSQLANGMSAEFLDTAAKELGCTISV  296
            AHS+LA GM    LDTAAKELGCTIS+
Sbjct  147  AHSRLATGMPVHHLDTAAKELGCTISI  173



>gb|AEK05881.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05886.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05891.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05896.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05901.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05906.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05911.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05916.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05921.1| gigantea-5, partial [Populus balsamifera]
Length=173

 Score =   229 bits (584),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACTLPQLELLE TARAVQPVL+WGESG AVADGLSNLLKCR+PAT+RCLSHP
Sbjct  28   DGMLVDGEACTLPQLELLEATARAVQPVLQWGESGFAVADGLSNLLKCRLPATIRCLSHP  87

Query  556  SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
            SAHVRALS SVLR I H+GSIK  +K    NGIHGP+YQ       I+WQADIE+CL  E
Sbjct  88   SAHVRALSTSVLRDIQHTGSIKPASKLTQRNGIHGPSYQYFR-SDVINWQADIEKCLTWE  146

Query  376  AHSQLANGMSAEFLDTAAKELGCTISV  296
            AHS+LA GM    LDTAAKELGCTIS+
Sbjct  147  AHSRLATGMPVHHLDTAAKELGCTISI  173



>gb|AEK05816.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05821.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05826.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05831.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05836.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05841.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05846.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05851.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05856.1| gigantea-5, partial [Populus balsamifera]
Length=173

 Score =   227 bits (579),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACTLPQLELLE TARAVQPVL+WGESG AVADGLSNLLKCR+PAT+RCLSHP
Sbjct  28   DGMLVDGEACTLPQLELLEATARAVQPVLQWGESGFAVADGLSNLLKCRLPATIRCLSHP  87

Query  556  SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
            SAHVRALS SVLR I H+GSIK  +K    NGIHGP+YQ       I+WQADIE+CL  E
Sbjct  88   SAHVRALSTSVLRDIQHTGSIKPASKLTXRNGIHGPSYQYXR-SDVINWQADIEKCLTWE  146

Query  376  AHSQLANGMSAEFLDTAAKELGCTISV  296
            AHS+LA GM    LDTAAKELGCTIS+
Sbjct  147  AHSRLATGMPVHHLDTAAKELGCTISI  173



>ref|XP_007019604.1| Gigantea protein isoform 4 [Theobroma cacao]
 gb|EOY16829.1| Gigantea protein isoform 4 [Theobroma cacao]
Length=1147

 Score =   244 bits (622),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLEWGESGLAVADGLSNLLKCR+PAT RCLSHP
Sbjct  1002  DGMLVDGEACTLPQLELLEATARAVQPVLEWGESGLAVADGLSNLLKCRLPATTRCLSHP  1061

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR ILH+GSIK  +K V +NGIHGP+YQ  +V G IDW  DIE+CL  E
Sbjct  1062  SAHVRALSTSVLRNILHAGSIKPNSKQVEINGIHGPSYQYFSV-GVIDWHTDIEKCLTWE  1120

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHSQLA GM   FLDTAAKELGC+IS+
Sbjct  1121  AHSQLARGMPIRFLDTAAKELGCSISI  1147



>ref|XP_007019601.1| Gigantea protein isoform 1 [Theobroma cacao]
 ref|XP_007019602.1| Gigantea protein isoform 1 [Theobroma cacao]
 gb|EOY16826.1| Gigantea protein isoform 1 [Theobroma cacao]
 gb|EOY16827.1| Gigantea protein isoform 1 [Theobroma cacao]
Length=1170

 Score =   244 bits (622),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLEWGESGLAVADGLSNLLKCR+PAT RCLSHP
Sbjct  1025  DGMLVDGEACTLPQLELLEATARAVQPVLEWGESGLAVADGLSNLLKCRLPATTRCLSHP  1084

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR ILH+GSIK  +K V +NGIHGP+YQ  +V G IDW  DIE+CL  E
Sbjct  1085  SAHVRALSTSVLRNILHAGSIKPNSKQVEINGIHGPSYQYFSV-GVIDWHTDIEKCLTWE  1143

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHSQLA GM   FLDTAAKELGC+IS+
Sbjct  1144  AHSQLARGMPIRFLDTAAKELGCSISI  1170



>ref|XP_007019603.1| Gigantea protein isoform 3 [Theobroma cacao]
 gb|EOY16828.1| Gigantea protein isoform 3 [Theobroma cacao]
Length=1171

 Score =   244 bits (622),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLEWGESGLAVADGLSNLLKCR+PAT RCLSHP
Sbjct  1026  DGMLVDGEACTLPQLELLEATARAVQPVLEWGESGLAVADGLSNLLKCRLPATTRCLSHP  1085

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR ILH+GSIK  +K V +NGIHGP+YQ  +V G IDW  DIE+CL  E
Sbjct  1086  SAHVRALSTSVLRNILHAGSIKPNSKQVEINGIHGPSYQYFSV-GVIDWHTDIEKCLTWE  1144

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHSQLA GM   FLDTAAKELGC+IS+
Sbjct  1145  AHSQLARGMPIRFLDTAAKELGCSISI  1171



>gb|AEK26576.1| gigantea 5 [Populus tremula]
Length=179

 Score =   224 bits (571),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACTLPQLELLE TARAVQPVL+WGESG AVADGLSNLLKCR+PAT+RCLSHP
Sbjct  34   DGMLVDGEACTLPQLELLEATARAVQPVLQWGESGFAVADGLSNLLKCRLPATIRCLSHP  93

Query  556  SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
            SAHVRALS SVLR I  +GS+K  +K  + NGIHGP+YQ       I+WQADIE+CL  E
Sbjct  94   SAHVRALSTSVLRDIQQTGSMKPASKLTHRNGIHGPSYQYFR-SDVINWQADIEKCLTWE  152

Query  376  AHSQLANGMSAEFLDTAAKELGCTISV  296
            AHS+LA GM    LD+AAKELGCTIS+
Sbjct  153  AHSRLATGMPVHHLDSAAKELGCTISI  179



>ref|XP_007199688.1| hypothetical protein PRUPE_ppa000556mg [Prunus persica]
 gb|EMJ00887.1| hypothetical protein PRUPE_ppa000556mg [Prunus persica]
Length=1098

 Score =   238 bits (607),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVLEWGESGLAVADGLSNLLKCR+PAT+RCLSHP
Sbjct  953   DGMLVDGEACTLPQLELLEATARAIQPVLEWGESGLAVADGLSNLLKCRLPATIRCLSHP  1012

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR IL + SI+    PV +NGIHGP+Y+  N+   IDWQAD+E+CL  E
Sbjct  1013  SAHVRALSTSVLRDILQTSSIRPNPNPVEINGIHGPSYKYFNL-DVIDWQADVEKCLTWE  1071

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+LA GM  +FLDTAAKELGC+IS+
Sbjct  1072  AHSRLATGMPIKFLDTAAKELGCSISI  1098



>ref|XP_008237480.1| PREDICTED: protein GIGANTEA [Prunus mume]
 ref|XP_008237481.1| PREDICTED: protein GIGANTEA [Prunus mume]
 ref|XP_008237482.1| PREDICTED: protein GIGANTEA [Prunus mume]
 ref|XP_008237483.1| PREDICTED: protein GIGANTEA [Prunus mume]
Length=1170

 Score =   239 bits (609),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVLEWGESGLAVADGLSNLLKCR+PAT+RCLSHP
Sbjct  1025  DGMLVDGEACTLPQLELLEATARAIQPVLEWGESGLAVADGLSNLLKCRLPATIRCLSHP  1084

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR IL + SI+    PV +NGIHGP+Y+  N+   IDWQAD+E+CL  E
Sbjct  1085  SAHVRALSTSVLRDILQTSSIRPNPNPVEINGIHGPSYKYFNL-DVIDWQADVEKCLTWE  1143

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+LA GM  +FLDTAAKELGC+IS+
Sbjct  1144  AHSRLATGMPIKFLDTAAKELGCSISI  1170



>ref|XP_011100590.1| PREDICTED: protein GIGANTEA-like [Sesamum indicum]
Length=1166

 Score =   238 bits (608),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 131/147 (89%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGL+NLLKCR+PATVRC+SHP
Sbjct  1021  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLTNLLKCRLPATVRCVSHP  1080

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLRAILH+GS KS+ K V +NGIH P +Q +NV  T DW+ADIE+CL  E
Sbjct  1081  SAHVRALSTSVLRAILHAGSTKSKGKQVGVNGIHRPPFQYINVDVT-DWRADIEKCLTWE  1139

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+LA G+  +F++TAAKELGCTIS+
Sbjct  1140  AHSRLATGLPIQFVNTAAKELGCTISI  1166



>gb|AJC01622.1| gigantea [Prunus dulcis]
Length=1170

 Score =   238 bits (608),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVLEWGESGLAVADGLSNLLKCR+PAT+RCLSHP
Sbjct  1025  DGMLVDGEACTLPQLELLEATARAIQPVLEWGESGLAVADGLSNLLKCRLPATIRCLSHP  1084

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR IL + SI+    PV +NGIHGP+Y+  N+   IDWQAD+E+CL  E
Sbjct  1085  SAHVRALSTSVLRDILQTSSIRPNPNPVEINGIHGPSYKYFNL-DVIDWQADVEKCLTWE  1143

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+LA GM  +FLDTAAKELGC+IS+
Sbjct  1144  AHSRLATGMPIKFLDTAAKELGCSISI  1170



>ref|XP_006473108.1| PREDICTED: protein GIGANTEA-like [Citrus sinensis]
Length=249

 Score =   222 bits (566),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACTLPQLELLE TARA+QP+L WG+SGLA+ADGLSNLLKCR+PAT+RCLSHP
Sbjct  104  DGMLVDGEACTLPQLELLEATARAIQPILRWGKSGLAIADGLSNLLKCRLPATIRCLSHP  163

Query  556  SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
            SAHVRALS SVLR  LH+ S KS  + V  NGIHG +    N+   I+WQ+DIE+CL  E
Sbjct  164  SAHVRALSTSVLRDFLHTSSFKSNIEQVERNGIHGSSLHYFNIDA-INWQSDIEKCLTWE  222

Query  376  AHSQLANGMSAEFLDTAAKELGCTISV  296
            AHS+LA GM  +FLD AAKELGCTIS+
Sbjct  223  AHSRLATGMPIQFLDIAAKELGCTISI  249



>ref|XP_002524341.1| Protein GIGANTEA, putative [Ricinus communis]
 gb|EEF38081.1| Protein GIGANTEA, putative [Ricinus communis]
Length=1161

 Score =   238 bits (607),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLEWGESG AVADGLSNLLKCR+PAT+RCLSHP
Sbjct  1016  DGMLVDGEACTLPQLELLEATARAVQPVLEWGESGFAVADGLSNLLKCRLPATIRCLSHP  1075

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRA+S SVLR IL++GSIK  +  V++NGI GP+YQ  N+  T DWQ DIE+CL  E
Sbjct  1076  SAHVRAVSTSVLRGILYTGSIKRTSNRVDINGIRGPSYQYFNIDVT-DWQTDIEKCLTWE  1134

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+LA GM  +FLDTAAKELGCTIS+
Sbjct  1135  AHSRLATGMPIQFLDTAAKELGCTISI  1161



>emb|CDP11443.1| unnamed protein product [Coffea canephora]
Length=1167

 Score =   238 bits (606),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 129/147 (88%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVL+WGESGLAVADGL NLLKCR+PATVRCLSHP
Sbjct  1022  DGMLVDGEACTLPQLELLEATARAVQPVLKWGESGLAVADGLLNLLKCRLPATVRCLSHP  1081

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLRAIL++GS+K+  K V+ NGIHGPAYQ L+VG  ++WQ DIE+CL  E
Sbjct  1082  SAHVRALSTSVLRAILYAGSLKASGKKVDKNGIHGPAYQYLSVGN-VNWQTDIEKCLTWE  1140

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS LA GM  +FL TAAKELGCTI++
Sbjct  1141  AHSLLATGMPTQFLSTAAKELGCTITI  1167



>dbj|BAJ22595.1| GIGANTEA [Glycine max]
Length=1168

 Score =   237 bits (604),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 128/147 (87%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLE+GESGLAVADGLSNLLKCR+ AT+RCLSHP
Sbjct  1023  DGMLVDGEACTLPQLELLEATARAVQPVLEFGESGLAVADGLSNLLKCRLSATIRCLSHP  1082

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALSISVLR ILH+GSI+   KP  +NG H P+YQ  N+   IDWQADIE+CL  E
Sbjct  1083  SAHVRALSISVLRDILHTGSIRCSPKPRRLNGTHNPSYQYFNL-DVIDWQADIEKCLTWE  1141

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+L+NG+S  FLDTAAKELGCTIS+
Sbjct  1142  AHSRLSNGLSINFLDTAAKELGCTISM  1168



>ref|XP_004290483.1| PREDICTED: protein GIGANTEA [Fragaria vesca subsp. vesca]
 ref|XP_011458472.1| PREDICTED: protein GIGANTEA [Fragaria vesca subsp. vesca]
 ref|XP_011458473.1| PREDICTED: protein GIGANTEA [Fragaria vesca subsp. vesca]
Length=1178

 Score =   237 bits (604),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAV+PVLEWGESGLAVADGLSNLLKCR+ AT+RCLSHP
Sbjct  1033  DGMLVDGEACTLPQLELLEATARAVKPVLEWGESGLAVADGLSNLLKCRLSATIRCLSHP  1092

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS+SVLR IL + S++    PV +NGIHGP+Y+  N+   IDWQADIE+CL  E
Sbjct  1093  SAHVRALSVSVLRDILQTSSVRPNPNPVQINGIHGPSYKYFNL-DVIDWQADIEKCLTWE  1151

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+LA GM  +FLDTAAKELGCTISV
Sbjct  1152  AHSRLATGMPIKFLDTAAKELGCTISV  1178



>gb|ACJ65312.1| GI1 protein [Glycine max]
Length=1176

 Score =   236 bits (603),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 128/147 (87%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLE+GESGLAVADGLSNLLKCR+ AT+RCLSHP
Sbjct  1031  DGMLVDGEACTLPQLELLEATARAVQPVLEFGESGLAVADGLSNLLKCRLSATIRCLSHP  1090

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALSISVLR ILH+GSI+   KP  +NG H P+YQ  N+   IDWQADIE+CL  E
Sbjct  1091  SAHVRALSISVLRDILHTGSIRCSPKPRRLNGTHNPSYQYFNL-DVIDWQADIEKCLTWE  1149

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+L+NG+S  FLDTAAKELGCTIS+
Sbjct  1150  AHSRLSNGLSINFLDTAAKELGCTISM  1176



>ref|XP_003556164.1| PREDICTED: protein GIGANTEA isoformX1 [Glycine max]
 ref|XP_006606175.1| PREDICTED: protein GIGANTEA isoform X2 [Glycine max]
 ref|XP_006606176.1| PREDICTED: protein GIGANTEA isoform X3 [Glycine max]
 ref|XP_006606177.1| PREDICTED: protein GIGANTEA isoform X4 [Glycine max]
 gb|ACA24489.1| gigantea-like protein 1 [Glycine max]
Length=1175

 Score =   236 bits (603),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 128/147 (87%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLE+GESGLAVADGLSNLLKCR+ AT+RCLSHP
Sbjct  1030  DGMLVDGEACTLPQLELLEATARAVQPVLEFGESGLAVADGLSNLLKCRLSATIRCLSHP  1089

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALSISVLR ILH+GSI+   KP  +NG H P+YQ  N+   IDWQADIE+CL  E
Sbjct  1090  SAHVRALSISVLRDILHTGSIRCSPKPRRLNGTHNPSYQYFNL-DVIDWQADIEKCLTWE  1148

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+L+NG+S  FLDTAAKELGCTIS+
Sbjct  1149  AHSRLSNGLSINFLDTAAKELGCTISM  1175



>ref|XP_009631435.1| PREDICTED: protein GIGANTEA-like isoform X6 [Nicotiana tomentosiformis]
Length=945

 Score =   235 bits (599),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 131/147 (89%), Gaps = 1/147 (1%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLA+ADGLSNLLKCR+PATVRC+SHP
Sbjct  800  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAIADGLSNLLKCRLPATVRCISHP  859

Query  556  SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
            SA VRALS SVLR I+H+GS+KS AK  ++NGIHGPAY+ L++ G IDW+ADIE+CL  E
Sbjct  860  SALVRALSTSVLRVIMHAGSLKSSAKRADVNGIHGPAYKYLSI-GIIDWRADIEKCLTWE  918

Query  376  AHSQLANGMSAEFLDTAAKELGCTISV  296
            A+S++ NGM  +FLD AAKELGCTI +
Sbjct  919  ANSRIENGMCTKFLDIAAKELGCTICI  945



>ref|XP_009631436.1| PREDICTED: protein GIGANTEA-like isoform X7 [Nicotiana tomentosiformis]
Length=941

 Score =   235 bits (599),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 131/147 (89%), Gaps = 1/147 (1%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLA+ADGLSNLLKCR+PATVRC+SHP
Sbjct  796  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAIADGLSNLLKCRLPATVRCISHP  855

Query  556  SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
            SA VRALS SVLR I+H+GS+KS AK  ++NGIHGPAY+ L++ G IDW+ADIE+CL  E
Sbjct  856  SALVRALSTSVLRVIMHAGSLKSSAKRADVNGIHGPAYKYLSI-GIIDWRADIEKCLTWE  914

Query  376  AHSQLANGMSAEFLDTAAKELGCTISV  296
            A+S++ NGM  +FLD AAKELGCTI +
Sbjct  915  ANSRIENGMCTKFLDIAAKELGCTICI  941



>ref|XP_008386373.1| PREDICTED: protein GIGANTEA-like [Malus domestica]
Length=1169

 Score =   236 bits (602),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QP+LEWGESGLAV+DGLSNLLKCR+PAT+RCLSHP
Sbjct  1024  DGMLVDGEACTLPQLELLEATARAIQPMLEWGESGLAVSDGLSNLLKCRLPATIRCLSHP  1083

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR IL + SI+    PV +NGIHGP+Y+  N+   IDWQADIE+CL  E
Sbjct  1084  SAHVRALSTSVLRDILQASSIRPNPNPVEINGIHGPSYKYFNL-DVIDWQADIEKCLTWE  1142

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+LA GM  +FLDTAAKELGC+IS+
Sbjct  1143  AHSRLATGMHIKFLDTAAKELGCSISI  1169



>ref|XP_009335139.1| PREDICTED: protein GIGANTEA-like [Pyrus x bretschneideri]
 ref|XP_009335140.1| PREDICTED: protein GIGANTEA-like [Pyrus x bretschneideri]
Length=1169

 Score =   236 bits (602),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QP+LEWGESGLAV+DGLSNLLKCR+PAT+RCLSHP
Sbjct  1024  DGMLVDGEACTLPQLELLEATARAIQPMLEWGESGLAVSDGLSNLLKCRLPATIRCLSHP  1083

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR IL + SI+    PV +NGIHGP+Y+  N+   IDWQADIE+CL  E
Sbjct  1084  SAHVRALSTSVLRDILQASSIRPNPNPVEINGIHGPSYKYFNL-DVIDWQADIEKCLTWE  1142

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+LA GM  +FLDTAAKELGC+IS+
Sbjct  1143  AHSRLATGMHIKFLDTAAKELGCSISI  1169



>ref|XP_009772049.1| PREDICTED: protein GIGANTEA-like [Nicotiana sylvestris]
Length=1155

 Score =   236 bits (601),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 131/147 (89%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLA+ADGLSNLLKCR+PATVRC+SHP
Sbjct  1010  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAIADGLSNLLKCRLPATVRCISHP  1069

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SA VRALS SVLR I+H+GSIKS AK  ++NGIHGPAY+ L++ G IDW+ADIE+CL  E
Sbjct  1070  SALVRALSTSVLRVIMHAGSIKSSAKRADVNGIHGPAYKYLSI-GIIDWRADIEKCLTWE  1128

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             A+S++ NGM  +FLD AAKELGCTI +
Sbjct  1129  ANSRIENGMCTKFLDMAAKELGCTICI  1155



>gb|KHN46389.1| Protein GIGANTEA, partial [Glycine soja]
Length=1157

 Score =   235 bits (600),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLE+GESGLAVADGLSNLLKCR+ AT+RCLSHP
Sbjct  1012  DGMLVDGEACTLPQLELLEATARAVQPVLEFGESGLAVADGLSNLLKCRLSATIRCLSHP  1071

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALSISVLR ILH+GSI+   KP  +NG H P+YQ  N+   IDWQADIE+CL  E
Sbjct  1072  SAHVRALSISVLRDILHTGSIRCSPKPRRLNGTHNPSYQYFNL-DVIDWQADIEKCLTWE  1130

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+L+NG+S  FLDT AKELGCTIS+
Sbjct  1131  AHSRLSNGLSINFLDTTAKELGCTISM  1157



>ref|XP_006359039.1| PREDICTED: protein GIGANTEA-like isoform X1 [Solanum tuberosum]
Length=1189

 Score =   235 bits (600),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 131/147 (89%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARAVQP+LEWGESG ++ DGLSNLLKCR+PATV C+SHP
Sbjct  1044  DGMLVDGEACTLPQLELLEVTARAVQPMLEWGESGSSIVDGLSNLLKCRLPATVHCISHP  1103

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SA VRALSIS+LRAI+H+GSIK+RAK  ++NGIHGPAY+ LN+ GTI+WQ DIE+CL  E
Sbjct  1104  SAIVRALSISLLRAIMHTGSIKTRAKRADVNGIHGPAYKYLNI-GTINWQRDIEKCLTWE  1162

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             A+S++ NGM  EFLD AAKELGCTI +
Sbjct  1163  ANSRIENGMCTEFLDMAAKELGCTIFI  1189



>ref|XP_006359040.1| PREDICTED: protein GIGANTEA-like isoform X2 [Solanum tuberosum]
Length=1166

 Score =   235 bits (599),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 131/147 (89%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARAVQP+LEWGESG ++ DGLSNLLKCR+PATV C+SHP
Sbjct  1021  DGMLVDGEACTLPQLELLEVTARAVQPMLEWGESGSSIVDGLSNLLKCRLPATVHCISHP  1080

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SA VRALSIS+LRAI+H+GSIK+RAK  ++NGIHGPAY+ LN+ GTI+WQ DIE+CL  E
Sbjct  1081  SAIVRALSISLLRAIMHTGSIKTRAKRADVNGIHGPAYKYLNI-GTINWQRDIEKCLTWE  1139

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             A+S++ NGM  EFLD AAKELGCTI +
Sbjct  1140  ANSRIENGMCTEFLDMAAKELGCTIFI  1166



>ref|XP_011042897.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
 ref|XP_011042898.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
 ref|XP_011042899.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
Length=1169

 Score =   234 bits (598),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLEWGESGLAVADGLSNLLKCR+PAT++CLSHP
Sbjct  1024  DGMLVDGEACTLPQLELLEATARAVQPVLEWGESGLAVADGLSNLLKCRLPATIQCLSHP  1083

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALSISVLR IL +GSIK  +K  + NGIHGP+YQ  +    IDWQADIE+CL  E
Sbjct  1084  SAHVRALSISVLRDILRTGSIKPSSKRADRNGIHGPSYQYFS-PDKIDWQADIEKCLTWE  1142

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+LA GM    LDTAAKELGCTIS+
Sbjct  1143  AHSRLATGMPIHHLDTAAKELGCTISI  1169



>ref|XP_009631431.1| PREDICTED: protein GIGANTEA-like isoform X2 [Nicotiana tomentosiformis]
Length=1169

 Score =   234 bits (598),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 131/147 (89%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLA+ADGLSNLLKCR+PATVRC+SHP
Sbjct  1024  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAIADGLSNLLKCRLPATVRCISHP  1083

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SA VRALS SVLR I+H+GS+KS AK  ++NGIHGPAY+ L++ G IDW+ADIE+CL  E
Sbjct  1084  SALVRALSTSVLRVIMHAGSLKSSAKRADVNGIHGPAYKYLSI-GIIDWRADIEKCLTWE  1142

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             A+S++ NGM  +FLD AAKELGCTI +
Sbjct  1143  ANSRIENGMCTKFLDIAAKELGCTICI  1169



>ref|XP_009631429.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009631430.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nicotiana tomentosiformis]
Length=1173

 Score =   234 bits (598),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 131/147 (89%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLA+ADGLSNLLKCR+PATVRC+SHP
Sbjct  1028  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAIADGLSNLLKCRLPATVRCISHP  1087

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SA VRALS SVLR I+H+GS+KS AK  ++NGIHGPAY+ L++ G IDW+ADIE+CL  E
Sbjct  1088  SALVRALSTSVLRVIMHAGSLKSSAKRADVNGIHGPAYKYLSI-GIIDWRADIEKCLTWE  1146

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             A+S++ NGM  +FLD AAKELGCTI +
Sbjct  1147  ANSRIENGMCTKFLDIAAKELGCTICI  1173



>ref|XP_009631434.1| PREDICTED: protein GIGANTEA-like isoform X5 [Nicotiana tomentosiformis]
Length=1155

 Score =   234 bits (598),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 131/147 (89%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLA+ADGLSNLLKCR+PATVRC+SHP
Sbjct  1010  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAIADGLSNLLKCRLPATVRCISHP  1069

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SA VRALS SVLR I+H+GS+KS AK  ++NGIHGPAY+ L++ G IDW+ADIE+CL  E
Sbjct  1070  SALVRALSTSVLRVIMHAGSLKSSAKRADVNGIHGPAYKYLSI-GIIDWRADIEKCLTWE  1128

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             A+S++ NGM  +FLD AAKELGCTI +
Sbjct  1129  ANSRIENGMCTKFLDIAAKELGCTICI  1155



>ref|XP_009631432.1| PREDICTED: protein GIGANTEA-like isoform X3 [Nicotiana tomentosiformis]
Length=1165

 Score =   234 bits (598),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 131/147 (89%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLA+ADGLSNLLKCR+PATVRC+SHP
Sbjct  1020  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAIADGLSNLLKCRLPATVRCISHP  1079

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SA VRALS SVLR I+H+GS+KS AK  ++NGIHGPAY+ L++ G IDW+ADIE+CL  E
Sbjct  1080  SALVRALSTSVLRVIMHAGSLKSSAKRADVNGIHGPAYKYLSI-GIIDWRADIEKCLTWE  1138

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             A+S++ NGM  +FLD AAKELGCTI +
Sbjct  1139  ANSRIENGMCTKFLDIAAKELGCTICI  1165



>gb|KJB59489.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=802

 Score =   232 bits (592),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACTLPQLELLE TARAVQPVLEWGESGLAVADGLSNLLKCR+PAT RCLSHP
Sbjct  658  DGMLVDGEACTLPQLELLEATARAVQPVLEWGESGLAVADGLSNLLKCRLPATTRCLSHP  717

Query  556  SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
            SAHVRALS SVLR ILH GSI S++K + + GI GP+YQ  N+G  I+WQ DIE+CL  E
Sbjct  718  SAHVRALSTSVLRNILHIGSINSKSK-LEIYGIRGPSYQFFNIGA-INWQTDIEKCLTWE  775

Query  376  AHSQLANGMSAEFLDTAAKELGCTISV  296
             +SQLA GM+ +FLDTAAKELGC IS+
Sbjct  776  VYSQLARGMTIQFLDTAAKELGCNISI  802



>ref|XP_009631433.1| PREDICTED: protein GIGANTEA-like isoform X4 [Nicotiana tomentosiformis]
Length=1159

 Score =   234 bits (598),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 131/147 (89%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLA+ADGLSNLLKCR+PATVRC+SHP
Sbjct  1014  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAIADGLSNLLKCRLPATVRCISHP  1073

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SA VRALS SVLR I+H+GS+KS AK  ++NGIHGPAY+ L++ G IDW+ADIE+CL  E
Sbjct  1074  SALVRALSTSVLRVIMHAGSLKSSAKRADVNGIHGPAYKYLSI-GIIDWRADIEKCLTWE  1132

