BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF012D07

Length=741
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008456300.1|  PREDICTED: phosphoglycerate kinase, chloropl...    182   2e-73   Cucumis melo [Oriental melon]
ref|XP_004139904.1|  PREDICTED: phosphoglycerate kinase, chloropl...    182   3e-73   Cucumis sativus [cucumbers]
ref|XP_011095719.1|  PREDICTED: phosphoglycerate kinase, chloropl...    184   4e-73   Sesamum indicum [beniseed]
gb|KJB14025.1|  hypothetical protein B456_002G107300                    179   3e-72   Gossypium raimondii
gb|KJB14026.1|  hypothetical protein B456_002G107300                    179   3e-72   Gossypium raimondii
gb|KDP25067.1|  hypothetical protein JCGZ_22602                         181   4e-72   Jatropha curcas
ref|XP_011086346.1|  PREDICTED: phosphoglycerate kinase, chloropl...    182   6e-72   Sesamum indicum [beniseed]
gb|KHG01489.1|  hypothetical protein F383_22605                         178   7e-72   Gossypium arboreum [tree cotton]
ref|XP_004306579.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    178   1e-71   Fragaria vesca subsp. vesca
ref|XP_008383150.1|  PREDICTED: phosphoglycerate kinase, chloropl...    177   2e-71   Malus domestica [apple tree]
ref|XP_008349091.1|  PREDICTED: phosphoglycerate kinase, chloropl...    179   3e-71   
ref|XP_010269369.1|  PREDICTED: phosphoglycerate kinase, chloropl...    179   4e-71   Nelumbo nucifera [Indian lotus]
ref|XP_008346077.1|  PREDICTED: phosphoglycerate kinase, chloropl...    179   4e-71   
ref|XP_008371996.1|  PREDICTED: phosphoglycerate kinase, chloropl...    179   4e-71   
ref|XP_004488763.1|  PREDICTED: phosphoglycerate kinase, chloropl...    177   5e-71   Cicer arietinum [garbanzo]
ref|XP_008226130.1|  PREDICTED: phosphoglycerate kinase, chloropl...    176   7e-71   Prunus mume [ume]
ref|XP_009763674.1|  PREDICTED: phosphoglycerate kinase, chloropl...    183   8e-71   Nicotiana sylvestris
sp|Q42961.1|PGKH_TOBAC  RecName: Full=Phosphoglycerate kinase, ch...    183   8e-71   Nicotiana tabacum [American tobacco]
ref|XP_009622055.1|  PREDICTED: phosphoglycerate kinase, chloropl...    183   8e-71   Nicotiana tomentosiformis
ref|XP_003596091.1|  Phosphoglycerate kinase                            175   1e-70   Medicago truncatula
ref|XP_007213965.1|  hypothetical protein PRUPE_ppa005031mg             176   1e-70   Prunus persica
ref|XP_003531482.1|  PREDICTED: phosphoglycerate kinase, chloropl...    173   2e-70   Glycine max [soybeans]
ref|XP_002513353.1|  phosphoglycerate kinase, putative                  175   3e-70   Ricinus communis
gb|ADR71054.1|  phosphoglycerate kinase                                 183   3e-70   Nicotiana benthamiana
ref|XP_003546820.1|  PREDICTED: phosphoglycerate kinase, chloropl...    173   3e-70   
ref|XP_010060861.1|  PREDICTED: phosphoglycerate kinase, chloropl...    180   3e-70   Eucalyptus grandis [rose gum]
ref|XP_010094703.1|  Phosphoglycerate kinase                            174   4e-70   Morus notabilis
ref|XP_008786111.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    173   4e-70   Phoenix dactylifera
gb|KDO61594.1|  hypothetical protein CISIN_1g011942mg                   176   4e-70   Citrus sinensis [apfelsine]
ref|XP_006422251.1|  hypothetical protein CICLE_v10004891mg             176   5e-70   Citrus clementina [clementine]
ref|XP_010936574.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    173   5e-70   Elaeis guineensis
ref|XP_004243968.1|  PREDICTED: phosphoglycerate kinase, chloropl...    180   6e-70   Solanum lycopersicum
ref|XP_008805983.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    172   6e-70   Phoenix dactylifera
ref|NP_001275227.1|  phosphoglycerate kinase, chloroplastic-like        180   6e-70   Solanum tuberosum [potatoes]
gb|AAC26785.1|  phosphoglycerate kinase precursor                       180   7e-70   Solanum tuberosum [potatoes]
ref|XP_002263796.1|  PREDICTED: phosphoglycerate kinase, chloropl...    177   7e-70   Vitis vinifera
gb|ABB86255.1|  phosphoglycerate kinase precursor-like                  180   9e-70   Solanum tuberosum [potatoes]
ref|XP_007022578.1|  Phosphoglycerate kinase 1                          174   1e-69   
gb|KHN21386.1|  Phosphoglycerate kinase, chloroplastic                  171   1e-69   Glycine soja [wild soybean]
emb|CBI24182.3|  unnamed protein product                                176   2e-69   Vitis vinifera
gb|AFK48886.1|  unknown                                                 171   2e-69   Lotus japonicus
ref|XP_002315066.1|  PHOSPHOGLYCERATE KINASE 1 family protein           179   2e-69   
ref|XP_010923458.1|  PREDICTED: phosphoglycerate kinase, chloropl...    171   2e-69   Elaeis guineensis
gb|EYU33792.1|  hypothetical protein MIMGU_mgv1a005422mg                170   4e-69   Erythranthe guttata [common monkey flower]
ref|XP_009397212.1|  PREDICTED: phosphoglycerate kinase, chloropl...    174   4e-69   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADV16381.1|  chloroplast phosphoglycerate kinase 3                   179   4e-69   Helianthus annuus
sp|P12782.1|PGKH_WHEAT  RecName: Full=Phosphoglycerate kinase, ch...    177   4e-69   Triticum aestivum [Canadian hard winter wheat]
gb|EMT12348.1|  Phosphoglycerate kinase, chloroplastic                  177   6e-69   
ref|XP_009402843.1|  PREDICTED: phosphoglycerate kinase, chloropl...    170   7e-69   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS54865.1|  Phosphoglycerate kinase, chloroplastic                  176   1e-68   Triticum urartu
ref|XP_007149208.1|  hypothetical protein PHAVU_005G050700g             174   1e-68   Phaseolus vulgaris [French bean]
ref|XP_002441313.1|  hypothetical protein SORBIDRAFT_09g024340          169   1e-68   Sorghum bicolor [broomcorn]
emb|CDP13574.1|  unnamed protein product                                174   1e-68   Coffea canephora [robusta coffee]
ref|XP_004961633.1|  PREDICTED: phosphoglycerate kinase, chloropl...    171   1e-68   Setaria italica
gb|ACJ85441.1|  unknown                                                 172   3e-68   Medicago truncatula
ref|XP_011016496.1|  PREDICTED: phosphoglycerate kinase, chloropl...    177   4e-68   Populus euphratica
ref|XP_006654593.1|  PREDICTED: phosphoglycerate kinase, chloropl...    169   7e-68   Oryza brachyantha
gb|AFW78532.1|  phosphoglycerate kinase                                 172   1e-67   
gb|AFW78533.1|  phosphoglycerate kinase                                 172   1e-67   
ref|XP_002891879.1|  hypothetical protein ARALYDRAFT_474689             176   1e-67   
ref|NP_001147628.1|  phosphoglycerate kinase                            172   1e-67   
gb|ACN32155.1|  unknown                                                 172   2e-67   Zea mays [maize]
ref|NP_176015.1|  phosphoglycerate kinase                               174   2e-67   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001055937.1|  Os05g0496200                                       167   3e-67   
ref|NP_001117503.1|  phosphoglycerate kinase                            172   6e-67   Arabidopsis thaliana [mouse-ear cress]
gb|AFW82396.1|  hypothetical protein ZEAMMB73_945417                    171   8e-67   
gb|AAA79705.1|  phosphoglycerate kinase                                 174   8e-67   Arabidopsis thaliana [mouse-ear cress]
gb|ABK96267.1|  unknown                                                 170   8e-67   Populus trichocarpa x Populus deltoides
ref|XP_003568189.1|  PREDICTED: phosphoglycerate kinase, chloropl...    169   1e-66   
ref|XP_008656415.1|  PREDICTED: phosphoglycerate kinase, chloropl...    170   1e-66   
ref|XP_002312238.1|  hypothetical protein POPTR_0008s08410g             169   2e-66   Populus trichocarpa [western balsam poplar]
ref|XP_006858226.1|  hypothetical protein AMTR_s00062p00189550          169   2e-66   Amborella trichopoda
ref|XP_002884926.1|  hypothetical protein ARALYDRAFT_478641             166   2e-66   Arabidopsis lyrata subsp. lyrata
ref|XP_006300323.1|  hypothetical protein CARUB_v10020404mg             175   2e-66   
ref|XP_010417621.1|  PREDICTED: phosphoglycerate kinase, cytosolic      174   3e-66   Camelina sativa [gold-of-pleasure]
ref|XP_006297559.1|  hypothetical protein CARUB_v10013582mg             166   3e-66   Capsella rubella
ref|NP_178073.1|  phosphoglycerate kinase                               174   3e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010669994.1|  PREDICTED: phosphoglycerate kinase, chloropl...    169   3e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010499471.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    166   4e-66   Camelina sativa [gold-of-pleasure]
gb|AAM61185.1|  phosphoglycerate kinase, putative                       174   6e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010544343.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoglyce...    165   6e-66   Tarenaya hassleriana [spider flower]
ref|XP_006389877.1|  hypothetical protein EUTSA_v10018657mg             174   6e-66   Eutrema salsugineum [saltwater cress]
dbj|BAH57185.1|  AT1G79550                                              173   7e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010487004.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    165   8e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010465058.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    166   1e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010472814.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    172   1e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010275944.1|  PREDICTED: phosphoglycerate kinase, cytosolic      174   1e-65   Nelumbo nucifera [Indian lotus]
ref|XP_003546821.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    171   1e-65   Glycine max [soybeans]
ref|XP_011086347.1|  PREDICTED: phosphoglycerate kinase, cytosolic      173   1e-65   Sesamum indicum [beniseed]
emb|CDX67989.1|  BnaA07g20290D                                          172   2e-65   
ref|XP_002889253.1|  hypothetical protein ARALYDRAFT_477124             172   2e-65   
emb|CDX87375.1|  BnaA07g34980D                                          172   2e-65   
ref|XP_006407295.1|  hypothetical protein EUTSA_v10020621mg             169   3e-65   Eutrema salsugineum [saltwater cress]
ref|NP_187884.1|  phosphoglycerate kinase 1                             166   4e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009106677.1|  PREDICTED: phosphoglycerate kinase, cytosolic      171   4e-65   Brassica rapa
ref|XP_003531483.1|  PREDICTED: phosphoglycerate kinase, cytosolic      169   4e-65   
ref|XP_004970259.1|  PREDICTED: phosphoglycerate kinase, chloropl...    163   5e-65   Setaria italica
emb|CDX73803.1|  BnaA03g32440D                                          169   5e-65   
ref|XP_004970258.1|  PREDICTED: phosphoglycerate kinase, chloropl...    163   5e-65   Setaria italica
emb|CDY00798.1|  BnaC03g37820D                                          169   5e-65   
ref|XP_009128369.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    171   6e-65   Brassica rapa
gb|ABI18157.1|  cytosolic phosphoglycerate kinase                       171   7e-65   Helianthus annuus
emb|CBL95264.1|  phosphoglycerate kinase 1                              162   1e-64   Pinus pinaster [cluster pine]
gb|AAB60303.1|  phosphoglycerate kinase                                 165   1e-64   Arabidopsis thaliana [mouse-ear cress]
emb|CDY49746.1|  BnaA02g19260D                                          170   1e-64   Brassica napus [oilseed rape]
emb|CDX88547.1|  BnaC06g39910D                                          170   1e-64   
gb|AIZ74346.1|  phosphoglycerate kinase 1                               161   1e-64   Pinus massoniana [Chinese red pine]
ref|XP_007022579.1|  Phosphoglycerate kinase isoform 1                  169   1e-64   
ref|XP_009384174.1|  PREDICTED: phosphoglycerate kinase, cytosolic      173   1e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009607754.1|  PREDICTED: phosphoglycerate kinase, cytosolic      169   1e-64   Nicotiana tomentosiformis
ref|XP_002971814.1|  hypothetical protein SELMODRAFT_267533             167   1e-64   
ref|XP_009791377.1|  PREDICTED: phosphoglycerate kinase, cytosolic      169   1e-64   Nicotiana sylvestris
ref|XP_002972334.1|  hypothetical protein SELMODRAFT_231942             166   1e-64   
gb|KDO61597.1|  hypothetical protein CISIN_1g040813mg                   169   2e-64   Citrus sinensis [apfelsine]
ref|XP_011468861.1|  PREDICTED: phosphoglycerate kinase, cytosolic      169   2e-64   Fragaria vesca subsp. vesca
ref|XP_010094705.1|  Phosphoglycerate kinase                            168   2e-64   Morus notabilis
emb|CDX79326.1|  BnaC06g19770D                                          168   3e-64   
gb|KJB14019.1|  hypothetical protein B456_002G107200                    169   3e-64   Gossypium raimondii
ref|XP_010324204.1|  PREDICTED: phosphoglycerate kinase, cytosolic      167   3e-64   
gb|KJB14020.1|  hypothetical protein B456_002G107200                    170   4e-64   Gossypium raimondii
ref|XP_010064085.1|  PREDICTED: phosphoglycerate kinase, cytosolic      169   4e-64   Eucalyptus grandis [rose gum]
emb|CDY70232.1|  BnaC02g46710D                                          169   4e-64   Brassica napus [oilseed rape]
ref|XP_011016588.1|  PREDICTED: phosphoglycerate kinase, cytosolic      168   4e-64   Populus euphratica
ref|XP_006422250.1|  hypothetical protein CICLE_v10005101mg             167   6e-64   Citrus clementina [clementine]
emb|CDY43401.1|  BnaA01g30320D                                          165   6e-64   Brassica napus [oilseed rape]
gb|AIZ68220.1|  phosphoglycerate kinase                                 171   7e-64   Ornithogalum longebracteatum [sea-onion]
ref|XP_009135249.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    168   7e-64   Brassica rapa
ref|XP_008383158.1|  PREDICTED: phosphoglycerate kinase, cytosolic      169   8e-64   Malus domestica [apple tree]
ref|XP_011095716.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    169   8e-64   Sesamum indicum [beniseed]
gb|KCW71393.1|  hypothetical protein EUGRSUZ_F04463                     168   8e-64   Eucalyptus grandis [rose gum]
gb|ACJ11718.1|  phosphoglycerate kinase                                 168   8e-64   Gossypium hirsutum [American cotton]
emb|CDY24247.1|  BnaC01g38270D                                          165   1e-63   Brassica napus [oilseed rape]
dbj|BAA33801.1|  cytosolic phosphoglycerate kinase 1                    167   2e-63   Populus nigra [black poplar]
gb|KDP25066.1|  hypothetical protein JCGZ_22601                         164   2e-63   Jatropha curcas
ref|NP_001275451.1|  phosphoglycerate kinase, cytosolic-like            165   2e-63   Solanum tuberosum [potatoes]
gb|EYU33791.1|  hypothetical protein MIMGU_mgv1a006853mg                171   2e-63   Erythranthe guttata [common monkey flower]
ref|XP_010941660.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    167   3e-63   
ref|XP_002263950.1|  PREDICTED: phosphoglycerate kinase, cytosolic      169   3e-63   Vitis vinifera
ref|XP_010941661.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    167   4e-63   Elaeis guineensis
gb|AAO63774.1|  3-phosphoglycerate kinase                               167   4e-63   Populus tremuloides
gb|ABK92531.1|  unknown                                                 167   4e-63   Populus trichocarpa [western balsam poplar]
ref|XP_008226131.1|  PREDICTED: phosphoglycerate kinase, cytosolic      168   4e-63   Prunus mume [ume]
ref|XP_010936568.1|  PREDICTED: phosphoglycerate kinase, cytosolic      165   4e-63   Elaeis guineensis
ref|XP_007213914.1|  hypothetical protein PRUPE_ppa005669mg             168   5e-63   
emb|CDY52872.1|  BnaCnng23600D                                          164   5e-63   Brassica napus [oilseed rape]
emb|CBI24183.3|  unnamed protein product                                169   5e-63   Vitis vinifera
ref|XP_009777860.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    162   6e-63   Nicotiana sylvestris
ref|XP_002513352.1|  phosphoglycerate kinase, putative                  164   7e-63   Ricinus communis
gb|ABR16231.1|  unknown                                                 159   7e-63   Picea sitchensis
gb|EEC71648.1|  hypothetical protein OsI_04088                          157   7e-63   Oryza sativa Indica Group [Indian rice]
gb|ABK24564.1|  unknown                                                 159   7e-63   Picea sitchensis
ref|XP_002315067.1|  cytosolic phosphoglycerate kinase family pro...    166   7e-63   
ref|XP_009124670.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    165   9e-63   Brassica rapa
ref|XP_010537804.1|  PREDICTED: phosphoglycerate kinase, cytosolic      162   9e-63   Tarenaya hassleriana [spider flower]
ref|XP_009618219.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    162   9e-63   Nicotiana tomentosiformis
gb|AGV54662.1|  phosphoglycerate kinase chloroplastic-like protein      165   1e-62   Phaseolus vulgaris [French bean]
sp|P29409.2|PGKH_SPIOL  RecName: Full=Phosphoglycerate kinase, ch...    164   1e-62   Spinacia oleracea
ref|XP_009414502.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    166   2e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002312237.1|  hypothetical protein POPTR_0008s08400g             164   2e-62   
ref|XP_009399252.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    165   2e-62   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABB86242.1|  phosphoglycerate kinase-like                            162   2e-62   Solanum tuberosum [potatoes]
ref|XP_004139837.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    162   2e-62   Cucumis sativus [cucumbers]
ref|XP_006858233.1|  hypothetical protein AMTR_s00062p00191350          167   2e-62   Amborella trichopoda
ref|XP_007149209.1|  hypothetical protein PHAVU_005G050800g             165   2e-62   Phaseolus vulgaris [French bean]
ref|XP_008447095.1|  PREDICTED: phosphoglycerate kinase, cytosolic      163   3e-62   Cucumis melo [Oriental melon]
ref|XP_011013857.1|  PREDICTED: phosphoglycerate kinase, chloropl...    177   3e-62   Populus euphratica
ref|XP_009146585.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    165   4e-62   Brassica rapa
gb|AAX57302.1|  putative phospho-glycerate kinase                       166   4e-62   Solanum peruvianum [Peruvian tomato]
gb|ABS19535.1|  CT114                                                   166   4e-62   Solanum chilense
gb|AGT16255.1|  phosphoglycerate kinase                                 158   4e-62   Saccharum hybrid cultivar R570
gb|AAX57323.1|  putative phospho-glycerate kinase                       166   4e-62   Solanum habrochaites
ref|XP_008805982.1|  PREDICTED: phosphoglycerate kinase, cytosolic      163   5e-62   Phoenix dactylifera
emb|CDP13576.1|  unnamed protein product                                162   5e-62   Coffea canephora [robusta coffee]
gb|ABS19537.1|  CT114                                                   167   5e-62   [Lycopersicon] peruvianum var. humifusum
ref|NP_001167912.1|  phosphoglycerate kinase                            159   5e-62   Zea mays [maize]
gb|ABS19536.1|  CT114                                                   166   5e-62   Solanum chilense
gb|EPS64076.1|  phosphoglycerate kinase                                 160   6e-62   Genlisea aurea
gb|ABS19544.1|  CT114                                                   166   7e-62   [Lycopersicon] peruvianum var. humifusum
dbj|BAA33802.1|  cytosolic phosphoglycerate kinase 1                    162   8e-62   Populus nigra [black poplar]
ref|XP_011013882.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    164   8e-62   Populus euphratica
ref|XP_009104523.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    167   9e-62   Brassica rapa
gb|ABF69999.1|  phosphoglycerate kinase, putative                       165   1e-61   Musa acuminata [banana]
ref|XP_010557291.1|  PREDICTED: phosphoglycerate kinase, cytosolic      161   1e-61   Tarenaya hassleriana [spider flower]
gb|AAZ85273.1|  putative phosphoglycerate kinase                        165   1e-61   Solanum chmielewskii
gb|ABS19556.1|  CT114                                                   165   1e-61   [Lycopersicon] peruvianum var. humifusum
gb|ABS19538.1|  CT114                                                   167   2e-61   [Lycopersicon] peruvianum var. humifusum
ref|XP_008798227.1|  PREDICTED: phosphoglycerate kinase, cytosolic      161   2e-61   Phoenix dactylifera
emb|CDP16886.1|  unnamed protein product                                162   5e-61   Coffea canephora [robusta coffee]
gb|ADV16380.1|  cytosolic phosphoglycerate kinase 2                     165   5e-61   Helianthus annuus
gb|ABS19547.1|  CT114                                                   163   6e-61   [Lycopersicon] peruvianum var. humifusum
sp|P12783.1|PGKY_WHEAT  RecName: Full=Phosphoglycerate kinase, cy...    159   6e-61   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ88371.1|  predicted protein                                      159   6e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004951776.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    165   1e-60   Setaria italica
ref|XP_009417722.1|  PREDICTED: phosphoglycerate kinase, cytosolic      163   1e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001058317.1|  Os06g0668200                                       163   4e-60   
gb|AFW70281.1|  phosphoglycerate kinase                                 162   9e-60   
ref|XP_003570108.1|  PREDICTED: phosphoglycerate kinase, cytosolic      157   1e-59   Brachypodium distachyon [annual false brome]
gb|AAC32142.1|  phosphoglycerate kinase                                 144   1e-59   Picea mariana [black spruce]
ref|XP_004966316.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    159   1e-59   Setaria italica
ref|NP_001142404.1|  uncharacterized protein LOC100274579               161   3e-59   Zea mays [maize]
gb|EMT08517.1|  Phosphoglycerate kinase, cytosolic                      158   4e-59   
ref|XP_002977295.1|  hypothetical protein SELMODRAFT_107116             158   9e-59   Selaginella moellendorffii
ref|XP_006656354.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    156   1e-58   Oryza brachyantha
ref|XP_002972143.1|  hypothetical protein SELMODRAFT_96742              157   1e-58   Selaginella moellendorffii
gb|ABR25550.1|  phosphoglycerate kinase                                 159   5e-58   Oryza sativa Indica Group [Indian rice]
dbj|BAJ85222.1|  predicted protein                                      153   9e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001046020.1|  Os02g0169300                                       157   1e-57   
ref|XP_011013868.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    149   2e-57   Populus euphratica
ref|XP_006646936.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    154   2e-57   Oryza brachyantha
gb|ABI74567.1|  phosphoglycerate kinase                                 157   2e-57   Oryza sativa Indica Group [Indian rice]
gb|EMT29203.1|  Phosphoglycerate kinase, cytosolic                      160   3e-57   
gb|ABI74568.1|  phosphoglycerate kinase                                 155   8e-57   Oryza sativa Indica Group [Indian rice]
ref|WP_035992253.1|  phosphoglycerate kinase                            147   2e-56   Leptolyngbya sp. KIOST-1
ref|WP_015184203.1|  phosphoglycerate kinase                            151   4e-56   Microcoleus sp. PCC 7113
ref|WP_017300589.1|  phosphoglycerate kinase                            149   4e-56   Nodosilinea nodulosa
ref|WP_041032823.1|  phosphoglycerate kinase                            147   1e-55   Tolypothrix campylonemoides
ref|WP_011377868.1|  MULTISPECIES: phosphoglycerate kinase              147   7e-55   Synechococcus
ref|WP_029637902.1|  phosphoglycerate kinase [                          147   7e-55   [Scytonema hofmanni] UTEX B 1581
ref|WP_015166011.1|  phosphoglycerate kinase                            146   1e-54   Pseudanabaena sp. PCC 7367
ref|WP_016865730.1|  phosphoglycerate kinase                            145   1e-54   Fischerella muscicola
ref|WP_026135280.1|  phosphoglycerate kinase                            150   1e-54   Scytonema hofmannii
ref|WP_039728851.1|  MULTISPECIES: phosphoglycerate kinase              145   1e-54   Lyngbya confervoides
ref|WP_026734580.1|  phosphoglycerate kinase                            147   1e-54   Fischerella sp. PCC 9605
ref|WP_011242745.1|  phosphoglycerate kinase                            146   2e-54   Synechococcus elongatus
ref|WP_026097925.1|  phosphoglycerate kinase                            145   2e-54   Geitlerinema sp. PCC 7105
ref|WP_035831895.1|  phosphoglycerate kinase                            145   2e-54   
ref|WP_015149149.1|  phosphoglycerate kinase                            142   3e-54   Oscillatoria acuminata
ref|WP_016924803.1|  phosphoglycerate kinase                            145   3e-54   Prochlorothrix hollandica