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             A+S++ NGM  +FLD AAKELGCTI +
Sbjct  1133  ANSRIENGMCTKFLDIAAKELGCTICI  1159



>ref|XP_004237832.1| PREDICTED: protein GIGANTEA [Solanum lycopersicum]
Length=1167

 Score =   234 bits (597),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 130/147 (88%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESG  + DGLSNLLKCR+PATVRC+SHP
Sbjct  1022  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGSVIVDGLSNLLKCRLPATVRCISHP  1081

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SA VRALSIS+LRAI+ +GSIK+RA   ++NGIHGPAY+ LN+ GTI+WQ DIE+CL  E
Sbjct  1082  SALVRALSISLLRAIMQTGSIKTRANRADVNGIHGPAYKYLNI-GTINWQRDIEKCLTWE  1140

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             A+S++ NGM  +FLD AAKELGCTIS+
Sbjct  1141  ANSRIENGMCTQFLDMAAKELGCTISI  1167



>ref|XP_006588466.1| PREDICTED: uncharacterized protein LOC100800578 isoform X1 [Glycine 
max]
 ref|XP_006588467.1| PREDICTED: uncharacterized protein LOC100800578 isoform X2 [Glycine 
max]
 ref|XP_006588468.1| PREDICTED: uncharacterized protein LOC100800578 isoform X3 [Glycine 
max]
Length=1177

 Score =   234 bits (597),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLE+GESGLAVADGLSNLLKCR+ AT+RCLSHP
Sbjct  1032  DGMLVDGEACTLPQLELLEATARAVQPVLEFGESGLAVADGLSNLLKCRLSATIRCLSHP  1091

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALSISVLR ILH+GSI+   KP  +NG H P+YQ  N+   +DWQADIE+CL  E
Sbjct  1092  SAHVRALSISVLRDILHTGSIRCSPKPRRLNGTHNPSYQYFNLDA-VDWQADIEKCLTWE  1150

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+L+NG+S  FLD AAKELGCTIS+
Sbjct  1151  AHSRLSNGLSINFLDIAAKELGCTISM  1177



>gb|KHN17039.1| Protein GIGANTEA [Glycine soja]
Length=1149

 Score =   234 bits (596),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLE+GESGLAVADGLSNLLKCR+ AT+RCLSHP
Sbjct  1004  DGMLVDGEACTLPQLELLEATARAVQPVLEFGESGLAVADGLSNLLKCRLSATIRCLSHP  1063

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALSISVLR ILH+GSI+   KP  +NG H P+YQ  N+   +DWQADIE+CL  E
Sbjct  1064  SAHVRALSISVLRDILHTGSIRCSPKPRRLNGTHNPSYQYFNLDA-VDWQADIEKCLTWE  1122

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+L+NG+S  FLD AAKELGCTIS+
Sbjct  1123  AHSRLSNGLSINFLDIAAKELGCTISM  1149



>ref|NP_001239995.1| uncharacterized protein LOC100800578 [Glycine max]
 gb|ACJ65313.1| GI2 protein [Glycine max]
 dbj|BAJ22594.1| GIGANTEA [Glycine max]
Length=1170

 Score =   234 bits (597),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLE+GESGLAVADGLSNLLKCR+ AT+RCLSHP
Sbjct  1025  DGMLVDGEACTLPQLELLEATARAVQPVLEFGESGLAVADGLSNLLKCRLSATIRCLSHP  1084

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALSISVLR ILH+GSI+   KP  +NG H P+YQ  N+   +DWQADIE+CL  E
Sbjct  1085  SAHVRALSISVLRDILHTGSIRCSPKPRRLNGTHNPSYQYFNLDA-VDWQADIEKCLTWE  1143

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+L+NG+S  FLD AAKELGCTIS+
Sbjct  1144  AHSRLSNGLSINFLDIAAKELGCTISM  1170



>dbj|BAN82589.1| gigantea [Glycine max]
Length=1171

 Score =   234 bits (597),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLE+GESGLAVADGLSNLLKCR+ AT+RCLSHP
Sbjct  1026  DGMLVDGEACTLPQLELLEATARAVQPVLEFGESGLAVADGLSNLLKCRLSATIRCLSHP  1085

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALSISVLR ILH+GSI+   KP  +NG H P+YQ  N+   +DWQADIE+CL  E
Sbjct  1086  SAHVRALSISVLRDILHTGSIRCSPKPRRLNGTHNPSYQYFNLDA-VDWQADIEKCLTWE  1144

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+L+NG+S  FLD AAKELGCTIS+
Sbjct  1145  AHSRLSNGLSINFLDIAAKELGCTISM  1171



>dbj|BAN82581.1| gigantea [Glycine max]
 dbj|BAN82582.1| gigantea [Glycine max]
 dbj|BAN82583.1| gigantea [Glycine max]
 dbj|BAN82584.1| gigantea [Glycine max]
 dbj|BAN82585.1| gigantea [Glycine max]
 dbj|BAN82587.1| gigantea [Glycine max]
 dbj|BAN82588.1| gigantea [Glycine max]
Length=1170

 Score =   234 bits (597),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLE+GESGLAVADGLSNLLKCR+ AT+RCLSHP
Sbjct  1025  DGMLVDGEACTLPQLELLEATARAVQPVLEFGESGLAVADGLSNLLKCRLSATIRCLSHP  1084

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALSISVLR ILH+GSI+   KP  +NG H P+YQ  N+   +DWQADIE+CL  E
Sbjct  1085  SAHVRALSISVLRDILHTGSIRCSPKPRRLNGTHNPSYQYFNLDA-VDWQADIEKCLTWE  1143

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+L+NG+S  FLD AAKELGCTIS+
Sbjct  1144  AHSRLSNGLSINFLDIAAKELGCTISM  1170



>dbj|BAN82586.1| gigantea [Glycine max]
 dbj|BAN82590.1| gigantea [Glycine max]
 dbj|BAN82591.1| gigantea [Glycine max]
 dbj|BAN82592.1| gigantea [Glycine max]
Length=1170

 Score =   234 bits (596),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLE+GESGLAVADGLSNLLKCR+ AT+RCLSHP
Sbjct  1025  DGMLVDGEACTLPQLELLEATARAVQPVLEFGESGLAVADGLSNLLKCRLSATIRCLSHP  1084

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALSISVLR ILH+GSI+   KP  +NG H P+YQ  N+   +DWQADIE+CL  E
Sbjct  1085  SAHVRALSISVLRDILHTGSIRCSPKPRRLNGTHNPSYQYFNLDA-VDWQADIEKCLTWE  1143

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+L+NG+S  FLD AAKELGCTIS+
Sbjct  1144  AHSRLSNGLSINFLDIAAKELGCTISM  1170



>gb|AII99806.1| gigantea [Dimocarpus longan]
Length=1171

 Score =   234 bits (596),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVLEWGESGLAVADGLSNLLKCR+PAT+RCLSHP
Sbjct  1026  DGMLVDGEACTLPQLELLEATARAIQPVLEWGESGLAVADGLSNLLKCRLPATIRCLSHP  1085

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR ILH+ S KS +K + +NGI  P YQ  N+   IDW AD E+CL  E
Sbjct  1086  SAHVRALSTSVLRDILHTTSSKSNSKQIEINGICSPPYQYFNIDA-IDWHADTEKCLTWE  1144

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+LA GMS +FLDTAAKELGCTIS+
Sbjct  1145  AHSRLATGMSIQFLDTAAKELGCTISI  1171



>ref|XP_008381855.1| PREDICTED: protein GIGANTEA-like [Malus domestica]
Length=1170

 Score =   233 bits (595),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QP+LEWGESGLAVADGLSNLLKCR+PAT+RCLSHP
Sbjct  1025  DGMLVDGEACTLPQLELLEATARAIQPMLEWGESGLAVADGLSNLLKCRLPATIRCLSHP  1084

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR IL + SI+    PV ++GIHGP+Y+  N+   IDWQ DIE+CL  E
Sbjct  1085  SAHVRALSTSVLRDILQASSIRPNPNPVEIDGIHGPSYKYFNL-DVIDWQGDIEKCLTWE  1143

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+LA GM  +FLDTAAKELGC+IS+
Sbjct  1144  AHSRLATGMQIKFLDTAAKELGCSISL  1170



>gb|KJB59490.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=1022

 Score =   232 bits (592),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLEWGESGLAVADGLSNLLKCR+PAT RCLSHP
Sbjct  878   DGMLVDGEACTLPQLELLEATARAVQPVLEWGESGLAVADGLSNLLKCRLPATTRCLSHP  937

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR ILH GSI S++K + + GI GP+YQ  N+G  I+WQ DIE+CL  E
Sbjct  938   SAHVRALSTSVLRNILHIGSINSKSK-LEIYGIRGPSYQFFNIGA-INWQTDIEKCLTWE  995

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
              +SQLA GM+ +FLDTAAKELGC IS+
Sbjct  996   VYSQLARGMTIQFLDTAAKELGCNISI  1022



>ref|XP_004173921.1| PREDICTED: protein GIGANTEA-like, partial [Cucumis sativus]
Length=156

 Score =   214 bits (546),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACTLPQLELLE TARAV+PVLEWGESGL++ADGL+NLLKCR+PATVRCLSHP
Sbjct  11   DGMLVDGEACTLPQLELLEATARAVRPVLEWGESGLSIADGLANLLKCRLPATVRCLSHP  70

Query  556  SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
            SAHVRALS SVLR IL +GS   R+ P N+NG+H P++Q  N    I+W+ D+E+CL  E
Sbjct  71   SAHVRALSTSVLRDILQTGSYVHRSTPNNINGVHSPSFQYFNREA-INWKVDLEKCLTWE  129

Query  376  AHSQLANGMSAEFLDTAAKELGCTISV  296
            AHS+L  GM  E L  AAKELGC+IS+
Sbjct  130  AHSRLVTGMPIEVLHVAAKELGCSISL  156



>ref|XP_011074103.1| PREDICTED: protein GIGANTEA-like isoform X1 [Sesamum indicum]
 ref|XP_011074104.1| PREDICTED: protein GIGANTEA-like isoform X1 [Sesamum indicum]
 ref|XP_011074105.1| PREDICTED: protein GIGANTEA-like isoform X1 [Sesamum indicum]
Length=1169

 Score =   233 bits (594),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 128/147 (87%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TA AVQPVLEWGESGLAVADGLSNLL CR+PATVRC+SHP
Sbjct  1024  DGMLVDGEACTLPQLELLEATAIAVQPVLEWGESGLAVADGLSNLLNCRLPATVRCVSHP  1083

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLRAILH+GSIKS  K V +NG+H P YQ +NVG T DW+AD+E+CL  E
Sbjct  1084  SAHVRALSTSVLRAILHAGSIKSSYKQVEVNGVHIPRYQYVNVGIT-DWRADVEKCLTWE  1142

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+LA G+  +F+DTAA ELGCTIS+
Sbjct  1143  AHSRLAMGLPIQFVDTAATELGCTISI  1169



>gb|KJB59494.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59495.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59496.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59497.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59498.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=1168

 Score =   233 bits (594),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLEWGESGLAVADGLSNLLKCR+PAT RCLSHP
Sbjct  1024  DGMLVDGEACTLPQLELLEATARAVQPVLEWGESGLAVADGLSNLLKCRLPATTRCLSHP  1083

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR ILH GSI S++K + + GI GP+YQ  N+G  I+WQ DIE+CL  E
Sbjct  1084  SAHVRALSTSVLRNILHIGSINSKSK-LEIYGIRGPSYQFFNIGA-INWQTDIEKCLTWE  1141

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
              +SQLA GM+ +FLDTAAKELGC IS+
Sbjct  1142  VYSQLARGMTIQFLDTAAKELGCNISI  1168



>ref|XP_002307516.1| GIGANTEA family protein [Populus trichocarpa]
 gb|EEE94512.1| GIGANTEA family protein [Populus trichocarpa]
Length=1171

 Score =   232 bits (591),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVL+WGESG AVADGLSNLLKCR+PAT+RCLSHP
Sbjct  1026  DGMLVDGEACTLPQLELLEATARAVQPVLQWGESGFAVADGLSNLLKCRLPATIRCLSHP  1085

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR I H+GSIK  +K  + NGIHGP+YQ L     I+WQADIE+CL  E
Sbjct  1086  SAHVRALSTSVLRDIQHTGSIKPASKLTHRNGIHGPSYQYLR-SDVINWQADIEKCLTWE  1144

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+LA GM    LDTAAKELGCTIS+
Sbjct  1145  AHSRLATGMPVHHLDTAAKELGCTISI  1171



>gb|AFK37980.1| unknown [Lotus japonicus]
Length=336

 Score =   219 bits (558),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 122/146 (84%), Gaps = 1/146 (1%)
 Frame = -3

Query  733  GMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHPS  554
            GMLVDGEACTLPQLELLE TARAV PVL++G SGLA+ADGLSNLLKCR+PATVRCL HPS
Sbjct  192  GMLVDGEACTLPQLELLEATARAVHPVLQFGGSGLALADGLSNLLKCRLPATVRCLCHPS  251

Query  553  AHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEA  374
            AHVR LSISVLR ILH+GS +   K   MNGIH P+YQ  N+   IDW ADIE+CL  EA
Sbjct  252  AHVRTLSISVLRDILHTGSTRCSPKSQRMNGIHHPSYQYFNL-DVIDWLADIEKCLTWEA  310

Query  373  HSQLANGMSAEFLDTAAKELGCTISV  296
            H++L+NG+S  FLDTAAKELGCTI+V
Sbjct  311  HTRLSNGLSINFLDTAAKELGCTIAV  336



>emb|CAJ38396.1| photoperiodic response / GIGANTEA [Plantago major]
Length=228

 Score =   216 bits (549),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 124/149 (83%), Gaps = 3/149 (2%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACTLPQLELLE TARAVQPVLEWGESG+ VADGLSNLLKCR+PATVRC+SHP
Sbjct  78   DGMLVDGEACTLPQLELLEATARAVQPVLEWGESGVMVADGLSNLLKCRLPATVRCVSHP  137

Query  556  SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHG--PAYQCLNVGGTIDWQADIERCLN  383
            SAHVRALS SVL A+LH+GS  +  + + +  ++G  P Y+C NV  T DWQADIE+CL 
Sbjct  138  SAHVRALSRSVLGAMLHAGSSINSDRKITLPAMNGSAPPYECTNVSNT-DWQADIEKCLT  196

Query  382  CEAHSQLANGMSAEFLDTAAKELGCTISV  296
             EAHS+LA G+  +F+D AAKELGCTIS+
Sbjct  197  WEAHSRLATGLPIQFVDNAAKELGCTISI  225



>ref|XP_004252566.1| PREDICTED: protein GIGANTEA-like isoform X1 [Solanum lycopersicum]
Length=1167

 Score =   231 bits (590),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 131/148 (89%), Gaps = 2/148 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARA+QPVL+WGESG +VADGL+NLLKCR+PATVRC+SHP
Sbjct  1021  DGMLVDGEACTLPQLELLEVTARAIQPVLDWGESGQSVADGLTNLLKCRLPATVRCVSHP  1080

Query  556   SAHVRALSISVLRAILHSGSIKSRAK-PVNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  380
             SAHVRALS SVLR I+++GS+K  AK   ++N IH PAYQ L++   IDW+ADIE+CL C
Sbjct  1081  SAHVRALSTSVLRDIMYAGSVKPSAKQAADVNAIHNPAYQYLSI-SIIDWKADIEKCLMC  1139

Query  379   EAHSQLANGMSAEFLDTAAKELGCTISV  296
             EA S+L NGMSA+FLDTAA+ELGCTISV
Sbjct  1140  EASSRLENGMSAQFLDTAARELGCTISV  1167



>ref|XP_010314472.1| PREDICTED: protein GIGANTEA-like isoform X2 [Solanum lycopersicum]
Length=1166

 Score =   231 bits (590),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 131/148 (89%), Gaps = 2/148 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARA+QPVL+WGESG +VADGL+NLLKCR+PATVRC+SHP
Sbjct  1020  DGMLVDGEACTLPQLELLEVTARAIQPVLDWGESGQSVADGLTNLLKCRLPATVRCVSHP  1079

Query  556   SAHVRALSISVLRAILHSGSIKSRAK-PVNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  380
             SAHVRALS SVLR I+++GS+K  AK   ++N IH PAYQ L++   IDW+ADIE+CL C
Sbjct  1080  SAHVRALSTSVLRDIMYAGSVKPSAKQAADVNAIHNPAYQYLSI-SIIDWKADIEKCLMC  1138

Query  379   EAHSQLANGMSAEFLDTAAKELGCTISV  296
             EA S+L NGMSA+FLDTAA+ELGCTISV
Sbjct  1139  EASSRLENGMSAQFLDTAARELGCTISV  1166



>ref|XP_006386299.1| hypothetical protein POPTR_0002s06490g [Populus trichocarpa]
 gb|ERP64096.1| hypothetical protein POPTR_0002s06490g [Populus trichocarpa]
Length=1171

 Score =   231 bits (588),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLEWGESGLAVADGLSN+LKCR+PAT+RCLSHP
Sbjct  1026  DGMLVDGEACTLPQLELLEATARAVQPVLEWGESGLAVADGLSNILKCRLPATIRCLSHP  1085

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR IL +GSIK  +K  + NGIHGP+YQ  ++   IDWQADIE+CL  E
Sbjct  1086  SAHVRALSTSVLRDILQTGSIKPSSKQGDRNGIHGPSYQYFSL-DKIDWQADIEKCLTWE  1144

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             A S+LA GM    LDTAAKELGCTIS+
Sbjct  1145  ARSRLATGMPIHHLDTAAKELGCTISI  1171



>ref|XP_002300901.2| GIGANTEA family protein [Populus trichocarpa]
 gb|EEE80174.2| GIGANTEA family protein [Populus trichocarpa]
Length=1194

 Score =   231 bits (588),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLEWGESGLAVADGLSN+LKCR+PAT+RCLSHP
Sbjct  1049  DGMLVDGEACTLPQLELLEATARAVQPVLEWGESGLAVADGLSNILKCRLPATIRCLSHP  1108

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR IL +GSIK  +K  + NGIHGP+YQ  ++   IDWQADIE+CL  E
Sbjct  1109  SAHVRALSTSVLRDILQTGSIKPSSKQGDRNGIHGPSYQYFSL-DKIDWQADIEKCLTWE  1167

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             A S+LA GM    LDTAAKELGCTIS+
Sbjct  1168  ARSRLATGMPIHHLDTAAKELGCTISI  1194



>ref|XP_009336496.1| PREDICTED: protein GIGANTEA-like [Pyrus x bretschneideri]
Length=1170

 Score =   231 bits (588),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QP+LEWGESGLAVADGLSNLLKCR+PAT+RCLSHP
Sbjct  1025  DGMLVDGEACTLPQLELLEATARAIQPMLEWGESGLAVADGLSNLLKCRLPATIRCLSHP  1084

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR IL + SI+    PV ++GIHGP+Y+  N+   IDWQ DIE+CL  E
Sbjct  1085  SAHVRALSTSVLRDILQASSIRPNPNPVEIDGIHGPSYKYFNL-DVIDWQGDIEKCLTWE  1143

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+LA GM  +FLD AAKELGC+IS+
Sbjct  1144  AHSRLATGMQIKFLDGAAKELGCSISL  1170



>ref|XP_010097648.1| hypothetical protein L484_023788 [Morus notabilis]
 gb|EXB70603.1| hypothetical protein L484_023788 [Morus notabilis]
Length=1195

 Score =   231 bits (588),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLE GESGLAVADGL+NLLKCR+PAT+RCLSHP
Sbjct  1050  DGMLVDGEACTLPQLELLEATARAVQPVLELGESGLAVADGLANLLKCRLPATIRCLSHP  1109

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR ILH+GSIK+  KPV +N  HGP+YQ  N    I+W ADIE+ L  E
Sbjct  1110  SAHVRALSTSVLRDILHTGSIKTNHKPVEINAPHGPSYQYFN-PDDINWHADIEKRLTWE  1168

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+LA GMS +FLD AAKELGCTIS+
Sbjct  1169  AHSRLATGMSIQFLDIAAKELGCTISI  1195



>gb|KDP36552.1| hypothetical protein JCGZ_08319 [Jatropha curcas]
Length=1168

 Score =   230 bits (587),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLEWGESG AVADGLSNLLKCR+PAT+RCLSHP
Sbjct  1023  DGMLVDGEACTLPQLELLEATARAVQPVLEWGESGFAVADGLSNLLKCRLPATIRCLSHP  1082

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR+ILH+GSI+     V++NG  GP+ Q +N+   IDWQADIE+CL  E
Sbjct  1083  SAHVRALSASVLRSILHTGSIRPTVNQVDINGFRGPSCQYINI-DVIDWQADIEKCLTWE  1141

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+LA G+  +FLD AAKEL CTIS+
Sbjct  1142  AHSRLATGLDIQFLDAAAKELDCTISI  1168



>ref|XP_011044276.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
Length=1171

 Score =   229 bits (585),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVL+WGESG AVADGLSNLLKCR+PAT+RCLSHP
Sbjct  1026  DGMLVDGEACTLPQLELLEATARAVQPVLQWGESGFAVADGLSNLLKCRLPATIRCLSHP  1085

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR I H+GS+K  +K  + NGIHGP+YQ       I+WQADIE+CL  E
Sbjct  1086  SAHVRALSTSVLRDIQHTGSMKPASKLTHRNGIHGPSYQYFR-SDVINWQADIEKCLTWE  1144

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+LA GM    LDTAAKELGCTIS+
Sbjct  1145  AHSRLATGMPIHHLDTAAKELGCTISI  1171



>ref|XP_009802612.1| PREDICTED: protein GIGANTEA-like [Nicotiana sylvestris]
 ref|XP_009802613.1| PREDICTED: protein GIGANTEA-like [Nicotiana sylvestris]
Length=1156

 Score =   229 bits (583),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 132/148 (89%), Gaps = 2/148 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARA+QPVL+WGESG AVADGL+NLLKCR+ ATVRC+SHP
Sbjct  1010  DGMLVDGEACTLPQLELLEVTARAIQPVLDWGESGQAVADGLTNLLKCRLTATVRCVSHP  1069

Query  556   SAHVRALSISVLRAILHSGSIK-SRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  380
             SAHVRALS SVLRAI+++GS++ S AK  ++NG H PAYQ L++   IDW+ADIE+CL  
Sbjct  1070  SAHVRALSTSVLRAIMYAGSVRSSSAKQADVNGFHSPAYQYLSI-SIIDWKADIEKCLMW  1128

Query  379   EAHSQLANGMSAEFLDTAAKELGCTISV  296
             EA+S+L NGMSA+FLDTAA+ELGCTIS+
Sbjct  1129  EANSRLENGMSAQFLDTAARELGCTISI  1156



>ref|XP_007143577.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
 ref|XP_007143578.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
 gb|ESW15571.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
 gb|ESW15572.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
Length=1199

 Score =   227 bits (579),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLE+GESGLAVADGLSNLLKCR+ AT+RCLSHP
Sbjct  1054  DGMLVDGEACTLPQLELLEATARAVQPVLEFGESGLAVADGLSNLLKCRLSATIRCLSHP  1113

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALSISVLR ILH+GSI+   KP  +NG H P+YQ  N    IDWQADIE+CL  E
Sbjct  1114  SAHVRALSISVLRDILHTGSIRYNLKPRRINGTHNPSYQYFN-SDAIDWQADIEKCLTWE  1172

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+L+  +   FLDTAAKELGC IS+
Sbjct  1173  AHSRLSTRLPINFLDTAAKELGCNISM  1199



>emb|CAN81809.1| hypothetical protein VITISV_032939 [Vitis vinifera]
Length=1172

 Score =   227 bits (579),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 125/147 (85%), Gaps = 3/147 (2%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQ VLEWGESGLAVADGLSNLLKCR+PAT+RCLSHP
Sbjct  1029  DGMLVDGEACTLPQLELLEATARAVQLVLEWGESGLAVADGLSNLLKCRVPATIRCLSHP  1088

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR +L SGSIK   K    NGIH  +YQ +N+ G IDWQADIE+CL  E
Sbjct  1089  SAHVRALSTSVLRDVLQSGSIKPHIKQGGRNGIH--SYQYVNL-GIIDWQADIEKCLTWE  1145

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+LA GM+ +FLD AAKELGCTIS+
Sbjct  1146  AHSRLATGMTNQFLDAAAKELGCTISI  1172



>ref|XP_009610493.1| PREDICTED: protein GIGANTEA-like [Nicotiana tomentosiformis]
 ref|XP_009610494.1| PREDICTED: protein GIGANTEA-like [Nicotiana tomentosiformis]
Length=1158

 Score =   226 bits (577),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 131/148 (89%), Gaps = 2/148 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARA+QPVL+WGESG AVADGL+NLLKCR+ ATVRC+SHP
Sbjct  1012  DGMLVDGEACTLPQLELLEVTARAIQPVLDWGESGQAVADGLTNLLKCRLTATVRCVSHP  1071

Query  556   SAHVRALSISVLRAILHSGSIK-SRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  380
             SAHVRALS SVLRAI+ +GS+K S AK  ++NGIH PAYQ L++   IDW+ADIE+CL  
Sbjct  1072  SAHVRALSTSVLRAIMFAGSVKPSSAKQADVNGIHSPAYQYLSI-SIIDWKADIEKCLMW  1130

Query  379   EAHSQLANGMSAEFLDTAAKELGCTISV  296
             EA+S+L NGMSA+FL TAA+ELGCTIS+
Sbjct  1131  EANSRLENGMSAQFLGTAARELGCTISI  1158



>ref|XP_002264755.1| PREDICTED: protein GIGANTEA [Vitis vinifera]
 ref|XP_010665061.1| PREDICTED: protein GIGANTEA [Vitis vinifera]
 ref|XP_010665062.1| PREDICTED: protein GIGANTEA [Vitis vinifera]
Length=1170

 Score =   227 bits (578),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 125/147 (85%), Gaps = 3/147 (2%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQ VLEWGESGLAVADGLSNLLKCR+PAT+RCLSHP
Sbjct  1027  DGMLVDGEACTLPQLELLEATARAVQLVLEWGESGLAVADGLSNLLKCRVPATIRCLSHP  1086

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR +L SGSIK   K    NGIH  +YQ +N+ G IDWQADIE+CL  E
Sbjct  1087  SAHVRALSTSVLRDVLQSGSIKPHIKQGGRNGIH--SYQYVNL-GIIDWQADIEKCLTWE  1143

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+LA GM+ +FLD AAKELGCTIS+
Sbjct  1144  AHSRLATGMTNQFLDVAAKELGCTISI  1170



>ref|XP_004496436.1| PREDICTED: protein GIGANTEA-like isoform X2 [Cicer arietinum]
Length=1152

 Score =   226 bits (577),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLE+GESGLAVADGLSNLLKCR+ AT+RCLSHP
Sbjct  1007  DGMLVDGEACTLPQLELLEATARAVQPVLEFGESGLAVADGLSNLLKCRLAATIRCLSHP  1066

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVR LS+SVLR ILH+ SI+   KP+ +NG H P+YQ   +   +DWQ DIE+CL CE
Sbjct  1067  SAHVRTLSVSVLRDILHTSSIRCNPKPLRINGNHNPSYQYFKL-DVVDWQTDIEKCLTCE  1125

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS++++G+  +FLDTAAKELGC IS+
Sbjct  1126  AHSRISSGLPIKFLDTAAKELGCAISI  1152



>ref|XP_006361617.1| PREDICTED: protein GIGANTEA-like isoform X2 [Solanum tuberosum]
Length=1170

 Score =   226 bits (576),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 130/148 (88%), Gaps = 2/148 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGE CTLPQLELLEVTARA+QPVL+WGESG +VADGL+NLLKCR+PATVRC+SHP
Sbjct  1024  DGMLVDGETCTLPQLELLEVTARAIQPVLDWGESGQSVADGLTNLLKCRLPATVRCVSHP  1083

Query  556   SAHVRALSISVLRAILHSGSIKSRAK-PVNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  380
             SAHVRALS SVLR I+++GS+K  AK   ++NGIH PAYQ L +  + DW+ADIE+CL  
Sbjct  1084  SAHVRALSTSVLRDIMYAGSVKPSAKQAADVNGIHNPAYQYLGISIS-DWKADIEKCLMW  1142

Query  379   EAHSQLANGMSAEFLDTAAKELGCTISV  296
             EA+S+L NGMSA+FLDTAA+ELGCTISV
Sbjct  1143  EANSRLENGMSAQFLDTAARELGCTISV  1170



>ref|XP_006361616.1| PREDICTED: protein GIGANTEA-like isoform X1 [Solanum tuberosum]
Length=1171

 Score =   226 bits (576),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 130/148 (88%), Gaps = 2/148 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGE CTLPQLELLEVTARA+QPVL+WGESG +VADGL+NLLKCR+PATVRC+SHP
Sbjct  1025  DGMLVDGETCTLPQLELLEVTARAIQPVLDWGESGQSVADGLTNLLKCRLPATVRCVSHP  1084

Query  556   SAHVRALSISVLRAILHSGSIKSRAK-PVNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  380
             SAHVRALS SVLR I+++GS+K  AK   ++NGIH PAYQ L +  + DW+ADIE+CL  
Sbjct  1085  SAHVRALSTSVLRDIMYAGSVKPSAKQAADVNGIHNPAYQYLGISIS-DWKADIEKCLMW  1143

Query  379   EAHSQLANGMSAEFLDTAAKELGCTISV  296
             EA+S+L NGMSA+FLDTAA+ELGCTISV
Sbjct  1144  EANSRLENGMSAQFLDTAARELGCTISV  1171



>ref|XP_004496435.1| PREDICTED: protein GIGANTEA-like isoform X1 [Cicer arietinum]
Length=1180

 Score =   226 bits (576),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLE+GESGLAVADGLSNLLKCR+ AT+RCLSHP
Sbjct  1035  DGMLVDGEACTLPQLELLEATARAVQPVLEFGESGLAVADGLSNLLKCRLAATIRCLSHP  1094

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVR LS+SVLR ILH+ SI+   KP+ +NG H P+YQ   +   +DWQ DIE+CL CE
Sbjct  1095  SAHVRTLSVSVLRDILHTSSIRCNPKPLRINGNHNPSYQYFKL-DVVDWQTDIEKCLTCE  1153

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS++++G+  +FLDTAAKELGC IS+
Sbjct  1154  AHSRISSGLPIKFLDTAAKELGCAISI  1180



>ref|XP_003592047.1| Protein GIGANTEA [Medicago truncatula]
Length=795

 Score =   221 bits (563),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACTLPQLELLE TARA+QPVLE+GE GLAVADGLSNLLKCR+ AT+RCL HP
Sbjct  650  DGMLVDGEACTLPQLELLEATARAIQPVLEFGEPGLAVADGLSNLLKCRLAATIRCLCHP  709

Query  556  SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
            SAHVRALS+SVLR ILH+GSI+   KP+ +NG H P+YQ   +   +DWQADIE+C+  E
Sbjct  710  SAHVRALSVSVLRDILHTGSIRCSPKPLRINGSHNPSYQYFKL-DVVDWQADIEKCMAWE  768

Query  376  AHSQLANGMSAEFLDTAAKELGCTISV  296
            AHS+++ G+  +FLDTAAKELGC ISV
Sbjct  769  AHSRISAGLPIKFLDTAAKELGCAISV  795



>ref|XP_006434519.1| hypothetical protein CICLE_v10004044mg [Citrus clementina]
 gb|ESR47759.1| hypothetical protein CICLE_v10004044mg [Citrus clementina]
Length=1082

 Score =   223 bits (568),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QP+L WG+SGLA+ADGLSNLLKCR+PAT+RCLSHP
Sbjct  937   DGMLVDGEACTLPQLELLEATARAIQPILRWGKSGLAIADGLSNLLKCRLPATIRCLSHP  996

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR  LH+ S KS  + V  NGIHG +    N+   I+WQADIE+CL  E
Sbjct  997   SAHVRALSTSVLRDFLHTSSFKSNIEQVERNGIHGSSLHYFNIDA-INWQADIEKCLTWE  1055

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+LA GM  +FLD AAKELGCTIS+
Sbjct  1056  AHSRLATGMPIQFLDIAAKELGCTISI  1082



>gb|KGN44456.1| hypothetical protein Csa_7G293740 [Cucumis sativus]
Length=811

 Score =   221 bits (563),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACTLPQLELLEVTARAV+PVLEWGESGL++ADGLSNLLKCR+ ATVRCLSHP
Sbjct  667  DGMLVDGEACTLPQLELLEVTARAVKPVLEWGESGLSIADGLSNLLKCRLSATVRCLSHP  726

Query  556  SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
            SAHVRALS SVLR ILH+  IKS +K VN+NGI+ P+YQ  +  G IDW+ADIE+CL  E
Sbjct  727  SAHVRALSTSVLRDILHTSLIKSNSKSVNVNGIY-PSYQYFS-SGIIDWKADIEKCLGWE  784

Query  376  AHSQLANGMSAEFLDTAAKELGCTISV  296
              SQLA G S +FL  AAKEL C+IS+
Sbjct  785  VRSQLATGQSTQFLQAAAKELSCSISL  811



>gb|KDO83806.1| hypothetical protein CISIN_1g001216mg [Citrus sinensis]
Length=1122

 Score =   222 bits (566),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QP+L WG+SGLA+ADGLSNLLKCR+PAT+RCLSHP
Sbjct  977   DGMLVDGEACTLPQLELLEATARAIQPILRWGKSGLAIADGLSNLLKCRLPATIRCLSHP  1036

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR  LH+ S KS  + V  NGIHG +    N+   I+WQ+DIE+CL  E
Sbjct  1037  SAHVRALSTSVLRDFLHTSSFKSNIEQVERNGIHGSSLHYFNIDA-INWQSDIEKCLTWE  1095

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+LA GM  +FLD AAKELGCTIS+
Sbjct  1096  AHSRLATGMPIQFLDIAAKELGCTISI  1122



>ref|XP_006473104.1| PREDICTED: protein GIGANTEA-like isoform X1 [Citrus sinensis]
 ref|XP_006473105.1| PREDICTED: protein GIGANTEA-like isoform X2 [Citrus sinensis]
 ref|XP_006473106.1| PREDICTED: protein GIGANTEA-like isoform X3 [Citrus sinensis]
 ref|XP_006473107.1| PREDICTED: protein GIGANTEA-like isoform X4 [Citrus sinensis]
Length=1165

 Score =   222 bits (566),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QP+L WG+SGLA+ADGLSNLLKCR+PAT+RCLSHP
Sbjct  1020  DGMLVDGEACTLPQLELLEATARAIQPILRWGKSGLAIADGLSNLLKCRLPATIRCLSHP  1079

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR  LH+ S KS  + V  NGIHG +    N+   I+WQ+DIE+CL  E
Sbjct  1080  SAHVRALSTSVLRDFLHTSSFKSNIEQVERNGIHGSSLHYFNIDA-INWQSDIEKCLTWE  1138

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+LA GM  +FLD AAKELGCTIS+
Sbjct  1139  AHSRLATGMPIQFLDIAAKELGCTISI  1165



>gb|AES62299.2| gigantea protein 1B [Medicago truncatula]
Length=1177

 Score =   221 bits (564),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVLE+GE GLAVADGLSNLLKCR+ AT+RCL HP
Sbjct  1032  DGMLVDGEACTLPQLELLEATARAIQPVLEFGEPGLAVADGLSNLLKCRLAATIRCLCHP  1091

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS+SVLR ILH+GSI+   KP+ +NG H P+YQ   +   +DWQADIE+C+  E
Sbjct  1092  SAHVRALSVSVLRDILHTGSIRCSPKPLRINGSHNPSYQYFKL-DVVDWQADIEKCMAWE  1150

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+++ G+  +FLDTAAKELGC ISV
Sbjct  1151  AHSRISAGLPIKFLDTAAKELGCAISV  1177



>ref|XP_003592048.1| Protein GIGANTEA [Medicago truncatula]
Length=1200

 Score =   221 bits (564),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVLE+GE GLAVADGLSNLLKCR+ AT+RCL HP
Sbjct  1055  DGMLVDGEACTLPQLELLEATARAIQPVLEFGEPGLAVADGLSNLLKCRLAATIRCLCHP  1114

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS+SVLR ILH+GSI+   KP+ +NG H P+YQ   +   +DWQADIE+C+  E
Sbjct  1115  SAHVRALSVSVLRDILHTGSIRCSPKPLRINGSHNPSYQYFKL-DVVDWQADIEKCMAWE  1173

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+++ G+  +FLDTAAKELGC ISV
Sbjct  1174  AHSRISAGLPIKFLDTAAKELGCAISV  1200



>ref|XP_003592046.1| Protein GIGANTEA [Medicago truncatula]
Length=1172

 Score =   221 bits (563),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVLE+GE GLAVADGLSNLLKCR+ AT+RCL HP
Sbjct  1027  DGMLVDGEACTLPQLELLEATARAIQPVLEFGEPGLAVADGLSNLLKCRLAATIRCLCHP  1086

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS+SVLR ILH+GSI+   KP+ +NG H P+YQ   +   +DWQADIE+C+  E
Sbjct  1087  SAHVRALSVSVLRDILHTGSIRCSPKPLRINGSHNPSYQYFKL-DVVDWQADIEKCMAWE  1145

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+++ G+  +FLDTAAKELGC ISV
Sbjct  1146  AHSRISAGLPIKFLDTAAKELGCAISV  1172



>gb|ABP81863.1| LATE BLOOMER 1 [Pisum sativum]
Length=1175

 Score =   221 bits (563),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVLE+GE G+AVADGLSNLLKCR+ AT+RCL HP
Sbjct  1030  DGMLVDGEACTLPQLELLEATARAIQPVLEFGEPGMAVADGLSNLLKCRLAATIRCLCHP  1089

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVR LS+SVLR ILH+GSI+   KP+ +NG H P+Y    +   +DWQADIE+CL CE
Sbjct  1090  SAHVRTLSVSVLRDILHTGSIRCSPKPLRINGNHNPSYPYFKL-DVVDWQADIEKCLTCE  1148

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+++ G+  +FLDTAAKELGC IS+
Sbjct  1149  AHSRISAGLPIKFLDTAAKELGCAISI  1175



>gb|AFK65758.1| GIGANTEA, partial [Chrysanthemum x morifolium]
Length=1151

 Score =   220 bits (561),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLEWGESG+AVADGLSNLLKCR+PATVRCLSHP
Sbjct  1006  DGMLVDGEACTLPQLELLEATARAVQPVLEWGESGMAVADGLSNLLKCRLPATVRCLSHP  1065

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVR +SISVLRAILH G +++  +  N+    GPAYQ LNV  T DW++D+ +CL  E
Sbjct  1066  SAHVRTVSISVLRAILHVGVLRTSGEEANIPAACGPAYQYLNVDVT-DWESDVGKCLTWE  1124

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS++A GM  ++L+TAAKELGC IS+
Sbjct  1125  AHSRIATGMPIQYLNTAAKELGCPISI  1151



>ref|XP_004139688.1| PREDICTED: protein GIGANTEA-like [Cucumis sativus]
Length=1168

 Score =   220 bits (560),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARAV+PVLEWGESGL++ADGLSNLLKCR+ ATVRCLSHP
Sbjct  1024  DGMLVDGEACTLPQLELLEVTARAVKPVLEWGESGLSIADGLSNLLKCRLSATVRCLSHP  1083

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR ILH+  IKS +K VN+NGI+ P+YQ  +  G IDW+ADIE+CL  E
Sbjct  1084  SAHVRALSTSVLRDILHTSLIKSNSKSVNVNGIY-PSYQYFS-SGIIDWKADIEKCLGWE  1141

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
               SQLA G S +FL  AAKEL C+IS+
Sbjct  1142  VRSQLATGQSTQFLQAAAKELSCSISL  1168



>dbj|BAM67030.1| gigantea-like [Chrysanthemum seticuspe f. boreale]
Length=1145

 Score =   219 bits (558),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLEWGESG+AVADGLSNLLKCR+PATVRCLSHP
Sbjct  1000  DGMLVDGEACTLPQLELLEATARAVQPVLEWGESGMAVADGLSNLLKCRLPATVRCLSHP  1059

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVR LS SVLRAILH G +     P N+    GPAYQ LNV  T DW++D+ +CL  E
Sbjct  1060  SAHVRTLSTSVLRAILHVGLVNPIGAPPNIPAACGPAYQYLNVDVT-DWESDVGKCLTWE  1118

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS++A GM  ++L+TAAKELGC IS+
Sbjct  1119  AHSRIATGMPIQYLNTAAKELGCPISI  1145



>gb|AGL61504.1| gigantea-like protein [Chrysanthemum x morifolium]
Length=1145

 Score =   219 bits (558),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLEWGESG+AVADGLSNLLKCR+PATVRCLSHP
Sbjct  1000  DGMLVDGEACTLPQLELLEATARAVQPVLEWGESGMAVADGLSNLLKCRLPATVRCLSHP  1059

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVR LS SVLRAILH G +     P N+    GPAYQ LNV  T DW++D+ +CL  E
Sbjct  1060  SAHVRTLSTSVLRAILHVGLVNPIGAPPNIPAACGPAYQYLNVDVT-DWESDVGKCLTWE  1118

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS++A GM  ++L+TAAKELGC IS+
Sbjct  1119  AHSRIATGMPIQYLNTAAKELGCPISI  1145



>ref|XP_008461914.1| PREDICTED: protein GIGANTEA-like isoform X3 [Cucumis melo]
Length=954

 Score =   216 bits (549),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 127/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACTLPQLELLEVTARAV+PVLEWGESGL++ADGLSNLLKCR+PATVRCLSHP
Sbjct  810  DGMLVDGEACTLPQLELLEVTARAVKPVLEWGESGLSIADGLSNLLKCRLPATVRCLSHP  869

Query  556  SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
            SAHVRALS SVLR ILH+ SIKS +K VN+NGI+ P+YQ  +  G IDW+ADIE+CL  E
Sbjct  870  SAHVRALSTSVLRDILHTSSIKSSSKSVNINGIY-PSYQYFS-SGIIDWKADIEKCLGWE  927

Query  376  AHSQLANGMSAEFLDTAAKELGCTISV  296
              SQLA+G S +FL  AAKEL C+IS+
Sbjct  928  VRSQLASGQSTQFLQAAAKELSCSISL  954



>ref|XP_010062090.1| PREDICTED: protein GIGANTEA isoform X2 [Eucalyptus grandis]
 ref|XP_010062091.1| PREDICTED: protein GIGANTEA isoform X2 [Eucalyptus grandis]
Length=983

 Score =   216 bits (549),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 122/147 (83%), Gaps = 2/147 (1%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACTLPQLELLEVTARAV+PVLEWGESGL VADGLSNLLKCR+PATV CLSHP
Sbjct  839  DGMLVDGEACTLPQLELLEVTARAVRPVLEWGESGLIVADGLSNLLKCRLPATVTCLSHP  898

Query  556  SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
            SAHVRALS SVLR I+ +GS+ SR      NGIH P  Q  N+   I+WQADI +CL  E
Sbjct  899  SAHVRALSTSVLRDIMQTGSVDSRQSVRERNGIHSPC-QYFNL-DVIEWQADIGKCLKWE  956

Query  376  AHSQLANGMSAEFLDTAAKELGCTISV  296
            AHS+L++GMS +FLD AAKELGCTIS+
Sbjct  957  AHSRLSSGMSIQFLDIAAKELGCTISL  983



>ref|XP_004140955.1| PREDICTED: protein GIGANTEA-like [Cucumis sativus]
 gb|KGN46115.1| hypothetical protein Csa_6G055360 [Cucumis sativus]
Length=1170

 Score =   216 bits (551),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAV+PVLEWGESGL++ADGL+NLLKCR+PATVRCLSHP
Sbjct  1025  DGMLVDGEACTLPQLELLEATARAVRPVLEWGESGLSIADGLANLLKCRLPATVRCLSHP  1084

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR IL +GS   R+ P N+NG+H P++Q  N    I+W+ D+E+CL  E
Sbjct  1085  SAHVRALSTSVLRDILQTGSYVHRSTPNNINGVHSPSFQYFNREA-INWKVDLEKCLTWE  1143

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+L  GM  E L  AAKELGC+IS+
Sbjct  1144  AHSRLVTGMPIEVLHVAAKELGCSISL  1170



>ref|XP_008461913.1| PREDICTED: protein GIGANTEA-like isoform X2 [Cucumis melo]
Length=999

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 127/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACTLPQLELLEVTARAV+PVLEWGESGL++ADGLSNLLKCR+PATVRCLSHP
Sbjct  855  DGMLVDGEACTLPQLELLEVTARAVKPVLEWGESGLSIADGLSNLLKCRLPATVRCLSHP  914

Query  556  SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
            SAHVRALS SVLR ILH+ SIKS +K VN+NGI+ P+YQ  +  G IDW+ADIE+CL  E
Sbjct  915  SAHVRALSTSVLRDILHTSSIKSSSKSVNINGIY-PSYQYFS-SGIIDWKADIEKCLGWE  972

Query  376  AHSQLANGMSAEFLDTAAKELGCTISV  296
              SQLA+G S +FL  AAKEL C+IS+
Sbjct  973  VRSQLASGQSTQFLQAAAKELSCSISL  999



>ref|XP_010477543.1| PREDICTED: protein GIGANTEA-like isoform X1 [Camelina sativa]
Length=1170

 Score =   216 bits (550),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 120/151 (79%), Gaps = 5/151 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PAT+RCLSHP
Sbjct  1019  DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHP  1078

Query  556   SAHVRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERC  389
             SAHVRALS SVLR I++  SI  +  P       NG+H P+Y+  N   TIDW+ADI++C
Sbjct  1079  SAHVRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMHSPSYRFFN-AATIDWKADIQKC  1137

Query  388   LNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             LN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1138  LNWEAHSLLSTTMPTQFLDTAARELGCTISL  1168



>ref|XP_010477546.1| PREDICTED: protein GIGANTEA-like isoform X4 [Camelina sativa]
Length=1169

 Score =   216 bits (550),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 120/151 (79%), Gaps = 5/151 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PAT+RCLSHP
Sbjct  1018  DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHP  1077

Query  556   SAHVRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERC  389
             SAHVRALS SVLR I++  SI  +  P       NG+H P+Y+  N   TIDW+ADI++C
Sbjct  1078  SAHVRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMHSPSYRFFN-AATIDWKADIQKC  1136

Query  388   LNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             LN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1137  LNWEAHSLLSTTMPTQFLDTAARELGCTISL  1167



>ref|XP_010477545.1| PREDICTED: protein GIGANTEA-like isoform X3 [Camelina sativa]
Length=1169

 Score =   216 bits (550),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 120/151 (79%), Gaps = 5/151 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PAT+RCLSHP
Sbjct  1018  DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHP  1077

Query  556   SAHVRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERC  389
             SAHVRALS SVLR I++  SI  +  P       NG+H P+Y+  N   TIDW+ADI++C
Sbjct  1078  SAHVRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMHSPSYRFFN-AATIDWKADIQKC  1136

Query  388   LNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             LN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1137  LNWEAHSLLSTTMPTQFLDTAARELGCTISL  1167



>ref|XP_010477544.1| PREDICTED: protein GIGANTEA-like isoform X2 [Camelina sativa]
Length=1170

 Score =   216 bits (550),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 120/151 (79%), Gaps = 5/151 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PAT+RCLSHP
Sbjct  1019  DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHP  1078

Query  556   SAHVRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERC  389
             SAHVRALS SVLR I++  SI  +  P       NG+H P+Y+  N   TIDW+ADI++C
Sbjct  1079  SAHVRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMHSPSYRFFN-AATIDWKADIQKC  1137

Query  388   LNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             LN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1138  LNWEAHSLLSTTMPTQFLDTAARELGCTISL  1168



>ref|XP_010062087.1| PREDICTED: protein GIGANTEA isoform X1 [Eucalyptus grandis]
 ref|XP_010062088.1| PREDICTED: protein GIGANTEA isoform X1 [Eucalyptus grandis]
 ref|XP_010062089.1| PREDICTED: protein GIGANTEA isoform X1 [Eucalyptus grandis]
 gb|KCW69154.1| hypothetical protein EUGRSUZ_F02686 [Eucalyptus grandis]
Length=1166

 Score =   216 bits (550),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 122/147 (83%), Gaps = 2/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARAV+PVLEWGESGL VADGLSNLLKCR+PATV CLSHP
Sbjct  1022  DGMLVDGEACTLPQLELLEVTARAVRPVLEWGESGLIVADGLSNLLKCRLPATVTCLSHP  1081

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR I+ +GS+ SR      NGIH P  Q  N+   I+WQADI +CL  E
Sbjct  1082  SAHVRALSTSVLRDIMQTGSVDSRQSVRERNGIHSPC-QYFNL-DVIEWQADIGKCLKWE  1139

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+L++GMS +FLD AAKELGCTIS+
Sbjct  1140  AHSRLSSGMSIQFLDIAAKELGCTISL  1166



>gb|KCW69153.1| hypothetical protein EUGRSUZ_F02686 [Eucalyptus grandis]
Length=1167

 Score =   216 bits (550),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 122/147 (83%), Gaps = 2/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARAV+PVLEWGESGL VADGLSNLLKCR+PATV CLSHP
Sbjct  1023  DGMLVDGEACTLPQLELLEVTARAVRPVLEWGESGLIVADGLSNLLKCRLPATVTCLSHP  1082

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR I+ +GS+ SR      NGIH P  Q  N+   I+WQADI +CL  E
Sbjct  1083  SAHVRALSTSVLRDIMQTGSVDSRQSVRERNGIHSPC-QYFNL-DVIEWQADIGKCLKWE  1140

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+L++GMS +FLD AAKELGCTIS+
Sbjct  1141  AHSRLSSGMSIQFLDIAAKELGCTISL  1167



>ref|XP_008456743.1| PREDICTED: protein GIGANTEA-like [Cucumis melo]
 ref|XP_008456744.1| PREDICTED: protein GIGANTEA-like [Cucumis melo]
 ref|XP_008456745.1| PREDICTED: protein GIGANTEA-like [Cucumis melo]
Length=1170

 Score =   216 bits (549),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA++PVLEWGESGL++ADGL+NLLKCR+PATVRCLSHP
Sbjct  1025  DGMLVDGEACTLPQLELLEATARAIRPVLEWGESGLSIADGLANLLKCRLPATVRCLSHP  1084

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR IL +GS   R+ P N+NG+H P++Q  N    I+W+ D+E+CL  E
Sbjct  1085  SAHVRALSTSVLRNILQTGSYVLRSTPKNINGVHSPSFQYFNREA-INWKDDLEKCLTWE  1143

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+L  GM  E L  AAKELGC+IS+
Sbjct  1144  AHSRLVTGMPIEVLHVAAKELGCSISL  1170



>ref|XP_010462850.1| PREDICTED: protein GIGANTEA-like [Camelina sativa]
Length=1138

 Score =   215 bits (548),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 120/151 (79%), Gaps = 5/151 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PAT+RCLSHP
Sbjct  987   DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHP  1046

Query  556   SAHVRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERC  389
             SAHVRALS SVLR I++  SI  +  P       NG+H P+Y+  N   TIDW+ADI++C
Sbjct  1047  SAHVRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMHSPSYRFFN-AATIDWKADIQKC  1105

Query  388   LNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             LN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1106  LNWEAHSLLSTTMPTQFLDTAARELGCTISL  1136



>ref|XP_002890532.1| hypothetical protein ARALYDRAFT_889789 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66791.1| hypothetical protein ARALYDRAFT_889789 [Arabidopsis lyrata subsp. 
lyrata]
Length=1174

 Score =   215 bits (548),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 121/151 (80%), Gaps = 5/151 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PATVRCLSHP
Sbjct  1023  DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATVRCLSHP  1082

Query  556   SAHVRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERC  389
             SAHVRALSISVLR I++  SI  +  P       NG++ P+Y+  N   TIDW+ADI++C
Sbjct  1083  SAHVRALSISVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AATIDWKADIQKC  1141

Query  388   LNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             LN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1142  LNWEAHSLLSTTMPTQFLDTAARELGCTISL  1172



>ref|XP_008461912.1| PREDICTED: protein GIGANTEA-like isoform X1 [Cucumis melo]
Length=1168

 Score =   215 bits (548),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 127/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARAV+PVLEWGESGL++ADGLSNLLKCR+PATVRCLSHP
Sbjct  1024  DGMLVDGEACTLPQLELLEVTARAVKPVLEWGESGLSIADGLSNLLKCRLPATVRCLSHP  1083

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR ILH+ SIKS +K VN+NGI+ P+YQ  +  G IDW+ADIE+CL  E
Sbjct  1084  SAHVRALSTSVLRDILHTSSIKSSSKSVNINGIY-PSYQYFS-SGIIDWKADIEKCLGWE  1141

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
               SQLA+G S +FL  AAKEL C+IS+
Sbjct  1142  VRSQLASGQSTQFLQAAAKELSCSISL  1168



>ref|XP_006306336.1| hypothetical protein CARUB_v10012213mg [Capsella rubella]
 gb|EOA39234.1| hypothetical protein CARUB_v10012213mg [Capsella rubella]
Length=1171

 Score =   215 bits (548),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 120/151 (79%), Gaps = 5/151 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PAT+RCLSHP
Sbjct  1020  DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHP  1079

Query  556   SAHVRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERC  389
             SAHVRALS SVLR I++  SI  +  P       NG+H P+Y+  N   TIDW+ADI++C
Sbjct  1080  SAHVRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMHSPSYRFFN-AATIDWKADIQKC  1138

Query  388   LNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             LN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1139  LNWEAHSLLSTTMPTQFLDTAAQELGCTISL  1169



>gb|KFK44368.1| gigantea [Arabis alpina]
Length=1173

 Score =   215 bits (548),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 123/154 (80%), Gaps = 8/154 (5%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PAT+RCLSHP
Sbjct  1018  DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHP  1077

Query  556   SAHVRALSISVLRAILHSG--SIKSRAKPVNM-----NGIHGPAYQCLNVGGTIDWQADI  398
             SAHVRALS SVLR I++    +IK+  KP+       NG+H P+Y+  N   TIDW+ADI
Sbjct  1078  SAHVRALSTSVLRDIMNQSPITIKATPKPITTTATEKNGMHSPSYRFFN-AATIDWKADI  1136

Query  397   ERCLNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             ++CLN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1137  QKCLNWEAHSLLSTTMPTQFLDTAARELGCTISL  1170



>ref|XP_010498761.1| PREDICTED: protein GIGANTEA [Camelina sativa]
Length=1169

 Score =   214 bits (545),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 120/151 (79%), Gaps = 5/151 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PAT+RCLSHP
Sbjct  1018  DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHP  1077

Query  556   SAHVRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERC  389
             SAHVRALS SVLR I++  SI  +  P       NG+H P+Y+  N   +IDW+ADI++C
Sbjct  1078  SAHVRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMHSPSYRFFN-ATSIDWKADIQKC  1136

Query  388   LNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             LN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1137  LNWEAHSLLSTTMPTQFLDTAARELGCTISL  1167



>gb|KJB28961.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1155

 Score =   214 bits (544),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 114/147 (78%), Gaps = 10/147 (7%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLEWGESGLAV DGLSNLLKCR+PAT RCLSHP
Sbjct  1019  DGMLVDGEACTLPQLELLEATARAVQPVLEWGESGLAVVDGLSNLLKCRLPATTRCLSHP  1078