ref|WP_011936642.1|  phosphoglycerate kinase                            146   3e-54   Synechococcus sp. RCC307
ref|WP_017289328.1|  phosphoglycerate kinase                            142   4e-54   Leptolyngbya boryana
sp|P74421.2|PGK_SYNY3  RecName: Full=Phosphoglycerate kinase            150   5e-54   Synechocystis sp. PCC 6803 substr. Kazusa
ref|WP_010873144.1|  phosphoglycerate kinase                            150   5e-54   Synechocystis
ref|WP_006105635.1|  phosphoglycerate kinase                            144   5e-54   Coleofasciculus chthonoplastes
ref|WP_039739530.1|  phosphoglycerate kinase                            142   7e-54   
ref|WP_007099195.1|  phosphoglycerate kinase                            147   8e-54   Synechococcus sp. RS9916
dbj|BAA18521.1|  phosphoglycerate kinase                                150   8e-54   Synechocystis sp. PCC 6803
ref|WP_017309094.1|  MULTISPECIES: phosphoglycerate kinase              149   9e-54   Hapalosiphonaceae
gb|KIE11439.1|  phosphoglycerate kinase                                 149   9e-54   Tolypothrix bouteillei VB521301
ref|WP_009454679.1|  MULTISPECIES: phosphoglycerate kinase              144   1e-53   Fischerella thermalis
ref|WP_027842190.1|  phosphoglycerate kinase                            148   1e-53   Mastigocoleus testarum
ref|WP_016861411.1|  phosphoglycerate kinase                            147   1e-53   Fischerella muscicola
ref|WP_026098466.1|  phosphoglycerate kinase                            143   1e-53   Oscillatoria sp. PCC 10802
ref|WP_016873269.1|  phosphoglycerate kinase                            144   2e-53   Chlorogloeopsis fritschii
ref|WP_006528046.1|  phosphoglycerate kinase                            141   2e-53   Gloeocapsa sp. PCC 73106
ref|WP_013321558.1|  phosphoglycerate kinase                            139   2e-53   Cyanothece sp. PCC 7822
ref|WP_015119342.1|  phosphoglycerate kinase                            143   2e-53   Rivularia sp. PCC 7116
ref|WP_026719925.1|  phosphoglycerate kinase                            145   2e-53   Fischerella sp. PCC 9431
ref|WP_011620601.1|  phosphoglycerate kinase                            142   3e-53   Synechococcus sp. CC9311
ref|WP_015190859.1|  phosphoglycerate kinase                            136   3e-53   Gloeocapsa sp. PCC 7428
ref|WP_028953033.1|  phosphoglycerate kinase                            142   4e-53   Synechococcus sp. CC9616
ref|WP_011129182.1|  phosphoglycerate kinase                            144   4e-53   Synechococcus
ref|WP_028089947.1|  phosphoglycerate kinase                            147   4e-53   Dolichospermum circinale
ref|WP_011827369.1|  phosphoglycerate kinase                            143   4e-53   
ref|WP_011058101.1|  phosphoglycerate kinase                            138   4e-53   Thermosynechococcus elongatus
ref|WP_038552523.1|  phosphoglycerate kinase                            144   6e-53   Synechococcus sp. KORDI-52
gb|AFH41108.1|  plastid 3-phosphoglycerate kinase                       176   8e-53   Triticum aestivum subsp. yunnanense
gb|AFH41121.1|  plastid 3-phosphoglycerate kinase                       176   8e-53   Triticum spelta [spelt]
gb|AID16252.1|  phosphoglycerate kinase                                 176   8e-53   Triticum aestivum subsp. yunnanense
gb|AFH41102.1|  plastid 3-phosphoglycerate kinase                       176   8e-53   Triticum aestivum [Canadian hard winter wheat]
gb|AFH41091.1|  plastid 3-phosphoglycerate kinase                       176   8e-53   Triticum compactum
gb|AAM51702.1|AF343476_1  3-phosphoglycerate kinase                     176   9e-53   Triticum dicoccoides [wild emmer wheat]
gb|AAM51700.1|AF343474_1  3-phosphoglycerate kinase                     176   9e-53   Triticum urartu
gb|AFH41101.1|  plastid 3-phosphoglycerate kinase                       176   9e-53   Triticum aestivum [Canadian hard winter wheat]
gb|AFH41104.1|  plastid 3-phosphoglycerate kinase                       176   9e-53   Triticum macha
gb|AID16262.1|  phosphoglycerate kinase                                 176   9e-53   Triticum petropavlovskyi
ref|WP_015167138.1|  phosphoglycerate kinase                            144   9e-53   Synechococcus sp. PCC 7502
gb|AFH41099.1|  plastid 3-phosphoglycerate kinase                       176   9e-53   Triticum turgidum [cone wheat]
gb|AFH41137.1|  plastid 3-phosphoglycerate kinase                       176   9e-53   Triticum turgidum subsp. durum
gb|AFH41131.1|  plastid 3-phosphoglycerate kinase                       176   1e-52   Triticum turgidum subsp. turanicum
gb|AID16255.1|  phosphoglycerate kinase                                 176   1e-52   Triticum petropavlovskyi
gb|AFH41130.1|  plastid 3-phosphoglycerate kinase                       176   1e-52   Triticum petropavlovskyi
ref|WP_024125258.1|  phosphoglycerate kinase                            138   1e-52   Thermosynechococcus sp. NK55a
gb|AFH41149.1|  plastid 3-phosphoglycerate kinase                       176   1e-52   Triticum timopheevii [Sanduri wheat]
ref|WP_028085373.1|  phosphoglycerate kinase                            145   1e-52   Dolichospermum circinale
gb|AFH41081.1|  plastid 3-phosphoglycerate kinase                       176   1e-52   Aegilops tauschii subsp. tauschii x Triticum turgidum subsp. polonicum
ref|WP_008189591.1|  phosphoglycerate kinase                            146   1e-52   Moorea producens
gb|AHF64875.1|  Phosphoglycerate kinase                                 143   1e-52   Synechococcus sp. WH 8109
gb|KGG29033.1|  Phosphoglycerate kinase                                 144   1e-52   Prochlorococcus sp. MIT 0701
ref|WP_036911068.1|  MULTISPECIES: phosphoglycerate kinase              144   2e-52   Prochlorococcus
ref|WP_009628155.1|  phosphoglycerate kinase                            146   2e-52   
ref|WP_043693415.1|  phosphoglycerate kinase                            141   2e-52   
ref|WP_011131470.1|  phosphoglycerate kinase                            141   2e-52   
ref|WP_017294263.1|  phosphoglycerate kinase                            141   2e-52   
ref|WP_012194769.1|  phosphoglycerate kinase                            146   2e-52   
ref|WP_011365387.1|  phosphoglycerate kinase                            142   2e-52   
gb|AFH41155.1|  plastid 3-phosphoglycerate kinase                       175   2e-52   
gb|ACO40269.1|  3-phosphoglycerate kinase                               176   2e-52   
ref|WP_015204810.1|  phosphoglycerate kinase                            139   2e-52   
gb|ACO40271.1|  3-phosphoglycerate kinase                               176   2e-52   
gb|AFH41088.1|  plastid 3-phosphoglycerate kinase                       176   2e-52   
gb|ACO40272.1|  3-phosphoglycerate kinase                               176   2e-52   
gb|ACO40247.1|  3-phosphoglycerate kinase                               176   2e-52   
gb|ACO40274.1|  3-phosphoglycerate kinase                               176   2e-52   
ref|WP_017323648.1|  phosphoglycerate kinase                            140   3e-52   
gb|AFH41074.1|  plastid 3-phosphoglycerate kinase                       174   3e-52   
dbj|BAD94190.1|  phosphoglycerate kinase like protein                   128   3e-52   
gb|ACO40277.1|  3-phosphoglycerate kinase                               176   3e-52   
ref|WP_015218887.1|  phosphoglycerate kinase                            138   3e-52   
gb|KIZ02489.1|  phosphoglycerate kinase                                 143   3e-52   
gb|ACO40257.1|  3-phosphoglycerate kinase                               176   3e-52   
ref|WP_011360883.1|  phosphoglycerate kinase                            143   3e-52   
ref|WP_040940054.1|  phosphoglycerate kinase                            132   3e-52   
ref|WP_015145174.1|  phosphoglycerate kinase                            138   4e-52   
gb|AFH41084.1|  plastid 3-phosphoglycerate kinase                       174   4e-52   
ref|WP_009788740.1|  phosphoglycerate kinase                            143   4e-52   
ref|WP_006507734.1|  phosphoglycerate kinase                            147   4e-52   
gb|AFH41095.1|  plastid 3-phosphoglycerate kinase                       174   4e-52   
gb|ACO40262.1|  3-phosphoglycerate kinase                               175   4e-52   
gb|AFH41144.1|  plastid 3-phosphoglycerate kinase                       176   4e-52   
gb|AEQ59377.1|  3-phosphoglycerate kinase                               176   4e-52   
gb|ACO40261.1|  3-phosphoglycerate kinase                               176   4e-52   
gb|AEQ59408.1|  3-phosphoglycerate kinase                               176   5e-52   
gb|AGL91125.1|  3-phosphoglycerate kinase                               176   5e-52   
gb|AEQ59379.1|  3-phosphoglycerate kinase                               176   5e-52   
gb|AEQ59380.1|  3-phosphoglycerate kinase                               176   5e-52   
ref|WP_006042911.1|  phosphoglycerate kinase                            140   5e-52   
gb|ACO40268.1|  3-phosphoglycerate kinase                               175   5e-52   
ref|WP_017317549.1|  phosphoglycerate kinase                            138   5e-52   
gb|AEQ59398.1|  3-phosphoglycerate kinase                               175   5e-52   
gb|ACO40256.1|  3-phosphoglycerate kinase                               176   5e-52   
ref|WP_019502041.1|  phosphoglycerate kinase                            143   5e-52   
gb|AFH41073.1|  plastid 3-phosphoglycerate kinase                       174   5e-52   
ref|WP_015153171.1|  phosphoglycerate kinase                            135   6e-52   
gb|ACO40258.1|  3-phosphoglycerate kinase                               173   6e-52   
gb|AID16249.1|  phosphoglycerate kinase                                 173   6e-52   
gb|ACO40267.1|  3-phosphoglycerate kinase                               173   6e-52   
gb|AAM51708.1|AF343482_1  3-phosphoglycerate kinase                     173   7e-52   
ref|WP_017303631.1|  phosphoglycerate kinase                            138   7e-52   
gb|AFH41140.1|  plastid 3-phosphoglycerate kinase                       173   8e-52   
ref|WP_040931032.1|  phosphoglycerate kinase                            131   8e-52   
ref|WP_006854064.1|  phosphoglycerate kinase                            142   9e-52   
ref|WP_011934238.1|  phosphoglycerate kinase                            141   9e-52   
gb|ACO40276.1|  3-phosphoglycerate kinase                               176   1e-51   
gb|AID16246.1|  phosphoglycerate kinase                                 173   1e-51   
gb|AID16253.1|  phosphoglycerate kinase                                 172   1e-51   
gb|AEQ59407.1|  3-phosphoglycerate kinase                               174   1e-51   
gb|AEQ59375.1|  3-phosphoglycerate kinase                               174   1e-51   
gb|AFH41139.1|  plastid 3-phosphoglycerate kinase                       172   1e-51   
ref|WP_023076270.1|  phosphoglycerate kinase                            141   1e-51   
ref|WP_006173249.1|  phosphoglycerate kinase                            135   1e-51   
ref|WP_039715776.1|  phosphoglycerate kinase                            134   1e-51   
gb|AEQ59383.1|  3-phosphoglycerate kinase                               176   1e-51   
gb|AEQ59415.1|  3-phosphoglycerate kinase                               174   1e-51   
gb|AFH41124.1|  plastid 3-phosphoglycerate kinase                       174   1e-51   
ref|WP_015193656.1|  phosphoglycerate kinase                            145   1e-51   
gb|AFY38465.1|  phosphoglycerate kinase                                 137   1e-51   
gb|AGL91123.1|  3-phosphoglycerate kinase                               174   2e-51   
gb|AID16261.1|  phosphoglycerate kinase                                 173   2e-51   
ref|WP_041765481.1|  phosphoglycerate kinase                            137   2e-51   
gb|ACO40270.1|  3-phosphoglycerate kinase                               174   2e-51   
gb|ACO40273.1|  3-phosphoglycerate kinase                               173   2e-51   
gb|AEQ59378.1|  3-phosphoglycerate kinase                               174   2e-51   
gb|ACO40241.1|  3-phosphoglycerate kinase                               174   2e-51   
gb|AGL91128.1|  3-phosphoglycerate kinase                               173   2e-51   
ref|WP_035157181.1|  phosphoglycerate kinase                            143   2e-51   
ref|WP_015785332.1|  MULTISPECIES: phosphoglycerate kinase              136   2e-51   
gb|ACO40243.1|  3-phosphoglycerate kinase                               174   2e-51   
gb|AGH55660.1|  phosphoglycerate kinase                                 167   2e-51   
gb|ACO40251.1|  3-phosphoglycerate kinase                               173   2e-51   
gb|AGL91113.1|  3-phosphoglycerate kinase                               174   2e-51   
gb|AGL91045.1|  3-phosphoglycerate kinase                               174   2e-51   
ref|XP_005646469.1|  phosphoglycerate kinase precursor                  140   2e-51   
gb|ACO40239.1|  3-phosphoglycerate kinase                               174   2e-51   
gb|AGL91103.1|  3-phosphoglycerate kinase                               173   2e-51   
gb|AAM51720.1|AF343494_1  3-phosphoglycerate kinase                     173   2e-51   
gb|AGL91127.1|  3-phosphoglycerate kinase                               174   2e-51   
gb|AGL91108.1|  3-phosphoglycerate kinase                               173   2e-51   
ref|WP_036901530.1|  phosphoglycerate kinase                            141   2e-51   
gb|ACO40264.1|  3-phosphoglycerate kinase                               174   2e-51   
ref|WP_008234716.1|  phosphoglycerate kinase                            139   2e-51   
ref|WP_022604954.1|  phosphoglycerate kinase                            128   2e-51   
gb|AEQ59399.1|  3-phosphoglycerate kinase                               173   2e-51   
gb|AEQ59384.1|  3-phosphoglycerate kinase                               173   2e-51   
gb|AEQ59418.1|  3-phosphoglycerate kinase                               173   2e-51   
gb|ACO40255.1|  3-phosphoglycerate kinase                               173   2e-51   
ref|WP_028947361.1|  phosphoglycerate kinase                            146   2e-51   
gb|ACO40254.1|  3-phosphoglycerate kinase                               173   2e-51   
gb|AEQ59427.1|  3-phosphoglycerate kinase                               173   3e-51   
gb|AGL91112.1|  3-phosphoglycerate kinase                               173   3e-51   
gb|AEQ59412.1|  3-phosphoglycerate kinase                               173   3e-51   
gb|AEQ59386.1|  3-phosphoglycerate kinase                               173   3e-51   
gb|ACO40259.1|  3-phosphoglycerate kinase                               173   3e-51   
ref|WP_019495207.1|  phosphoglycerate kinase                            142   3e-51   
gb|AEQ59435.1|  3-phosphoglycerate kinase                               173   3e-51   
gb|AEQ59432.1|  3-phosphoglycerate kinase                               173   3e-51   
gb|AEQ59422.1|  3-phosphoglycerate kinase                               173   3e-51   
gb|AEQ59434.1|  3-phosphoglycerate kinase                               173   3e-51   
gb|AEQ59417.1|  3-phosphoglycerate kinase                               173   3e-51   
ref|WP_009631644.1|  phosphoglycerate kinase                            138   3e-51   
gb|AEQ59436.1|  3-phosphoglycerate kinase                               173   3e-51   
gb|AEQ59413.1|  3-phosphoglycerate kinase                               173   3e-51   
ref|XP_001699523.1|  phosphoglycerate kinase                            143   3e-51   
gb|AEQ59382.1|  3-phosphoglycerate kinase                               173   3e-51   
gb|AEQ59403.1|  3-phosphoglycerate kinase                               172   3e-51   
gb|ACO40260.1|  3-phosphoglycerate kinase                               176   3e-51   
gb|AEQ59402.1|  3-phosphoglycerate kinase                               172   4e-51   
ref|WP_038547249.1|  phosphoglycerate kinase                            137   4e-51   
gb|AGL91121.1|  3-phosphoglycerate kinase                               173   4e-51   
gb|AGL91124.1|  3-phosphoglycerate kinase                               173   4e-51   
gb|AEQ59420.1|  3-phosphoglycerate kinase                               172   4e-51   
ref|WP_015198799.1|  phosphoglycerate kinase                            144   4e-51   
ref|WP_012598967.1|  phosphoglycerate kinase                            135   4e-51   
ref|WP_011124376.1|  MULTISPECIES: phosphoglycerate kinase              135   4e-51   
ref|WP_036916478.1|  MULTISPECIES: phosphoglycerate kinase              139   5e-51   
gb|KGG11463.1|  Phosphoglycerate kinase                                 135   5e-51   
gb|AFH41106.1|  plastid 3-phosphoglycerate kinase                       170   5e-51   
gb|ACO40249.1|  3-phosphoglycerate kinase                               172   6e-51   
gb|AGL91129.1|  3-phosphoglycerate kinase                               172   6e-51   
gb|ACO40263.1|  3-phosphoglycerate kinase                               172   6e-51   
gb|EMS46092.1|  Phosphoglycerate kinase, cytosolic                      157   6e-51   
gb|ACO40266.1|  3-phosphoglycerate kinase                               172   7e-51   
ref|YP_002049002.1|  Phosphoglycerate kinase                            139   7e-51   
gb|AGL91104.1|  3-phosphoglycerate kinase                               171   7e-51   
ref|WP_006911676.1|  phosphoglycerate kinase                            134   8e-51   
gb|AEQ59396.1|  3-phosphoglycerate kinase                               173   8e-51   
gb|AEQ59411.1|  3-phosphoglycerate kinase                               171   8e-51   
gb|AEQ59414.1|  3-phosphoglycerate kinase                               171   9e-51   
gb|EWM26407.1|  phosphoglycerate kinase                                 139   1e-50   
gb|AGL91126.1|  3-phosphoglycerate kinase                               170   1e-50   
gb|ACO40242.1|  3-phosphoglycerate kinase                               170   1e-50   
gb|AEQ59421.1|  3-phosphoglycerate kinase                               171   1e-50   
gb|AAM51719.1|AF343493_1  3-phosphoglycerate kinase                     172   1e-50   
ref|WP_011429225.1|  phosphoglycerate kinase                            138   1e-50   
gb|AEQ59431.1|  3-phosphoglycerate kinase                               171   1e-50   
ref|WP_019507461.1|  phosphoglycerate kinase                            142   2e-50   
gb|AEQ59387.1|  3-phosphoglycerate kinase                               170   2e-50   
ref|WP_007352879.1|  MULTISPECIES: phosphoglycerate kinase              143   2e-50   
gb|AEQ59393.1|  3-phosphoglycerate kinase                               170   2e-50   
gb|AEQ59392.1|  3-phosphoglycerate kinase                               170   2e-50   
gb|AEQ59391.1|  3-phosphoglycerate kinase                               170   3e-50   
gb|AEQ59430.1|  3-phosphoglycerate kinase                               169   3e-50   
gb|AGL76992.1|  phosphoglycerate kinase                                 164   3e-50   
gb|AEQ59409.1|  3-phosphoglycerate kinase                               171   4e-50   
gb|ACO40245.1|  3-phosphoglycerate kinase                               171   4e-50   
ref|XP_002951648.1|  phosphoglycerate kinase                            137   5e-50   
gb|AEQ59423.1|  3-phosphoglycerate kinase                               169   5e-50   
gb|ACO40279.1|  3-phosphoglycerate kinase                               169   5e-50   
ref|WP_030007016.1|  phosphoglycerate kinase                            135   6e-50   
ref|WP_006515662.1|  phosphoglycerate kinase                            141   7e-50   
gb|KCW71391.1|  hypothetical protein EUGRSUZ_F04463                     169   7e-50   
ref|WP_036484843.1|  phosphoglycerate kinase                            139   9e-50   
ref|WP_012307199.1|  phosphoglycerate kinase                            134   9e-50   
emb|CDP13575.1|  unnamed protein product                                159   1e-49   
ref|XP_005851590.1|  hypothetical protein CHLNCDRAFT_29609              141   1e-49   
ref|WP_026101118.1|  phosphoglycerate kinase                            140   1e-49   
ref|WP_034417079.1|  phosphoglycerate kinase                            132   3e-49   
ref|WP_006278490.1|  phosphoglycerate kinase                            129   3e-49   
ref|WP_011433296.1|  phosphoglycerate kinase                            134   3e-49   
ref|WP_024545807.1|  phosphoglycerate kinase                            132   4e-49   
ref|WP_009343450.1|  phosphoglycerate kinase                            134   4e-49   
ref|WP_042152714.1|  phosphoglycerate kinase                            141   5e-49   
ref|WP_036904641.1|  phosphoglycerate kinase                            132   5e-49   
ref|WP_011317630.1|  phosphoglycerate kinase                            150   7e-49   
ref|WP_008311068.1|  phosphoglycerate kinase                            122   8e-49   
gb|KIJ83619.1|  phosphoglycerate kinase                                 144   8e-49   
sp|P41758.1|PGKH_CHLRE  RecName: Full=Phosphoglycerate kinase, ch...    134   1e-48   
ref|WP_011823052.1|  phosphoglycerate kinase                            131   1e-48   
ref|WP_027404640.1|  phosphoglycerate kinase                            131   1e-48   
ref|WP_015110302.1|  phosphoglycerate kinase                            126   1e-48   
ref|XP_001777571.1|  predicted protein                                  135   1e-48   
ref|WP_039205250.1|  phosphoglycerate kinase                            131   1e-48   
ref|WP_010998270.1|  phosphoglycerate kinase                            149   2e-48   
ref|XP_011396717.1|  Phosphoglycerate kinase, chloroplastic             138   2e-48   
ref|WP_011294195.1|  phosphoglycerate kinase                            130   2e-48   
ref|WP_038650981.1|  phosphoglycerate kinase                            129   2e-48   
ref|WP_037220338.1|  phosphoglycerate kinase                            147   3e-48   
ref|WP_007101320.1|  phosphoglycerate kinase                            125   4e-48   
ref|WP_010305334.1|  phosphoglycerate kinase                            125   4e-48   
ref|WP_015080710.1|  phosphoglycerate kinase                            129   5e-48   
ref|WP_015162225.1|  phosphoglycerate kinase                            133   6e-48   
ref|WP_010313479.1|  phosphoglycerate kinase                            125   7e-48   
ref|WP_012412172.1|  phosphoglycerate kinase                            148   7e-48   
ref|WP_015224558.1|  phosphoglycerate kinase                            124   9e-48   
ref|WP_015173530.1|  phosphoglycerate kinase                            120   9e-48   
ref|WP_025943278.1|  phosphoglycerate kinase                            136   1e-47   
ref|WP_025934740.1|  phosphoglycerate kinase                            135   1e-47   
ref|WP_025943564.1|  MULTISPECIES: phosphoglycerate kinase              136   2e-47   
ref|WP_025924106.1|  phosphoglycerate kinase                            135   2e-47   
ref|WP_025913196.1|  MULTISPECIES: phosphoglycerate kinase              135   2e-47   
ref|WP_025962791.1|  phosphoglycerate kinase                            135   2e-47   
ref|WP_011817688.1|  MULTISPECIES: phosphoglycerate kinase              135   2e-47   
ref|WP_025934229.1|  phosphoglycerate kinase                            135   2e-47   
ref|WP_025925003.1|  MULTISPECIES: phosphoglycerate kinase              135   2e-47   
ref|WP_025968960.1|  phosphoglycerate kinase                            135   2e-47   
ref|WP_025963501.1|  phosphoglycerate kinase                            135   2e-47   
ref|WP_032517310.1|  phosphoglycerate kinase                            135   2e-47   
ref|WP_042849696.1|  phosphoglycerate kinase                            135   2e-47   
ref|WP_025922800.1|  phosphoglycerate kinase                            135   2e-47   
ref|WP_025906011.1|  MULTISPECIES: phosphoglycerate kinase              135   2e-47   
ref|WP_012007002.1|  phosphoglycerate kinase                            135   2e-47   
ref|WP_025942147.1|  phosphoglycerate kinase                            135   2e-47   
ref|WP_002806351.1|  phosphoglycerate kinase                            135   2e-47   
ref|WP_012626442.1|  phosphoglycerate kinase                            120   3e-47   
gb|KEH15368.1|  phosphoglycerate kinase-like protein                    167   3e-47   
ref|WP_011612823.1|  phosphoglycerate kinase                            138   4e-47   
ref|WP_011375763.1|  phosphoglycerate kinase                            134   4e-47   
ref|WP_032526506.1|  phosphoglycerate kinase                            133   4e-47   
ref|WP_025927303.1|  MULTISPECIES: phosphoglycerate kinase              135   4e-47   
ref|WP_025965230.1|  phosphoglycerate kinase                            134   4e-47   
ref|WP_025922089.1|  MULTISPECIES: phosphoglycerate kinase              134   5e-47   