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALSISVLR IL S         + +NGIHGP +        IDW  DIE+CL  E
Sbjct  1079  SAHVRALSISVLRNILQSN------PKLEINGIHGPYFSI----SVIDWHTDIEKCLTWE  1128

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHSQLA GM   FLDTAAKELGC IS+
Sbjct  1129  AHSQLARGMPIHFLDTAAKELGCNISM  1155



>gb|ABP96481.1| GIGANTEA [Arabidopsis lyrata subsp. petraea]
Length=1173

 Score =   213 bits (543),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 120/151 (79%), Gaps = 5/151 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PATVRCLSHP
Sbjct  1023  DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATVRCLSHP  1082

Query  556   SAHVRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERC  389
             SAHVRALSISVLR I++  S   +  P       NG++ P+Y+  N   TIDW+ADI++C
Sbjct  1083  SAHVRALSISVLRDIMNQSSXPIKVTPKLPTTEKNGMNSPSYRFFN-AATIDWKADIQKC  1141

Query  388   LNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             LN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1142  LNWEAHSLLSTTMPTQFLDTAARELGCTISL  1172



>ref|XP_010681263.1| PREDICTED: protein GIGANTEA [Beta vulgaris subsp. vulgaris]
 ref|XP_010681268.1| PREDICTED: protein GIGANTEA [Beta vulgaris subsp. vulgaris]
Length=1178

 Score =   213 bits (542),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 119/147 (81%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVL+WGESGLAVADGLSNLLKCR+PAT+ CLSHP
Sbjct  1033  DGMLVDGEACTLPQLELLEATARAVQPVLKWGESGLAVADGLSNLLKCRLPATITCLSHP  1092

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR I  +GSIK   K  + NG H  A++ L++ G IDW  DIE+CL  E
Sbjct  1093  SAHVRALSTSVLRDIQQNGSIKFSFKQESRNGTHKTAFEYLHI-GIIDWHTDIEKCLTWE  1151

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+L  G + E+LD AAKELGC I++
Sbjct  1152  AHSRLTRGKTIEYLDMAAKELGCAITI  1178



>gb|ABR26000.1| gigantea protein [Oryza sativa Indica Group]
Length=169

 Score =   196 bits (499),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 117/148 (79%), Gaps = 3/148 (2%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACTLPQLELLEVTARAV  ++EWG+SG++VADGLSNLLKCR+  T+RCLSHP
Sbjct  22   DGMLVDGEACTLPQLELLEVTARAVHLIVEWGDSGVSVADGLSNLLKCRLSTTIRCLSHP  81

Query  556  SAHVRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLN  383
            SAHVRALS+SVLR IL+SG I S    +  + NGI  P YQCL     I+WQAD+ERC+ 
Sbjct  82   SAHVRALSMSVLRDILNSGQINSSKLIQGEHRNGIQSPTYQCL-AASIINWQADVERCIE  140

Query  382  CEAHSQLANGMSAEFLDTAAKELGCTIS  299
             EAHS+ A G++  FL  AAKELGC ++
Sbjct  141  WEAHSRRATGLTLAFLTAAAKELGCPLT  168



>gb|AEK05793.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05794.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05796.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05797.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05798.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05804.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05805.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05806.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05809.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   211 bits (537),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 115/137 (84%), Gaps = 1/137 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLEWGESGLAVADGLSN+LKCR+PAT+RCLSHP
Sbjct  978   DGMLVDGEACTLPQLELLEATARAVQPVLEWGESGLAVADGLSNILKCRLPATIRCLSHP  1037

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALSISVLR IL +GSI+  +K  + NGIHGP+YQ  +    IDWQADIE+CL  E
Sbjct  1038  SAHVRALSISVLRDILQTGSIQPSSKQGDRNGIHGPSYQYFS-PDKIDWQADIEKCLTWE  1096

Query  376   AHSQLANGMSAEFLDTA  326
             A S+LA GM    LDTA
Sbjct  1097  ARSRLATGMPIHHLDTA  1113



>gb|AEK05801.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   211 bits (537),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 115/137 (84%), Gaps = 1/137 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLEWGESGLAVADGLSN+LKCR+PAT+RCLSHP
Sbjct  978   DGMLVDGEACTLPQLELLEATARAVQPVLEWGESGLAVADGLSNILKCRLPATIRCLSHP  1037

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALSISVLR IL +GSI+  +K  + NGIHGP+YQ  +    IDWQADIE+CL  E
Sbjct  1038  SAHVRALSISVLRDILQTGSIQPSSKQGDRNGIHGPSYQYFS-PDKIDWQADIEKCLTWE  1096

Query  376   AHSQLANGMSAEFLDTA  326
             A S+LA GM    LDTA
Sbjct  1097  ARSRLATGMPIHHLDTA  1113



>gb|AEK05795.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05800.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   211 bits (537),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 115/137 (84%), Gaps = 1/137 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLEWGESGLAVADGLSN+LKCR+PAT+RCLSHP
Sbjct  978   DGMLVDGEACTLPQLELLEATARAVQPVLEWGESGLAVADGLSNILKCRLPATIRCLSHP  1037

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALSISVLR IL +GSI+  +K  + NGIHGP+YQ  +    IDWQADIE+CL  E
Sbjct  1038  SAHVRALSISVLRDILQTGSIQPSSKQGDRNGIHGPSYQYFS-PDKIDWQADIEKCLTWE  1096

Query  376   AHSQLANGMSAEFLDTA  326
             A S+LA GM    LDTA
Sbjct  1097  ARSRLATGMPIHHLDTA  1113



>gb|AEK05790.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05808.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   211 bits (537),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 115/137 (84%), Gaps = 1/137 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLEWGESGLAVADGLSN+LKCR+PAT+RCLSHP
Sbjct  978   DGMLVDGEACTLPQLELLEATARAVQPVLEWGESGLAVADGLSNILKCRLPATIRCLSHP  1037

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALSISVLR IL +GSI+  +K  + NGIHGP+YQ  +    IDWQADIE+CL  E
Sbjct  1038  SAHVRALSISVLRDILQTGSIQPSSKQGDRNGIHGPSYQYFS-PDKIDWQADIEKCLTWE  1096

Query  376   AHSQLANGMSAEFLDTA  326
             A S+LA GM    LDTA
Sbjct  1097  ARSRLATGMPIHHLDTA  1113



>gb|AEK05807.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05810.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05811.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   211 bits (537),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 115/137 (84%), Gaps = 1/137 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLEWGESGLAVADGLSN+LKCR+PAT+RCLSHP
Sbjct  978   DGMLVDGEACTLPQLELLEATARAVQPVLEWGESGLAVADGLSNILKCRLPATIRCLSHP  1037

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALSISVLR IL +GSI+  +K  + NGIHGP+YQ  +    IDWQADIE+CL  E
Sbjct  1038  SAHVRALSISVLRDILQTGSIQPSSKQGDRNGIHGPSYQYFS-PDKIDWQADIEKCLTWE  1096

Query  376   AHSQLANGMSAEFLDTA  326
             A S+LA GM    LDTA
Sbjct  1097  ARSRLATGMPIHHLDTA  1113



>gb|AEK05799.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   211 bits (537),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 115/137 (84%), Gaps = 1/137 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLEWGESGLAVADGLSN+LKCR+PAT+RCLSHP
Sbjct  978   DGMLVDGEACTLPQLELLEATARAVQPVLEWGESGLAVADGLSNILKCRLPATIRCLSHP  1037

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALSISVLR IL +GSI+  +K  + NGIHGP+YQ  +    IDWQADIE+CL  E
Sbjct  1038  SAHVRALSISVLRDILQTGSIQPSSKQGDRNGIHGPSYQYFS-PDKIDWQADIEKCLTWE  1096

Query  376   AHSQLANGMSAEFLDTA  326
             A S+LA GM    LDTA
Sbjct  1097  ARSRLATGMPIHHLDTA  1113



>gb|AEK05791.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05792.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   211 bits (537),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 115/137 (84%), Gaps = 1/137 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLEWGESGLAVADGLSN+LKCR+PAT+RCLSHP
Sbjct  978   DGMLVDGEACTLPQLELLEATARAVQPVLEWGESGLAVADGLSNILKCRLPATIRCLSHP  1037

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALSISVLR IL +GSI+  +K  + NGIHGP+YQ  +    IDWQADIE+CL  E
Sbjct  1038  SAHVRALSISVLRDILQTGSIQPSSKQGDRNGIHGPSYQYFS-PDKIDWQADIEKCLTWE  1096

Query  376   AHSQLANGMSAEFLDTA  326
             A S+LA GM    LDTA
Sbjct  1097  ARSRLATGMPIHHLDTA  1113



>gb|AEK05802.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   211 bits (537),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 115/137 (84%), Gaps = 1/137 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLEWGESGLAVADGLSN+LKCR+PAT+RCLSHP
Sbjct  978   DGMLVDGEACTLPQLELLEATARAVQPVLEWGESGLAVADGLSNILKCRLPATIRCLSHP  1037

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALSISVLR IL +GSI+  +K  + NGIHGP+YQ  +    IDWQADIE+CL  E
Sbjct  1038  SAHVRALSISVLRDILQTGSIQPSSKQGDRNGIHGPSYQYFS-PDKIDWQADIEKCLTWE  1096

Query  376   AHSQLANGMSAEFLDTA  326
             A S+LA GM    LDTA
Sbjct  1097  ARSRLATGMPIHHLDTA  1113



>gb|AAF00023.1| GIGANTEA [Arabidopsis thaliana]
Length=1155

 Score =   210 bits (535),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PAT+RCLSHP
Sbjct  1004  DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHP  1063

Query  556   SAHVRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERC  389
             SAHVRALS SVLR I++  SI  +  P       NG++ P+Y+  N   +IDW+ADI+ C
Sbjct  1064  SAHVRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AASIDWKADIQNC  1122

Query  388   LNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             LN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1123  LNWEAHSLLSTTMPTQFLDTAARELGCTISL  1153



>emb|CAA72908.1| hypothetical protein [Arabidopsis thaliana]
Length=1167

 Score =   210 bits (535),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PAT+RCLSHP
Sbjct  1016  DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHP  1075

Query  556   SAHVRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERC  389
             SAHVRALS SVLR I++  SI  +  P       NG++ P+Y+  N   +IDW+ADI+ C
Sbjct  1076  SAHVRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AASIDWKADIQNC  1134

Query  388   LNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             LN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1135  LNWEAHSLLSTTMPTQFLDTAARELGCTISL  1165



>gb|ABP96483.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96490.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96491.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96492.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96493.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96494.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96495.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96502.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   210 bits (535),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PAT+RCLSHP
Sbjct  1022  DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHP  1081

Query  556   SAHVRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERC  389
             SAHVRALS SVLR I++  SI  +  P       NG++ P+Y+  N   +IDW+ADI+ C
Sbjct  1082  SAHVRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AASIDWKADIQNC  1140

Query  388   LNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             LN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1141  LNWEAHSLLSTTMPTQFLDTAARELGCTISL  1171



>gb|EYU30283.1| hypothetical protein MIMGU_mgv1a000455mg [Erythranthe guttata]
Length=1141

 Score =   210 bits (535),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 121/148 (82%), Gaps = 4/148 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARA+QPVLEWGESGL VADGL+NLLKCR+PATVRC+SHP
Sbjct  997   DGMLVDGEACTLPQLELLEVTARAIQPVLEWGESGLTVADGLTNLLKCRLPATVRCVSHP  1056

Query  556   SAHVRALSISVLRAILHSGSIK-SRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  380
             SAHVRALS SVLRAILH+GS K +  K    N IH P +    +   +DWQADIE+CL  
Sbjct  1057  SAHVRALSTSVLRAILHAGSRKPNTTKTGAANSIHSPRHHHHLL---LDWQADIEKCLAW  1113

Query  379   EAHSQLANGMSAEFLDTAAKELGCTISV  296
             EAHS+   G+  +F+D+AAKELGCTISV
Sbjct  1114  EAHSRRVTGLPVQFVDSAAKELGCTISV  1141



>gb|ABP96496.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   210 bits (535),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PAT+RCLSHP
Sbjct  1022  DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHP  1081

Query  556   SAHVRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERC  389
             SAHVRALS SVLR I++  SI  +  P       NG++ P+Y+  N   +IDW+ADI+ C
Sbjct  1082  SAHVRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AASIDWKADIQNC  1140

Query  388   LNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             LN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1141  LNWEAHSLLSTTMPTQFLDTAARELGCTISL  1171



>gb|ABP96484.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96487.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96489.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96500.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96501.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   210 bits (535),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PAT+RCLSHP
Sbjct  1022  DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHP  1081

Query  556   SAHVRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERC  389
             SAHVRALS SVLR I++  SI  +  P       NG++ P+Y+  N   +IDW+ADI+ C
Sbjct  1082  SAHVRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AASIDWKADIQNC  1140

Query  388   LNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             LN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1141  LNWEAHSLLSTTMPTQFLDTAARELGCTISL  1171



>gb|ABP96485.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96486.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96499.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   210 bits (535),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PAT+RCLSHP
Sbjct  1022  DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHP  1081

Query  556   SAHVRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERC  389
             SAHVRALS SVLR I++  SI  +  P       NG++ P+Y+  N   +IDW+ADI+ C
Sbjct  1082  SAHVRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AASIDWKADIQNC  1140

Query  388   LNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             LN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1141  LNWEAHSLLSTTMPTQFLDTAARELGCTISL  1171



>ref|NP_564180.1| protein GIGANTEA [Arabidopsis thaliana]
 sp|Q9SQI2.2|GIGAN_ARATH RecName: Full=Protein GIGANTEA [Arabidopsis thaliana]
 gb|AAF00092.1|AF105064_1 GIGANTEA [Arabidopsis thaliana]
 emb|CAB56039.1| gigantea protein [Arabidopsis thaliana]
 gb|AAT97405.1| gigantea [Arabidopsis thaliana]
 gb|AEE30286.1| gigantea protein (GI) [Arabidopsis thaliana]
Length=1173

 Score =   210 bits (535),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PAT+RCLSHP
Sbjct  1022  DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHP  1081

Query  556   SAHVRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERC  389
             SAHVRALS SVLR I++  SI  +  P       NG++ P+Y+  N   +IDW+ADI+ C
Sbjct  1082  SAHVRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AASIDWKADIQNC  1140

Query  388   LNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             LN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1141  LNWEAHSLLSTTMPTQFLDTAARELGCTISL  1171



>gb|AAT97404.1| gigantea [Arabidopsis thaliana]
Length=1173

 Score =   210 bits (535),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PAT+RCLSHP
Sbjct  1022  DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHP  1081

Query  556   SAHVRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERC  389
             SAHVRALS SVLR I++  SI  +  P       NG++ P+Y+  N   +IDW+ADI+ C
Sbjct  1082  SAHVRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AASIDWKADIQNC  1140

Query  388   LNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             LN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1141  LNWEAHSLLSTTMPTQFLDTAARELGCTISL  1171



>gb|AAT80910.1| GIGANTEA [Arabidopsis thaliana]
Length=1173

 Score =   210 bits (535),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PAT+RCLSHP
Sbjct  1022  DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHP  1081

Query  556   SAHVRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERC  389
             SAHVRALS SVLR I++  SI  +  P       NG++ P+Y+  N   +IDW+ADI+ C
Sbjct  1082  SAHVRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AASIDWKADIQNC  1140

Query  388   LNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             LN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1141  LNWEAHSLLSTTMPTQFLDTAARELGCTISL  1171



>gb|ABP96488.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   210 bits (535),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PAT+RCLSHP
Sbjct  1022  DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHP  1081

Query  556   SAHVRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERC  389
             SAHVRALS SVLR I++  SI  +  P       NG++ P+Y+  N   +IDW+ADI+ C
Sbjct  1082  SAHVRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AASIDWKADIQNC  1140

Query  388   LNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             LN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1141  LNWEAHSLLSTTMPTQFLDTAARELGCTISL  1171



>gb|ABP96498.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   210 bits (535),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PAT+RCLSHP
Sbjct  1022  DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHP  1081

Query  556   SAHVRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERC  389
             SAHVRALS SVLR I++  SI  +  P       NG++ P+Y+  N   +IDW+ADI+ C
Sbjct  1082  SAHVRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AASIDWKADIQNC  1140

Query  388   LNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             LN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1141  LNWEAHSLLSTTMPTQFLDTAARELGCTISL  1171



>gb|ABP96482.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   210 bits (535),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PAT+RCLSHP
Sbjct  1022  DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHP  1081

Query  556   SAHVRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERC  389
             SAHVRALS SVLR I++  SI  +  P       NG++ P+Y+  N   +IDW+ADI+ C
Sbjct  1082  SAHVRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AASIDWKADIQNC  1140

Query  388   LNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             LN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1141  LNWEAHSLLSTTMPTQFLDTAARELGCTISL  1171



>gb|ABP96497.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   210 bits (535),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PAT+RCLSHP
Sbjct  1022  DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHP  1081

Query  556   SAHVRALSISVLRAILHSGSIKSRAKP----VNMNGIHGPAYQCLNVGGTIDWQADIERC  389
             SAHVRALS SVLR I++  SI  +  P       NG++ P+Y+  N   +IDW+ADI+ C
Sbjct  1082  SAHVRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFN-AASIDWKADIQNC  1140

Query  388   LNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             LN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1141  LNWEAHSLLSTTMPTQFLDTAARELGCTISL  1171



>ref|XP_006416159.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 ref|XP_006416160.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 gb|ESQ34512.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 gb|ESQ34513.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
Length=1171

 Score =   209 bits (533),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 118/152 (78%), Gaps = 6/152 (4%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PAT+RCLSHP
Sbjct  1018  DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHP  1077

Query  556   SAHVRALSISVLRAILHSGSIKSRAKP-----VNMNGIHGPAYQCLNVGGTIDWQADIER  392
             SAHVRALS SVLR I++  S+     P        N +H P+Y+  N   TIDW+ADI++
Sbjct  1078  SAHVRALSTSVLRDIMNQSSVTITVTPKQRPATEKNVMHSPSYRFFN-AATIDWKADIQK  1136

Query  391   CLNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             CLN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1137  CLNWEAHSLLSTTMPTQFLDTAARELGCTISL  1168



>dbj|BAD68053.1| putative gigantea [Oryza sativa Japonica Group]
Length=261

 Score =   196 bits (499),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 117/148 (79%), Gaps = 3/148 (2%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACTLPQLELLEVTARAV  ++EWG+SG++VADGLSNLLKCR+  T+RCLSHP
Sbjct  114  DGMLVDGEACTLPQLELLEVTARAVHLIVEWGDSGVSVADGLSNLLKCRLSTTIRCLSHP  173

Query  556  SAHVRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLN  383
            SAHVRALS+SVLR IL+SG I S    +  + NGI  P YQCL     I+WQAD+ERC+ 
Sbjct  174  SAHVRALSMSVLRDILNSGQINSSKLIQGEHRNGIQSPTYQCL-AASIINWQADVERCIE  232

Query  382  CEAHSQLANGMSAEFLDTAAKELGCTIS  299
             EAHS+ A G++  FL  AAKELGC ++
Sbjct  233  WEAHSRRATGLTLAFLTAAAKELGCPLT  260



>gb|AEK05803.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   208 bits (529),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 114/137 (83%), Gaps = 1/137 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQPVLEWGESGLAVADGLSN+LKCR+PAT+RCLSHP
Sbjct  978   DGMLVDGEACTLPQLELLEATARAVQPVLEWGESGLAVADGLSNILKCRLPATIRCLSHP  1037

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALSISVLR IL +GSI+  +K  + NGIHGP+YQ  +    I WQADIE+CL  E
Sbjct  1038  SAHVRALSISVLRDILQTGSIQPSSKQGDRNGIHGPSYQYFS-PDKIXWQADIEKCLTWE  1096

Query  376   AHSQLANGMSAEFLDTA  326
             A S+LA GM    LDTA
Sbjct  1097  ARSRLATGMPIHHLDTA  1113



>emb|CBI22759.3| unnamed protein product [Vitis vinifera]
Length=259

 Score =   194 bits (494),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 110/147 (75%), Gaps = 26/147 (18%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACTLPQLELLE TARAVQ VLEWGESGLAVADGLSNLLKCR+PAT+RCLSHP
Sbjct  139  DGMLVDGEACTLPQLELLEATARAVQLVLEWGESGLAVADGLSNLLKCRVPATIRCLSHP  198

Query  556  SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
            SAHVRALS SVLR              VN+              G IDWQADIE+CL  E
Sbjct  199  SAHVRALSTSVLR------------DYVNL--------------GIIDWQADIEKCLTWE  232

Query  376  AHSQLANGMSAEFLDTAAKELGCTISV  296
            AHS+LA GM+ +FLD AAKELGCTIS+
Sbjct  233  AHSRLATGMTNQFLDVAAKELGCTISI  259



>gb|ACJ65314.1| GI3 protein [Glycine max]
Length=1155

 Score =   206 bits (524),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 120/147 (82%), Gaps = 4/147 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQL+LLE TA+AVQPV+E GESGL VADGLSNLLKCR+PAT+RCLSHP
Sbjct  1013  DGMLVDGEACTLPQLKLLEATAKAVQPVIELGESGLGVADGLSNLLKCRLPATIRCLSHP  1072

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SV+R ILH+ SI S  KP+  NGIH    Q LN    IDW+AD+E CL  E
Sbjct  1073  SAHVRALSSSVIRDILHTSSIGSSPKPLQKNGIHD---QYLNF-DVIDWRADVENCLTWE  1128

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+L+NG+S E+L+TAA +LG  IS+
Sbjct  1129  AHSRLSNGLSIEYLNTAADDLGFAISI  1155



>gb|KHN41309.1| Protein GIGANTEA [Glycine soja]
Length=1166

 Score =   206 bits (524),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 120/147 (82%), Gaps = 4/147 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQL+LLE TA+AVQPV+E GESGL VADGLSNLLKCR+PAT+RCLSHP
Sbjct  1024  DGMLVDGEACTLPQLKLLEATAKAVQPVIELGESGLGVADGLSNLLKCRLPATIRCLSHP  1083

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SV+R ILH+ SI S  KP+  NGIH    Q LN    IDW+AD+E CL  E
Sbjct  1084  SAHVRALSSSVIRDILHTSSIGSSPKPLQKNGIHD---QYLNF-DVIDWRADVENCLTWE  1139

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+L+NG+S E+L+TAA +LG  IS+
Sbjct  1140  AHSRLSNGLSIEYLNTAADDLGFAISI  1166



>ref|XP_010261024.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
Length=1174

 Score =   203 bits (516),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 117/147 (80%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQ V+EWGESG AVADGLSNLLKCR+PATV CLS P
Sbjct  1029  DGMLVDGEACTLPQLELLEATARAVQLVVEWGESGSAVADGLSNLLKCRLPATVHCLSRP  1088

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS+SVLR +L+ GS +S +K   +  IHG  Y  L++ G IDW  DIE+CL CE
Sbjct  1089  SAHVRALSVSVLRDVLYIGSNRSNSKQEGIQAIHGTRYPYLSL-GIIDWHEDIEKCLKCE  1147

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             A S+ A+GM+  FL  AAKELGCTIS 
Sbjct  1148  AQSRHASGMNITFLGAAAKELGCTIST  1174



>ref|XP_010261025.1| PREDICTED: protein GIGANTEA-like isoform X2 [Nelumbo nucifera]
Length=1102

 Score =   202 bits (515),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 117/147 (80%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQ V+EWGESG AVADGLSNLLKCR+PATV CLS P
Sbjct  957   DGMLVDGEACTLPQLELLEATARAVQLVVEWGESGSAVADGLSNLLKCRLPATVHCLSRP  1016

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS+SVLR +L+ GS +S +K   +  IHG  Y  L++ G IDW  DIE+CL CE
Sbjct  1017  SAHVRALSVSVLRDVLYIGSNRSNSKQEGIQAIHGTRYPYLSL-GIIDWHEDIEKCLKCE  1075

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             A S+ A+GM+  FL  AAKELGCTIS 
Sbjct  1076  AQSRHASGMNITFLGAAAKELGCTIST  1102



>ref|XP_009115601.1| PREDICTED: protein GIGANTEA [Brassica rapa]
Length=1171

 Score =   203 bits (516),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 118/155 (76%), Gaps = 9/155 (6%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PAT+RCLSHP
Sbjct  1015  DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHP  1074

Query  556   SAHVRALSISVLRAILH-SGSIKSRA-------KPVNMNGIHGPAYQCLNVGGTIDWQAD  401
             SAHVRALS SVLR I++ SG   ++A            NG   P+Y+  N    IDW+AD
Sbjct  1075  SAHVRALSTSVLRDIMNQSGITTTKATPKPPPTITTEKNGTDSPSYRFFNAAA-IDWKAD  1133

Query  400   IERCLNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             I++CLN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1134  IQKCLNWEAHSLLSTTMPTQFLDTAARELGCTISM  1168



>emb|CDY21388.1| BnaA09g30390D [Brassica napus]
Length=1171

 Score =   202 bits (515),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 118/155 (76%), Gaps = 9/155 (6%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PAT+RCLSHP
Sbjct  1015  DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHP  1074

Query  556   SAHVRALSISVLRAILH-SGSIKSRA-------KPVNMNGIHGPAYQCLNVGGTIDWQAD  401
             SAHVRALS SVLR I++ SG   ++A            NG   P+Y+  N    IDW+AD
Sbjct  1075  SAHVRALSTSVLRDIMNQSGITTTKATPKPPPTITTEKNGTDSPSYRFFNAAA-IDWKAD  1133

Query  400   IERCLNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             I++CLN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1134  IQKCLNWEAHSLLSTTMPTQFLDTAARELGCTISM  1168



>ref|NP_001288824.1| protein GIGANTEA [Brassica rapa]
 gb|AEB33730.1| GIGANTEA [Brassica rapa]
Length=1183

 Score =   202 bits (515),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 118/155 (76%), Gaps = 9/155 (6%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PAT+RCLSHP
Sbjct  1027  DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHP  1086

Query  556   SAHVRALSISVLRAILH-SGSIKSRA-------KPVNMNGIHGPAYQCLNVGGTIDWQAD  401
             SAHVRALS SVLR I++ SG   ++A            NG   P+Y+  N    IDW+AD
Sbjct  1087  SAHVRALSTSVLRDIMNQSGITTTKATPKPPPTITTEKNGTDSPSYRFFNAAA-IDWKAD  1145

Query  400   IERCLNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             I++CLN EAHS L+  M  +FLDTAA+ELGCTIS+
Sbjct  1146  IQKCLNWEAHSLLSTTMPTQFLDTAARELGCTISM  1180



>emb|CDY04787.1| BnaC05g18020D [Brassica napus]
Length=1170

 Score =   202 bits (513),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 117/155 (75%), Gaps = 9/155 (6%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+QPVL WG SGLAV DGLSNLLKCR+PAT+RCLSHP
Sbjct  1014  DGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHP  1073

Query  556   SAHVRALSISVLRAILH-SGSIKSRA-------KPVNMNGIHGPAYQCLNVGGTIDWQAD  401
             SAHVRALS SVLR I++ SG   S+A            NG   P+Y+  N    IDW+AD
Sbjct  1074  SAHVRALSTSVLRDIMNQSGITTSKATPKPPPTITTEKNGTDSPSYRFFNAAA-IDWKAD  1132

Query  400   IERCLNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             I++CLN EAHS L+  M  +FLDTAA ELGCTIS+
Sbjct  1133  IQKCLNWEAHSLLSTTMPTQFLDTAAGELGCTISM  1167



>gb|ACF84482.1| unknown [Zea mays]
Length=488

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 117/149 (79%), Gaps = 6/149 (4%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DG+LVDGEACTLPQLELLEVTARAV  ++EWG+ GL+VADGLSNLLKCR+  T+RCLSHP
Sbjct  340  DGILVDGEACTLPQLELLEVTARAVHLIIEWGDPGLSVADGLSNLLKCRLSTTIRCLSHP  399