>ref|XP_008456300.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Cucumis melo]
Length=485

 Score =   182 bits (462),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAKAKGVSLLLPTDV+IADKFAPDANSK+VPASAIPDGWMGLDIGPD
Sbjct  323  EEDKLELATSLLEKAKAKGVSLLLPTDVIIADKFAPDANSKIVPASAIPDGWMGLDIGPD  382

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT NDAL+TT+T+IWNGPMGVFEFDKFAVGTE++
Sbjct  383  SVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTEAI  418


 Score =   121 bits (304),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 64/66 (97%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALD
Sbjct  419  AKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALD  478

Query  273  EAVPVA  256
            EAVPVA
Sbjct  479  EAVPVA  484



>ref|XP_004139904.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004154567.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN46797.1| hypothetical protein Csa_6G136020 [Cucumis sativus]
Length=485

 Score =   182 bits (463),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAKAKGVSLLLPTDV+IADKFAPDANSK+VPASAIPDGWMGLDIGPD
Sbjct  323  EEDKLELATSLLEKAKAKGVSLLLPTDVIIADKFAPDANSKIVPASAIPDGWMGLDIGPD  382

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT NDAL+TT+T+IWNGPMGVFEFDKFAVGTE++
Sbjct  383  SVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTEAI  418


 Score =   120 bits (301),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 63/66 (95%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVGVA+VMSHISTGGGASLELLEGKELPGV+ALD
Sbjct  419  AKKLAELSGKGVTTIIGGGDSVAAVEKVGVANVMSHISTGGGASLELLEGKELPGVLALD  478

Query  273  EAVPVA  256
            EAVPVA
Sbjct  479  EAVPVA  484



>ref|XP_011095719.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Sesamum indicum]
Length=481

 Score =   184 bits (468),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 91/96 (95%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD
Sbjct  319  EEDKLELATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  378

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT +DALETTKTVIWNGPMGVFEFDKFAVGTE++
Sbjct  379  SVKTFSDALETTKTVIWNGPMGVFEFDKFAVGTEAI  414


 Score =   118 bits (295),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 62/66 (94%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            + KLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALD
Sbjct  415  ANKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALD  474

Query  273  EAVPVA  256
            EA PVA
Sbjct  475  EATPVA  480



>gb|KJB14025.1| hypothetical protein B456_002G107300 [Gossypium raimondii]
Length=491

 Score =   179 bits (455),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAKAKGVSLLLPTDVVIADKFAPDANSK+VPASAIPDGWMGLDIGPD
Sbjct  326  EEDKLELATSLLAKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPD  385

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT N+AL+TT+T+IWNGPMGVFEFDKFAVGTE++
Sbjct  386  SVKTFNEALDTTQTIIWNGPMGVFEFDKFAVGTEAI  421


 Score =   120 bits (301),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 64/66 (97%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGVIALD
Sbjct  422  AKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVIALD  481

Query  273  EAVPVA  256
            EAVPVA
Sbjct  482  EAVPVA  487



>gb|KJB14026.1| hypothetical protein B456_002G107300 [Gossypium raimondii]
Length=488

 Score =   179 bits (454),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAKAKGVSLLLPTDVVIADKFAPDANSK+VPASAIPDGWMGLDIGPD
Sbjct  326  EEDKLELATSLLAKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPD  385

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT N+AL+TT+T+IWNGPMGVFEFDKFAVGTE++
Sbjct  386  SVKTFNEALDTTQTIIWNGPMGVFEFDKFAVGTEAI  421


 Score =   120 bits (301),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 64/66 (97%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGVIALD
Sbjct  422  AKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVIALD  481

Query  273  EAVPVA  256
            EAVPVA
Sbjct  482  EAVPVA  487



>gb|KDP25067.1| hypothetical protein JCGZ_22602 [Jatropha curcas]
Length=487

 Score =   181 bits (460),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDANSKVVPASAIPDGWMGLDIGP+
Sbjct  325  EEDKLNLATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPE  384

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT ++ALETTKTVIWNGPMGVFEFDKFAVGTE++
Sbjct  385  SVKTFSEALETTKTVIWNGPMGVFEFDKFAVGTEAI  420


 Score =   118 bits (295),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 62/66 (94%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALD
Sbjct  421  AKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVLALD  480

Query  273  EAVPVA  256
            EA PVA
Sbjct  481  EATPVA  486



>ref|XP_011086346.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Sesamum indicum]
Length=481

 Score =   182 bits (461),  Expect(2) = 6e-72, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAKAKGVSLLLPTDVVIADKFAPDA SKVVPASAIPDGWMGLDIGPD
Sbjct  319  EEDKLDLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAESKVVPASAIPDGWMGLDIGPD  378

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT +DALETTKTVIWNGPMGVFEFDKFAVGTE++
Sbjct  379  SVKTFSDALETTKTVIWNGPMGVFEFDKFAVGTEAI  414


 Score =   117 bits (292),  Expect(2) = 6e-72, Method: Compositional matrix adjust.
 Identities = 61/66 (92%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            + KLAELSGKGVTTIIGGGDSVAAVEKVGVA+VMSHISTGGGASLELLEGKELPGV+ALD
Sbjct  415  ANKLAELSGKGVTTIIGGGDSVAAVEKVGVANVMSHISTGGGASLELLEGKELPGVLALD  474

Query  273  EAVPVA  256
            EA PVA
Sbjct  475  EATPVA  480



>gb|KHG01489.1| hypothetical protein F383_22605 [Gossypium arboreum]
Length=488

 Score =   178 bits (451),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAKAKGVSLLLPTDVVIADKFAPDANSK+VPASAIPDGWMGLDIGPD
Sbjct  326  EEDKLELATSLLAKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPD  385

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT N+AL+TT+T+IWNGPMGVFEF+KFAVGTE++
Sbjct  386  SVKTFNEALDTTQTIIWNGPMGVFEFEKFAVGTEAI  421


 Score =   120 bits (301),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 64/66 (97%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGVIALD
Sbjct  422  AKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVIALD  481

Query  273  EAVPVA  256
            EAVPVA
Sbjct  482  EAVPVA  487



>ref|XP_004306579.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Fragaria 
vesca subsp. vesca]
Length=480

 Score =   178 bits (451),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+ KAKAKGVSLLLPTDVVIADKFAPDANSK+VPAS+IPDGWMGLDIGPD
Sbjct  318  EEDKLELATSLIAKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASSIPDGWMGLDIGPD  377

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT NDAL+TT+T+IWNGPMGVFEFDKFAVGTE++
Sbjct  378  SIKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTEAI  413


 Score =   120 bits (300),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALD
Sbjct  414  AKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALD  473

Query  273  EAVPV  259
            EAVPV
Sbjct  474  EAVPV  478



>ref|XP_008383150.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Malus 
domestica]
Length=480

 Score =   177 bits (449),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+ KA AKGVSLLLPTDVVIADKFAPDANSK+VPAS+IPDGWMGLDIGPD
Sbjct  318  EEDKLELATSLMAKANAKGVSLLLPTDVVIADKFAPDANSKIVPASSIPDGWMGLDIGPD  377

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT NDAL+TTKT+IWNGPMGVFEFDKFA GTESV
Sbjct  378  SIKTFNDALDTTKTIIWNGPMGVFEFDKFAEGTESV  413


 Score =   120 bits (300),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            +S +KKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+
Sbjct  411  ESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVL  470

Query  282  ALDEAVPV  259
            ALDEA PV
Sbjct  471  ALDEATPV  478



>ref|XP_008349091.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Malus 
domestica]
Length=480

 Score =   179 bits (454),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+ KAKAKGVSLLLPTDVVIADKFAPDANSK+VPAS+IPDGWMGLDIGPD
Sbjct  318  EEDKLELATSLMAKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASSIPDGWMGLDIGPD  377

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT NDAL+TTKT+IWNGPMGVFEFDKFA GTESV
Sbjct  378  SIKTFNDALDTTKTIIWNGPMGVFEFDKFAEGTESV  413


 Score =   117 bits (292),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 61/66 (92%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            +S +KKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+
Sbjct  411  ESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVL  470

Query  282  ALDEAV  265
            ALDEA+
Sbjct  471  ALDEAI  476



>ref|XP_010269369.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Nelumbo 
nucifera]
Length=486

 Score =   179 bits (455),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAK+KGVSLLLP+DVV+ADKFAPDANSK+VPASAIPDGWMGLDIGPD
Sbjct  324  EEDKLDLATSLLEKAKSKGVSLLLPSDVVVADKFAPDANSKIVPASAIPDGWMGLDIGPD  383

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT N+AL+TTKT+IWNGPMGVFEFDKFAVGTE+V
Sbjct  384  SIKTFNEALDTTKTIIWNGPMGVFEFDKFAVGTEAV  419


 Score =   116 bits (291),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+
Sbjct  417  EAVAKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVL  476

Query  282  ALDEAVPVA  256
            ALDEAV VA
Sbjct  477  ALDEAVAVA  485



>ref|XP_008346077.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Malus domestica]
Length=480

 Score =   179 bits (454),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+ KAKAKGVSLLLPTDVVIADKFAPDANSK+VPAS+IPDGWMGLDIGPD
Sbjct  318  EEDKLELATSLMAKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASSIPDGWMGLDIGPD  377

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT NDAL+TTKT+IWNGPMGVFEFDKFA GTESV
Sbjct  378  SIKTFNDALDTTKTIIWNGPMGVFEFDKFAEGTESV  413


 Score =   116 bits (291),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 61/66 (92%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            +S +KKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+
Sbjct  411  ESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVL  470

Query  282  ALDEAV  265
            ALDEA+
Sbjct  471  ALDEAI  476



>ref|XP_008371996.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Malus 
domestica]
Length=480

 Score =   179 bits (454),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+ KAKAKGVSLLLPTDVVIADKFAPDANSK+VPAS+IPDGWMGLDIGPD
Sbjct  318  EEDKLELATSLMAKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASSIPDGWMGLDIGPD  377

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT NDAL+TTKT+IWNGPMGVFEFDKFA GTESV
Sbjct  378  SIKTFNDALDTTKTIIWNGPMGVFEFDKFAEGTESV  413


 Score =   117 bits (292),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 61/66 (92%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            +S +KKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+
Sbjct  411  ESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVL  470

Query  282  ALDEAV  265
            ALDEA+
Sbjct  471  ALDEAI  476



>ref|XP_004488763.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Cicer 
arietinum]
Length=479

 Score =   177 bits (449),  Expect(2) = 5e-71, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT+LL KAKAKGVSLLLP+DVVIADKFAPDANS+VVPASAIPDGWMGLDIGPD
Sbjct  317  EEDKLELATTLLAKAKAKGVSLLLPSDVVIADKFAPDANSQVVPASAIPDGWMGLDIGPD  376

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT N+AL+TTKT+IWNGPMGVFEFDKFAVGTE++
Sbjct  377  SIKTFNEALDTTKTIIWNGPMGVFEFDKFAVGTEAI  412


 Score =   118 bits (296),  Expect(2) = 5e-71, Method: Compositional matrix adjust.
 Identities = 62/66 (94%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALD
Sbjct  413  AKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALD  472

Query  273  EAVPVA  256
            EA PVA
Sbjct  473  EATPVA  478



>ref|XP_008226130.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Prunus mume]
Length=480

 Score =   176 bits (446),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+ KAKAKGVSLLLPTDVVIADKFAPDANSK+VPAS+IPDGWMGLDIGPD
Sbjct  318  EEDKLELATSLIAKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASSIPDGWMGLDIGPD  377

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT N+AL+TT+T+IWNGPMGVFEFDKFA GTESV
Sbjct  378  SIKTFNEALDTTQTIIWNGPMGVFEFDKFAEGTESV  413


 Score =   119 bits (298),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            +S +KKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK+LPGV+
Sbjct  411  ESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKQLPGVL  470

Query  282  ALDEAVPV  259
            ALDEA PV
Sbjct  471  ALDEATPV  478



>ref|XP_009763674.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Nicotiana 
sylvestris]
Length=481

 Score =   183 bits (465),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDANSK+VPASAIPDGWMGLDIGPD
Sbjct  318  EEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPD  377

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT NDAL+TTKTVIWNGPMGVFEFDKFAVGTE++
Sbjct  378  SVKTFNDALDTTKTVIWNGPMGVFEFDKFAVGTEAI  413


 Score =   111 bits (278),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 62/67 (93%), Positives = 64/67 (96%), Gaps = 1/67 (1%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LPGVIALD
Sbjct  414  AKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVIALD  473

Query  273  EA-VPVA  256
            EA  PVA
Sbjct  474  EADAPVA  480



>sp|Q42961.1|PGKH_TOBAC RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA88841.1| phosphoglycerate kinase [Nicotiana tabacum]
Length=481

 Score =   183 bits (465),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDANSK+VPASAIPDGWMGLDIGPD
Sbjct  318  EEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPD  377

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT NDAL+TTKTVIWNGPMGVFEFDKFAVGTE++
Sbjct  378  SVKTFNDALDTTKTVIWNGPMGVFEFDKFAVGTEAI  413


 Score =   111 bits (278),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 62/67 (93%), Positives = 64/67 (96%), Gaps = 1/67 (1%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LPGVIALD
Sbjct  414  AKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVIALD  473

Query  273  EA-VPVA  256
            EA  PVA
Sbjct  474  EADAPVA  480



>ref|XP_009622055.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Nicotiana 
tomentosiformis]
Length=481

 Score =   183 bits (465),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDANSK+VPASAIPDGWMGLDIGPD
Sbjct  318  EEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPD  377

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT NDAL+TTKTVIWNGPMGVFEFDKFAVGTE++
Sbjct  378  SVKTFNDALDTTKTVIWNGPMGVFEFDKFAVGTEAI  413


 Score =   111 bits (278),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 62/67 (93%), Positives = 64/67 (96%), Gaps = 1/67 (1%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LPGVIALD
Sbjct  414  AKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVIALD  473

Query  273  EA-VPVA  256
            EA  PVA
Sbjct  474  EADAPVA  480



>ref|XP_003596091.1| Phosphoglycerate kinase [Medicago truncatula]
 gb|AES66342.1| phosphoglycerate kinase-like protein [Medicago truncatula]
Length=479

 Score =   175 bits (444),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT+L+ KAKAKGVSLLLP+DVVIADKFAPDANS++VPASAIPDGWMGLDIGPD
Sbjct  317  EEDKLELATTLIAKAKAKGVSLLLPSDVVIADKFAPDANSQIVPASAIPDGWMGLDIGPD  376

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT N+AL+TT+T+IWNGPMGVFEFDKFAVGTES+
Sbjct  377  SIKTFNEALDTTQTIIWNGPMGVFEFDKFAVGTESI  412


 Score =   119 bits (297),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            +S +KKLA+LSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+
Sbjct  410  ESIAKKLADLSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVL  469

Query  282  ALDEAVPVA  256
            ALDEA PVA
Sbjct  470  ALDEATPVA  478



>ref|XP_007213965.1| hypothetical protein PRUPE_ppa005031mg [Prunus persica]
 gb|EMJ15164.1| hypothetical protein PRUPE_ppa005031mg [Prunus persica]
Length=480

 Score =   176 bits (446),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+ KAKAKGVSLLLPTDVVIADKFAPDANSK+VPAS+IPDGWMGLDIGPD
Sbjct  318  EEDKLELATSLIAKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASSIPDGWMGLDIGPD  377

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT N+AL+TT+T+IWNGPMGVFEFDKFA GTESV
Sbjct  378  SIKTFNEALDTTQTIIWNGPMGVFEFDKFAEGTESV  413


 Score =   118 bits (295),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            +S +KKLAELSGKGVTTIIGGGDSVAAVEKVGVA+VMSHISTGGGASLELLEGK+LPGV+
Sbjct  411  ESVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVANVMSHISTGGGASLELLEGKQLPGVL  470

Query  282  ALDEAVPV  259
            ALDEA PV
Sbjct  471  ALDEATPV  478



>ref|XP_003531482.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Glycine 
max]
Length=485

 Score =   173 bits (439),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAK KGVSLLLP+DVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD
Sbjct  323  EEDKLDLATSLLAKAKEKGVSLLLPSDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  382

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVK+ ++AL+TT+T+IWNGPMGVFEFDKFAVGTE++
Sbjct  383  SVKSFSEALDTTQTIIWNGPMGVFEFDKFAVGTEAI  418


 Score =   120 bits (300),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 63/66 (95%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALD
Sbjct  419  AKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALD  478

Query  273  EAVPVA  256
            EAVPVA
Sbjct  479  EAVPVA  484



>ref|XP_002513353.1| phosphoglycerate kinase, putative [Ricinus communis]
 gb|EEF48756.1| phosphoglycerate kinase, putative [Ricinus communis]
Length=479

 Score =   175 bits (444),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAK KGVSLLLPTDVVIADKFAPDANSKVV ASAIPDGWMGLD+GP+
Sbjct  317  EEDKLDLATSLLAKAKLKGVSLLLPTDVVIADKFAPDANSKVVAASAIPDGWMGLDVGPE  376

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT N+ALETTKTVIWNGPMGVFEFDKFAVGTE++
Sbjct  377  SVKTFNEALETTKTVIWNGPMGVFEFDKFAVGTEAI  412


 Score =   118 bits (295),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 62/66 (94%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALD
Sbjct  413  AKKLAELSGKGVTTIIGGGDSVAAVEKVGVAEVMSHISTGGGASLELLEGKELPGVLALD  472

Query  273  EAVPVA  256
            EA PVA
Sbjct  473  EATPVA  478



>gb|ADR71054.1| phosphoglycerate kinase [Nicotiana benthamiana]
Length=481

 Score =   183 bits (464),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDANSK+VPASAIPDGWMGLDIGPD
Sbjct  318  EEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPD  377

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT NDAL+TTKTVIWNGPMGVFEFDKFAVGTE++
Sbjct  378  SVKTFNDALDTTKTVIWNGPMGVFEFDKFAVGTEAI  413


 Score =   110 bits (275),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LPGV+ALD
Sbjct  414  AKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVVALD  473

Query  273  EA  268
            EA
Sbjct  474  EA  475



>ref|XP_003546820.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Glycine max]
Length=483

 Score =   173 bits (439),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAK KGVSLLLP+DVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD
Sbjct  321  EEDKLDLATSLLAKAKEKGVSLLLPSDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  380

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVK+ ++AL+TT+T+IWNGPMGVFEFDKFAVGTE++
Sbjct  381  SVKSFSEALDTTQTIIWNGPMGVFEFDKFAVGTEAI  416


 Score =   120 bits (300),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 63/66 (95%), Positives = 66/66 (100%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALD
Sbjct  417  AKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALD  476

Query  273  EAVPVA  256
            EAVPVA
Sbjct  477  EAVPVA  482



>ref|XP_010060861.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Eucalyptus 
grandis]
 gb|KCW67742.1| hypothetical protein EUGRSUZ_F01476 [Eucalyptus grandis]
Length=484

 Score =   180 bits (456),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL+KAKAKGVSLLLPTDVVIADKFAPDANSK+VPASAIPDGWMGLDIGPD
Sbjct  322  EEDKLDLATSLLKKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPD  381

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT NDAL TTKTVIWNGPMGVFEFDKFA GTE+V
Sbjct  382  SIKTFNDALGTTKTVIWNGPMGVFEFDKFAAGTEAV  417


 Score =   113 bits (282),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAELS  GVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+
Sbjct  415  EAVAKKLAELSAAGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVV  474

Query  282  ALDEAVPV  259
            ALDEA PV
Sbjct  475  ALDEATPV  482



>ref|XP_010094703.1| Phosphoglycerate kinase [Morus notabilis]
 gb|EXB56749.1| Phosphoglycerate kinase [Morus notabilis]
Length=478

 Score =   174 bits (441),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT+LL KAKAKGVSLLLP+DVVIADKFAPDANSK+VP+SAIPDGWMGLDIGPD
Sbjct  316  EEDKLDLATTLLAKAKAKGVSLLLPSDVVIADKFAPDANSKIVPSSAIPDGWMGLDIGPD  375

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TTKT+IWNGPMGVFEFDKFAVGTE++
Sbjct  376  SIKTFSEALDTTKTIIWNGPMGVFEFDKFAVGTEAI  411


 Score =   119 bits (297),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 62/66 (94%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALD
Sbjct  412  AKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALD  471

Query  273  EAVPVA  256
            EA PVA
Sbjct  472  EATPVA  477



>ref|XP_008786111.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Phoenix dactylifera]
Length=491

 Score =   173 bits (438),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAK++GVSL+LPTDVV+ADKFAPDAN+KVVP++AIPDGWMGLDIGPD
Sbjct  329  EEDKLELATSLLVKAKSRGVSLMLPTDVVVADKFAPDANTKVVPSTAIPDGWMGLDIGPD  388

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVK+ +DALETTKTVIWNGPMGVFEFDKFAVGTE++
Sbjct  389  SVKSFSDALETTKTVIWNGPMGVFEFDKFAVGTEAI  424


 Score =   119 bits (299),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+
Sbjct  422  EAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVV  481

Query  282  ALDEAVPVA  256
            ALDEAVPVA
Sbjct  482  ALDEAVPVA  490



>gb|KDO61594.1| hypothetical protein CISIN_1g011942mg [Citrus sinensis]
Length=474

 Score =   176 bits (446),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT+LL KAKAKGV+LLLP+DVVIADKFAPDANSKVVPA+AIPDGWMGLDIGPD
Sbjct  312  EEDKLDLATTLLAKAKAKGVNLLLPSDVVIADKFAPDANSKVVPATAIPDGWMGLDIGPD  371

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT N+AL+TTKTVIWNGPMGVFEFDKFAVGTE++
Sbjct  372  SVKTFNEALDTTKTVIWNGPMGVFEFDKFAVGTEAI  407


 Score =   116 bits (291),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 61/66 (92%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLA+LSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALD
Sbjct  408  AKKLADLSGKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKELPGVVALD  467

Query  273  EAVPVA  256
            EA PVA
Sbjct  468  EATPVA  473



>ref|XP_006422251.1| hypothetical protein CICLE_v10004891mg [Citrus clementina]
 ref|XP_006493789.1| PREDICTED: phosphoglycerate kinase 2, chloroplastic-like [Citrus 
sinensis]
 gb|ESR35491.1| hypothetical protein CICLE_v10004891mg [Citrus clementina]
Length=474

 Score =   176 bits (446),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT+LL KAKAKGV+LLLP+DVVIADKFAPDANSKVVPA+AIPDGWMGLDIGPD
Sbjct  312  EEDKLDLATTLLAKAKAKGVNLLLPSDVVIADKFAPDANSKVVPATAIPDGWMGLDIGPD  371

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT N+AL+TTKTVIWNGPMGVFEFDKFAVGTE++
Sbjct  372  SVKTFNEALDTTKTVIWNGPMGVFEFDKFAVGTEAI  407


 Score =   116 bits (291),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 61/66 (92%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLA+LSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALD
Sbjct  408  AKKLADLSGKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKELPGVVALD  467

Query  273  EAVPVA  256
            EA PVA
Sbjct  468  EATPVA  473



>ref|XP_010936574.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Elaeis guineensis]
Length=490

 Score =   173 bits (438),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL+KAK+KGVSL+LPTDVVIADKFA DANSKVVP++AIPDGWMGLDIGPD
Sbjct  328  EEDKLELATSLLKKAKSKGVSLMLPTDVVIADKFAADANSKVVPSTAIPDGWMGLDIGPD  387

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVK+ +DALETTKTVIWNGPMGVFEF+KFAVGTE++
Sbjct  388  SVKSFSDALETTKTVIWNGPMGVFEFEKFAVGTEAI  423


 Score =   119 bits (298),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 62/66 (94%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTT+IGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALD
Sbjct  424  AKKLAELSGKGVTTVIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALD  483

Query  273  EAVPVA  256
            EAVPVA
Sbjct  484  EAVPVA  489



>ref|XP_004243968.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Solanum lycopersicum]
Length=482

 Score =   180 bits (457),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDANSK+VPASAIPDGWMGLDIGPD
Sbjct  319  EEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPD  378

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT NDAL+TTKTVIWNGPMGVFEFDKFA GTE++
Sbjct  379  SIKTFNDALDTTKTVIWNGPMGVFEFDKFATGTEAI  414


 Score =   111 bits (278),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 62/67 (93%), Positives = 64/67 (96%), Gaps = 1/67 (1%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LPGVIALD
Sbjct  415  AKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVIALD  474

Query  273  EA-VPVA  256
            EA  PVA
Sbjct  475  EADAPVA  481



>ref|XP_008805983.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Phoenix dactylifera]
 ref|XP_008776889.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Phoenix dactylifera]
Length=488

 Score =   172 bits (436),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL+KAK+KGVSL+LP DVVIADKFA DANSKVVP++AIPDGWMGLDIGPD
Sbjct  326  EEDKLELATSLLKKAKSKGVSLMLPADVVIADKFAADANSKVVPSTAIPDGWMGLDIGPD  385

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVK+ +DALETTKTVIWNGPMGVFEFDKFAVGTE++
Sbjct  386  SVKSFSDALETTKTVIWNGPMGVFEFDKFAVGTEAI  421


 Score =   120 bits (300),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 63/66 (95%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALD
Sbjct  422  AKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALD  481

Query  273  EAVPVA  256
            EAVPVA
Sbjct  482  EAVPVA  487



>ref|NP_001275227.1| phosphoglycerate kinase, chloroplastic-like [Solanum tuberosum]
 gb|ABB72817.1| phosphoglycerate kinase precursor-like protein [Solanum tuberosum]
Length=482

 Score =   180 bits (457),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDANSK+VPASAIPDGWMGLDIGPD
Sbjct  319  EEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPD  378

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT NDAL+TTKTVIWNGPMGVFEFDKFA GTE++
Sbjct  379  SIKTFNDALDTTKTVIWNGPMGVFEFDKFAAGTEAI  414


 Score =   111 bits (278),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 62/67 (93%), Positives = 64/67 (96%), Gaps = 1/67 (1%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LPGVIALD
Sbjct  415  AKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVIALD  474

Query  273  EA-VPVA  256
            EA  PVA
Sbjct  475  EADAPVA  481



>gb|AAC26785.1| phosphoglycerate kinase precursor [Solanum tuberosum]
Length=482

 Score =   180 bits (457),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDANSK+VPASAIPDGWMGLDIGPD
Sbjct  319  EEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPD  378

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT NDAL+TTKTVIWNGPMGVFEFDKFA GTE++
Sbjct  379  SIKTFNDALDTTKTVIWNGPMGVFEFDKFATGTEAI  414


 Score =   111 bits (278),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 62/67 (93%), Positives = 64/67 (96%), Gaps = 1/67 (1%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LPGVIALD
Sbjct  415  AKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVIALD  474

Query  273  EA-VPVA  256
            EA  PVA
Sbjct  475  EADAPVA  481



>ref|XP_002263796.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Vitis vinifera]
 emb|CAN81990.1| hypothetical protein VITISV_000725 [Vitis vinifera]
Length=478

 Score =   177 bits (449),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSK+VPASAIPDGWMGLDIGPD
Sbjct  316  EEDKLSLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPD  375

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+K  N+ALETTKTVIWNGPMGVFEFDKFA GT +V
Sbjct  376  SIKIFNEALETTKTVIWNGPMGVFEFDKFAEGTVAV  411


 Score =   114 bits (286),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGK VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALD
Sbjct  412  AKKLAELSGKDVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALD  471

Query  273  EAVPV  259
            EA PV
Sbjct  472  EATPV  476



>gb|ABB86255.1| phosphoglycerate kinase precursor-like [Solanum tuberosum]
Length=482

 Score =   180 bits (457),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDANSK+VPASAIPDGWMGLDIGPD
Sbjct  319  EEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPD  378

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT NDAL+TTKTVIWNGPMGVFEFDKFA GTE++
Sbjct  379  SIKTFNDALDTTKTVIWNGPMGVFEFDKFATGTEAI  414


 Score =   111 bits (277),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 62/67 (93%), Positives = 64/67 (96%), Gaps = 1/67 (1%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGK LPGVIALD
Sbjct  415  AKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVIALD  474

Query  273  EA-VPVA  256
            EA  PVA
Sbjct  475  EADAPVA  481



>ref|XP_007022578.1| Phosphoglycerate kinase 1 [Theobroma cacao]
 gb|EOY14103.1| Phosphoglycerate kinase 1 [Theobroma cacao]
Length=491