Query  556  SAHVRALSISVLRAILHSGSIK----SRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERC  389
            SAHVRALS+SVLR IL  GS+     SR +    NGI  P+Y+C+   G ++WQAD+ERC
Sbjct  400  SAHVRALSMSVLRDILDHGSVSPNKISRGEQ-QRNGIQSPSYRCV-AAGILNWQADVERC  457

Query  388  LNCEAHSQLANGMSAEFLDTAAKELGCTI  302
            +  EAHS+ A G++  FL TAAKELGC +
Sbjct  458  IEWEAHSRRATGLTLAFLSTAAKELGCPL  486



>ref|NP_001042220.1| Os01g0182600 [Oryza sativa Japonica Group]
 sp|Q9AWL7.2|GIGAN_ORYSJ RecName: Full=Protein GIGANTEA [Oryza sativa Japonica Group]
 dbj|BAD68052.1| putative gigantea [Oryza sativa Japonica Group]
 dbj|BAF04134.1| Os01g0182600 [Oryza sativa Japonica Group]
Length=1160

 Score =   197 bits (502),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 117/148 (79%), Gaps = 3/148 (2%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARAV  ++EWG+SG++VADGLSNLLKCR+  T+RCLSHP
Sbjct  1013  DGMLVDGEACTLPQLELLEVTARAVHLIVEWGDSGVSVADGLSNLLKCRLSTTIRCLSHP  1072

Query  556   SAHVRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLN  383
             SAHVRALS+SVLR IL+SG I S    +  + NGI  P YQCL     I+WQAD+ERC+ 
Sbjct  1073  SAHVRALSMSVLRDILNSGQINSSKLIQGEHRNGIQSPTYQCL-AASIINWQADVERCIE  1131

Query  382   CEAHSQLANGMSAEFLDTAAKELGCTIS  299
              EAHS+ A G++  FL  AAKELGC ++
Sbjct  1132  WEAHSRRATGLTLAFLTAAAKELGCPLT  1159



>gb|ABZ81992.1| gigantea [Zea mays]
Length=1162

 Score =   197 bits (502),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 117/148 (79%), Gaps = 4/148 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARAV  ++EWG+SGL+VADGLSNLLKCR+  T+RCLSHP
Sbjct  1014  DGMLVDGEACTLPQLELLEVTARAVHLIIEWGDSGLSVADGLSNLLKCRLSTTIRCLSHP  1073

Query  556   SAHVRALSISVLRAILHSGSI---KSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCL  386
             SAHVRALS+SVLR IL +GS+   K+       NGI  P+Y+CL   G I+WQAD+ERC+
Sbjct  1074  SAHVRALSMSVLRDILSNGSVNPNKTIQGEQQRNGIQSPSYRCL-AAGIINWQADVERCI  1132

Query  385   NCEAHSQLANGMSAEFLDTAAKELGCTI  302
               EAHS+ A G++  FL  AAKELGC +
Sbjct  1133  EWEAHSRRATGLTLAFLSAAAKELGCPL  1160



>ref|NP_001288586.1| gigantea like1a [Zea mays]
 ref|XP_008655715.1| PREDICTED: protein GIGANTEA [Zea mays]
 ref|XP_008655716.1| PREDICTED: protein GIGANTEA [Zea mays]
 tpg|DAA06172.1| TPA_inf: gigantea 1A [Zea mays]
 gb|AFW80283.1| gigantea isoform 1 [Zea mays]
 gb|AFW80284.1| gigantea isoform 2 [Zea mays]
Length=1162

 Score =   197 bits (502),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 117/148 (79%), Gaps = 4/148 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARAV  ++EWG+SGL+VADGLSNLLKCR+  T+RCLSHP
Sbjct  1014  DGMLVDGEACTLPQLELLEVTARAVHLIIEWGDSGLSVADGLSNLLKCRLSTTIRCLSHP  1073

Query  556   SAHVRALSISVLRAILHSGSI---KSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCL  386
             SAHVRALS+SVLR IL +GS+   K+       NGI  P+Y+CL   G I+WQAD+ERC+
Sbjct  1074  SAHVRALSMSVLRDILSNGSVNPNKTIQGEQQRNGIQSPSYRCL-AAGIINWQADVERCI  1132

Query  385   NCEAHSQLANGMSAEFLDTAAKELGCTI  302
               EAHS+ A G++  FL  AAKELGC +
Sbjct  1133  EWEAHSRRATGLTLAFLSAAAKELGCPL  1160



>gb|AGM20686.1| GI1-2 [Populus tomentosa]
Length=1170

 Score =   197 bits (502),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 109/135 (81%), Gaps = 1/135 (1%)
 Frame = -3

Query  700   PQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHPSAHVRALSISVL  521
             PQ  LLE TARAVQPVLEWGESGLAVADGLSNLLKCR+PAT+RCLSHPSAHVRALS SVL
Sbjct  1037  PQDVLLEATARAVQPVLEWGESGLAVADGLSNLLKCRLPATIRCLSHPSAHVRALSTSVL  1096

Query  520   RAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHSQLANGMSAE  341
             R IL SGSIK  +K  + NGI GP+YQ  +    IDWQADIE+CL  EA S+LA GM   
Sbjct  1097  RDILRSGSIKPSSKRADRNGIQGPSYQYFS-PDKIDWQADIEKCLTWEAGSRLATGMPIH  1155

Query  340   FLDTAAKELGCTISV  296
              LDTAAKELGCTIS+
Sbjct  1156  HLDTAAKELGCTISI  1170



>gb|EEE54000.1| hypothetical protein OsJ_00641 [Oryza sativa Japonica Group]
Length=1176

 Score =   197 bits (502),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 117/148 (79%), Gaps = 3/148 (2%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARAV  ++EWG+SG++VADGLSNLLKCR+  T+RCLSHP
Sbjct  1029  DGMLVDGEACTLPQLELLEVTARAVHLIVEWGDSGVSVADGLSNLLKCRLSTTIRCLSHP  1088

Query  556   SAHVRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLN  383
             SAHVRALS+SVLR IL+SG I S    +  + NGI  P YQCL     I+WQAD+ERC+ 
Sbjct  1089  SAHVRALSMSVLRDILNSGQINSSKLIQGEHRNGIQSPTYQCL-AASIINWQADVERCIE  1147

Query  382   CEAHSQLANGMSAEFLDTAAKELGCTIS  299
              EAHS+ A G++  FL  AAKELGC ++
Sbjct  1148  WEAHSRRATGLTLAFLTAAAKELGCPLT  1175



>gb|EEC70061.1| hypothetical protein OsI_00663 [Oryza sativa Indica Group]
Length=1176

 Score =   197 bits (501),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 117/148 (79%), Gaps = 3/148 (2%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARAV  ++EWG+SG++VADGLSNLLKCR+  T+RCLSHP
Sbjct  1029  DGMLVDGEACTLPQLELLEVTARAVHLIVEWGDSGVSVADGLSNLLKCRLSTTIRCLSHP  1088

Query  556   SAHVRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLN  383
             SAHVRALS+SVLR IL+SG I S    +  + NGI  P YQCL     I+WQAD+ERC+ 
Sbjct  1089  SAHVRALSMSVLRDILNSGQINSSKLIQGEHRNGIQSPTYQCL-AASIINWQADVERCIE  1147

Query  382   CEAHSQLANGMSAEFLDTAAKELGCTIS  299
              EAHS+ A G++  FL  AAKELGC ++
Sbjct  1148  WEAHSRRATGLTLAFLTAAAKELGCPLT  1175



>ref|XP_010535090.1| PREDICTED: protein GIGANTEA [Tarenaya hassleriana]
 ref|XP_010535098.1| PREDICTED: protein GIGANTEA [Tarenaya hassleriana]
 ref|XP_010535104.1| PREDICTED: protein GIGANTEA [Tarenaya hassleriana]
Length=1167

 Score =   197 bits (501),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 118/148 (80%), Gaps = 4/148 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARA+Q VLEWG+SG+A+ DGLSNLLKCR+PATVRCLSH 
Sbjct  1018  DGMLVDGEACTLPQLELLEATARAIQLVLEWGQSGIALVDGLSNLLKCRLPATVRCLSHQ  1077

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMN-GIHGPAYQCLNVGGTIDWQADIERCLNC  380
             SAHVR LSISVLR I+   S+K + KP   N GIH   +   N G  IDW+ADI++CL+ 
Sbjct  1078  SAHVRTLSISVLRGIMQQSSMKKK-KPQEKNGGIHKGTF--FNGGEAIDWKADIQKCLSW  1134

Query  379   EAHSQLANGMSAEFLDTAAKELGCTISV  296
             EAHS +++ +  +FLDTAA ELGCTIS+
Sbjct  1135  EAHSLVSSSLPTQFLDTAALELGCTISI  1162



>gb|AGW52153.1| GI [Populus tomentosa]
Length=1241

 Score =   197 bits (501),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 109/135 (81%), Gaps = 1/135 (1%)
 Frame = -3

Query  700   PQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHPSAHVRALSISVL  521
             PQ  LLE TARAVQPVLEWGESGLAVADGLSNLLKCR+PAT+RCLSHPSAHVRALS SVL
Sbjct  1108  PQDVLLEATARAVQPVLEWGESGLAVADGLSNLLKCRLPATIRCLSHPSAHVRALSTSVL  1167

Query  520   RAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHSQLANGMSAE  341
             R IL SGSIK  +K  + NGI GP+YQ  +    IDWQADIE+CL  EA S+LA GM   
Sbjct  1168  RDILRSGSIKPSSKRADRNGIQGPSYQYFS-PDKIDWQADIEKCLTWEAGSRLATGMPIH  1226

Query  340   FLDTAAKELGCTISV  296
              LDTAAKELGCTIS+
Sbjct  1227  HLDTAAKELGCTISI  1241



>gb|EYU36555.1| hypothetical protein MIMGU_mgv1a000427mg [Erythranthe guttata]
Length=1160

 Score =   197 bits (500),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 117/147 (80%), Gaps = 4/147 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARAVQ VL+WGESGLAVADGLSNLLKCR+PATVRC+SHP
Sbjct  1018  DGMLVDGEACTLPQLELLEVTARAVQTVLKWGESGLAVADGLSNLLKCRLPATVRCVSHP  1077

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLRA+LH+GS    AK   +NG     Y  +   G  D +A +E+CL  E
Sbjct  1078  SAHVRALSTSVLRAVLHAGSESISAK-SQVNGFRSQPYISV---GIRDCKAHVEKCLTWE  1133

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+LA G+  +F+DT AKELGCTI +
Sbjct  1134  AHSRLATGLPIQFVDTTAKELGCTICI  1160



>emb|CAB56058.1| gigantea homologue [Oryza sativa]
Length=975

 Score =   195 bits (496),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 118/148 (80%), Gaps = 4/148 (3%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACTLPQLELLEVTARAV  ++EWG+SG++VADGLSNLLKCR+  T+RCLSHP
Sbjct  829  DGMLVDGEACTLPQLELLEVTARAVHLIVEWGDSGVSVADGLSNLLKCRLSTTIRCLSHP  888

Query  556  SAHVRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLN  383
            SAHVRALS+SVLR IL+SG I S    +  + NGI  P YQCL     I+WQAD+ERC+ 
Sbjct  889  SAHVRALSMSVLRDILNSGQINSSKLIQGEHRNGIQSPTYQCL-AASIINWQADVERCIE  947

Query  382  CEAHSQLANGMSAEFLDTAAKELGCTIS  299
             EAHS+ A G++  FL TAAKELGC ++
Sbjct  948  WEAHSRRATGLTLAFL-TAAKELGCPLT  974



>ref|XP_007151935.1| hypothetical protein PHAVU_004G088300g [Phaseolus vulgaris]
 gb|ESW23929.1| hypothetical protein PHAVU_004G088300g [Phaseolus vulgaris]
Length=1169

 Score =   195 bits (496),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 117/148 (79%), Gaps = 5/148 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTL QL+LLE TA+AVQPV+E GESG AVADGLSNLLKCR+PAT+RCLSHP
Sbjct  1026  DGMLVDGEACTLTQLKLLEATAKAVQPVIELGESGFAVADGLSNLLKCRLPATIRCLSHP  1085

Query  556   SAHVRALSISVLRAILHSGSIKSRA-KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  380
             SAHVRALS SVLR ILH+ SI+  + K    N IH    Q  N+   IDWQADI +CL  
Sbjct  1086  SAHVRALSTSVLRDILHTCSIRRYSPKRPQKNDIHN---QYFNL-DVIDWQADINKCLTW  1141

Query  379   EAHSQLANGMSAEFLDTAAKELGCTISV  296
             EAHSQL NGMS E+L+TAA++LG  IS+
Sbjct  1142  EAHSQLLNGMSIEYLNTAARDLGFGISI  1169



>ref|XP_006643836.1| PREDICTED: protein GIGANTEA-like isoform X1 [Oryza brachyantha]
 ref|XP_006643837.1| PREDICTED: protein GIGANTEA-like isoform X2 [Oryza brachyantha]
Length=1162

 Score =   195 bits (496),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 117/150 (78%), Gaps = 5/150 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARAV  ++EWG+SG+AVADGLSNLLKCR+  T+RCLSHP
Sbjct  1013  DGMLVDGEACTLPQLELLEVTARAVHLIVEWGDSGVAVADGLSNLLKCRLSTTIRCLSHP  1072

Query  556   SAHVRALSISVLRAILHSGSIKS----RAKPVNMNGIHGPAYQCLNVGGTIDWQADIERC  389
             SAHVRALS+SVLR IL+SG I S    + +  + NGI  P YQCL     I+WQAD+ERC
Sbjct  1073  SAHVRALSMSVLRDILNSGQIHSSKLIQIQGEHRNGIQSPTYQCL-AASIINWQADVERC  1131

Query  388   LNCEAHSQLANGMSAEFLDTAAKELGCTIS  299
             +  EA S+ A G++  FL  AAKELGC ++
Sbjct  1132  IEWEARSRRATGLTLAFLTAAAKELGCPLT  1161



>gb|ADZ72836.1| GIGANTEA-like protein [Aquilegia formosa]
Length=750

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 112/146 (77%), Gaps = 2/146 (1%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACTLPQLELLE TA+AVQ V++WG+S  A+ DGLSNLLKCR+PATVRCLSHP
Sbjct  604  DGMLVDGEACTLPQLELLEATAKAVQLVVKWGDSSSAITDGLSNLLKCRLPATVRCLSHP  663

Query  556  SAHVRALSISVLRAILHSGSIKSRAK-PVNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  380
            SAHVRALS SVLR IL  G IK   K     +G+ GP+++CL+    IDW  DIE+CL  
Sbjct  664  SAHVRALSTSVLRDILFLGPIKFNVKQEKRYSGVQGPSHRCLS-SSIIDWNKDIEKCLTW  722

Query  379  EAHSQLANGMSAEFLDTAAKELGCTI  302
            EA S+   G+S  FLD AAK+LGCTI
Sbjct  723  EARSRHTTGVSTTFLDAAAKDLGCTI  748



>ref|XP_006842209.1| hypothetical protein AMTR_s00078p00173230 [Amborella trichopoda]
 gb|ERN03884.1| hypothetical protein AMTR_s00078p00173230 [Amborella trichopoda]
Length=1143

 Score =   194 bits (492),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 116/147 (79%), Gaps = 1/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAVQ  L WGESG +VADGLSNLLKCR+PAT+ CLSHP
Sbjct  998   DGMLVDGEACTLPQLELLEATARAVQLFLSWGESGSSVADGLSNLLKCRLPATIHCLSHP  1057

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS S+LR IL+ GS KS     ++ GI  P Y+ +++ GTIDW++D+E+CL  E
Sbjct  1058  SAHVRALSTSLLRDILNIGSPKSNFAEEDIRGIPVPPYRNISI-GTIDWRSDLEKCLAWE  1116

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             A ++ A GM+  FL  AAKELGC ISV
Sbjct  1117  ARNRRATGMTLTFLSAAAKELGCAISV  1143



>ref|XP_010915066.1| PREDICTED: protein GIGANTEA-like [Elaeis guineensis]
Length=1171

 Score =   193 bits (490),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 117/147 (80%), Gaps = 2/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAV  V+ WGESGLAVADGLSNLLK R+ AT+RCLSHP
Sbjct  1025  DGMLVDGEACTLPQLELLEATARAVLLVVNWGESGLAVADGLSNLLKFRLSATIRCLSHP  1084

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMN-GIHGPAYQCLNVGGTIDWQADIERCLNC  380
             SAHVRALS SVLR I+HS  IKS +     N GI  P+Y CL+V G I+W ADIE+C+  
Sbjct  1085  SAHVRALSTSVLRDIMHSNPIKSTSFLHGDNQGICDPSYGCLSV-GIINWHADIEKCIKW  1143

Query  379   EAHSQLANGMSAEFLDTAAKELGCTIS  299
             EAHS+LA G++  FL+ AAKELGC ++
Sbjct  1144  EAHSRLATGLTLAFLNAAAKELGCPLT  1170



>ref|XP_008672375.1| PREDICTED: uncharacterized protein LOC100272803 isoform X1 [Zea 
mays]
 ref|XP_008672376.1| PREDICTED: uncharacterized protein LOC100272803 isoform X1 [Zea 
mays]
 ref|XP_008672377.1| PREDICTED: uncharacterized protein LOC100272803 isoform X1 [Zea 
mays]
 tpg|DAA53146.1| TPA: gigantea1B [Zea mays]
Length=1160

 Score =   192 bits (489),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 117/149 (79%), Gaps = 6/149 (4%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DG+LVDGEACTLPQLELLEVTARAV  ++EWG+ GL+VADGLSNLLKCR+  T+RCLSHP
Sbjct  1012  DGILVDGEACTLPQLELLEVTARAVHLIIEWGDPGLSVADGLSNLLKCRLSTTIRCLSHP  1071

Query  556   SAHVRALSISVLRAILHSGSIK----SRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERC  389
             SAHVRALS+SVLR IL  GS+     SR +    NGI  P+Y+C+   G ++WQAD+ERC
Sbjct  1072  SAHVRALSMSVLRDILDHGSVSPNKISRGE-QQRNGIQSPSYRCV-AAGILNWQADVERC  1129

Query  388   LNCEAHSQLANGMSAEFLDTAAKELGCTI  302
             +  EAHS+ A G++  FL TAAKELGC +
Sbjct  1130  IEWEAHSRRATGLTLAFLSTAAKELGCPL  1158



>ref|NP_001140728.1| uncharacterized protein LOC100272803 [Zea mays]
 tpg|DAA06171.1| TPA_inf: gigantea 1B [Zea mays]
Length=1160

 Score =   192 bits (489),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 117/149 (79%), Gaps = 6/149 (4%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DG+LVDGEACTLPQLELLEVTARAV  ++EWG+ GL+VADGLSNLLKCR+  T+RCLSHP
Sbjct  1012  DGILVDGEACTLPQLELLEVTARAVHLIIEWGDPGLSVADGLSNLLKCRLSTTIRCLSHP  1071

Query  556   SAHVRALSISVLRAILHSGSIK----SRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERC  389
             SAHVRALS+SVLR IL  GS+     SR +    NGI  P+Y+C+   G ++WQAD+ERC
Sbjct  1072  SAHVRALSMSVLRDILDHGSVSPNKISRGE-QQRNGIQSPSYRCV-AAGILNWQADVERC  1129

Query  388   LNCEAHSQLANGMSAEFLDTAAKELGCTI  302
             +  EAHS+ A G++  FL TAAKELGC +
Sbjct  1130  IEWEAHSRRATGLTLAFLSTAAKELGCPL  1158



>ref|XP_008793464.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
Length=1169

 Score =   192 bits (488),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 116/147 (79%), Gaps = 2/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE TARAV  V  WGESGLAVADGLSNLLKCR+ AT+RCLSHP
Sbjct  1023  DGMLVDGEACTLPQLELLEATARAVLLVANWGESGLAVADGLSNLLKCRLSATIRCLSHP  1082

Query  556   SAHVRALSISVLRAILHSGSIKSRA-KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  380
             SAHVRALS SVLR I++S  IKS +    +  G+  P+Y CL+V G ++W ADIE+C+  
Sbjct  1083  SAHVRALSTSVLRDIMYSNPIKSTSFMHGDSQGLRDPSYGCLSV-GIVNWHADIEKCIKW  1141

Query  379   EAHSQLANGMSAEFLDTAAKELGCTIS  299
             EAHS+ A G++  FLD AAKELGC ++
Sbjct  1142  EAHSRRATGLTLAFLDAAAKELGCPLT  1168



>ref|XP_009380419.1| PREDICTED: protein GIGANTEA-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380420.1| PREDICTED: protein GIGANTEA-like isoform X2 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380421.1| PREDICTED: protein GIGANTEA-like isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=1162

 Score =   191 bits (486),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 118/152 (78%), Gaps = 12/152 (8%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARAV+ V++WGESGLAVAD LSNLLKCR+PA V+CLSHP
Sbjct  1016  DGMLVDGEACTLPQLELLEVTARAVRLVIQWGESGLAVADDLSNLLKCRLPAAVQCLSHP  1075

Query  556   SAHVRALSISVLRAILH------SGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIE  395
             SAHVRALSI+VLR I+       SG I+  A      G+  P+YQCLN+ G I+W +D+E
Sbjct  1076  SAHVRALSIAVLRNIIQNSMSNGSGRIQGDAP-----GLSDPSYQCLNL-GIINWHSDVE  1129

Query  394   RCLNCEAHSQLANGMSAEFLDTAAKELGCTIS  299
             +CL  EA S+LA G++  FL  AAKELGC IS
Sbjct  1130  KCLKWEARSRLATGLTLAFLSAAAKELGCPIS  1161



>gb|AIC83986.1| gigantea-like protein [Festuca pratensis]
Length=1149

 Score =   190 bits (482),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 114/147 (78%), Gaps = 3/147 (2%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARA+  ++EWG+ G+AVADGLSNLLKCR+  T+RCLSHP
Sbjct  1002  DGMLVDGEACTLPQLELLEVTARAIHLIVEWGDPGVAVADGLSNLLKCRLSPTIRCLSHP  1061

Query  556   SAHVRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLN  383
             SAHVRALS+SVLR IL+SG I S    +    NGI  P+Y+C+    T +WQAD+ERC+ 
Sbjct  1062  SAHVRALSMSVLRDILNSGPISSTKINQGEQRNGIQSPSYRCMAASMT-NWQADVERCIE  1120

Query  382   CEAHSQLANGMSAEFLDTAAKELGCTI  302
              EAH++ A GM+  FL  AA ELGC +
Sbjct  1121  WEAHNRQATGMTLAFLTAAANELGCPL  1147



>gb|KJB28962.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1147

 Score =   190 bits (482),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 106/147 (72%), Gaps = 18/147 (12%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGE        LLE TARAVQPVLEWGESGLAV DGLSNLLKCR+PAT RCLSHP
Sbjct  1019  DGMLVDGE--------LLEATARAVQPVLEWGESGLAVVDGLSNLLKCRLPATTRCLSHP  1070

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALSISVLR IL S         + +NGIHGP +        IDW  DIE+CL  E
Sbjct  1071  SAHVRALSISVLRNILQSN------PKLEINGIHGPYFSI----SVIDWHTDIEKCLTWE  1120

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHSQLA GM   FLDTAAKELGC IS+
Sbjct  1121  AHSQLARGMPIHFLDTAAKELGCNISM  1147



>ref|XP_004968438.1| PREDICTED: protein GIGANTEA-like [Setaria italica]
Length=1160

 Score =   190 bits (482),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 115/148 (78%), Gaps = 5/148 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARAV  ++EWG+SGL+VADGLSNLLKCR+  T+RCLSHP
Sbjct  1013  DGMLVDGEACTLPQLELLEVTARAVHLIIEWGDSGLSVADGLSNLLKCRLSPTIRCLSHP  1072

Query  556   SAHVRALSISVLRAILHSGSI---KSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCL  386
             SAHVRALS+SVLR IL++G I   K        NGI   +Y+CL    +I+WQAD+ERC+
Sbjct  1073  SAHVRALSMSVLRDILNNGHITPSKIIQGEQQRNGIQNSSYRCL--AASINWQADVERCI  1130

Query  385   NCEAHSQLANGMSAEFLDTAAKELGCTI  302
               EAHS+ A G++  FL  AAKELGC +
Sbjct  1131  EWEAHSRRATGLTLAFLSAAAKELGCPL  1158



>emb|CAY26028.1| GIGANTEA [Lolium perenne]
 gb|ABF83898.2| GIGANTEA [Lolium perenne]
Length=1148

 Score =   188 bits (478),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 113/147 (77%), Gaps = 3/147 (2%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARA+  ++EWG+ G+AVADGLSNLLKCR+  T+RCLSHP
Sbjct  1001  DGMLVDGEACTLPQLELLEVTARAIHLIVEWGDPGVAVADGLSNLLKCRLSPTIRCLSHP  1060

Query  556   SAHVRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLN  383
             SAHVRALS+SVLR IL+SG I S    +    NGI  P+Y+C     T +WQAD+ERC+ 
Sbjct  1061  SAHVRALSMSVLRDILNSGPISSTKIIQGEQRNGIQSPSYRCAAASMT-NWQADVERCIE  1119

Query  382   CEAHSQLANGMSAEFLDTAAKELGCTI  302
              EAH++ A GM+  FL  AA ELGC +
Sbjct  1120  WEAHNRQATGMTLAFLTAAANELGCPL  1146



>gb|AAL08497.2| gigantea-like protein [Hordeum vulgare]
Length=856

 Score =   186 bits (473),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 114/148 (77%), Gaps = 5/148 (3%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACTLPQLELLEVTARA+  ++EWG+ G+AVADGLSNLLKCR+  T+RCLSH 
Sbjct  709  DGMLVDGEACTLPQLELLEVTARAIHLIVEWGDPGVAVADGLSNLLKCRLSPTIRCLSHA  768

Query  556  SAHVRALSISVLRAILHSGSIKSRAKPV---NMNGIHGPAYQCLNVGGTIDWQADIERCL  386
            SAHVRALS+SVLR IL+SG + S +K +     NGI  P YQC     T++WQAD+ERC+
Sbjct  769  SAHVRALSMSVLRDILNSGPLGS-SKTIQGEQRNGIQSPNYQC-AAANTVNWQADVERCI  826

Query  385  NCEAHSQLANGMSAEFLDTAAKELGCTI  302
            + EA S+ A GM+  FL  AA ELGC +
Sbjct  827  DWEARSRRATGMTLAFLTAAANELGCPL  854



>ref|XP_003564357.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230544.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230545.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230546.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230547.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
Length=1155

 Score =   188 bits (477),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 111/147 (76%), Gaps = 3/147 (2%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARA+  ++EWG+ G+AVADGLSNLLKCR+  T+RCLSHP
Sbjct  1008  DGMLVDGEACTLPQLELLEVTARAIHLIVEWGDPGVAVADGLSNLLKCRLSTTIRCLSHP  1067

Query  556   SAHVRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLN  383
             SAHVRALS+SVLR IL+SG I S    +    NG+  P YQC      ++WQAD+ERC+ 
Sbjct  1068  SAHVRALSMSVLRDILNSGPINSTKIIQGEQRNGVQSPTYQC-AAASMVNWQADMERCIE  1126

Query  382   CEAHSQLANGMSAEFLDTAAKELGCTI  302
              EA S+ A GM+  FL  AA ELGC +
Sbjct  1127  WEARSRRATGMTLAFLSAAANELGCPL  1153



>emb|CDM81775.1| unnamed protein product [Triticum aestivum]
Length=1155

 Score =   187 bits (476),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 113/147 (77%), Gaps = 3/147 (2%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARA+  ++EWG+ G+AVADGLSNLLKCR+  T+RCLSH 
Sbjct  1008  DGMLVDGEACTLPQLELLEVTARAIHLIVEWGDPGVAVADGLSNLLKCRLSPTIRCLSHA  1067