 Score =   174 bits (440),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT LL KAKAKGVSLLLPTDVVIADKFAPDANS+VVPASAIPDGWMGLDIGPD
Sbjct  326  EEDKLDLATLLLAKAKAKGVSLLLPTDVVIADKFAPDANSQVVPASAIPDGWMGLDIGPD  385

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT N+AL+TT+T+IWNGPMGVFEFDKFA GTE++
Sbjct  386  SIKTFNEALDTTQTIIWNGPMGVFEFDKFATGTEAI  421


 Score =   117 bits (292),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 61/65 (94%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALD
Sbjct  422  AKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVVALD  481

Query  273  EAVPV  259
            EA PV
Sbjct  482  EATPV  486



>gb|KHN21386.1| Phosphoglycerate kinase, chloroplastic [Glycine soja]
Length=181

 Score =   171 bits (433),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAK KGVSLLLP+DVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD
Sbjct  19   EEDKLDLATSLLAKAKEKGVSLLLPSDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  78

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVK+ ++AL+TT+T+IWNGPMGVFEFDKFAVGTE++
Sbjct  79   SVKSFSEALDTTQTIIWNGPMGVFEFDKFAVGTEAI  114


 Score =   119 bits (299),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+
Sbjct  112  EAIAKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVL  171

Query  282  ALDEAVPVA  256
            ALDEAVPVA
Sbjct  172  ALDEAVPVA  180



>emb|CBI24182.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   176 bits (446),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSK+VPASAIPDGWMGLDIGPD
Sbjct  243  EEDKLSLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPD  302

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+K  N+ALETTKTVIWNGPMGVFEFDKFA GT +V
Sbjct  303  SIKIFNEALETTKTVIWNGPMGVFEFDKFAEGTVAV  338


 Score =   114 bits (285),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGK VTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALD
Sbjct  339  AKKLAELSGKDVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALD  398

Query  273  EAVPV  259
            EA PV
Sbjct  399  EATPV  403



>gb|AFK48886.1| unknown [Lotus japonicus]
Length=181

 Score =   171 bits (432),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT+L+ KAKAKGVSLLLP+DVVIADKFAPDANSK+VP+SAIPDGWMGLDIGPD
Sbjct  19   EEDKLELATTLIAKAKAKGVSLLLPSDVVIADKFAPDANSKIVPSSAIPDGWMGLDIGPD  78

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+K+ +DAL+TT+T+IWNGPMGVFEFDKFAVGTE++
Sbjct  79   SIKSFSDALDTTQTIIWNGPMGVFEFDKFAVGTEAI  114


 Score =   119 bits (299),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLA+LSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+
Sbjct  112  EAIAKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVL  171

Query  282  ALDEAVPVA  256
            ALDEAVPVA
Sbjct  172  ALDEAVPVA  180



>ref|XP_002315066.1| PHOSPHOGLYCERATE KINASE 1 family protein [Populus trichocarpa]
 gb|EEF01237.1| PHOSPHOGLYCERATE KINASE 1 family protein [Populus trichocarpa]
Length=481

 Score =   179 bits (453),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKLGLATSLLEKAKAKGVSLLLP+DV+IADKFAPDANSK+VPASAIPDGWMGLDIGP+
Sbjct  319  EEDKLGLATSLLEKAKAKGVSLLLPSDVIIADKFAPDANSKIVPASAIPDGWMGLDIGPE  378

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT ++AL TT+TVIWNGPMGVFEFDKFAVGTE++
Sbjct  379  SVKTFSEALGTTQTVIWNGPMGVFEFDKFAVGTEAI  414


 Score =   111 bits (278),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALD
Sbjct  415  AKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVLALD  474

Query  273  EAVPVA  256
            E   VA
Sbjct  475  EVERVA  480



>ref|XP_010923458.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Elaeis 
guineensis]
Length=492

 Score =   171 bits (434),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KA +KGVSL+LP+DVV+ADKFAPDANSKVVP++AIPDGWMGLDIGPD
Sbjct  330  EEDKLELATSLLAKAVSKGVSLMLPSDVVVADKFAPDANSKVVPSTAIPDGWMGLDIGPD  389

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVK+ +DALETTKTVIWNGPMGVFEFDKFAVGTE++
Sbjct  390  SVKSFSDALETTKTVIWNGPMGVFEFDKFAVGTEAI  425


 Score =   118 bits (296),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 62/66 (94%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALD
Sbjct  426  AKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVLALD  485

Query  273  EAVPVA  256
            E+VPVA
Sbjct  486  ESVPVA  491



>gb|EYU33792.1| hypothetical protein MIMGU_mgv1a005422mg [Erythranthe guttata]
Length=484

 Score =   170 bits (431),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAKAKGVSLLLPTDVVIA+KFAPDA SK+VPA+ IPDGWMGLDIGPD
Sbjct  322  EEDKLDLATSLLEKAKAKGVSLLLPTDVVIANKFAPDAESKIVPATEIPDGWMGLDIGPD  381

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT N AL+TTKTVIWNGPMGVFEF+KFA GTE++
Sbjct  382  SIKTFNAALDTTKTVIWNGPMGVFEFEKFAAGTEAI  417


 Score =   119 bits (297),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 62/66 (94%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            + KLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV+ALD
Sbjct  418  ANKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVLALD  477

Query  273  EAVPVA  256
            EA+PVA
Sbjct  478  EAIPVA  483



>ref|XP_009397212.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
 gb|ABF70168.1| phosphoglycerate kinase, chloroplast, putative [Musa acuminata]
Length=479

 Score =   174 bits (440),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            E+DKL LATSLL KAKAKGVSLLLPTDVVIADKFAPDA SKVVPAS IPDGWMGLD+GPD
Sbjct  317  EDDKLELATSLLAKAKAKGVSLLLPTDVVIADKFAPDAQSKVVPASEIPDGWMGLDVGPD  376

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT NDAL+TTKT+IWNGPMGVFEFDKFA GTE++
Sbjct  377  SVKTFNDALDTTKTIIWNGPMGVFEFDKFATGTEAI  412


 Score =   115 bits (288),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 62/66 (94%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALD
Sbjct  413  AKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALD  472

Query  273  EAVPVA  256
            EAV VA
Sbjct  473  EAVVVA  478



>gb|ADV16381.1| chloroplast phosphoglycerate kinase 3 [Helianthus annuus]
Length=481

 Score =   179 bits (454),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT+LL KAKAKGVSLLLPTDVV+ADKFAPDANSKVVPA+AIPDGWMGLDIGPD
Sbjct  318  EEDKLDLATTLLAKAKAKGVSLLLPTDVVVADKFAPDANSKVVPAAAIPDGWMGLDIGPD  377

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT N+ALETTKTVIWNGPMGVFEFDKFAVGTE+V
Sbjct  378  SVKTFNEALETTKTVIWNGPMGVFEFDKFAVGTEAV  413


 Score =   110 bits (274),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV 
Sbjct  411  EAVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKVLPGVD  470

Query  282  ALDEAV  265
            ALDEAV
Sbjct  471  ALDEAV  476



>sp|P12782.1|PGKH_WHEAT RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor [Triticum aestivum]
 emb|CAA33303.1| unnamed protein product [Triticum aestivum]
 emb|CAA51931.1| phosphoglycerate kinase [Triticum aestivum]
Length=480

 Score =   177 bits (449),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAKAKGVSLLLP+DV+IADKFAPDANS+ VPASAIPDGWMGLDIGPD
Sbjct  315  EEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDANSQTVPASAIPDGWMGLDIGPD  374

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT NDAL+TT+T+IWNGPMGVFEFDKFAVGTES+
Sbjct  375  SVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESI  410


 Score =   112 bits (279),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            +S +KKLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+
Sbjct  408  ESIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVV  467

Query  282  ALDEAV  265
            ALDE V
Sbjct  468  ALDEGV  473



>gb|EMT12348.1| Phosphoglycerate kinase, chloroplastic [Aegilops tauschii]
Length=376

 Score =   177 bits (449),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAKAKGVSLLLP+DV+IADKFAPDANS+ VPASAIPDGWMGLDIGPD
Sbjct  211  EEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDANSQTVPASAIPDGWMGLDIGPD  270

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT NDAL+TT+T+IWNGPMGVFEFDKFAVGTES+
Sbjct  271  SVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESI  306


 Score =   111 bits (278),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            +S +KKLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+
Sbjct  304  ESIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVV  363

Query  282  ALDEAV  265
            ALDE V
Sbjct  364  ALDEGV  369



>ref|XP_009402843.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=480

 Score =   170 bits (431),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            E+DKL LA+SLL KAKAKGVSLLLPTDV+IADKFA DA SKVVPAS IPDGWMGLDIGPD
Sbjct  318  EDDKLELASSLLAKAKAKGVSLLLPTDVIIADKFAADAESKVVPASEIPDGWMGLDIGPD  377

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT +DAL+TTKT+IWNGPMGVFEFDKFAVGTES+
Sbjct  378  SVKTFSDALDTTKTIIWNGPMGVFEFDKFAVGTESI  413


 Score =   118 bits (295),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            +S +KKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+
Sbjct  411  ESIAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVV  470

Query  282  ALDEAVPVA  256
            ALDEAV VA
Sbjct  471  ALDEAVAVA  479



>gb|EMS54865.1| Phosphoglycerate kinase, chloroplastic [Triticum urartu]
Length=460

 Score =   176 bits (447),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAKAKGVSLLLP+DV+IADKFAPDANS+ VPASAIPDGWMGLDIGPD
Sbjct  243  EEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDANSQTVPASAIPDGWMGLDIGPD  302

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT NDAL+TT+T+IWNGPMGVFEFDKFAVGTES+
Sbjct  303  SVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESI  338


 Score =   111 bits (278),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            +S +KKLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+
Sbjct  336  ESIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVV  395

Query  282  ALDEAV  265
            ALDE V
Sbjct  396  ALDEGV  401



>ref|XP_007149208.1| hypothetical protein PHAVU_005G050700g [Phaseolus vulgaris]
 gb|ESW21202.1| hypothetical protein PHAVU_005G050700g [Phaseolus vulgaris]
Length=477

 Score =   174 bits (442),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT+LL KAK KGVSLLLP+DVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD
Sbjct  315  EEDKLDLATTLLAKAKEKGVSLLLPSDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  374

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVK+ N+AL+TTKT+IWNGPMGVFEFDKFAVGTE++
Sbjct  375  SVKSFNEALDTTKTIIWNGPMGVFEFDKFAVGTEAI  410


 Score =   113 bits (282),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLA+LS KGVTTIIGGGDSVAAVEKVGVA+VMSHISTGGGASLELLEGKELPGV+ALD
Sbjct  411  AKKLADLSEKGVTTIIGGGDSVAAVEKVGVANVMSHISTGGGASLELLEGKELPGVVALD  470

Query  273  EAVPV  259
            EA PV
Sbjct  471  EATPV  475



>ref|XP_002441313.1| hypothetical protein SORBIDRAFT_09g024340 [Sorghum bicolor]
 gb|EES19743.1| hypothetical protein SORBIDRAFT_09g024340 [Sorghum bicolor]
Length=483

 Score =   169 bits (428),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAK KGVSLLLPTDVVIADKFAPDANS++VPASAIPDGWMGLDIGPD
Sbjct  321  EEDKLDLATSLLAKAKEKGVSLLLPTDVVIADKFAPDANSQIVPASAIPDGWMGLDIGPD  380

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            +V + N AL+T +TVIWNGPMGVFEFDKFAVGTE+V
Sbjct  381  AVTSFNAALDTCQTVIWNGPMGVFEFDKFAVGTEAV  416


 Score =   118 bits (296),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+
Sbjct  414  EAVAKKLAELSAKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVV  473

Query  282  ALDEAVPVA  256
            ALDEA+PVA
Sbjct  474  ALDEAIPVA  482



>emb|CDP13574.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   174 bits (441),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAKAKGVSLLLP+DV+IADKFAPDANS+VVPASAIPDGWMGLDIGPD
Sbjct  243  EEDKLDLATSLLEKAKAKGVSLLLPSDVIIADKFAPDANSQVVPASAIPDGWMGLDIGPD  302

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTES  455
            S+KT ++ LET KTVIWNGPMGVFEFDKFAVGTE+
Sbjct  303  SIKTFSEVLETAKTVIWNGPMGVFEFDKFAVGTEA  337


 Score =   113 bits (283),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLA+LS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK+LPGVI
Sbjct  336  EATAKKLADLSRKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKQLPGVI  395

Query  282  ALDEAVPV  259
            ALDEA PV
Sbjct  396  ALDEATPV  403



>ref|XP_004961633.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Setaria 
italica]
Length=480

 Score =   171 bits (434),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAK KGVSL+LPTDVVIADKFAPDANS++VPASAIPDGWMGLDIGPD
Sbjct  319  EEDKLELATSLLAKAKEKGVSLMLPTDVVIADKFAPDANSQIVPASAIPDGWMGLDIGPD  378

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SV + N AL+TT+TVIWNGPMGVFEFDKFAVGTE+V
Sbjct  379  SVASFNAALDTTQTVIWNGPMGVFEFDKFAVGTEAV  414


 Score =   116 bits (290),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 61/66 (92%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGVI
Sbjct  412  EAVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVI  471

Query  282  ALDEAV  265
            ALDEAV
Sbjct  472  ALDEAV  477



>gb|ACJ85441.1| unknown [Medicago truncatula]
Length=260

 Score =   172 bits (436),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT+L+ KAKAKGVSLLLP+DVVIADKFAPDANS++VPASAIPDGWMGLDIGPD
Sbjct  98   EEDKLELATTLIAKAKAKGVSLLLPSDVVIADKFAPDANSQIVPASAIPDGWMGLDIGPD  157

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT N+AL+TT+T+IWNGPMGVFEFDKFAVGTE +
Sbjct  158  SIKTFNEALDTTQTIIWNGPMGVFEFDKFAVGTEFI  193


 Score =   114 bits (285),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLA+LSGKGVTTIIGGGD VAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALD
Sbjct  194  AKKLADLSGKGVTTIIGGGDFVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVLALD  253

Query  273  EAVPVA  256
            EA PVA
Sbjct  254  EATPVA  259



>ref|XP_011016496.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Populus euphratica]
Length=481

 Score =   177 bits (449),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKLGLATSLLEKAKAKGVSLLLP+DVVIADKFAPDANSK VPASAIPDGWMGLDIGP+
Sbjct  319  EEDKLGLATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKTVPASAIPDGWMGLDIGPE  378

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT ++AL TT+TVIWNGPMGVFEFDKFA+GTE++
Sbjct  379  SVKTFSEALGTTQTVIWNGPMGVFEFDKFAIGTEAI  414


 Score =   108 bits (271),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV+ALD
Sbjct  415  AKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKALPGVLALD  474

Query  273  EAVPVA  256
            E   VA
Sbjct  475  EVERVA  480



>ref|XP_006654593.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Oryza 
brachyantha]
Length=405

 Score =   169 bits (429),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAK KGV+LLLP+DVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD
Sbjct  243  EEDKLELATSLLAKAKEKGVALLLPSDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  302

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SV + +  LETTKTVIWNGPMGVFEFDKFAVGTE++
Sbjct  303  SVASFSSTLETTKTVIWNGPMGVFEFDKFAVGTEAI  338


 Score =   115 bits (289),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 62/66 (94%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLA+LSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGVIALD
Sbjct  339  AKKLADLSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVIALD  398

Query  273  EAVPVA  256
            EAV VA
Sbjct  399  EAVTVA  404



>gb|AFW78532.1| phosphoglycerate kinase [Zea mays]
Length=480

 Score =   172 bits (437),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAK KGVSL+LPTDVVIADKFAPDANS++VPASAIPDGWMGLDIGPD
Sbjct  318  EEDKLELATSLLAKAKEKGVSLMLPTDVVIADKFAPDANSQIVPASAIPDGWMGLDIGPD  377

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SV + N AL+TTKTVIWNGPMGVFEFDKFAVGTE+V
Sbjct  378  SVASFNAALDTTKTVIWNGPMGVFEFDKFAVGTEAV  413


 Score =   112 bits (279),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+
Sbjct  411  EAVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVV  470

Query  282  ALDEAVPV  259
            AL+EA  V
Sbjct  471  ALNEAATV  478



>gb|AFW78533.1| phosphoglycerate kinase [Zea mays]
Length=483

 Score =   172 bits (437),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAK KGVSL+LPTDVVIADKFAPDANS++VPASAIPDGWMGLDIGPD
Sbjct  318  EEDKLELATSLLAKAKEKGVSLMLPTDVVIADKFAPDANSQIVPASAIPDGWMGLDIGPD  377

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SV + N AL+TTKTVIWNGPMGVFEFDKFAVGTE+V
Sbjct  378  SVASFNAALDTTKTVIWNGPMGVFEFDKFAVGTEAV  413


 Score =   112 bits (279),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+AL+
Sbjct  414  AKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALN  473

Query  273  EAVPV  259
            EA  V
Sbjct  474  EAATV  478



>ref|XP_002891879.1| hypothetical protein ARALYDRAFT_474689 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68138.1| hypothetical protein ARALYDRAFT_474689 [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   176 bits (445),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAKA+GVSLLLPTDVVIADKFAPDANSK+VPASAIPDGWMGLDIGPD
Sbjct  316  EEDKLELATSLLAKAKARGVSLLLPTDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPD  375

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT N+AL+TT+TVIWNGPMGVFEF+KFA GTE+V
Sbjct  376  SVKTFNEALDTTQTVIWNGPMGVFEFEKFAQGTEAV  411


 Score =   108 bits (271),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -1

Query  471  Q*AQSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            Q  ++ + KLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LP
Sbjct  406  QGTEAVANKLAELSKKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLP  465

Query  291  GVIALDEAVPV  259
            GV+ LDEA PV
Sbjct  466  GVVVLDEATPV  476



>ref|NP_001147628.1| phosphoglycerate kinase [Zea mays]
 gb|ACG28158.1| phosphoglycerate kinase [Zea mays]
 gb|ACG28313.1| phosphoglycerate kinase [Zea mays]
Length=480

 Score =   172 bits (436),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAK KGVSL+LPTDVVIADKFAPDANS++VPASAIPDGWMGLDIGPD
Sbjct  318  EEDKLELATSLLAKAKEKGVSLMLPTDVVIADKFAPDANSQIVPASAIPDGWMGLDIGPD  377

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SV + N AL+TTKTVIWNGPMGVFEFDKFAVGTE+V
Sbjct  378  SVASFNAALDTTKTVIWNGPMGVFEFDKFAVGTEAV  413


 Score =   112 bits (279),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+
Sbjct  411  EAVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVV  470

Query  282  ALDEAVPV  259
            AL+EA  V
Sbjct  471  ALNEAATV  478



>gb|ACN32155.1| unknown [Zea mays]
Length=411

 Score =   172 bits (436),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAK KGVSL+LPTDVVIADKFAPDANS++VPASAIPDGWMGLDIGPD
Sbjct  246  EEDKLELATSLLAKAKEKGVSLMLPTDVVIADKFAPDANSQIVPASAIPDGWMGLDIGPD  305

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SV + N AL+TTKTVIWNGPMGVFEFDKFAVGTE+V
Sbjct  306  SVASFNAALDTTKTVIWNGPMGVFEFDKFAVGTEAV  341


 Score =   112 bits (279),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+
Sbjct  339  EAVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVV  398