Query  556   SAHVRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLN  383
             SAHVRALS+SVLR IL+SG + S    +    NGI  P YQC     T++WQAD+ERC++
Sbjct  1068  SAHVRALSMSVLRDILNSGPLGSTKIIQGEQRNGIQSPNYQCA-AANTVNWQADVERCID  1126

Query  382   CEAHSQLANGMSAEFLDTAAKELGCTI  302
              EA S+ A GM+  FL  AA ELGCT+
Sbjct  1127  WEARSRRATGMTLAFLTAAANELGCTL  1153



>gb|KHN00736.1| Protein GIGANTEA [Glycine soja]
Length=176

 Score =   173 bits (439),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 105/132 (80%), Gaps = 4/132 (3%)
 Frame = -3

Query  691  ELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHPSAHVRALSISVLRAI  512
            +LLE TA+AVQPV+E GESGLAVADGLSNLLKCR+PAT+RCLSHPSA+VRALS SVLR I
Sbjct  49   QLLEATAKAVQPVIELGESGLAVADGLSNLLKCRLPATIRCLSHPSANVRALSTSVLRDI  108

Query  511  LHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCEAHSQLANGMSAEFLD  332
            LH+ SI S  KP   NGIH    Q  N+   IDW+AD+E+C   EAHS+L+NG+S E+L+
Sbjct  109  LHTSSIGSSPKPPQKNGIHN---QYFNL-DVIDWRADVEKCSTWEAHSRLSNGLSIEYLN  164

Query  331  TAAKELGCTISV  296
            TAA +LG  IS+
Sbjct  165  TAANDLGFAISI  176



>ref|XP_010925341.1| PREDICTED: protein GIGANTEA-like [Elaeis guineensis]
Length=1170

 Score =   187 bits (475),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 114/147 (78%), Gaps = 2/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARAVQ V +WGESGLAV DGLSNLLK R+ AT+RCLSH 
Sbjct  1024  DGMLVDGEACTLPQLELLEVTARAVQLVEDWGESGLAVTDGLSNLLKFRLSATIRCLSHS  1083

Query  556   SAHVRALSISVLRAILHSGSIKSRA-KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  380
             SAHVRALS SVLRAI+H    KS      +  G++ P+Y+ L+  G I+W +DIE+C+  
Sbjct  1084  SAHVRALSTSVLRAIMHGNPTKSTTFMHGDRQGLYDPSYRSLS-AGVINWYSDIEKCIKW  1142

Query  379   EAHSQLANGMSAEFLDTAAKELGCTIS  299
             EAHS+ A G++  FLD AAKELGC ++
Sbjct  1143  EAHSRRATGLTLAFLDAAAKELGCPLT  1169



>gb|EMS55238.1| hypothetical protein TRIUR3_30834 [Triticum urartu]
Length=1126

 Score =   186 bits (473),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 112/147 (76%), Gaps = 3/147 (2%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARA+  ++EWG+ G+AVADGLSNLLKCR+  T+RCLSH 
Sbjct  979   DGMLVDGEACTLPQLELLEVTARAIHLIVEWGDPGVAVADGLSNLLKCRLSPTIRCLSHA  1038

Query  556   SAHVRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLN  383
             SAHVRALS+SVLR IL+SG + S    +    NGI  P YQC     T++WQAD+ERC++
Sbjct  1039  SAHVRALSMSVLRDILNSGPLGSTKIIQGEQRNGIQSPNYQC-TAANTVNWQADVERCID  1097

Query  382   CEAHSQLANGMSAEFLDTAAKELGCTI  302
              EA S+ A GM+  FL  AA ELGC +
Sbjct  1098  WEARSRRATGMTLAFLTAAANELGCPL  1124



>gb|EMT06342.1| hypothetical protein F775_28583 [Aegilops tauschii]
Length=1146

 Score =   186 bits (473),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 112/147 (76%), Gaps = 3/147 (2%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARA+  ++EWG+ G+AVADGLSNLLKCR+  T+RCLSH 
Sbjct  999   DGMLVDGEACTLPQLELLEVTARAIHLIVEWGDPGVAVADGLSNLLKCRLSPTIRCLSHA  1058

Query  556   SAHVRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLN  383
             SAHVRALS+SVLR IL+SG + S    +    NGI  P YQC     T++WQAD+ERC++
Sbjct  1059  SAHVRALSMSVLRDILNSGPLGSTKIIQGEQRNGIQSPTYQC-AAANTVNWQADVERCID  1117

Query  382   CEAHSQLANGMSAEFLDTAAKELGCTI  302
              EA S+ A GM+  FL  AA ELGC +
Sbjct  1118  WEARSRRATGMTLAFLTAAANELGCPL  1144



>gb|AAT79486.1| gigantea 2 [Triticum aestivum]
Length=1153

 Score =   186 bits (472),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 112/147 (76%), Gaps = 3/147 (2%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARA+  ++EWG+ G+AVADGLSNLLKCR+  T+RCLSH 
Sbjct  1006  DGMLVDGEACTLPQLELLEVTARAIHLIVEWGDPGVAVADGLSNLLKCRLSPTIRCLSHA  1065

Query  556   SAHVRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLN  383
             SAHVRALS+SVLR IL+SG + S    +    NGI  P YQC     T++WQAD+ERC++
Sbjct  1066  SAHVRALSMSVLRDILNSGPLGSTKIIQGEQRNGIQSPTYQCA-AANTVNWQADVERCID  1124

Query  382   CEAHSQLANGMSAEFLDTAAKELGCTI  302
              EA S+ A GM+  FL  AA ELGC +
Sbjct  1125  WEARSRRATGMTLAFLTAAANELGCPL  1151



>gb|AAQ11738.1| gigantea [Triticum aestivum]
Length=1155

 Score =   186 bits (472),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 112/147 (76%), Gaps = 3/147 (2%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARA+  ++EWG+ G+AVADGLSNLLKCR+  T+RCLSH 
Sbjct  1008  DGMLVDGEACTLPQLELLEVTARAIHLIVEWGDPGVAVADGLSNLLKCRLSPTIRCLSHA  1067

Query  556   SAHVRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLN  383
             SAHVRALS+SVLR IL+SG + S    +    NGI  P YQC     T++WQAD+ERC++
Sbjct  1068  SAHVRALSMSVLRDILNSGPLGSTKIIQGEQRNGIQSPTYQC-AAANTVNWQADVERCID  1126

Query  382   CEAHSQLANGMSAEFLDTAAKELGCTI  302
              EA S+ A GM+  FL  AA ELGC +
Sbjct  1127  WEARSRRATGMTLAFLTAAANELGCPL  1153



>gb|AAW66945.1| gigantea-like protein [Hordeum vulgare]
 gb|AAW66946.1| gigantea-like protein [Hordeum vulgare subsp. vulgare]
Length=1155

 Score =   186 bits (471),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 114/148 (77%), Gaps = 5/148 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARA+  ++EWG+ G+AVADGLSNLLKCR+  T+RCLSH 
Sbjct  1008  DGMLVDGEACTLPQLELLEVTARAIHLIVEWGDPGVAVADGLSNLLKCRLSPTIRCLSHA  1067

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPV---NMNGIHGPAYQCLNVGGTIDWQADIERCL  386
             SAHVRALS+SVLR IL+SG + S +K +     NGI  P YQC     T++WQAD+ERC+
Sbjct  1068  SAHVRALSMSVLRDILNSGPLGS-SKTIQGEQRNGIQSPNYQCA-AANTVNWQADVERCI  1125

Query  385   NCEAHSQLANGMSAEFLDTAAKELGCTI  302
             + EA S+ A GM+  FL  AA ELGC +
Sbjct  1126  DWEARSRRATGMTLAFLTAAANELGCPL  1153



>gb|AAT79487.1| gigantea 3 [Triticum aestivum]
Length=1155

 Score =   186 bits (471),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 112/147 (76%), Gaps = 3/147 (2%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARA+  ++EWG+ G+AVADGLSNLLKCR+  T+RCLSH 
Sbjct  1008  DGMLVDGEACTLPQLELLEVTARAIHLIVEWGDPGVAVADGLSNLLKCRLSPTIRCLSHA  1067

Query  556   SAHVRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLN  383
             SAHVRALS+SVLR IL+SG + S    +    NGI  P YQC     T++WQAD+ERC++
Sbjct  1068  SAHVRALSMSVLRDILNSGPLGSTKIIQGEQRNGIQSPNYQCA-AANTVNWQADVERCID  1126

Query  382   CEAHSQLANGMSAEFLDTAAKELGCTI  302
              EA S+ A GM+  FL  AA ELGC +
Sbjct  1127  WEARSRRATGMTLAFLTAAANELGCPL  1153



>ref|XP_008786518.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
 ref|XP_008786528.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
 ref|XP_008786537.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
Length=1170

 Score =   179 bits (455),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 114/147 (78%), Gaps = 2/147 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEA TLPQLELLEVTARAVQ V++WG SGLAVADGLSNLLK R+ AT+RCLSH 
Sbjct  1024  DGMLVDGEASTLPQLELLEVTARAVQLVVDWGISGLAVADGLSNLLKFRLSATIRCLSHS  1083

Query  556   SAHVRALSISVLRAILHSGSIKSRA-KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  380
             SAHVRALS S+LR I+H  + KS +    +  G+  P+Y+ L+  G I+W +DIE+C+  
Sbjct  1084  SAHVRALSSSILRVIMHGNTTKSTSFMHGDGQGLCDPSYRSLS-AGIINWHSDIEKCIKW  1142

Query  379   EAHSQLANGMSAEFLDTAAKELGCTIS  299
             EAHS+ A GM+  FLD AAKELGC ++
Sbjct  1143  EAHSRRATGMTLAFLDAAAKELGCPLT  1169



>gb|ADR51711.1| GI [Secale cereale]
Length=1142

 Score =   179 bits (455),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 109/144 (76%), Gaps = 3/144 (2%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARA+  ++EWG+ G+AVADGLSNLLKCR+  T+RCLSH 
Sbjct  1000  DGMLVDGEACTLPQLELLEVTARAIHLIVEWGDPGVAVADGLSNLLKCRLSPTIRCLSHA  1059

Query  556   SAHVRALSISVLRAILHSGSIKSRA--KPVNMNGIHGPAYQCLNVGGTIDWQADIERCLN  383
             SAHVRALS+SVLR IL+SG + S    +    NGI  P YQC      ++WQAD+ERC++
Sbjct  1060  SAHVRALSMSVLRDILNSGPLGSTKIIQGEQRNGIQSPNYQC-AAANMVNWQADVERCID  1118

Query  382   CEAHSQLANGMSAEFLDTAAKELG  311
              EA S+ A GM+  FL  AA ELG
Sbjct  1119  WEARSRRATGMTLAFLTAAANELG  1142



>dbj|BAD97869.1| GI homologue [Lemna gibba]
Length=1116

 Score =   176 bits (446),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 112/153 (73%), Gaps = 8/153 (5%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARAVQ V+ WG+SGLA ADGLSNLLKC++PAT+RCLSHP
Sbjct  962   DGMLVDGEACTLPQLELLEVTARAVQLVIYWGDSGLAAADGLSNLLKCQLPATIRCLSHP  1021

Query  556   SAHVRALSISVLRAILHSGSIKSR----AKPVNMNGIHGPAYQ---CLNVGGTIDWQADI  398
             SAHVRALS +VLR IL+S  ++ +        +   +H    +   CLN    IDWQADI
Sbjct  1022  SAHVRALSTAVLRDILNSAPMRVKNSGGGGGGHGEEVHSSPQKYSRCLNQAA-IDWQADI  1080

Query  397   ERCLNCEAHSQLANGMSAEFLDTAAKELGCTIS  299
             ++ L  E HS+ A G++  FL  AAKELGCT S
Sbjct  1081  QKWLLWELHSRRATGLTLSFLHHAAKELGCTTS  1113



>dbj|BAD97864.1| GI homologue 1 [Lemna paucicostata]
Length=1115

 Score =   175 bits (443),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 109/151 (72%), Gaps = 5/151 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLE+LEVTARAVQ V+ WG+SGLA ADGLSNLLKCR+PAT+RCLSHP
Sbjct  962   DGMLVDGEACTLPQLEILEVTARAVQLVIYWGDSGLAAADGLSNLLKCRLPATIRCLSHP  1021

Query  556   SAHVRALSISVLRAILHSGSIKSR----AKPVNMNGIH-GPAYQCLNVGGTIDWQADIER  392
             SAHVRALS +VLR IL+   ++ +    +       +H  P        G IDWQADI++
Sbjct  1022  SAHVRALSTAVLRDILNGAPMRVKNSGSSSSGAAEEVHSSPQKYRAAQHGAIDWQADIQK  1081

Query  391   CLNCEAHSQLANGMSAEFLDTAAKELGCTIS  299
              L  E HS+ A G++  FL  AAKELGCT S
Sbjct  1082  WLLWELHSRRATGLTLSFLQHAAKELGCTTS  1112



>ref|XP_009408933.1| PREDICTED: protein GIGANTEA-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009408934.1| PREDICTED: protein GIGANTEA-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=1205

 Score =   174 bits (442),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 108/145 (74%), Gaps = 7/145 (5%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DG+LVDGE CTLPQLELLEVTA+AVQ V+ WGE+GLAVADGL+NLLKCR+ +TVRCLSHP
Sbjct  1066  DGLLVDGEVCTLPQLELLEVTAKAVQLVIHWGETGLAVADGLANLLKCRLSSTVRCLSHP  1125

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR ILHS      +  +N++G         N   +  WQAD+E+C+  E
Sbjct  1126  SAHVRALSTSVLRDILHSSPTTISSGCLNVDGQR-------NCNSSYHWQADMEKCIQWE  1178

Query  376   AHSQLANGMSAEFLDTAAKELGCTI  302
             A S+LA G++  +L  AAKELGC I
Sbjct  1179  AQSRLATGLTLAYLCAAAKELGCPI  1203



>ref|XP_009408935.1| PREDICTED: protein GIGANTEA-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=1163

 Score =   174 bits (441),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 108/145 (74%), Gaps = 7/145 (5%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DG+LVDGE CTLPQLELLEVTA+AVQ V+ WGE+GLAVADGL+NLLKCR+ +TVRCLSHP
Sbjct  1024  DGLLVDGEVCTLPQLELLEVTAKAVQLVIHWGETGLAVADGLANLLKCRLSSTVRCLSHP  1083

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLR ILHS      +  +N++G         N   +  WQAD+E+C+  E
Sbjct  1084  SAHVRALSTSVLRDILHSSPTTISSGCLNVDGQR-------NCNSSYHWQADMEKCIQWE  1136

Query  376   AHSQLANGMSAEFLDTAAKELGCTI  302
             A S+LA G++  +L  AAKELGC I
Sbjct  1137  AQSRLATGLTLAYLCAAAKELGCPI  1161



>gb|ADP92454.1| GIGANTEA 1 [x Doritaenopsis hybrid cultivar]
Length=1160

 Score =   173 bits (439),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 110/147 (75%), Gaps = 6/147 (4%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTARAV  V  WGE G AVADGL+NLLKCR+ ATVRCLSHP
Sbjct  1016  DGMLVDGEACTLPQLELLEVTARAVHLVANWGEIGFAVADGLTNLLKCRLSATVRCLSHP  1075

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIH--GPAYQCLNVGGTIDWQADIERCLN  383
             SA VRALSISVLR I+++G I S +   N   +H   P+Y+ L   G  +W A+IE+C+ 
Sbjct  1076  SALVRALSISVLRDIMNTGPINS-SNYTNTETLHLYDPSYRSL---GMTNWHANIEKCIK  1131

Query  382   CEAHSQLANGMSAEFLDTAAKELGCTI  302
              EA S+ A G++  FL +A+KELGC +
Sbjct  1132  WEARSRRATGLALSFLGSASKELGCPL  1158



>ref|XP_009381150.1| PREDICTED: protein GIGANTEA-like [Musa acuminata subsp. malaccensis]
Length=1171

 Score =   173 bits (439),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 109/145 (75%), Gaps = 10/145 (7%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLEVTA+AVQ VL WG  GLAV DGLSNLLKCR+ AT+RCLSHP
Sbjct  1024  DGMLVDGEACTLPQLELLEVTAKAVQLVLHWGGPGLAVVDGLSNLLKCRLSATIRCLSHP  1083

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SA VRALS SVLR ILH GS  +         +   +YQ LN+ G I+W++DI++C+  E
Sbjct  1084  SALVRALSKSVLRDILHHGSCLN---------VDNSSYQLLNM-GIINWRSDIDKCIQWE  1133

Query  376   AHSQLANGMSAEFLDTAAKELGCTI  302
             A S++A G++  +L  AAKELGC I
Sbjct  1134  AQSRIATGLTLAYLSAAAKELGCPI  1158



>gb|ACY30446.1| gigantea-like protein [Liriodendron tulipifera]
Length=1209

 Score =   168 bits (426),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 99/122 (81%), Gaps = 3/122 (2%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLK-CRIPATVRCLSH  560
             DGMLVDGEACTLPQLELLE TARAVQ VL+ GES  AVADGLSNLLK CR+PATVRCLSH
Sbjct  1030  DGMLVDGEACTLPQLELLEATARAVQVVLDLGESSSAVADGLSNLLKVCRLPATVRCLSH  1089

Query  559   PSAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNC  380
             PSAHVRALS+SVLR ILH  SI +  K  +   IHGP YQCL + GTI+W +DIE+CL  
Sbjct  1090  PSAHVRALSMSVLRDILHIDSI-NLTKEEDAEQIHGPPYQCLTI-GTINWHSDIEKCLTW  1147

Query  379   EA  374
             EA
Sbjct  1148  EA  1149



>ref|XP_011074106.1| PREDICTED: protein GIGANTEA-like isoform X2 [Sesamum indicum]
Length=1138

 Score =   165 bits (418),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 100/147 (68%), Gaps = 32/147 (22%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLE                               CR+PATVRC+SHP
Sbjct  1024  DGMLVDGEACTLPQLE-------------------------------CRLPATVRCVSHP  1052

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS SVLRAILH+GSIKS  K V +NG+H P YQ +NVG T DW+AD+E+CL  E
Sbjct  1053  SAHVRALSTSVLRAILHAGSIKSSYKQVEVNGVHIPRYQYVNVGIT-DWRADVEKCLTWE  1111

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
             AHS+LA G+  +F+DTAA ELGCTIS+
Sbjct  1112  AHSRLAMGLPIQFVDTAATELGCTISI  1138



>gb|AIR93790.1| gigantea [Kalanchoe fedtschenkoi]
Length=1149

 Score =   163 bits (413),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 110/148 (74%), Gaps = 2/148 (1%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACTLPQLELLE T +AVQP+LEWGESG  +ADGL  LLK R+PAT++CLSHP
Sbjct  1003  DGMLVDGEACTLPQLELLEATTKAVQPILEWGESGFPIADGLLKLLKRRLPATIQCLSHP  1062

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHG-PAYQCLNVGGTIDWQADIERCLNC  380
             SAHVRALSISV+R I+     +S A    ++ I G PA Q  +  G  DW+++IE CL  
Sbjct  1063  SAHVRALSISVVRDIMQIDVTESMAL-AEISSISGAPAEQSKSKLGIADWRSNIEMCLTW  1121

Query  379   EAHSQLANGMSAEFLDTAAKELGCTISV  296
             EAH+++++ M+ EFL  AAKELGC  S 
Sbjct  1122  EAHNRISSEMTLEFLSIAAKELGCRFST  1149



>gb|ACT22764.1| GIGANTEA [Allium cepa]
Length=1109

 Score =   160 bits (404),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 102/143 (71%), Gaps = 4/143 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DG+LVDGEACTLPQL+LLEVTARAV  V      GL +ADGLSNLLKCR+ ATVRCLSHP
Sbjct  968   DGLLVDGEACTLPQLQLLEVTARAVHLVANLEGPGLVIADGLSNLLKCRLSATVRCLSHP  1027

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS+SVLR I+H   +K         G+   +Y+   + GT++W ADI++C+  E
Sbjct  1028  SAHVRALSLSVLRDIMHISPLKFNTV---RTGVCNHSYRSSTL-GTVNWHADIDKCIKWE  1083

Query  376   AHSQLANGMSAEFLDTAAKELGC  308
             A S  ANG +  FLD AA ELGC
Sbjct  1084  AQSIEANGTTLAFLDAAANELGC  1106



>gb|ACT22765.1| GIGANTEA [Allium cepa]
Length=1109

 Score =   159 bits (403),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 102/143 (71%), Gaps = 4/143 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DG+LVDGEACTLPQL+LLEVTARAV  V      GL +ADGLSNLLKCR+ ATVRCLSHP
Sbjct  968   DGLLVDGEACTLPQLQLLEVTARAVHLVANLEGPGLVIADGLSNLLKCRLSATVRCLSHP  1027

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS+SVLR I+H   +K         G+   +Y+   + GT++W ADI++C+  E
Sbjct  1028  SAHVRALSLSVLRDIMHISPLKFNTV---RTGVCNHSYRSSTL-GTVNWHADIDKCIKWE  1083

Query  376   AHSQLANGMSAEFLDTAAKELGC  308
             A S  ANG +  FLD AA ELGC
Sbjct  1084  AQSIEANGTTLAFLDAAANELGC  1106



>ref|XP_004169554.1| PREDICTED: protein GIGANTEA-like [Cucumis sativus]
Length=127

 Score =   130 bits (328),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 79/102 (77%), Gaps = 2/102 (2%)
 Frame = -3

Query  601  LKCRIPATVRCLSHPSAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGG  422
            L+CR+ ATVRCLSHPSAHVRALS SVLR ILH+  IKS +K VN+NGI+ P+YQ  +  G
Sbjct  28   LQCRLSATVRCLSHPSAHVRALSTSVLRDILHTSLIKSNSKSVNVNGIY-PSYQYFS-SG  85

Query  421  TIDWQADIERCLNCEAHSQLANGMSAEFLDTAAKELGCTISV  296
             IDW+ADIE+CL  E  SQLA G S +FL  AAKEL C+IS+
Sbjct  86   IIDWKADIEKCLGWEVRSQLATGQSTQFLQAAAKELSCSISL  127



>dbj|BAP76055.1| putative GI [Cryptomeria japonica]
Length=1197

 Score =   137 bits (344),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 90/145 (62%), Gaps = 0/145 (0%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGM VDGEACT PQLELLE TA A Q  L WG  G A A GL NLLK R+PATV+CLSH 
Sbjct  1039  DGMPVDGEACTTPQLELLEATAGAAQFSLGWGSRGKATAQGLWNLLKYRLPATVQCLSHS  1098

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             SAHVRALS S+LR ILH        K ++    H     C+       W+ D+E+CL  E
Sbjct  1099  SAHVRALSTSLLRVILHESLNFGHGKYLSEKSHHSENVCCVEDLVIKYWRRDVEQCLAWE  1158

Query  376   AHSQLANGMSAEFLDTAAKELGCTI  302
              H++ A GMS   L +AA  LGC++
Sbjct  1159  VHNRQARGMSVALLVSAANALGCSV  1183



>gb|AGH20049.1| GI [Picea abies]
Length=1179

 Score =   128 bits (322),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 87/134 (65%), Gaps = 7/134 (5%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACT PQLELLE  A   Q  L WG  G A+A+GL NLLK R+PATV+CLSH 
Sbjct  1032  DGMLVDGEACTTPQLELLEAMAVTAQLSLGWGVPGKAMAEGLWNLLKYRLPATVQCLSHS  1091

Query  556   SAHVRALSISVLRAILHSGSIKSRA-KPVNMNGIHGPAYQCLNVGGTI---DWQADIERC  389
             SAHVRALS SVLR ILH+ S+  R  K  +    H    + L  G  I   DW   +E+C
Sbjct  1092  SAHVRALSTSVLRDILHAESLNFRYCKNFSEKNHHS---EHLYYGKDIVVQDWNKAVEQC  1148

Query  388   LNCEAHSQLANGMS  347
             L  EAH++ A GMS
Sbjct  1149  LAWEAHNRQARGMS  1162



>gb|ABR18021.1| unknown [Picea sitchensis]
Length=1179

 Score =   128 bits (321),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 87/134 (65%), Gaps = 7/134 (5%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGMLVDGEACT PQLELLE  A   Q  L WG  G A+A+GL NLLK R+PATV+CLSH 
Sbjct  1032  DGMLVDGEACTTPQLELLEAMAVTAQLSLGWGIPGKAMAEGLWNLLKYRLPATVQCLSHS  1091

Query  556   SAHVRALSISVLRAILHSGSIKSRA-KPVNMNGIHGPAYQCLNVGGTI---DWQADIERC  389
             SAHVRALS SVLR ILH+ S+  R  K  +    H    + L  G  I   DW   +E+C
Sbjct  1092  SAHVRALSTSVLRDILHAESLNFRYCKNFSEKNHHS---EHLYYGKDIVVQDWNKAVEQC  1148

Query  388   LNCEAHSQLANGMS  347
             L  EAH++ A GMS
Sbjct  1149  LAWEAHNRQARGMS  1162



>gb|AAP80607.1|AF469490_1 gigantea-like protein, partial [Triticum aestivum]
Length=190

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACTLPQLELLEVTARA+  ++EWG+ G+AVADGLSNLLKCR+  T+RCLS  
Sbjct  118  DGMLVDGEACTLPQLELLEVTARAIHLIVEWGDPGVAVADGLSNLLKCRLSPTIRCLSXA  177

Query  556  SAHVRALSISVL  521
            SAHVRALS+SVL
Sbjct  178  SAHVRALSMSVL  189



>gb|AFV79301.1| gigantea, partial [Pinus sylvestris]
Length=166

 Score =   115 bits (287),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACT PQLELLE  A A Q  L WG  G A+ADGL NLLK R+PATV+CLSH 
Sbjct  54   DGMLVDGEACTTPQLELLEAMAVAAQLSLGWGVPGKAMADGLWNLLKYRLPATVQCLSHS  113

Query  556  SAHVRALSISVLRAILHSGSIKSR  485
            SAHVRALSISVLR ILH+  +  R
Sbjct  114  SAHVRALSISVLRDILHAEYLNFR  137



>gb|AFV79206.1| gigantea, partial [Pinus sylvestris]
Length=166

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACT PQLELLE  A A Q  L WG  G A+ADGL NLLK R+PATV+CLSH 
Sbjct  54   DGMLVDGEACTTPQLELLEAMAVAAQLSLGWGVPGKAMADGLWNLLKYRLPATVQCLSHS  113

Query  556  SAHVRALSISVLRAILHSGSIKSR  485
            SAHVRALS SVLR ILH+  +  R
Sbjct  114  SAHVRALSTSVLRDILHTEYLNFR  137



>gb|AFV79552.1| gigantea, partial [Pinus pinaster]
Length=166

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACT PQLELLE  A A Q  L WG  G A+ DGL NLLK R+PATV+CLSH 
Sbjct  54   DGMLVDGEACTTPQLELLEAMAVAAQLSLGWGVPGKAMTDGLWNLLKYRLPATVQCLSHS  113

Query  556  SAHVRALSISVLRAILHSGSIKSR  485
            SAHVRALS SVLR ILH+ S+  R
Sbjct  114  SAHVRALSTSVLRDILHAESLNFR  137



>gb|AFV79241.1| gigantea, partial [Pinus sylvestris]
Length=166

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACT PQLELLE  A A Q  L WG  G A+ADGL NLLK R+PATV+CLSH 
Sbjct  54   DGMLVDGEACTTPQLELLEAMAVAAQLSLGWGVPGKAMADGLWNLLKYRLPATVQCLSHS  113