Query  282  ALDEAVPV  259
            AL+EA  V
Sbjct  399  ALNEAATV  406



>ref|NP_176015.1| phosphoglycerate kinase [Arabidopsis thaliana]
 sp|P50318.3|PGKH2_ARATH RecName: Full=Phosphoglycerate kinase 2, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG50920.1|AC069159_21 phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gb|AAL07140.1| putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAM20449.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gb|AAN15569.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gb|AEE33356.1| phosphoglycerate kinase [Arabidopsis thaliana]
Length=478

 Score =   174 bits (441),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT+LL KAKA+GVSLLLPTDVVIADKFAPDANSK+VPASAIPDGWMGLDIGPD
Sbjct  316  EEDKLELATTLLAKAKARGVSLLLPTDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPD  375

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT N+AL+TT+TVIWNGPMGVFEF+KFA GTE+V
Sbjct  376  SVKTFNEALDTTQTVIWNGPMGVFEFEKFAKGTEAV  411


 Score =   109 bits (273),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ + KLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV+
Sbjct  409  EAVANKLAELSKKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVV  468

Query  282  ALDEAVPV  259
            ALDEA PV
Sbjct  469  ALDEATPV  476



>ref|NP_001055937.1| Os05g0496200 [Oryza sativa Japonica Group]
 gb|AAU44053.1| putative phosphoglycerate kinase [Oryza sativa Japonica Group]
 dbj|BAF17851.1| Os05g0496200 [Oryza sativa Japonica Group]
 gb|EEE64225.1| hypothetical protein OsJ_19058 [Oryza sativa Japonica Group]
Length=181

 Score =   167 bits (424),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAK KGVSLLLP+DV+IADKFAPDANS+VVPASAIPDGWMGLDIGPD
Sbjct  19   EEDKLELATSLLAKAKEKGVSLLLPSDVIIADKFAPDANSQVVPASAIPDGWMGLDIGPD  78

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SV + +  LETT+TVIWNGPMGVFEFDKFAVGTE++
Sbjct  79   SVASFSSTLETTQTVIWNGPMGVFEFDKFAVGTEAI  114


 Score =   115 bits (288),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 62/66 (94%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLA+LSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGVIALD
Sbjct  115  AKKLADLSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVIALD  174

Query  273  EAVPVA  256
            EAV VA
Sbjct  175  EAVTVA  180



>ref|NP_001117503.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AEE33357.1| phosphoglycerate kinase [Arabidopsis thaliana]
Length=405

 Score =   172 bits (437),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT+LL KAKA+GVSLLLPTDVVIADKFAPDANSK+VPASAIPDGWMGLDIGPD
Sbjct  243  EEDKLELATTLLAKAKARGVSLLLPTDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPD  302

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT N+AL+TT+TVIWNGPMGVFEF+KFA GTE+V
Sbjct  303  SVKTFNEALDTTQTVIWNGPMGVFEFEKFAKGTEAV  338


 Score =   109 bits (273),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ + KLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV+
Sbjct  336  EAVANKLAELSKKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVV  395

Query  282  ALDEAVPV  259
            ALDEA PV
Sbjct  396  ALDEATPV  403



>gb|AFW82396.1| hypothetical protein ZEAMMB73_945417 [Zea mays]
Length=477

 Score =   171 bits (434),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAK KGVSL+LPTDVVIADKFAPDANS++VPASAIPDGWMGLDIGPD
Sbjct  315  EEDKLDLATSLLAKAKEKGVSLMLPTDVVIADKFAPDANSQIVPASAIPDGWMGLDIGPD  374

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+   N ALETT+TVIWNGPMGVFE+DKFA+GTE+V
Sbjct  375  SIAAFNAALETTQTVIWNGPMGVFEYDKFAIGTEAV  410


 Score =   110 bits (275),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV ALD
Sbjct  411  AKKLAELSRKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVTALD  470

Query  273  EAVPV  259
            EA  V
Sbjct  471  EAATV  475



>gb|AAA79705.1| phosphoglycerate kinase, partial [Arabidopsis thaliana]
Length=231

 Score =   174 bits (440),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT+LL KAKA+GVSLLLPTDVVIADKFAPDANSK+VPASAIPDGWMGLDIGPD
Sbjct  69   EEDKLELATTLLAKAKARGVSLLLPTDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPD  128

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESVK  449
            SVKT N+AL+TT+TVIWNGPMGVFEF+KFA GTE+V+
Sbjct  129  SVKTFNEALDTTQTVIWNGPMGVFEFEKFAKGTEAVR  165


 Score =   107 bits (268),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++   KLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV+
Sbjct  162  EAVRNKLAELSKKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVV  221

Query  282  ALDEAVPV  259
            ALDEA PV
Sbjct  222  ALDEATPV  229



>gb|ABK96267.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96531.1| unknown [Populus trichocarpa x Populus deltoides]
Length=481

 Score =   170 bits (431),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAKAKGVSLLLP+DVVIADKFAPDANSK VPASAIPDGWMGLDIGP+
Sbjct  319  EEDKLDLATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKTVPASAIPDGWMGLDIGPE  378

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT ++AL TT+TVIWNGPMGVFEF+KFA GTE++
Sbjct  379  SVKTFSEALGTTQTVIWNGPMGVFEFEKFANGTEAI  414


 Score =   111 bits (277),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALD
Sbjct  415  AKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVLALD  474

Query  273  EAVPVA  256
            E   VA
Sbjct  475  EVERVA  480



>ref|XP_003568189.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Brachypodium 
distachyon]
Length=482

 Score =   169 bits (428),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAK KGVSLLLP+DVVIADKFAPDANS+ V ASAIPDGWMGLDIGPD
Sbjct  317  EEDKLELATSLLAKAKEKGVSLLLPSDVVIADKFAPDANSQTVAASAIPDGWMGLDIGPD  376

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SV T N ALETT+T+IWNGPMGVFEFDKFAVGTE+V
Sbjct  377  SVATFNAALETTQTIIWNGPMGVFEFDKFAVGTEAV  412


 Score =   112 bits (279),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK+LPGV+
Sbjct  410  EAVAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKQLPGVV  469

Query  282  ALDEAVPV  259
            ALDEAV V
Sbjct  470  ALDEAVTV  477



>ref|XP_008656415.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Zea mays]
Length=627

 Score =   170 bits (431),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAK KGVSL+LPTDVVIADKFAPDANS++VPASAIPDGWMGLDIGPD
Sbjct  465  EEDKLDLATSLLAKAKEKGVSLMLPTDVVIADKFAPDANSQIVPASAIPDGWMGLDIGPD  524

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+   N ALETT+TVIWNGPMGVFE+DKFA+GTE+V
Sbjct  525  SIAAFNAALETTQTVIWNGPMGVFEYDKFAIGTEAV  560


 Score =   110 bits (276),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV ALD
Sbjct  561  AKKLAELSRKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVTALD  620

Query  273  EAVPV  259
            EA  V
Sbjct  621  EAATV  625



>ref|XP_002312238.1| hypothetical protein POPTR_0008s08410g [Populus trichocarpa]
 dbj|BAA33803.1| chloroplast phosphoglycerate kinase [Populus nigra]
 gb|EEE89605.1| hypothetical protein POPTR_0008s08410g [Populus trichocarpa]
Length=481

 Score =   169 bits (428),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT+LLEKAKAKGVSLLLP+DVVIADKFAPDANSK VPASAIPDGWMGLDIGP+
Sbjct  319  EEDKLDLATTLLEKAKAKGVSLLLPSDVVIADKFAPDANSKTVPASAIPDGWMGLDIGPE  378

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT ++AL TT+TVIWNGPMGVFEF+KFA GTE++
Sbjct  379  SVKTFSEALGTTQTVIWNGPMGVFEFEKFANGTEAI  414


 Score =   111 bits (278),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGKELPGV+ALD
Sbjct  415  AKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVLALD  474

Query  273  EAVPVA  256
            E   VA
Sbjct  475  EVERVA  480



>ref|XP_006858226.1| hypothetical protein AMTR_s00062p00189550 [Amborella trichopoda]
 gb|ERN19693.1| hypothetical protein AMTR_s00062p00189550 [Amborella trichopoda]
Length=481

 Score =   169 bits (428),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            E+DK+ LATSLLEKAKAKGVSLLLPTDVVIADKFAPDA SK+VPAS IPD WMGLDIGPD
Sbjct  319  EDDKIDLATSLLEKAKAKGVSLLLPTDVVIADKFAPDAESKIVPASGIPDRWMGLDIGPD  378

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TT+TVIWNGPMGVFEFDKFAVGTE++
Sbjct  379  SIKTFSEALDTTQTVIWNGPMGVFEFDKFAVGTEAI  414


 Score =   111 bits (277),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLA+LS KGVTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPGV+ALD
Sbjct  415  AKKLADLSAKGVTTIIGGGDSVAAVEKVGVAEKMSHISTGGGASLELLEGKALPGVLALD  474

Query  273  EAVPVAA  253
            E VPVAA
Sbjct  475  EVVPVAA  481



>ref|XP_002884926.1| hypothetical protein ARALYDRAFT_478641 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61185.1| hypothetical protein ARALYDRAFT_478641 [Arabidopsis lyrata subsp. 
lyrata]
Length=481

 Score =   166 bits (421),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT LL KAKAKGVSLLLPTDVV+ADKFAPDANSK+VPAS I DGWMGLDIGPD
Sbjct  319  EEDKLELATELLAKAKAKGVSLLLPTDVVVADKFAPDANSKIVPASGIEDGWMGLDIGPD  378

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT N+AL+TT+TVIWNGPMGVFE +KFA GTE+V
Sbjct  379  SIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAV  414


 Score =   114 bits (284),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ + KLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGVI
Sbjct  412  EAVANKLAELSGKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVI  471

Query  282  ALDEAVPV  259
            ALDEA+PV
Sbjct  472  ALDEAIPV  479



>ref|XP_006300323.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
 ref|XP_006300324.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
 gb|EOA33221.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
 gb|EOA33222.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
Length=401

 Score =   175 bits (444),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+VPASAIPDGWMGLDIGPD
Sbjct  244  EEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TTKT+IWNGPMGVFEFDKFA GTE+V
Sbjct  304  SIKTFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAV  339


 Score =   104 bits (260),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +K+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVL  396

Query  282  ALDEA  268
            ALD+A
Sbjct  397  ALDDA  401



>ref|XP_010417621.1| PREDICTED: phosphoglycerate kinase, cytosolic [Camelina sativa]
 ref|XP_010429848.1| PREDICTED: phosphoglycerate kinase, cytosolic [Camelina sativa]
 ref|XP_010429849.1| PREDICTED: phosphoglycerate kinase, cytosolic [Camelina sativa]
Length=401

 Score =   174 bits (441),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+VPASAIPDGWMGLDIGPD
Sbjct  244  EEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TTKT+IWNGPMGVFEF+KFA GTE+V
Sbjct  304  SIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAV  339


 Score =   105 bits (263),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +K+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVL  396

Query  282  ALDEA  268
            ALDEA
Sbjct  397  ALDEA  401



>ref|XP_006297559.1| hypothetical protein CARUB_v10013582mg [Capsella rubella]
 gb|EOA30457.1| hypothetical protein CARUB_v10013582mg [Capsella rubella]
Length=481

 Score =   166 bits (421),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT LL KAKAKGVSLLLPTDVV+ADKFAPDANSK+VPAS I DGWMGLDIGPD
Sbjct  319  EEDKLELATELLAKAKAKGVSLLLPTDVVVADKFAPDANSKIVPASGIEDGWMGLDIGPD  378

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT N+AL+TT+TVIWNGPMGVFE +KFA GTE+V
Sbjct  379  SIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAV  414


 Score =   113 bits (283),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ + KLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV+
Sbjct  412  EAVANKLAELSGKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVV  471

Query  282  ALDEAVPV  259
            ALDEA+PV
Sbjct  472  ALDEAIPV  479



>ref|NP_178073.1| phosphoglycerate kinase [Arabidopsis thaliana]
 ref|NP_849907.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAD30221.1|AC007202_3 Is a member of the PF|00162 Phosphoglycerate kinase family. ESTs 
gb|N38721, gb|T22178, gb|R90345, gb|R90715, gb|T21140, gb|T46295, 
gb|H37082, gb|T46076, gb|N37132, gb|AA597649, gb|AI100648 
and gb|Z48462 come from this gene [Arabidopsis thaliana]
 gb|AAF70260.1|AF247560_1 cytosolic phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAK15553.1|AF348582_1 putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAL32941.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP37845.1| At1g79550 [Arabidopsis thaliana]
 gb|AEE36262.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AEE36263.1| phosphoglycerate kinase [Arabidopsis thaliana]
Length=401

 Score =   174 bits (441),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+VPA+AIPDGWMGLDIGPD
Sbjct  244  EEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPATAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TTKT+IWNGPMGVFEFDKFA GTE+V
Sbjct  304  SIKTFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAV  339


 Score =   105 bits (263),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +K+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVL  396

Query  282  ALDEA  268
            ALDEA
Sbjct  397  ALDEA  401



>ref|XP_010669994.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=482

 Score =   169 bits (429),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT+LLEKAKAKGVSLLLP DVVIADKFA DANSK+VPAS IPDGWMGLDIGPD
Sbjct  320  EEDKLDLATTLLEKAKAKGVSLLLPPDVVIADKFAADANSKIVPASEIPDGWMGLDIGPD  379

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+K  +DAL+TT+TVIWNGPMGVFEFDKFAVGTE++
Sbjct  380  SIKMFSDALDTTQTVIWNGPMGVFEFDKFAVGTEAI  415


 Score =   110 bits (274),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKL E+S KGVTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGKELPGV+ALD
Sbjct  416  AKKLEEISKKGVTTIIGGGDSVAAVEKVGVAESMSHISTGGGASLELLEGKELPGVLALD  475

Query  273  EAVPV  259
            EAVPV
Sbjct  476  EAVPV  480



>ref|XP_010499471.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic [Camelina 
sativa]
Length=481

 Score =   166 bits (420),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT LL KAKAKGVSLLLPTDVV+ADKFAPDANSK+VPAS I DGWMGLDIGPD
Sbjct  319  EEDKLELATELLAKAKAKGVSLLLPTDVVVADKFAPDANSKIVPASGIEDGWMGLDIGPD  378

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT N+AL+TT+TVIWNGPMGVFE +KFA GTE+V
Sbjct  379  SIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAV  414


 Score =   113 bits (282),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ + KLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV+
Sbjct  412  EAVANKLAELSGKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVV  471

Query  282  ALDEAVPV  259
            ALDEA+PV
Sbjct  472  ALDEAIPV  479



>gb|AAM61185.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
Length=401

 Score =   174 bits (441),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+VPA+AIPDGWMGLDIGPD
Sbjct  244  EEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPATAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TTKT+IWNGPMGVFEFDKFA GTE+V
Sbjct  304  SIKTFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAV  339


 Score =   104 bits (260),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +K+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLEL+EGK LPGV+
Sbjct  337  EAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELIEGKPLPGVL  396

Query  282  ALDEA  268
            ALDEA
Sbjct  397  ALDEA  401



>ref|XP_010544343.1| PREDICTED: LOW QUALITY PROTEIN: phosphoglycerate kinase 1, chloroplastic-like 
[Tarenaya hassleriana]
Length=480

 Score =   165 bits (418),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 90/98 (92%), Gaps = 2/98 (2%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPA--SAIPDGWMGLDIG  566
            EEDKL LATSLL KAKAKGVSLLLPTDVVIADKFAPDANSKV+ A    +PDGWMGLDIG
Sbjct  316  EEDKLELATSLLAKAKAKGVSLLLPTDVVIADKFAPDANSKVLNAVNCRLPDGWMGLDIG  375

Query  565  PDSVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            PDSVKT NDAL++T+T+IWNGPMGVFEFDKFAVGTE+V
Sbjct  376  PDSVKTFNDALDSTQTIIWNGPMGVFEFDKFAVGTEAV  413


 Score =   113 bits (283),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK+LPGVI
Sbjct  411  EAVAKKLAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKQLPGVI  470

Query  282  ALDEAVPV  259
            ALDEA PV
Sbjct  471  ALDEAAPV  478



>ref|XP_006389877.1| hypothetical protein EUTSA_v10018657mg [Eutrema salsugineum]
 gb|ESQ27163.1| hypothetical protein EUTSA_v10018657mg [Eutrema salsugineum]
Length=401

 Score =   174 bits (441),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+VPA+AIPDGWMGLDIGPD
Sbjct  244  EEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPATAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TTKT+IWNGPMGVFEFDKFA GTE+V
Sbjct  304  SIKTFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAV  339


 Score =   104 bits (260),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +K+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVL  396

Query  282  ALDEA  268
            ALD+A
Sbjct  397  ALDDA  401



>dbj|BAH57185.1| AT1G79550 [Arabidopsis thaliana]
Length=226

 Score =   173 bits (438),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+VPA+AIPDGWMGLDIGPD
Sbjct  69   EEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPATAIPDGWMGLDIGPD  128

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TTKT+IWNGPMGVFEFDKFA GTE+V
Sbjct  129  SIKTFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAV  164


 Score =   105 bits (262),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +K+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  162  EAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVL  221

Query  282  ALDEA  268
            ALDEA
Sbjct  222  ALDEA  226



>ref|XP_010487004.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Camelina 
sativa]
Length=481

 Score =   165 bits (417),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT LL +AKAKGVSLLLPTDVV+ADKFAPDANSK+VPAS I DGWMGLDIGPD
Sbjct  319  EEDKLELATELLAEAKAKGVSLLLPTDVVVADKFAPDANSKIVPASGIEDGWMGLDIGPD  378

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT N+AL+TT+TVIWNGPMGVFE +KFA GTE+V
Sbjct  379  SIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAV  414


 Score =   113 bits (282),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ + KLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV+
Sbjct  412  EAVANKLAELSGKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVV  471

Query  282  ALDEAVPV  259
            ALDEA+PV
Sbjct  472  ALDEAIPV  479



>ref|XP_010465058.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Camelina 
sativa]
Length=481

 Score =   166 bits (420),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT LL KAKAKGVSLLLPTDVV+ADKFAPDANSK+VPAS I DGWMGLDIGPD
Sbjct  319  EEDKLELATELLAKAKAKGVSLLLPTDVVVADKFAPDANSKIVPASGIEDGWMGLDIGPD  378

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT N+AL+TT+TVIWNGPMGVFE +KFA GTE+V
Sbjct  379  SIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAV  414


 Score =   111 bits (278),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ + KLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGV 
Sbjct  412  EAVANKLAELSGKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVT  471

Query  282  ALDEAVPV  259
            ALDEA+PV
Sbjct  472  ALDEAIPV  479



>ref|XP_010472814.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Camelina 
sativa]
Length=401

 Score =   172 bits (436),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL+EKAKAKGVSLLLPTDVVIADKF PDANSK+VPASAIPDGWMGLDIGPD
Sbjct  244  EEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFCPDANSKIVPASAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TTKT+IWNGPMGVFEF+KFA GTE+V
Sbjct  304  SIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAV  339


 Score =   105 bits (263),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +K+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVL  396

Query  282  ALDEA  268
            ALDEA
Sbjct  397  ALDEA  401



>ref|XP_010275944.1| PREDICTED: phosphoglycerate kinase, cytosolic [Nelumbo nucifera]
Length=402

 Score =   174 bits (442),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAK+KGVSLLLPTDVVIADKFA DANS+VVPAS+IPDGWMGLDIGPD
Sbjct  244  EEDKLDLATSLLEKAKSKGVSLLLPTDVVIADKFAADANSQVVPASSIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT N++L+TTKT+IWNGPMGVFEFDKFAVGTE++
Sbjct  304  SIKTFNESLDTTKTIIWNGPMGVFEFDKFAVGTEAI  339