Query  556  SAHVRALSISVLRAILHSGSIKSR  485
            SAHVRALS SVLR ILH+  +  R
Sbjct  114  SAHVRALSTSVLRDILHAEYLNFR  137



>gb|AFV79204.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79205.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79208.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79209.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79210.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79211.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79212.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79213.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79214.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79215.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79216.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79217.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79218.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79219.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79220.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79221.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79223.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79224.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79225.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79226.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79227.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79228.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79229.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79230.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79231.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79232.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79233.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79234.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79235.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79236.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79237.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79238.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79239.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79240.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79242.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79244.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79245.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79246.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79248.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79249.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79250.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79251.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79253.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79254.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79255.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79256.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79257.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79258.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79259.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79260.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79261.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79262.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79263.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79264.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79265.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79266.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79267.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79268.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79269.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79270.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79271.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79272.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79273.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79274.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79275.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79276.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79277.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79278.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79279.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79280.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79281.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79282.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79283.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79284.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79285.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79286.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79287.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79288.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79289.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79290.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79292.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79293.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79295.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79296.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79297.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79298.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79300.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79302.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79303.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79304.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79305.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79306.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79308.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79310.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79312.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79313.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79314.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79316.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79317.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79318.1| gigantea, partial [Pinus sylvestris]
Length=166

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACT PQLELLE  A A Q  L WG  G A+ADGL NLLK R+PATV+CLSH 
Sbjct  54   DGMLVDGEACTTPQLELLEAMAVAAQLSLGWGVPGKAMADGLWNLLKYRLPATVQCLSHS  113

Query  556  SAHVRALSISVLRAILHSGSIKSR  485
            SAHVRALS SVLR ILH+  +  R
Sbjct  114  SAHVRALSTSVLRDILHAEYLNFR  137



>gb|AFV79222.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79247.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79252.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79291.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79307.1| gigantea, partial [Pinus sylvestris]
Length=166

 Score =   113 bits (282),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACT PQLELLE  A A Q  L WG  G A+ADGL NLLK R+PATV+CLSH 
Sbjct  54   DGMLVDGEACTTPQLELLEAMAVAAQLSLGWGVPGKAMADGLWNLLKYRLPATVQCLSHS  113

Query  556  SAHVRALSISVLRAILHSGSIKSR  485
            SAHVRALS SVLR ILH+  +  R
Sbjct  114  SAHVRALSTSVLRDILHAEYLNFR  137



>gb|AFV79207.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79243.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79309.1| gigantea, partial [Pinus sylvestris]
Length=166

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACT PQLELLE  A A Q  L WG  G  +ADGL NLLK R+PATV+CLSH 
Sbjct  54   DGMLVDGEACTTPQLELLEAMAVAAQLSLGWGVPGKVMADGLWNLLKYRLPATVQCLSHS  113

Query  556  SAHVRALSISVLRAILHSGSIKSR  485
            SAHVRALS SVLR ILH+  +  R
Sbjct  114  SAHVRALSTSVLRDILHAEYLNFR  137



>gb|AFV79294.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79299.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79311.1| gigantea, partial [Pinus sylvestris]
 gb|AFV79315.1| gigantea, partial [Pinus sylvestris]
Length=166

 Score =   110 bits (274),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACT PQLELLE  A A Q  L WG  G  +ADGL NLLK R+PATV+CLSH 
Sbjct  54   DGMLVDGEACTTPQLELLEAMAVAAQLSLGWGVPGKVMADGLWNLLKYRLPATVQCLSHS  113

Query  556  SAHVRALSISVLRAILHS  503
            SAHVRALS SVLR ILH+
Sbjct  114  SAHVRALSTSVLRDILHA  131



>dbj|BAO74118.1| GIGANTEA, partial [Lotus japonicus]
Length=976

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACTLPQLELLE TARAV PVL++G SGLA+ADGLSNLLKCR+PATVRCL HP
Sbjct  915  DGMLVDGEACTLPQLELLEATARAVHPVLQFGGSGLALADGLSNLLKCRLPATVRCLCHP  974

Query  556  SA  551
            SA
Sbjct  975  SA  976



>dbj|BAO74110.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74111.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74112.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74113.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74114.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74115.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74116.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74117.1| GIGANTEA, partial [Lotus japonicus]
Length=976

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
            DGMLVDGEACTLPQLELLE TARAV PVL++G SGLA+ADGLSNLLKCR+PATVRCL HP
Sbjct  915  DGMLVDGEACTLPQLELLEATARAVHPVLQFGGSGLALADGLSNLLKCRLPATVRCLCHP  974

Query  556  SA  551
            SA
Sbjct  975  SA  976



>gb|ACF74296.1| gigantea [Arachis hypogaea]
Length=115

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCR  590
            DGMLVDGEACTLPQLELLEVTARAVQPVLE GESGLAVADGLSNLLKCR
Sbjct  62   DGMLVDGEACTLPQLELLEVTARAVQPVLELGESGLAVADGLSNLLKCR  110



>emb|CAJ38397.1| photoperiodic response / GIGANTEA [Plantago major]
Length=77

 Score = 94.4 bits (233),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 51/60 (85%), Gaps = 1/60 (2%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVR-CLSH  560
            DGMLVDGEACT+PQLELLE TARAVQPV  WG+SG  VADGL NLLKCR+PATV+ C S 
Sbjct  18   DGMLVDGEACTVPQLELLEATARAVQPVRGWGDSGNMVADGLFNLLKCRLPATVQLCFSS  77



>ref|XP_002969462.1| hypothetical protein SELMODRAFT_170553 [Selaginella moellendorffii]
 gb|EFJ29550.1| hypothetical protein SELMODRAFT_170553 [Selaginella moellendorffii]
Length=1056

 Score = 96.3 bits (238),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 80/145 (55%), Gaps = 20/145 (14%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGM VDGE CTLPQLELLE  A A++ +  W  S    + GL  LLK R+PA VRCLSH 
Sbjct  929   DGMSVDGEPCTLPQLELLEAIAMAIKSLCAWKVS----SRGLLILLKERLPAVVRCLSHD  984

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             S  +RA S S+LR I+ +  +++             +Y     G    W  D+E+ +  E
Sbjct  985   SPRIRASSASLLREIVSTDVLRA-------------SYPGDKAGA---WLEDVEQSIAWE  1028

Query  376   AHSQLANGMSAEFLDTAAKELGCTI  302
              H + A G+S  FL +AA  LGC +
Sbjct  1029  THYRRAEGLSESFLASAAIALGCKL  1053



>emb|CAK26429.1| putative gigantea [Picea abies]
Length=115

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 65/101 (64%), Gaps = 7/101 (7%)
 Frame = -3

Query  637  SGLAVADGLSNLLKCRIPATVRCLSHPSAHVRALSISVLRAILHSGSIKSRA-KPVNMNG  461
            SG A+A+GL NLLK R+PATV+CLSH SAHVRALS SVLR ILH+ S+  R  K  +   
Sbjct  1    SGXAMAEGLWNLLKYRLPATVQCLSHSSAHVRALSTSVLRDILHAESLNFRYCKNFSEKN  60

Query  460  IHGPAYQCLNVGGTI---DWQADIERCLNCEAHSQLANGMS  347
             H    + L  G  I   DW   +E+CL  EAH++ A GMS
Sbjct  61   HHS---EHLYYGKDIVVQDWNKAVEQCLAWEAHNRQARGMS  98



>ref|XP_002961231.1| hypothetical protein SELMODRAFT_140066 [Selaginella moellendorffii]
 gb|EFJ38770.1| hypothetical protein SELMODRAFT_140066 [Selaginella moellendorffii]
Length=1063

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 80/145 (55%), Gaps = 20/145 (14%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGM VDGE CTLPQLELLE  A A++ +  W  S    + GL  LLK R+PA VRCLSH 
Sbjct  936   DGMSVDGEPCTLPQLELLEAIAMAIKSLCAWKVS----SRGLLILLKERLPAIVRCLSHD  991

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             S  +RA S S+LR I+ +  +++             +Y     G    W  D+E+ +  E
Sbjct  992   SPRIRASSASLLREIVSTDVLRA-------------SYPGDKAGA---WLEDVEQSIAWE  1035

Query  376   AHSQLANGMSAEFLDTAAKELGCTI  302
              H + A G+S  FL +AA  LGC +
Sbjct  1036  THYRRAEGLSESFLASAAIALGCKL  1060



>emb|CAK26465.1| putative gigantea [Picea abies]
 emb|CAK26467.1| putative gigantea, partial [Picea abies]
Length=115

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 65/101 (64%), Gaps = 7/101 (7%)
 Frame = -3

Query  637  SGLAVADGLSNLLKCRIPATVRCLSHPSAHVRALSISVLRAILHSGSIKSRA-KPVNMNG  461
            SG A+A+GL NLLK R+PATV+CLSH SAHVRALS SVLR ILH+ S+  R  K  +   
Sbjct  1    SGXAMAEGLWNLLKYRLPATVQCLSHSSAHVRALSTSVLRDILHAESLNFRYCKNFSEKN  60

Query  460  IHGPAYQCLNVGGTI---DWQADIERCLNCEAHSQLANGMS  347
             H    + L  G  I   DW   +E+CL  EAH++ A GMS
Sbjct  61   HHS---EHLYYGKDIVVQDWTKAVEQCLAWEAHNRQARGMS  98



>emb|CAK26422.1| putative gigantea [Picea abies]
 emb|CAK26424.1| putative gigantea [Picea abies]
 emb|CAK26427.1| putative gigantea, partial [Picea abies]
 emb|CAK26430.1| putative gigantea, partial [Picea abies]
 emb|CAK26431.1| putative gigantea, partial [Picea abies]
 emb|CAK26432.1| putative gigantea, partial [Picea abies]
 emb|CAK26434.1| putative gigantea, partial [Picea abies]
 emb|CAK26435.1| putative gigantea, partial [Picea abies]
 emb|CAK26436.1| putative gigantea, partial [Picea abies]
 emb|CAK26437.1| putative gigantea, partial [Picea abies]
 emb|CAK26438.1| putative gigantea, partial [Picea abies]
 emb|CAK26439.1| putative gigantea, partial [Picea abies]
 emb|CAK26440.1| putative gigantea, partial [Picea abies]
 emb|CAK26441.1| putative gigantea [Picea abies]
 emb|CAK26442.1| putative gigantea, partial [Picea abies]
 emb|CAK26443.1| putative gigantea, partial [Picea abies]
 emb|CAK26447.1| putative gigantea [Picea abies]
 emb|CAK26448.1| putative gigantea, partial [Picea abies]
 emb|CAK26452.1| putative gigantea, partial [Picea abies]
 emb|CAK26458.1| putative gigantea, partial [Picea abies]
 emb|CAK26459.1| putative gigantea, partial [Picea abies]
 emb|CAK26460.1| putative gigantea, partial [Picea abies]
 emb|CAK26461.1| putative gigantea [Picea abies]
 emb|CAK26463.1| putative gigantea, partial [Picea abies]
 emb|CAK26466.1| putative gigantea, partial [Picea abies]
 emb|CAK26468.1| putative gigantea, partial [Picea abies]
 emb|CAK26469.1| putative gigantea, partial [Picea abies]
Length=115

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 65/101 (64%), Gaps = 7/101 (7%)
 Frame = -3

Query  637  SGLAVADGLSNLLKCRIPATVRCLSHPSAHVRALSISVLRAILHSGSIKSRA-KPVNMNG  461
            SG A+A+GL NLLK R+PATV+CLSH SAHVRALS SVLR ILH+ S+  R  K  +   
Sbjct  1    SGKAMAEGLWNLLKYRLPATVQCLSHSSAHVRALSTSVLRDILHAESLNFRYCKNFSEKN  60

Query  460  IHGPAYQCLNVGGTI---DWQADIERCLNCEAHSQLANGMS  347
             H    + L  G  I   DW   +E+CL  EAH++ A GMS
Sbjct  61   HHS---EHLYYGKDIVVQDWNKAVEQCLAWEAHNRQARGMS  98



>emb|CAK26423.1| putative gigantea [Picea abies]
 emb|CAK26426.1| putative gigantea, partial [Picea abies]
 emb|CAK26449.1| putative gigantea [Picea abies]
 emb|CAK26450.1| putative gigantea [Picea abies]
 emb|CAK26453.1| putative gigantea, partial [Picea abies]
 emb|CAK26454.1| putative gigantea, partial [Picea abies]
 emb|CAK26455.1| putative gigantea, partial [Picea abies]
 emb|CAK26462.1| putative gigantea, partial [Picea abies]
Length=115

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 65/101 (64%), Gaps = 7/101 (7%)
 Frame = -3

Query  637  SGLAVADGLSNLLKCRIPATVRCLSHPSAHVRALSISVLRAILHSGSIKSRA-KPVNMNG  461
            SG A+A+GL NLLK R+PATV+CLSH SAHVRALS SVLR ILH+ S+  R  K  +   
Sbjct  1    SGKAMAEGLWNLLKYRLPATVQCLSHSSAHVRALSTSVLRDILHAESLNFRYCKNFSEKN  60

Query  460  IHGPAYQCLNVGGTI---DWQADIERCLNCEAHSQLANGMS  347
             H    + L  G  I   DW   +E+CL  EAH++ A GMS
Sbjct  61   HHS---EHLYYGKDIVVQDWTKAVEQCLAWEAHNRQARGMS  98



>ref|XP_004163795.1| PREDICTED: protein GIGANTEA-like [Cucumis sativus]
Length=1016

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -3

Query  736  DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLK  596
            DGMLVDGEACTLPQLELLEVTARAV+PVLEWGESGL++ADGLSNLLK
Sbjct  903  DGMLVDGEACTLPQLELLEVTARAVKPVLEWGESGLSIADGLSNLLK  949



>gb|ADM74041.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74043.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74044.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74045.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74046.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74049.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74050.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74051.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74052.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74053.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74054.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74055.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74056.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74057.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74058.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74059.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74060.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74061.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74062.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74063.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74064.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74065.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74066.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74067.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74068.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74069.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74070.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74071.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74072.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74073.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74074.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74077.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74078.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74079.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74080.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74081.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74082.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74083.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74084.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74085.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74086.1| gigantea-like protein, partial [Picea sitchensis]
Length=117

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 65/103 (63%), Gaps = 7/103 (7%)
 Frame = -3

Query  643  GESGLAVADGLSNLLKCRIPATVRCLSHPSAHVRALSISVLRAILHSGSIKSRA-KPVNM  467
            G  G A+A+GL NLLK R+PATV+CLSH SAHVRALS SVLR ILH+ S+  R  K  + 
Sbjct  1    GVPGKAMAEGLWNLLKYRLPATVQCLSHSSAHVRALSTSVLRDILHAESLNFRYCKNFSE  60

Query  466  NGIHGPAYQCLNVGGTI---DWQADIERCLNCEAHSQLANGMS  347
               H    + L  G  I   DW   +E+CL  EAH++ A GMS
Sbjct  61   KNHHS---EHLYYGKDIVVQDWNKAVEQCLAWEAHNRQARGMS  100



>emb|CAK26456.1| putative gigantea [Picea abies]
Length=115

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 64/101 (63%), Gaps = 7/101 (7%)
 Frame = -3

Query  637  SGLAVADGLSNLLKCRIPATVRCLSHPSAHVRALSISVLRAILHSGSIKSRA-KPVNMNG  461
            SG A+A+GL NLLK R+PATV+CLSH SAHVRALS SVLR ILH+ S+  R  K  +   
Sbjct  1    SGKAMAEGLWNLLKYRLPATVQCLSHSSAHVRALSTSVLRDILHAESLNFRYCKNFSEKN  60

Query  460  IHGPAYQCLNVGGTI---DWQADIERCLNCEAHSQLANGMS  347
             H    + L  G  I   DW   +E+CL  EAH++   GMS
Sbjct  61   HHS---EHLYYGKDIVVQDWNKAVEQCLAWEAHNRQTRGMS  98



>gb|KJB28964.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1080

 Score = 94.0 bits (232),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/47 (96%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLK  596
             DGMLVDGEACTLPQLELLE TARAVQPVLEWGESGLAV DGLSNLLK
Sbjct  1019  DGMLVDGEACTLPQLELLEATARAVQPVLEWGESGLAVVDGLSNLLK  1065



>dbj|BAO66507.1| GIGANTEA [Marchantia polymorpha]
Length=1187

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 89/147 (61%), Gaps = 5/147 (3%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLKCRIPATVRCLSHP  557
             DGM +DGEAC LPQLELLE  A A Q  L+W E    VAD L +LL+ R+PATVRCLSH 
Sbjct  1046  DGMTLDGEACKLPQLELLEAAALAAQAALKWEEPNEEVADQLFSLLRERLPATVRCLSHN  1105

Query  556   SAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTIDWQADIERCLNCE  377
             S HVRA+S++ LR +L+  S++S +   +  G            GT +W+  +E+C+  E
Sbjct  1106  STHVRAMSVARLRDMLYMESLRSSSSRKSSEGSERE-----EANGTGNWRRYVEQCVVWE  1160

Query  376   AHSQLANGMSAEFLDTAAKELGCTISV  296
              H + A GMS   L  AA  LGC I V
Sbjct  1161  VHCRRAGGMSISLLANAASALGCPIPV  1187



>gb|ADM74042.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74047.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74048.1| gigantea-like protein, partial [Picea sitchensis]
Length=117

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 65/103 (63%), Gaps = 7/103 (7%)
 Frame = -3

Query  643  GESGLAVADGLSNLLKCRIPATVRCLSHPSAHVRALSISVLRAILHSGSIKSRA-KPVNM  467
            G  G ++A+GL NLLK R+PATV+CLSH SAHVRALS SVLR ILH+ S+  R  K  + 
Sbjct  1    GVPGKSMAEGLWNLLKYRLPATVQCLSHSSAHVRALSTSVLRDILHAESLNFRYCKNFSE  60

Query  466  NGIHGPAYQCLNVGGTI---DWQADIERCLNCEAHSQLANGMS  347
               H    + L  G  I   DW   +E+CL  EAH++ A GMS
Sbjct  61   KNHHS---EHLYYGKDIVVQDWNKAVEQCLAWEAHNRQARGMS  100



>emb|CAK26451.1| putative gigantea [Picea abies]
Length=115

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 64/101 (63%), Gaps = 7/101 (7%)
 Frame = -3

Query  637  SGLAVADGLSNLLKCRIPATVRCLSHPSAHVRALSISVLRAILHSGSIKSRA-KPVNMNG  461
            SG A+A+GL NLLK R+PATV+CLSH SAHVRALS SVL  ILH+ S+  R  K  +   
Sbjct  1    SGKAMAEGLWNLLKYRLPATVQCLSHSSAHVRALSTSVLXDILHAESLNFRYCKNFSEKN  60

Query  460  IHGPAYQCLNVGGTI---DWQADIERCLNCEAHSQLANGMS  347
             H    + L  G  I   DW   +E+CL  EAH++ A GMS
Sbjct  61   HHS---EHLYYGKDIVVQDWNKAVEQCLAWEAHNRQARGMS  98



>emb|CAK26444.1| putative gigantea [Picea abies]
Length=115

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 62/101 (61%), Gaps = 7/101 (7%)
 Frame = -3

Query  637  SGLAVADGLSNLLKCRIPATVRCLSHPSAHVRALSISVLRAILHSGSIKSRA-KPVNMNG  461
            SG A+A GL NLLK R+P TV+CLSH SAHVRALS SVLR ILH+ S+  R  K  +   
Sbjct  1    SGKAMAXGLWNLLKYRLPXTVQCLSHSSAHVRALSTSVLRDILHAESLNFRYCKNFSEKN  60

Query  460  IHGPAYQCLNVGGTI---DWQADIERCLNCEAHSQLANGMS  347
             H      L  G  I   DW   +E+CL  EAH++ A GMS
Sbjct  61   HHSXH---LYYGKDIVVQDWNKAVEQCLAWEAHNRQARGMS  98



>gb|ADM74075.1| gigantea-like protein, partial [Picea sitchensis]
 gb|ADM74076.1| gigantea-like protein, partial [Picea sitchensis]
Length=117

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 64/103 (62%), Gaps = 7/103 (7%)
 Frame = -3

Query  643  GESGLAVADGLSNLLKCRIPATVRCLSHPSAHVRALSISVLRAILHSGSIKSRA-KPVNM  467
            G  G A+A+GL NLLK R+PATV+CLSH SAHVRALS SVLR ILH+  +  R  K  + 
Sbjct  1    GVPGKAMAEGLWNLLKYRLPATVQCLSHSSAHVRALSTSVLRDILHAECLNFRYCKNFSE  60

Query  466  NGIHGPAYQCLNVGGTI---DWQADIERCLNCEAHSQLANGMS  347
               H    + L  G  I   DW   +E+CL  EAH++ A GMS
Sbjct  61   KNHHS---EHLYYGKDIVVQDWNKAVEQCLAWEAHNRQARGMS  100



>emb|CAK26425.1| putative gigantea [Picea abies]
 emb|CAK26428.1| putative gigantea [Picea abies]
 emb|CAK26433.1| putative gigantea [Picea abies]
 emb|CAK26445.1| putative gigantea, partial [Picea abies]
 emb|CAK26446.1| putative gigantea [Picea abies]
 emb|CAK26457.1| putative gigantea [Picea abies]
 emb|CAK26464.1| putative gigantea [Picea abies]
Length=110

 Score = 84.3 bits (207),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 61/96 (64%), Gaps = 7/96 (7%)
 Frame = -3

Query  622  ADGLSNLLKCRIPATVRCLSHPSAHVRALSISVLRAILHSGSIKSRA-KPVNMNGIHGPA  446
            A+GL NLLK R+PATV+CLSH SAHVRALS SVLR ILH+ S+  R  K  +    H   
Sbjct  1    AEGLWNLLKYRLPATVQCLSHSSAHVRALSTSVLRDILHAESLNFRYCKNFSEKNHHS--  58

Query  445  YQCLNVGGTI---DWQADIERCLNCEAHSQLANGMS  347
             + L  G  I   DW   +E+CL  EAH++ A GMS
Sbjct  59   -EHLYYGKDIVVQDWNKAVEQCLAWEAHNRQARGMS  93



>gb|AFW80282.1| gigantea1A [Zea mays]
Length=1085

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVTARAVQPVLEWGESGLAVADGLSNLLK  596
             DGMLVDGEACTLPQLELLEVTARAV  ++EWG+SGL+VADGLSNLLK
Sbjct  1014  DGMLVDGEACTLPQLELLEVTARAVHLIIEWGDSGLSVADGLSNLLK  1060



>gb|ADE32590.1| putative gigantea [Picea purpurea]
Length=101

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 53/86 (62%), Gaps = 7/86 (8%)
 Frame = -3

Query  592  RIPATVRCLSHPSAHVRALSISVLRAILHSGSIKSRA-KPVNMNGIHGPAYQCLNVGGTI  416
            R+PATV+CLSH SAHVRALS SVLR ILH+ S+  R  K  +    H    + L  G  I
Sbjct  2    RLPATVQCLSHSSAHVRALSTSVLRDILHAESLNFRYCKNFSEKNRHS---EHLYYGKDI  58

Query  415  ---DWQADIERCLNCEAHSQLANGMS  347
               DW   +E+CL  EAH++ A GMS
Sbjct  59   VVQDWNKAVEQCLAWEAHNRQARGMS  84



>gb|AIE55309.1| gigantea, partial [Picea smithiana]
 gb|AIE55310.1| gigantea, partial [Picea smithiana]
Length=101

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 53/86 (62%), Gaps = 7/86 (8%)
 Frame = -3

Query  592  RIPATVRCLSHPSAHVRALSISVLRAILHSGSIKSRA-KPVNMNGIHGPAYQCLNVGGTI  416
            R+PATV+CLSH SAHVRALS SVLR ILH+ S+  R  K  +    H    + L  G  I
Sbjct  2    RLPATVQCLSHSSAHVRALSTSVLRHILHAESLNFRYCKNFSEKNHHS---EHLYYGKDI  58

Query  415  ---DWQADIERCLNCEAHSQLANGMS  347
               DW   +E+CL  EAH++ A GMS
Sbjct  59   VVQDWNKAVEQCLAWEAHNRQARGMS  84