 Score =   103 bits (256),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+AL+
Sbjct  340  AKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKSLPGVLALN  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>ref|XP_003546821.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Glycine max]
 gb|KHN48876.1| Phosphoglycerate kinase, cytosolic [Glycine soja]
Length=401

 Score =   171 bits (433),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT+LLEKAKAKGVSLLLPTDVVIADKFA DANSK VPAS+IPDGWMGLDIGPD
Sbjct  244  EEDKLSLATTLLEKAKAKGVSLLLPTDVVIADKFAADANSKTVPASSIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT  +AL+TT+T+IWNGPMGVFEFDKFA GTE++
Sbjct  304  SIKTFGEALDTTQTIIWNGPMGVFEFDKFATGTEAI  339


 Score =   106 bits (265),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+ALD
Sbjct  340  AKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLPGVLALD  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>ref|XP_011086347.1| PREDICTED: phosphoglycerate kinase, cytosolic [Sesamum indicum]
Length=401

 Score =   173 bits (438),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKLGLATSL+EKAK KGVSLLLP+DVVIADKFA DANSKVVPAS IPDGWMGLDIGPD
Sbjct  244  EEDKLGLATSLMEKAKTKGVSLLLPSDVVIADKFAADANSKVVPASQIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+K+  +ALETTKT+IWNGPMGVFEFDKFA GTE++
Sbjct  304  SIKSFGEALETTKTIIWNGPMGVFEFDKFAAGTEAI  339


 Score =   104 bits (260),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD
Sbjct  340  AKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVLALD  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>emb|CDX67989.1| BnaA07g20290D [Brassica napus]
Length=348

 Score =   172 bits (436),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+VPA+AIPDGWMGLDIGPD
Sbjct  191  EEDKLDLARSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPATAIPDGWMGLDIGPD  250

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TTKT+IWNGPMGVFEF+KFA GTE+V
Sbjct  251  SIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAV  286


 Score =   104 bits (260),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +K+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  284  EAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVL  343

Query  282  ALDEA  268
            ALD+A
Sbjct  344  ALDDA  348



>ref|XP_002889253.1| hypothetical protein ARALYDRAFT_477124 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65512.1| hypothetical protein ARALYDRAFT_477124 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score =   172 bits (437),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+VPA+AIPDGWMGLDIGPD
Sbjct  244  EEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPATAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TTKT+IWNGPMGVFEF+KFA GTE+V
Sbjct  304  SIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAV  339


 Score =   104 bits (260),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +K+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVL  396

Query  282  ALDEA  268
            ALD+A
Sbjct  397  ALDDA  401



>emb|CDX87375.1| BnaA07g34980D [Brassica napus]
Length=401

 Score =   172 bits (437),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+V A+AIPDGWMGLDIGPD
Sbjct  244  EEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVAATAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT +DAL+TTKT+IWNGPMGVFEFDKFA GTE+V
Sbjct  304  SIKTFSDALDTTKTIIWNGPMGVFEFDKFAAGTEAV  339


 Score =   104 bits (260),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +K+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVL  396

Query  282  ALDEA  268
            ALD+A
Sbjct  397  ALDDA  401



>ref|XP_006407295.1| hypothetical protein EUTSA_v10020621mg [Eutrema salsugineum]
 gb|ESQ48748.1| hypothetical protein EUTSA_v10020621mg [Eutrema salsugineum]
Length=481

 Score =   169 bits (428),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAKAKGVSLLLPTDVV+ADKFAPDANSKVVPAS I DGWMGLDIGPD
Sbjct  319  EEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDANSKVVPASGIEDGWMGLDIGPD  378

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT N+AL+TT+TVIWNGPMGVFE +KFA GTE+V
Sbjct  379  SIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAV  414


 Score =   107 bits (267),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ + KLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGVI
Sbjct  412  EAVANKLAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVI  471

Query  282  ALDEAVPV  259
            ALDEA+ V
Sbjct  472  ALDEAITV  479



>ref|NP_187884.1| phosphoglycerate kinase 1 [Arabidopsis thaliana]
 sp|Q9LD57.1|PGKH1_ARATH RecName: Full=Phosphoglycerate kinase 1, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF70258.1|AF247558_1 phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAK25944.1|AF360234_1 putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAL16186.1|AF428418_1 AT3g12780/MBK21_14 [Arabidopsis thaliana]
 dbj|BAB02423.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAK73981.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 gb|AAL24323.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAL33785.1| putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAM16259.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 gb|AAM47957.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAM83218.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 dbj|BAE99262.1| phosphoglycerate kinase like protein [Arabidopsis thaliana]
 dbj|BAH19627.1| AT3G12780 [Arabidopsis thaliana]
 gb|AEE75246.1| phosphoglycerate kinase 1 [Arabidopsis thaliana]
Length=481

 Score =   166 bits (420),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT LL KAKAKGVSLLLPTDVV+ADKFAPDANSK+VPAS I DGWMGLDIGPD
Sbjct  319  EEDKLELATELLAKAKAKGVSLLLPTDVVVADKFAPDANSKIVPASGIEDGWMGLDIGPD  378

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT N+AL+TT+TVIWNGPMGVFE +KFA GTE++
Sbjct  379  SIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAI  414


 Score =   110 bits (274),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            + KLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGVIALD
Sbjct  415  ANKLAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIALD  474

Query  273  EAVPV  259
            EA+PV
Sbjct  475  EAIPV  479



>ref|XP_009106677.1| PREDICTED: phosphoglycerate kinase, cytosolic [Brassica rapa]
 ref|XP_009106678.1| PREDICTED: phosphoglycerate kinase, cytosolic [Brassica rapa]
Length=401

 Score =   171 bits (433),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+V A+AIPDGWMGLDIGPD
Sbjct  244  EEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVAATAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TTKT+IWNGPMGVFEFDKFA GTE+V
Sbjct  304  SIKTFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAV  339


 Score =   104 bits (260),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +K+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVL  396

Query  282  ALDEA  268
            ALD+A
Sbjct  397  ALDDA  401



>ref|XP_003531483.1| PREDICTED: phosphoglycerate kinase, cytosolic [Glycine max]
 gb|KHN21385.1| Phosphoglycerate kinase, cytosolic [Glycine soja]
Length=401

 Score =   169 bits (429),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT+LLEKAKAKGVSLLLPTDVVIADKFA DANSK VPAS+IPDGWMGLDIGPD
Sbjct  244  EEDKLSLATTLLEKAKAKGVSLLLPTDVVIADKFAADANSKTVPASSIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT  +AL+ T+TVIWNGPMGVFEFDKFA GTE++
Sbjct  304  SIKTFGEALDKTQTVIWNGPMGVFEFDKFATGTEAI  339


 Score =   106 bits (265),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+ALD
Sbjct  340  AKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLPGVLALD  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>ref|XP_004970259.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like isoform 
X2 [Setaria italica]
Length=484

 Score =   163 bits (412),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            E DKL LATSLL KAK KGVSL+LPTDVV+ADKFAPDA S+VVPASAIPDGWMGLDIGPD
Sbjct  327  EADKLELATSLLSKAKEKGVSLMLPTDVVVADKFAPDARSQVVPASAIPDGWMGLDIGPD  386

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+   + ALETT+TVIWNGPMGVFEF KFAVGTE++
Sbjct  387  SISAFSSALETTQTVIWNGPMGVFEFKKFAVGTEAI  422


 Score =   112 bits (281),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEG+ELPGV+ALD
Sbjct  423  AKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGRELPGVVALD  482

Query  273  EA  268
            EA
Sbjct  483  EA  484



>emb|CDX73803.1| BnaA03g32440D [Brassica napus]
Length=484

 Score =   169 bits (427),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAKAKGVSLLLPTDVV+ADKFAPDANSKVVPAS I DGWMGLDIGPD
Sbjct  322  EEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDANSKVVPASGIEDGWMGLDIGPD  381

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT N+AL+TT+TVIWNGPMGVFE +KFA GTE+V
Sbjct  382  SIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAV  417


 Score =   107 bits (266),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ + KLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGVI
Sbjct  415  EAVANKLAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVI  474

Query  282  ALDEAVPV  259
            ALDEA+ V
Sbjct  475  ALDEAITV  482



>ref|XP_004970258.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like isoform 
X1 [Setaria italica]
Length=485

 Score =   163 bits (412),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            E DKL LATSLL KAK KGVSL+LPTDVV+ADKFAPDA S+VVPASAIPDGWMGLDIGPD
Sbjct  328  EADKLELATSLLSKAKEKGVSLMLPTDVVVADKFAPDARSQVVPASAIPDGWMGLDIGPD  387

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+   + ALETT+TVIWNGPMGVFEF KFAVGTE++
Sbjct  388  SISAFSSALETTQTVIWNGPMGVFEFKKFAVGTEAI  423


 Score =   112 bits (281),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEG+ELPGV+ALD
Sbjct  424  AKKLAELSGKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGRELPGVVALD  483

Query  273  EA  268
            EA
Sbjct  484  EA  485



>emb|CDY00798.1| BnaC03g37820D [Brassica napus]
Length=482

 Score =   169 bits (427),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAKAKGVSLLLPTDVV+ADKFAPDANSKVVPAS I DGWMGLDIGPD
Sbjct  320  EEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDANSKVVPASGIEDGWMGLDIGPD  379

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT N+AL+TT+TVIWNGPMGVFE +KFA GTE+V
Sbjct  380  SIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAV  415


 Score =   107 bits (266),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ + KLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGVI
Sbjct  413  EAVANKLAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVI  472

Query  282  ALDEAVPV  259
            ALDEA+ V
Sbjct  473  ALDEAITV  480



>ref|XP_009128369.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Brassica 
rapa]
Length=401

 Score =   171 bits (432),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+VPA+AIPDGWMGLD+GPD
Sbjct  244  EEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPATAIPDGWMGLDVGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TT+T+IWNGPMGVFEF+KFA GTE+V
Sbjct  304  SIKTFSEALDTTQTIIWNGPMGVFEFEKFAAGTEAV  339


 Score =   104 bits (260),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +K+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVL  396

Query  282  ALDEA  268
            ALD+A
Sbjct  397  ALDDA  401



>gb|ABI18157.1| cytosolic phosphoglycerate kinase [Helianthus annuus]
Length=401

 Score =   171 bits (432),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT+LLEKAK+KGVSLLLP+DVVIADKFA DANSK+VPAS+IPDGWMGLDIGPD
Sbjct  244  EEDKLDLATTLLEKAKSKGVSLLLPSDVVIADKFAADANSKIVPASSIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+K+ ++AL+TTKTVIWNGPMGVFEFDKFAVGTE++
Sbjct  304  SIKSFSEALDTTKTVIWNGPMGVFEFDKFAVGTEAI  339


 Score =   104 bits (260),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV 
Sbjct  337  EAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVP  396

Query  282  ALDEA  268
            ALDEA
Sbjct  397  ALDEA  401



>emb|CBL95264.1| phosphoglycerate kinase 1 [Pinus pinaster]
Length=507

 Score =   162 bits (409),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            E+DK+ LA +L++KAK KGVSLLLPTDVVIADKFA DANSKVVPAS IPDGWMGLDIG D
Sbjct  345  EDDKIELAKTLMQKAKEKGVSLLLPTDVVIADKFAADANSKVVPASDIPDGWMGLDIGAD  404

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TTKTVIWNGPMGVFEFDKFA GTES+
Sbjct  405  SIKTFSEALDTTKTVIWNGPMGVFEFDKFAAGTESI  440


 Score =   112 bits (281),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            +S +KKLAELSGKGV TIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPGV+
Sbjct  438  ESIAKKLAELSGKGVITIIGGGDSVAAVEKVGVAEKMSHISTGGGASLELLEGKTLPGVL  497

Query  282  ALDEAVPV  259
            ALDEAVPV
Sbjct  498  ALDEAVPV  505



>gb|AAB60303.1| phosphoglycerate kinase, partial [Arabidopsis thaliana]
Length=399

 Score =   165 bits (417),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT LL KAKAKGVSLLLPTDVV+ADKFAPDANSK+VPAS I DGWMGLDIGPD
Sbjct  237  EEDKLELATELLAKAKAKGVSLLLPTDVVVADKFAPDANSKIVPASGIEDGWMGLDIGPD  296

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT N+AL+TT+TVIWNGPMGVFE +KFA GTE++
Sbjct  297  SIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAI  332


 Score =   109 bits (273),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ + KLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGVI
Sbjct  330  EAIANKLAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVI  389

Query  282  ALDEAVPV  259
            ALDEA+PV
Sbjct  390  ALDEAIPV  397



>emb|CDY49746.1| BnaA02g19260D [Brassica napus]
Length=388

 Score =   170 bits (430),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+VPA+AIPDGWMGLD+GPD
Sbjct  231  EEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPATAIPDGWMGLDVGPD  290

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TT+T+IWNGPMGVFEF+KFA GTE+V
Sbjct  291  SIKTFSEALDTTQTIIWNGPMGVFEFEKFAAGTEAV  326


 Score =   104 bits (260),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +K+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  324  EAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVL  383

Query  282  ALDEA  268
            ALD+A
Sbjct  384  ALDDA  388



>emb|CDX88547.1| BnaC06g39910D [Brassica napus]
Length=352

 Score =   170 bits (430),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+V A+AIPDGWMGLDIGPD
Sbjct  195  EEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVAATAIPDGWMGLDIGPD  254

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TTKT+IWNGPMGVFEFDKFA GTE+V
Sbjct  255  SIKTFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAV  290


 Score =   104 bits (260),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +K+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  288  EAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVL  347

Query  282  ALDEA  268
            ALD+A
Sbjct  348  ALDDA  352



>gb|AIZ74346.1| phosphoglycerate kinase 1 [Pinus massoniana]
Length=507

 Score =   161 bits (408),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            E+DK+ LA +L++KAK KGVSLLLPTDVVIADKFA DANSKVVPAS IPDGWMGLDIG D
Sbjct  345  EDDKIELAKTLMQKAKEKGVSLLLPTDVVIADKFAADANSKVVPASDIPDGWMGLDIGAD  404

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TTKTVIWNGPMGVFEFDKFA GTES+
Sbjct  405  SIKTFSEALDTTKTVIWNGPMGVFEFDKFAAGTESI  440


 Score =   112 bits (281),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            +S +KKLAELSGKGV TIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPGV+
Sbjct  438  ESIAKKLAELSGKGVITIIGGGDSVAAVEKVGVAEKMSHISTGGGASLELLEGKTLPGVL  497

Query  282  ALDEAVPV  259
            ALDEAVPV
Sbjct  498  ALDEAVPV  505



>ref|XP_007022579.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 ref|XP_007022580.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 ref|XP_007022581.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 gb|EOY14104.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 gb|EOY14105.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 gb|EOY14106.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
Length=401

 Score =   169 bits (428),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVV AS IPDGWMGLDIGPD
Sbjct  244  EEDKLELATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVSASEIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+ T ++AL+TTKT+IWNGPMGVFEF+KFA GTE++
Sbjct  304  SINTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAI  339


 Score =   105 bits (262),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVL  396

Query  282  ALDEA  268
            ALD+A
Sbjct  397  ALDDA  401



>ref|XP_009384174.1| PREDICTED: phosphoglycerate kinase, cytosolic [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   173 bits (438),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKLGLATSLLEKAK+KGVSLLLPTDVVIADKFA DA+SK+VPAS IPDGWMGLDIGPD
Sbjct  244  EEDKLGLATSLLEKAKSKGVSLLLPTDVVIADKFAADADSKIVPASGIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT + ALE+TKT+IWNGPMGVFEF+KFAVGTE++
Sbjct  304  SIKTFSGALESTKTIIWNGPMGVFEFEKFAVGTEAI  339


 Score =   101 bits (252),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLA+LSG GVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAIAKKLADLSGTGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKSLPGVL  396

Query  282  ALDEA  268
            ALD+A
Sbjct  397  ALDDA  401



>ref|XP_009607754.1| PREDICTED: phosphoglycerate kinase, cytosolic [Nicotiana tomentosiformis]
 sp|Q42962.1|PGKY_TOBAC RecName: Full=Phosphoglycerate kinase, cytosolic [Nicotiana tabacum]
 emb|CAA88840.1| phosphoglycerate kinase (PGK) [Nicotiana tabacum]
Length=401

 Score =   169 bits (429),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAKAKGVSLLLPTDVVIADKFA DANSKVVPAS IPDGWMGLDIGPD
Sbjct  244  EEDKLDLATSLMEKAKAKGVSLLLPTDVVIADKFAADANSKVVPASEIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++K+   AL+TTKTVIWNGPMGVFEFDKFA GTE++
Sbjct  304  AIKSFGSALDTTKTVIWNGPMGVFEFDKFAAGTEAI  339


 Score =   105 bits (261),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD
Sbjct  340  AKKLAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKPLPGVLALD  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>ref|XP_002971814.1| hypothetical protein SELMODRAFT_267533 [Selaginella moellendorffii]
 gb|EFJ26731.1| hypothetical protein SELMODRAFT_267533 [Selaginella moellendorffii]
Length=472

 Score =   167 bits (422),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDK+ LA SL++ AK KGVSLLLPTDVV+ADKFA DANSK+VP++AIPDGWMGLDIGPD
Sbjct  309  EEDKIDLAKSLMKTAKDKGVSLLLPTDVVVADKFAADANSKIVPSTAIPDGWMGLDIGPD  368

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT N+AL+TTKTVIWNGPMGVFEFDKFAVGTE+V
Sbjct  369  SVKTFNEALDTTKTVIWNGPMGVFEFDKFAVGTEAV  404


 Score =   107 bits (267),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 58/66 (88%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAELSGKGVTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPGV 
Sbjct  402  EAVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADKMSHISTGGGASLELLEGKVLPGVA  461

Query  282  ALDEAV  265
            ALDEAV
Sbjct  462  ALDEAV  467



>ref|XP_009791377.1| PREDICTED: phosphoglycerate kinase, cytosolic [Nicotiana sylvestris]
Length=401

 Score =   169 bits (429),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAKAKGVSLLLPTDVVIADKFA DANSKVVPAS IPDGWMGLDIGPD
Sbjct  244  EEDKLDLATSLMEKAKAKGVSLLLPTDVVIADKFAADANSKVVPASEIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++K+   AL+TTKTVIWNGPMGVFEFDKFA GTE++
Sbjct  304  AIKSFGSALDTTKTVIWNGPMGVFEFDKFAAGTEAI  339


 Score =   105 bits (261),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD
Sbjct  340  AKKLAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKPLPGVLALD  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>ref|XP_002972334.1| hypothetical protein SELMODRAFT_231942 [Selaginella moellendorffii]
 gb|EFJ26420.1| hypothetical protein SELMODRAFT_231942 [Selaginella moellendorffii]
Length=412

 Score =   166 bits (421),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDK+ LA SL+  AK KGVSLLLPTDVV+ADKFA DANSK+VP++AIPDGWMGLDIGPD
Sbjct  249  EEDKIDLAKSLMRTAKDKGVSLLLPTDVVVADKFAADANSKIVPSTAIPDGWMGLDIGPD  308

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT N+AL+TTKTVIWNGPMGVFEFDKFAVGTE+V
Sbjct  309  SVKTFNEALDTTKTVIWNGPMGVFEFDKFAVGTEAV  344


 Score =   107 bits (268),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 58/66 (88%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAELSGKGVTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPGV 
Sbjct  342  EAVAKKLAELSGKGVTTIIGGGDSVAAVEKVGVADKMSHISTGGGASLELLEGKVLPGVA  401

Query  282  ALDEAV  265
            ALDEAV
Sbjct  402  ALDEAV  407



>gb|KDO61597.1| hypothetical protein CISIN_1g040813mg [Citrus sinensis]
Length=401