>gb|ADE32537.1| putative gigantea [Picea likiangensis]
 gb|ADE32538.1| putative gigantea [Picea likiangensis]
 gb|ADE32539.1| putative gigantea [Picea likiangensis]
 gb|ADE32540.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32541.1| putative gigantea [Picea likiangensis]
 gb|ADE32542.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32543.1| putative gigantea [Picea likiangensis]
 gb|ADE32544.1| putative gigantea [Picea likiangensis]
 gb|ADE32545.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32546.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32547.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32548.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32549.1| putative gigantea [Picea likiangensis]
 gb|ADE32550.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32552.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32553.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32554.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32555.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32556.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32557.1| putative gigantea [Picea likiangensis]
 gb|ADE32558.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32559.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32560.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32561.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32562.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32563.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32564.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32565.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32567.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32568.1| putative gigantea [Picea likiangensis]
 gb|ADE32569.1| putative gigantea [Picea likiangensis]
 gb|ADE32570.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32571.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32572.1| putative gigantea [Picea likiangensis]
 gb|ADE32573.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32574.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32575.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32576.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32577.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32578.1| putative gigantea, partial [Picea likiangensis]
 gb|ADE32579.1| putative gigantea, partial [Picea purpurea]
 gb|ADE32580.1| putative gigantea, partial [Picea purpurea]
 gb|ADE32581.1| putative gigantea, partial [Picea purpurea]
 gb|ADE32582.1| putative gigantea, partial [Picea purpurea]
 gb|ADE32583.1| putative gigantea, partial [Picea purpurea]
 gb|ADE32584.1| putative gigantea, partial [Picea purpurea]
 gb|ADE32585.1| putative gigantea, partial [Picea purpurea]
 gb|ADE32586.1| putative gigantea, partial [Picea purpurea]
 gb|ADE32587.1| putative gigantea, partial [Picea purpurea]
 gb|ADE32588.1| putative gigantea, partial [Picea purpurea]
 gb|ADE32589.1| putative gigantea, partial [Picea purpurea]
 gb|ADE32591.1| putative gigantea, partial [Picea purpurea]
 gb|ADE32593.1| putative gigantea, partial [Picea purpurea]
 gb|ADE32594.1| putative gigantea, partial [Picea purpurea]
 gb|ADE32595.1| putative gigantea, partial [Picea purpurea]
 gb|ADE32596.1| putative gigantea, partial [Picea purpurea]
 gb|ADE32597.1| putative gigantea, partial [Picea purpurea]
 gb|ADE32598.1| putative gigantea [Picea purpurea]
 gb|ADE32599.1| putative gigantea, partial [Picea schrenkiana]
 gb|ADE32600.1| putative gigantea, partial [Picea schrenkiana]
 gb|ADE32601.1| putative gigantea, partial [Picea schrenkiana]
 gb|ADE32602.1| putative gigantea, partial [Picea schrenkiana]
 gb|ADE32603.1| putative gigantea, partial [Picea schrenkiana]
 gb|ADE32604.1| putative gigantea, partial [Picea schrenkiana]
 gb|ADE32605.1| putative gigantea [Picea schrenkiana]
 gb|ADE32607.1| putative gigantea, partial [Picea schrenkiana]
 gb|ADE32608.1| putative gigantea, partial [Picea schrenkiana]
 gb|ADE32609.1| putative gigantea, partial [Picea schrenkiana]
 gb|ADE32610.1| putative gigantea, partial [Picea schrenkiana]
 gb|ADE32611.1| putative gigantea, partial [Picea schrenkiana]
 gb|ADE32612.1| putative gigantea, partial [Picea schrenkiana]
 gb|ADE32613.1| putative gigantea, partial [Picea schrenkiana]
 gb|ADE32614.1| putative gigantea, partial [Picea schrenkiana]
 gb|ADE32615.1| putative gigantea, partial [Picea schrenkiana]
 gb|ADE32616.1| putative gigantea, partial [Picea schrenkiana]
 gb|ADE32617.1| putative gigantea, partial [Picea schrenkiana]
 gb|ADE32618.1| putative gigantea, partial [Picea wilsonii]
 gb|ADE32619.1| putative gigantea, partial [Picea wilsonii]
 gb|ADE32620.1| putative gigantea, partial [Picea wilsonii]
 gb|ADE32621.1| putative gigantea, partial [Picea wilsonii]
 gb|ADE32625.1| putative gigantea, partial [Picea wilsonii]
 gb|ADE32626.1| putative gigantea, partial [Picea wilsonii]
 gb|ADE32628.1| putative gigantea, partial [Picea wilsonii]
 gb|ADE32629.1| putative gigantea [Picea wilsonii]
 gb|ADE32630.1| putative gigantea, partial [Picea wilsonii]
 gb|ADE32631.1| putative gigantea, partial [Picea wilsonii]
 gb|ADE32632.1| putative gigantea, partial [Picea wilsonii]
 gb|ADE32633.1| putative gigantea, partial [Picea wilsonii]
 gb|ADE32634.1| putative gigantea, partial [Picea wilsonii]
 gb|ADE32635.1| putative gigantea [Picea wilsonii]
 gb|ADE32636.1| putative gigantea, partial [Picea wilsonii]
 gb|AGK38549.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38550.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38551.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38552.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38553.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38554.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38555.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38556.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38557.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38559.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38560.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38561.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38562.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38563.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38564.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38565.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38567.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38569.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38570.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38571.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38572.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38573.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38576.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38577.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38578.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38579.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38580.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38581.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38582.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38583.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38584.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38585.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38586.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38587.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38588.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38589.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38590.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38591.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38592.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38593.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38594.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38595.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38596.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38597.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38598.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK39059.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39060.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39061.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39062.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39064.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39065.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39066.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39067.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39068.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39069.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39070.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39071.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39072.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39073.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39074.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39075.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39076.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39077.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39078.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39079.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39080.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39081.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39082.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39083.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39084.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39085.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39086.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39087.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39088.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39089.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39090.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39091.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39092.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39093.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39094.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39095.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39096.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39097.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39098.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39099.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39100.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39101.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39102.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39103.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39104.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39105.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39106.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39107.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39108.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39109.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39110.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39111.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39112.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39113.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39114.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39115.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39116.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39117.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39118.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGK39883.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39884.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39886.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39887.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39889.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39890.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39891.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39892.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39893.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39894.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39895.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39896.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39897.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39898.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39899.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39900.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39901.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39902.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39903.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39904.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39905.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39906.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39907.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39908.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39909.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39910.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39911.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39912.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39913.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39914.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39915.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39916.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39917.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39918.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39919.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39920.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39921.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39922.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39923.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39924.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39925.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39926.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39927.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39928.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39929.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39930.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39931.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39932.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39933.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39937.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39938.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39939.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39940.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39941.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39942.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39943.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39944.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39945.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39946.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39947.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39948.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39949.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39950.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39951.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39953.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39954.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39955.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39956.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39957.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39958.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39959.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39960.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39961.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39962.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39963.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39964.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39965.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39966.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39967.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39968.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39969.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39970.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39971.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39972.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39973.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39974.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39975.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39977.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39978.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39979.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39980.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39981.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39982.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39983.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39984.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39985.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39986.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39987.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39988.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39989.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39990.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39991.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39993.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39994.1| putative gigantea, partial [Picea purpurea]
 gb|AGV41613.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41614.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41615.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41616.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41617.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41618.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41619.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41620.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41621.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41622.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41623.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41624.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41625.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41626.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41627.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41628.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41629.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41630.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41631.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41632.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41633.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41634.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41636.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41637.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41638.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41639.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41640.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41641.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41642.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41643.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41644.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41645.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41646.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41647.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41648.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41649.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41650.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41651.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41652.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41653.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41654.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41655.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41656.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41657.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41658.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41659.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41660.1| gigantea, partial [Picea likiangensis var. likiangensis]
 gb|AGV41661.1| gigantea, partial [Picea likiangensis]
 gb|AGV41662.1| gigantea, partial [Picea likiangensis]
 gb|AGV41664.1| gigantea, partial [Picea likiangensis]
 gb|AGV41665.1| gigantea, partial [Picea likiangensis]
 gb|AGV41666.1| gigantea, partial [Picea likiangensis]
 gb|AGV41667.1| gigantea, partial [Picea likiangensis]
 gb|AGV41668.1| gigantea, partial [Picea likiangensis]
 gb|AGV41669.1| gigantea, partial [Picea likiangensis]
 gb|AGV41670.1| gigantea, partial [Picea likiangensis]
 gb|AGV41671.1| gigantea, partial [Picea likiangensis]
 gb|AGV41672.1| gigantea, partial [Picea likiangensis]
 gb|AGV41674.1| gigantea, partial [Picea likiangensis]
 gb|AGV41675.1| gigantea, partial [Picea likiangensis]
 gb|AGV41676.1| gigantea, partial [Picea likiangensis]
 gb|AGV41677.1| gigantea, partial [Picea likiangensis]
 gb|AGV41678.1| gigantea, partial [Picea likiangensis]
 gb|AGV41680.1| gigantea, partial [Picea likiangensis]
 gb|AGV41681.1| gigantea, partial [Picea likiangensis]
 gb|AGV41682.1| gigantea, partial [Picea likiangensis]
 gb|AGV41684.1| gigantea, partial [Picea likiangensis]
 gb|AGV41685.1| gigantea, partial [Picea likiangensis]
 gb|AGV41687.1| gigantea, partial [Picea likiangensis]
 gb|AGV41688.1| gigantea, partial [Picea likiangensis]
 gb|AGV41689.1| gigantea, partial [Picea likiangensis]
 gb|AGV41690.1| gigantea, partial [Picea likiangensis]
 gb|AGV41691.1| gigantea, partial [Picea likiangensis]
 gb|AGV41692.1| gigantea, partial [Picea likiangensis]
 gb|AGV41693.1| gigantea, partial [Picea likiangensis]
 gb|AGV41694.1| gigantea, partial [Picea likiangensis]
 gb|AGV41697.1| gigantea, partial [Picea likiangensis]
 gb|AGV41698.1| gigantea, partial [Picea likiangensis]
 gb|AGV41699.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41700.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41701.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41702.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41703.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41704.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41705.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41706.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41707.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41708.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41709.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41710.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41711.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41712.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41713.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41714.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41715.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41716.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41717.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41718.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41719.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41720.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41721.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41722.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41723.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41724.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41725.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41726.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41727.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41728.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41729.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41730.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41731.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41732.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41733.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41734.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41735.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41737.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41738.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41739.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41740.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41741.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41742.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41743.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41744.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41745.1| gigantea, partial [Picea likiangensis var. rubescens]
 gb|AGV41746.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41747.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41748.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41749.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41750.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41751.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41752.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41753.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41754.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41755.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41756.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41757.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41758.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41759.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41760.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41762.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41763.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41764.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41765.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41766.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41767.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41768.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41769.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41770.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41771.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41772.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41773.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41774.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41775.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41776.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41777.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41778.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41779.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41780.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41781.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41782.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41783.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41784.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41785.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41786.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41787.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41788.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AGV41789.1| gigantea, partial [Picea likiangensis var. linzhiensis]
 gb|AHC92836.1| putative gigantea, partial [Picea neoveitchii]
 gb|AHC92837.1| putative gigantea, partial [Picea neoveitchii]
 gb|AHC92838.1| putative gigantea, partial [Picea neoveitchii]
 gb|AHC92839.1| putative gigantea, partial [Picea neoveitchii]
 gb|AHC92840.1| putative gigantea, partial [Picea neoveitchii]
 gb|AHC92841.1| putative gigantea, partial [Picea neoveitchii]
 gb|AHC92842.1| putative gigantea, partial [Picea neoveitchii]
 gb|AHC92843.1| putative gigantea, partial [Picea neoveitchii]
 gb|AHC92844.1| putative gigantea, partial [Picea neoveitchii]
 gb|AHC92845.1| putative gigantea, partial [Picea neoveitchii]
 gb|AHC92846.1| putative gigantea, partial [Picea neoveitchii]
 gb|AHC92847.1| putative gigantea, partial [Picea neoveitchii]
 gb|AHC92848.1| putative gigantea, partial [Picea neoveitchii]
 gb|AHC92849.1| putative gigantea, partial [Picea neoveitchii]
 gb|AHC92850.1| putative gigantea, partial [Picea neoveitchii]
 gb|AHC92851.1| putative gigantea, partial [Picea neoveitchii]
 gb|AHC92852.1| putative gigantea, partial [Picea neoveitchii]
 gb|AHC92853.1| putative gigantea, partial [Picea neoveitchii]
 gb|AHC92854.1| putative gigantea, partial [Picea neoveitchii]
 gb|AHC92855.1| putative gigantea, partial [Picea neoveitchii]
 gb|AHC93249.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93250.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93252.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93253.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93254.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93255.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93256.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93257.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93258.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93259.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93260.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93262.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93263.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93264.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93265.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93266.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93268.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93269.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93270.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93272.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93273.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93275.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93276.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93277.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93278.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93279.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93280.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93281.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93282.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93285.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93286.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93287.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93288.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93289.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93290.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93291.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93292.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93293.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93294.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93295.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93296.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93297.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93298.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93299.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93300.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93301.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93302.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93303.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93304.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93305.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93306.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93307.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93308.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93309.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93310.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93311.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93312.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93313.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93314.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93315.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93316.1| putative gigantea, partial [Picea wilsonii]
 gb|AIE54430.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54431.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54432.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54433.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54434.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54435.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54436.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54437.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54438.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54439.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54440.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54441.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54442.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54443.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54444.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54445.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54446.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54447.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54448.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54449.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54450.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54451.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54452.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54453.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54454.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54455.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54456.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54457.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54458.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54459.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54460.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54461.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54462.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54463.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54464.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54465.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54466.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54467.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54468.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54469.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54470.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54471.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54472.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54473.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54474.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54475.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54476.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54477.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54478.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54479.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54480.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54481.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54482.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54483.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54484.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54485.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54486.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54487.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54488.1| gigantea, partial [Picea schrenkiana]
 gb|AIE54489.1| gigantea, partial [Picea schrenkiana]
 gb|AIE55219.1| gigantea, partial [Picea smithiana]
 gb|AIE55220.1| gigantea, partial [Picea smithiana]
 gb|AIE55221.1| gigantea, partial [Picea smithiana]
 gb|AIE55222.1| gigantea, partial [Picea smithiana]
 gb|AIE55223.1| gigantea, partial [Picea smithiana]
 gb|AIE55224.1| gigantea, partial [Picea smithiana]
 gb|AIE55225.1| gigantea, partial [Picea smithiana]
 gb|AIE55226.1| gigantea, partial [Picea smithiana]
 gb|AIE55227.1| gigantea, partial [Picea smithiana]
 gb|AIE55228.1| gigantea, partial [Picea smithiana]
 gb|AIE55229.1| gigantea, partial [Picea smithiana]
 gb|AIE55230.1| gigantea, partial [Picea smithiana]
 gb|AIE55231.1| gigantea, partial [Picea smithiana]
 gb|AIE55232.1| gigantea, partial [Picea smithiana]
 gb|AIE55233.1| gigantea, partial [Picea smithiana]
 gb|AIE55234.1| gigantea, partial [Picea smithiana]
 gb|AIE55235.1| gigantea, partial [Picea smithiana]
 gb|AIE55236.1| gigantea, partial [Picea smithiana]
 gb|AIE55237.1| gigantea, partial [Picea smithiana]
 gb|AIE55238.1| gigantea, partial [Picea smithiana]
 gb|AIE55239.1| gigantea, partial [Picea smithiana]
 gb|AIE55240.1| gigantea, partial [Picea smithiana]
 gb|AIE55241.1| gigantea, partial [Picea smithiana]
 gb|AIE55242.1| gigantea, partial [Picea smithiana]
 gb|AIE55243.1| gigantea, partial [Picea smithiana]
 gb|AIE55244.1| gigantea, partial [Picea smithiana]
 gb|AIE55245.1| gigantea, partial [Picea smithiana]
 gb|AIE55246.1| gigantea, partial [Picea smithiana]
 gb|AIE55247.1| gigantea, partial [Picea smithiana]
 gb|AIE55248.1| gigantea, partial [Picea smithiana]
 gb|AIE55249.1| gigantea, partial [Picea smithiana]
 gb|AIE55250.1| gigantea, partial [Picea smithiana]
 gb|AIE55251.1| gigantea, partial [Picea smithiana]
 gb|AIE55252.1| gigantea, partial [Picea smithiana]
 gb|AIE55253.1| gigantea, partial [Picea smithiana]
 gb|AIE55254.1| gigantea, partial [Picea smithiana]
 gb|AIE55255.1| gigantea, partial [Picea smithiana]
 gb|AIE55256.1| gigantea, partial [Picea smithiana]
 gb|AIE55257.1| gigantea, partial [Picea smithiana]
 gb|AIE55258.1| gigantea, partial [Picea smithiana]
 gb|AIE55259.1| gigantea, partial [Picea smithiana]
 gb|AIE55260.1| gigantea, partial [Picea smithiana]
 gb|AIE55261.1| gigantea, partial [Picea smithiana]
 gb|AIE55262.1| gigantea, partial [Picea smithiana]
 gb|AIE55263.1| gigantea, partial [Picea smithiana]
 gb|AIE55264.1| gigantea, partial [Picea smithiana]
 gb|AIE55265.1| gigantea, partial [Picea smithiana]
 gb|AIE55266.1| gigantea, partial [Picea smithiana]
 gb|AIE55267.1| gigantea, partial [Picea smithiana]
 gb|AIE55268.1| gigantea, partial [Picea smithiana]
 gb|AIE55269.1| gigantea, partial [Picea smithiana]
 gb|AIE55270.1| gigantea, partial [Picea smithiana]
 gb|AIE55271.1| gigantea, partial [Picea smithiana]
 gb|AIE55272.1| gigantea, partial [Picea smithiana]
 gb|AIE55273.1| gigantea, partial [Picea smithiana]
 gb|AIE55274.1| gigantea, partial [Picea smithiana]
 gb|AIE55275.1| gigantea, partial [Picea smithiana]
 gb|AIE55276.1| gigantea, partial [Picea smithiana]
 gb|AIE55277.1| gigantea, partial [Picea smithiana]
 gb|AIE55278.1| gigantea, partial [Picea smithiana]
 gb|AIE55279.1| gigantea, partial [Picea smithiana]
 gb|AIE55280.1| gigantea, partial [Picea smithiana]
 gb|AIE55281.1| gigantea, partial [Picea smithiana]
 gb|AIE55282.1| gigantea, partial [Picea smithiana]
 gb|AIE55283.1| gigantea, partial [Picea smithiana]
 gb|AIE55284.1| gigantea, partial [Picea smithiana]
 gb|AIE55285.1| gigantea, partial [Picea smithiana]
 gb|AIE55286.1| gigantea, partial [Picea smithiana]
 gb|AIE55287.1| gigantea, partial [Picea smithiana]
 gb|AIE55288.1| gigantea, partial [Picea smithiana]
 gb|AIE55289.1| gigantea, partial [Picea smithiana]
 gb|AIE55290.1| gigantea, partial [Picea smithiana]
 gb|AIE55291.1| gigantea, partial [Picea smithiana]
 gb|AIE55292.1| gigantea, partial [Picea smithiana]
 gb|AIE55293.1| gigantea, partial [Picea smithiana]
 gb|AIE55294.1| gigantea, partial [Picea smithiana]
 gb|AIE55295.1| gigantea, partial [Picea smithiana]
 gb|AIE55296.1| gigantea, partial [Picea smithiana]
 gb|AIE55297.1| gigantea, partial [Picea smithiana]
 gb|AIE55298.1| gigantea, partial [Picea smithiana]
 gb|AIE55299.1| gigantea, partial [Picea smithiana]
 gb|AIE55300.1| gigantea, partial [Picea smithiana]
 gb|AIE55301.1| gigantea, partial [Picea smithiana]
 gb|AIE55302.1| gigantea, partial [Picea smithiana]
 gb|AIE55303.1| gigantea, partial [Picea smithiana]
 gb|AIE55304.1| gigantea, partial [Picea smithiana]
 gb|AIE55305.1| gigantea, partial [Picea smithiana]
 gb|AIE55306.1| gigantea, partial [Picea smithiana]
 gb|AIE55307.1| gigantea, partial [Picea smithiana]
 gb|AIE55308.1| gigantea, partial [Picea smithiana]
 gb|AIE55311.1| gigantea, partial [Picea smithiana]
 gb|AIE55312.1| gigantea, partial [Picea smithiana]
 gb|AIE55313.1| gigantea, partial [Picea smithiana]
 gb|AIE55314.1| gigantea, partial [Picea smithiana]
 gb|AIE55315.1| gigantea, partial [Picea smithiana]
 gb|AIE55316.1| gigantea, partial [Picea smithiana]
Length=101

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 53/86 (62%), Gaps = 7/86 (8%)
 Frame = -3

Query  592  RIPATVRCLSHPSAHVRALSISVLRAILHSGSIKSRA-KPVNMNGIHGPAYQCLNVGGTI  416
            R+PATV+CLSH SAHVRALS SVLR ILH+ S+  R  K  +    H    + L  G  I
Sbjct  2    RLPATVQCLSHSSAHVRALSTSVLRDILHAESLNFRYCKNFSEKNHHS---EHLYYGKDI  58

Query  415  ---DWQADIERCLNCEAHSQLANGMS  347
               DW   +E+CL  EAH++ A GMS
Sbjct  59   VVQDWNKAVEQCLAWEAHNRQARGMS  84



>gb|AGK38575.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGV41696.1| gigantea, partial [Picea likiangensis]
 gb|AHC93284.1| putative gigantea, partial [Picea wilsonii]
Length=101

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 53/86 (62%), Gaps = 7/86 (8%)
 Frame = -3

Query  592  RIPATVRCLSHPSAHVRALSISVLRAILHSGSIKSRA-KPVNMNGIHGPAYQCLNVGGTI  416
            R+PATV+CLSH SAHVRALS SVLR ILH+ SI  R  K  +    H    + L  G  I
Sbjct  2    RLPATVQCLSHSSAHVRALSTSVLRDILHAESINFRYCKNFSEKNHHS---EHLYHGKDI  58

Query  415  ---DWQADIERCLNCEAHSQLANGMS  347
               DW   +E+CL  EAH++ A GMS
Sbjct  59   VVQDWNKAVEQCLAWEAHNRQARGMS  84



>gb|AHC92686.1| putative gigantea, partial [Picea morrisonicola]
 gb|AHC92687.1| putative gigantea, partial [Picea morrisonicola]
 gb|AHC92688.1| putative gigantea, partial [Picea morrisonicola]
 gb|AHC92689.1| putative gigantea, partial [Picea morrisonicola]
 gb|AHC92690.1| putative gigantea, partial [Picea morrisonicola]
 gb|AHC92691.1| putative gigantea, partial [Picea morrisonicola]
 gb|AHC92692.1| putative gigantea, partial [Picea morrisonicola]
 gb|AHC92693.1| putative gigantea, partial [Picea morrisonicola]
 gb|AHC92694.1| putative gigantea, partial [Picea morrisonicola]
Length=101

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 53/86 (62%), Gaps = 7/86 (8%)
 Frame = -3

Query  592  RIPATVRCLSHPSAHVRALSISVLRAILHSGSIKSRA-KPVNMNGIHGPAYQCLNVGGTI  416
            R+PATV+CLSH SAHVRALS SVLR ILH+ S+  R  K  +    H    + L  G  I
Sbjct  2    RLPATVQCLSHSSAHVRALSTSVLRDILHAESLNVRYCKNFSEKNHHS---EHLYYGKDI  58

Query  415  ---DWQADIERCLNCEAHSQLANGMS  347
               DW   +E+CL  EAH++ A GMS
Sbjct  59   VVQDWNKAVEQCLAWEAHNRQARGMS  84



>gb|ADE32606.1| putative gigantea [Picea schrenkiana]
Length=101

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 53/86 (62%), Gaps = 7/86 (8%)
 Frame = -3

Query  592  RIPATVRCLSHPSAHVRALSISVLRAILHSGSIKSRA-KPVNMNGIHGPAYQCLNVGGTI  416
            R+PATV+CLSH SAHVRALS SVLR ILH+ S+  R  K  +    H    + L  G  I
Sbjct  2    RLPATVQCLSHSSAHVRALSTSVLRDILHAESLNFRYCKNFSEKNHHS---EHLYYGKDI  58

Query  415  ---DWQADIERCLNCEAHSQLANGMS  347
               DW   +E+CL  EAH++ A GMS
Sbjct  59   VVQDWNKAVEQCLVWEAHNRQARGMS  84



>gb|AGV41761.1| gigantea, partial [Picea likiangensis var. linzhiensis]
Length=101

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = -3

Query  592  RIPATVRCLSHPSAHVRALSISVLRAILHSGSIKSRA-KPVNMNGIHGPAYQCLNVGGTI  416
            R+PATV+CLSH SAHVRALS SVLR ILH+ S+  R  K  +    H             
Sbjct  2    RLPATVQCLSHSSAHVRALSTSVLRDILHAESLNFRYCKNFSEKNHHSEHLYYGKDNVVQ  61

Query  415  DWQADIERCLNCEAHSQLANGMS  347
            DW   +E+CL  EAH++ A GMS
Sbjct  62   DWNKAVEQCLAWEAHNRQARGMS  84



>gb|ADE32551.1| putative gigantea [Picea likiangensis]
 gb|AGK39063.1| putative gigantea protein, partial [Picea likiangensis]
 gb|AGV41736.1| gigantea, partial [Picea likiangensis var. rubescens]
Length=101

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 53/86 (62%), Gaps = 7/86 (8%)
 Frame = -3

Query  592  RIPATVRCLSHPSAHVRALSISVLRAILHSGSIKSRA-KPVNMNGIHGPAYQCLNVGGTI  416
            R+PATV+CLSH SAHVRALS SVLR ILH+ S+  +  K  +    H    + L  G  I
Sbjct  2    RLPATVQCLSHSSAHVRALSTSVLRDILHAESLNFKYCKNFSEKNHHS---EHLYYGKDI  58

Query  415  ---DWQADIERCLNCEAHSQLANGMS  347
               DW   +E+CL  EAH++ A GMS
Sbjct  59   VVQDWNKAVEQCLAWEAHNRQARGMS  84



>gb|ADE32622.1| putative gigantea [Picea wilsonii]
 gb|ADE32623.1| putative gigantea, partial [Picea wilsonii]
 gb|ADE32624.1| putative gigantea, partial [Picea wilsonii]
 gb|ADE32627.1| putative gigantea, partial [Picea wilsonii]
 gb|AGK38558.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38566.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38568.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGK38574.1| putative gigantea protein, partial [Picea wilsonii]
 gb|AGV41663.1| gigantea, partial [Picea likiangensis]
 gb|AGV41673.1| gigantea, partial [Picea likiangensis]
 gb|AGV41679.1| gigantea, partial [Picea likiangensis]
 gb|AGV41683.1| gigantea, partial [Picea likiangensis]
 gb|AGV41686.1| gigantea, partial [Picea likiangensis]
 gb|AGV41695.1| gigantea, partial [Picea likiangensis]
 gb|AHC93251.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93261.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93267.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93271.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93274.1| putative gigantea, partial [Picea wilsonii]
 gb|AHC93283.1| putative gigantea, partial [Picea wilsonii]
Length=101

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 53/86 (62%), Gaps = 7/86 (8%)
 Frame = -3

Query  592  RIPATVRCLSHPSAHVRALSISVLRAILHSGSIKSRA-KPVNMNGIHGPAYQCLNVGGTI  416
            R+PATV+CLSH SAHVRALS SVLR ILH+ S+  R  K  +    H    + L  G  I
Sbjct  2    RLPATVQCLSHSSAHVRALSTSVLRDILHAESLNFRYCKNFSEKNHHS---EHLYHGKDI  58

Query  415  ---DWQADIERCLNCEAHSQLANGMS  347
               DW   +E+CL  EAH++ A GMS
Sbjct  59   VVQDWNKAVEQCLAWEAHNRQARGMS  84



>gb|ADE32566.1| putative gigantea [Picea likiangensis]
 gb|AGV41635.1| gigantea, partial [Picea likiangensis var. likiangensis]
Length=101

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 52/86 (60%), Gaps = 7/86 (8%)
 Frame = -3

Query  592  RIPATVRCLSHPSAHVRALSISVLRAILHSGSIKSRA-KPVNMNGIHGPAYQCLNVGGTI  416
            R+PATV+CLSH SAHVRALS SVLR ILH+ S+  R  K  +    H    + L  G  I
Sbjct  2    RLPATVQCLSHSSAHVRALSTSVLRDILHAESLNFRYCKNFSEKNHHS---EHLYYGKDI  58

Query  415  ---DWQADIERCLNCEAHSQLANGMS  347
               DW   +E+CL  EAH++   GMS
Sbjct  59   VVQDWNKAVEQCLAWEAHNRQTRGMS  84



>gb|ADE32592.1| putative gigantea [Picea purpurea]
Length=101

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = -3

Query  592  RIPATVRCLSHPSAHVRALSISVLRAILHSGSIKSRAKPVNMNGIHGPAYQCLNVGGTI-  416
            R+PATV+CLSH SAHVRALS SVLR ILH+ S+  R         H   +  L  G  I 
Sbjct  2    RLPATVQCLSHSSAHVRALSTSVLRDILHAESLNFRYCKNFSEKNHLSEH--LYYGKDIV  59

Query  415  --DWQADIERCLNCEAHSQLANGMS  347
              DW   +E+CL  EAH++ A GMS
Sbjct  60   VQDWNKAVEQCLAWEAHNRQARGMS  84



>gb|AGK39934.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39936.1| putative gigantea, partial [Picea purpurea]
Length=101

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 52/85 (61%), Gaps = 7/85 (8%)
 Frame = -3

Query  589  IPATVRCLSHPSAHVRALSISVLRAILHSGSIKSRA-KPVNMNGIHGPAYQCLNVGGTI-  416
            +PATV+CLSH SAHVRALS SVLR ILH+ S+  R  K  +    H    + L  G  I 
Sbjct  3    LPATVQCLSHSSAHVRALSTSVLRDILHAESLNFRYCKNFSEKNHHS---EHLYYGKDIV  59

Query  415  --DWQADIERCLNCEAHSQLANGMS  347
              DW   +E+CL  EAH++ A GMS
Sbjct  60   VQDWNKAVEQCLAWEAHNRQARGMS  84



>gb|AGK39885.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39888.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39935.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39952.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39976.1| putative gigantea, partial [Picea purpurea]
 gb|AGK39992.1| putative gigantea, partial [Picea purpurea]
Length=101

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 52/86 (60%), Gaps = 7/86 (8%)
 Frame = -3

Query  592  RIPATVRCLSHPSAHVRALSISVLRAILHSGSIKSRA-KPVNMNGIHGPAYQCLNVGGTI  416
            R+PATV+CLSH SAHVRALS  VLR ILH+ S+  R  K  +    H    + L  G  I
Sbjct  2    RLPATVQCLSHSSAHVRALSTLVLRDILHAESLNFRYCKNFSEKNHHS---EHLYYGKDI  58

Query  415  ---DWQADIERCLNCEAHSQLANGMS  347
               DW   +E+CL  EAH++ A GMS
Sbjct  59   VVQDWNKAVEQCLAWEAHNRQARGMS  84



>gb|KJB59492.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=1055

 Score = 40.0 bits (92),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -3

Query  736   DGMLVDGEACTLPQLELLEVT  674
             DGMLVDGEACTLPQLEL + +
Sbjct  1024  DGMLVDGEACTLPQLELEQFS  1044


 Score = 30.8 bits (68),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -1

Query  675   QLEQFNQCSSGENLDWQ  625
             +LEQF++ SSGEN DWQ
Sbjct  1039  ELEQFSRYSSGENQDWQ  1055



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1354032766515