 Score =   169 bits (428),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAK+KGVSLLLPTDVVIADKFA DANSKVVPA+AIPDGWMGLD+GPD
Sbjct  244  EEDKLDLATSLMEKAKSKGVSLLLPTDVVIADKFAADANSKVVPATAIPDGWMGLDVGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++K+ ++AL+TTKT+IWNGPMGVFEFDKFA GTE++
Sbjct  304  AIKSFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAI  339


 Score =   104 bits (260),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVL  396

Query  282  ALDEA  268
            ALD+A
Sbjct  397  ALDDA  401



>ref|XP_011468861.1| PREDICTED: phosphoglycerate kinase, cytosolic [Fragaria vesca 
subsp. vesca]
Length=401

 Score =   169 bits (428),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL+EKAKAKGVS+LLPTDVVIADKFA DANSKVVPASAIPDGWMGLDIGPD
Sbjct  244  EEDKLDLAKSLMEKAKAKGVSILLPTDVVIADKFAADANSKVVPASAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TT+TVIWNGPMGVFEF+KFA GTE++
Sbjct  304  SIKTFSEALDTTQTVIWNGPMGVFEFEKFAAGTEAI  339


 Score =   104 bits (259),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD
Sbjct  340  AKKLAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALD  399

Query  273  EA  268
            EA
Sbjct  400  EA  401



>ref|XP_010094705.1| Phosphoglycerate kinase [Morus notabilis]
 gb|EXB56751.1| Phosphoglycerate kinase [Morus notabilis]
Length=401

 Score =   168 bits (426),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDK  LAT+LLEKAKAKGVS+LLPTDVVIADKFAPDANSK+VPAS+IPDGWMGLDIGPD
Sbjct  244  EEDKYDLATTLLEKAKAKGVSILLPTDVVIADKFAPDANSKIVPASSIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++ L+TT+T+IWNGPMGVFEF+KFA GTE++
Sbjct  304  SIKTFSETLDTTQTIIWNGPMGVFEFEKFAAGTEAI  339


 Score =   105 bits (261),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAE+SGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+ALD
Sbjct  340  AKKLAEISGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLPGVLALD  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>emb|CDX79326.1| BnaC06g19770D [Brassica napus]
Length=353

 Score =   168 bits (426),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL+EKA+ KGVSLLLPTDVVIADKFAPDANSK+VPA+AIPDGWMGLDIGPD
Sbjct  196  EEDKLDLARSLMEKAQDKGVSLLLPTDVVIADKFAPDANSKIVPATAIPDGWMGLDIGPD  255

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TTKT+IWNGPMGVFEF+KFA GTE+V
Sbjct  256  SIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAV  291


 Score =   104 bits (260),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +K+LAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  289  EAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVL  348

Query  282  ALDEA  268
            ALD+A
Sbjct  349  ALDDA  353



>gb|KJB14019.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14021.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14022.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14023.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14024.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
Length=401

 Score =   169 bits (429),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAKAKGVSLLLPTDVV+ADKFA DANSKVVPAS IPDGWMGLDIGPD
Sbjct  244  EEDKLDLATSLLEKAKAKGVSLLLPTDVVVADKFAADANSKVVPASGIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT +++L+TT+T+IWNGPMGVFEF+KFA GTE+V
Sbjct  304  SIKTFSESLDTTQTIIWNGPMGVFEFEKFAAGTEAV  339


 Score =   103 bits (257),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK+LPGV+
Sbjct  337  EAVAKKLAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKQLPGVL  396

Query  282  ALDEA  268
            AL++A
Sbjct  397  ALNDA  401



>ref|XP_010324204.1| PREDICTED: phosphoglycerate kinase, cytosolic [Solanum lycopersicum]
 ref|XP_010324205.1| PREDICTED: phosphoglycerate kinase, cytosolic [Solanum lycopersicum]
Length=401

 Score =   167 bits (422),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DANSK+VPAS IPDGWMGLDIGPD
Sbjct  244  EEDKLDLATSLMEKAKTKGVSLLLPTDVVIADKFAADANSKIVPASEIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++K+   AL+TTKT+IWNGPMGVFEFDKFA GTE++
Sbjct  304  AIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAI  339


 Score =   106 bits (264),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+ALD
Sbjct  340  AKKLAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLALD  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>gb|KJB14020.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
Length=349

 Score =   170 bits (430),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAKAKGVSLLLPTDVV+ADKFA DANSKVVPAS IPDGWMGLDIGPD
Sbjct  192  EEDKLDLATSLLEKAKAKGVSLLLPTDVVVADKFAADANSKVVPASGIPDGWMGLDIGPD  251

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT +++L+TT+T+IWNGPMGVFEF+KFA GTE+V
Sbjct  252  SIKTFSESLDTTQTIIWNGPMGVFEFEKFAAGTEAV  287


 Score =   103 bits (256),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK+LPGV+
Sbjct  285  EAVAKKLAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKQLPGVL  344

Query  282  ALDEA  268
            AL++A
Sbjct  345  ALNDA  349



>ref|XP_010064085.1| PREDICTED: phosphoglycerate kinase, cytosolic [Eucalyptus grandis]
 gb|KCW71390.1| hypothetical protein EUGRSUZ_F04463 [Eucalyptus grandis]
Length=401

 Score =   169 bits (427),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAK+KGVSLLLPTDVVIA+KFA DA+SK+VPASAIPDGWMGLDIGPD
Sbjct  244  EEDKLDLATSLLEKAKSKGVSLLLPTDVVIANKFAADADSKIVPASAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT  +AL+TTKTVIWNGPMGVFEF+KFA GTE+V
Sbjct  304  SIKTFGEALDTTKTVIWNGPMGVFEFEKFAAGTEAV  339


 Score =   103 bits (258),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAVAKKLAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVL  396

Query  282  ALDEA  268
            ALD+A
Sbjct  397  ALDDA  401



>emb|CDY70232.1| BnaC02g46710D [Brassica napus]
Length=401

 Score =   169 bits (428),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL+EKA+AKGVSLLLPTDVVIADKFAPDANSK+VPA+AIPDGWMGLD+GPD
Sbjct  244  EEDKLDLAKSLMEKAEAKGVSLLLPTDVVIADKFAPDANSKIVPATAIPDGWMGLDVGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TT+T+IWNGPMGVFEF+KFA GTE+V
Sbjct  304  SIKTFSEALDTTQTIIWNGPMGVFEFEKFAAGTEAV  339


 Score =   103 bits (257),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +K+LAELSGKGVTTIIGGGDSVA+VEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAVAKQLAELSGKGVTTIIGGGDSVASVEKVGLADKMSHISTGGGASLELLEGKPLPGVL  396

Query  282  ALDEA  268
            ALD+A
Sbjct  397  ALDDA  401



>ref|XP_011016588.1| PREDICTED: phosphoglycerate kinase, cytosolic [Populus euphratica]
Length=401

 Score =   168 bits (426),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAK KGV LLLP DVV+ADKFAPDANSKV+PAS IPDGWMGLDIGPD
Sbjct  244  EEDKLDLATSLIEKAKVKGVKLLLPADVVVADKFAPDANSKVLPASEIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TTKT+IWNGPMGVFEF+KFAVGTE++
Sbjct  304  SIKTFSEALDTTKTIIWNGPMGVFEFEKFAVGTEAI  339


 Score =   104 bits (259),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ ++KLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAIARKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVL  396

Query  282  ALDEA  268
            ALD+A
Sbjct  397  ALDDA  401



>ref|XP_006422250.1| hypothetical protein CICLE_v10005101mg [Citrus clementina]
 ref|XP_006493790.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Citrus sinensis]
 gb|ESR35490.1| hypothetical protein CICLE_v10005101mg [Citrus clementina]
Length=401

 Score =   167 bits (424),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL L TSL+EKAK+KGVSLLLPTDVVIADKFA DANSKVVPA+AIPDGWMGLD+GPD
Sbjct  244  EEDKLDLGTSLMEKAKSKGVSLLLPTDVVIADKFAADANSKVVPATAIPDGWMGLDVGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++K+ ++AL+TTKT+IWNGPMGVFEFDKFA GTE++
Sbjct  304  AIKSFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAI  339


 Score =   104 bits (260),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVL  396

Query  282  ALDEA  268
            ALD+A
Sbjct  397  ALDDA  401



>emb|CDY43401.1| BnaA01g30320D [Brassica napus]
Length=480

 Score =   165 bits (418),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAKAKGVSLLLPTDVV+ADKFAPDANSKVV AS I DGWMGLDIGPD
Sbjct  318  EEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDANSKVVSASGIEDGWMGLDIGPD  377

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT N+AL+TT+TVIWNGPMGVFE +KFA GTE++
Sbjct  378  SIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAI  413


 Score =   106 bits (265),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            + KLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGVIALD
Sbjct  414  ANKLAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIALD  473

Query  273  EAVPV  259
            EA+ V
Sbjct  474  EAIAV  478



>gb|AIZ68220.1| phosphoglycerate kinase [Ornithogalum saundersiae]
Length=401

 Score =   171 bits (434),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT+LLEKAK+KGVSLLLPTD+V+ADKFA DANSKVVPASAIPDGWMGLDIGPD
Sbjct  244  EEDKLSLATALLEKAKSKGVSLLLPTDIVVADKFAADANSKVVPASAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT  ++L+TTKTVIWNGPMGVFEFDKFA GTE++
Sbjct  304  SIKTFGESLDTTKTVIWNGPMGVFEFDKFAAGTEAI  339


 Score =   100 bits (249),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAEL+GKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+AL+
Sbjct  340  AKKLAELTGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKSLPGVLALN  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>ref|XP_009135249.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic [Brassica 
rapa]
Length=484

 Score =   168 bits (426),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAKAKGVSLLLPTDVV+ADKFAPDANSKVVPAS I DGWMGLDIGPD
Sbjct  322  EEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDANSKVVPASGIEDGWMGLDIGPD  381

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT N+AL+TT+TVIWNGPMGVFE +KFA GTE+V
Sbjct  382  SIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAV  417


 Score =   103 bits (257),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ + KLAELS KGVTTIIGGGDSVAAV KVGVA VMSHISTGGGASLELLEGK LPGVI
Sbjct  415  EAVANKLAELSEKGVTTIIGGGDSVAAVGKVGVAGVMSHISTGGGASLELLEGKVLPGVI  474

Query  282  ALDEAVPV  259
            ALDEA+ V
Sbjct  475  ALDEAITV  482



>ref|XP_008383158.1| PREDICTED: phosphoglycerate kinase, cytosolic [Malus domestica]
Length=401

 Score =   169 bits (427),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SLLEKAK+KGVS+LLPTDVVIADKFA DANSKVVPASAIPDGWMGLDIGPD
Sbjct  244  EEDKLDLAKSLLEKAKSKGVSILLPTDVVIADKFAADANSKVVPASAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TT+T+IWNGPMGVFEF+KFA GTE++
Sbjct  304  SIKTFSEALDTTQTIIWNGPMGVFEFEKFAAGTEAI  339


 Score =   102 bits (255),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD
Sbjct  340  AKKLAELSGKGVTTIIGGGDSVAAVEKAGLAEKMSHISTGGGASLELLEGKTLPGVLALD  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>ref|XP_011095716.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Sesamum indicum]
 ref|XP_011095717.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Sesamum indicum]
 ref|XP_011095718.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Sesamum indicum]
Length=401

 Score =   169 bits (427),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            E DKL LATSL+EKAKAKGVSLLLP+DVVIADKFA DANSKVVPAS IPDGWMGLDIGPD
Sbjct  244  EADKLDLATSLIEKAKAKGVSLLLPSDVVIADKFAADANSKVVPASQIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+K+  +ALETTKT+IWNGPMGVFEFDKFA GTE++
Sbjct  304  SIKSFGEALETTKTIIWNGPMGVFEFDKFAAGTEAI  339


 Score =   102 bits (255),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVL  396

Query  282  ALDEA  268
            AL++A
Sbjct  397  ALNDA  401



>gb|KCW71393.1| hypothetical protein EUGRSUZ_F04463 [Eucalyptus grandis]
Length=345

 Score =   168 bits (425),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAK+KGVSLLLPTDVVIA+KFA DA+SK+VPASAIPDGWMGLDIGPD
Sbjct  188  EEDKLDLATSLLEKAKSKGVSLLLPTDVVIANKFAADADSKIVPASAIPDGWMGLDIGPD  247

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT  +AL+TTKTVIWNGPMGVFEF+KFA GTE+V
Sbjct  248  SIKTFGEALDTTKTVIWNGPMGVFEFEKFAAGTEAV  283


 Score =   103 bits (258),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  281  EAVAKKLAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVL  340

Query  282  ALDEA  268
            ALD+A
Sbjct  341  ALDDA  345



>gb|ACJ11718.1| phosphoglycerate kinase [Gossypium hirsutum]
 gb|KHG14087.1| Phosphoglycerate kinase, cytosolic [Gossypium arboreum]
Length=401

 Score =   168 bits (426),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAKAKGVSLLLP+DVV+ADKFA DANSKVVPAS IPDGWMGLDIGPD
Sbjct  244  EEDKLDLATSLLEKAKAKGVSLLLPSDVVVADKFAADANSKVVPASGIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT +++L+TT+T+IWNGPMGVFEF+KFA GTE+V
Sbjct  304  SIKTFSESLDTTQTIIWNGPMGVFEFEKFAAGTEAV  339


 Score =   103 bits (256),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK+LPGV+
Sbjct  337  EAVAKKLAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKQLPGVL  396

Query  282  ALDEA  268
            AL++A
Sbjct  397  ALNDA  401



>emb|CDY24247.1| BnaC01g38270D [Brassica napus]
Length=481

 Score =   165 bits (417),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAKAKGVSLLLPTDVV+ADKFAPDANSKVV AS I DGWMGLDIGPD
Sbjct  319  EEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDANSKVVSASGIEDGWMGLDIGPD  378

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT N+AL+TT+TVIWNGPMGVFE +KFA GTE++
Sbjct  379  SIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAI  414


 Score =   106 bits (264),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            + KLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGVIALD
Sbjct  415  ANKLAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIALD  474

Query  273  EAVPV  259
            EA+ V
Sbjct  475  EAIAV  479



>dbj|BAA33801.1| cytosolic phosphoglycerate kinase 1 [Populus nigra]
Length=401

 Score =   167 bits (424),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAK KGV LLLP DVV+ADKFAPDANSKVVPAS IPDGWMGLDIGPD
Sbjct  244  EEDKLDLATSLIEKAKVKGVKLLLPADVVVADKFAPDANSKVVPASEIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TTKT+IWNGPMGVFEF+KFA GTE++
Sbjct  304  SIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAI  339


 Score =   102 bits (254),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ ++KLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAIARKLAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVL  396

Query  282  ALDEA  268
            ALD+A
Sbjct  397  ALDDA  401



>gb|KDP25066.1| hypothetical protein JCGZ_22601 [Jatropha curcas]
Length=401

 Score =   164 bits (414),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA +L+EKAKAKGV LLLPTDVVIADKFA DANSKVVPAS+IPDGW+GLD+GPD
Sbjct  244  EEDKLDLANTLMEKAKAKGVFLLLPTDVVIADKFAADANSKVVPASSIPDGWLGLDVGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S++T  +AL+TTKTVIWNGPMGVFEF+KFAVGTE++
Sbjct  304  SIQTFCEALDTTKTVIWNGPMGVFEFEKFAVGTEAI  339


 Score =   106 bits (264),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+ALD
Sbjct  340  AKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLPGVLALD  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>ref|NP_001275451.1| phosphoglycerate kinase, cytosolic-like [Solanum tuberosum]
 gb|ABB87110.1| unknown [Solanum tuberosum]
Length=401

 Score =   165 bits (417),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DANSK+VPAS IPDGWMGLDIGPD
Sbjct  244  EEDKLDLATSLMEKAKTKGVSLLLPTDVVIADKFAADANSKIVPASEIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++K+   AL+TTK +IWNGPMGVFEFDKFA GTE++
Sbjct  304  AIKSFGSALDTTKNIIWNGPMGVFEFDKFAAGTEAI  339


 Score =   105 bits (261),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD
Sbjct  340  AKKLAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKPLPGVLALD  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>gb|EYU33791.1| hypothetical protein MIMGU_mgv1a006853mg [Erythranthe guttata]
Length=429

 Score =   171 bits (434),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAKAKGVSLLLP+DVVIADKF+PDANSK+VPAS IPDGWMGLDIGPD
Sbjct  272  EEDKLDLATSLLEKAKAKGVSLLLPSDVVIADKFSPDANSKIVPASEIPDGWMGLDIGPD  331

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TTKT+IWNGPMGVFEF+KFA GTE++
Sbjct  332  SIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAI  367


 Score = 99.0 bits (245),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAEL  KGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  365  EAIAKKLAELGDKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKPLPGVL  424

Query  282  ALDEA  268
            AL++A
Sbjct  425  ALNDA  429



>ref|XP_010941660.1| PREDICTED: phosphoglycerate kinase, cytosolic isoform X1 [Elaeis 
guineensis]
Length=409

 Score =   167 bits (424),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT+L+EKAK+KGVSLLLPTDVV+ADKFA DA+SKVVPAS IPDGWMGLDIGPD
Sbjct  252  EEDKLDLATALIEKAKSKGVSLLLPTDVVVADKFAADADSKVVPASGIPDGWMGLDIGPD  311

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++ LE+TKT+IWNGPMGVFEFDKFAVGTE++
Sbjct  312  SIKTFSETLESTKTIIWNGPMGVFEFDKFAVGTEAI  347


 Score =   102 bits (253),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLA+LSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  345  EAIAKKLADLSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKSLPGVL  404

Query  282  ALDEA  268
            ALD+A
Sbjct  405  ALDDA  409



>ref|XP_002263950.1| PREDICTED: phosphoglycerate kinase, cytosolic [Vitis vinifera]
 emb|CAN81988.1| hypothetical protein VITISV_000723 [Vitis vinifera]
Length=401

 Score =   169 bits (428),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAK+KGVSLLLP DVVIADKFA DANSKVVPAS IPDGWMGLDIGPD
Sbjct  244  EEDKLDLATSLLEKAKSKGVSLLLPADVVIADKFAADANSKVVPASCIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT  ++L+TTKT+IWNGPMGVFEFDKFA+GTE++
Sbjct  304  SIKTFGESLDTTKTIIWNGPMGVFEFDKFALGTEAI  339


 Score =   100 bits (249),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLA+LS KGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAIAKKLADLSEKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKTLPGVL  396

Query  282  ALDEA  268
            ALD+A
Sbjct  397  ALDDA  401



>ref|XP_010941661.1| PREDICTED: phosphoglycerate kinase, cytosolic isoform X2 [Elaeis 
guineensis]
Length=401

 Score =   167 bits (423),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT+L+EKAK+KGVSLLLPTDVV+ADKFA DA+SKVVPAS IPDGWMGLDIGPD
Sbjct  244  EEDKLDLATALIEKAKSKGVSLLLPTDVVVADKFAADADSKVVPASGIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++ LE+TKT+IWNGPMGVFEFDKFAVGTE++
Sbjct  304  SIKTFSETLESTKTIIWNGPMGVFEFDKFAVGTEAI  339


 Score =   102 bits (253),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLA+LSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAIAKKLADLSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKSLPGVL  396

Query  282  ALDEA  268
            ALD+A
Sbjct  397  ALDDA  401



>gb|AAO63774.1| 3-phosphoglycerate kinase [Populus tremuloides]
Length=401

 Score =   167 bits (422),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAK KGV LLLP DVV+ADKFAPDANSKVV AS IPDGWMGLDIGPD
Sbjct  244  EEDKLDLATSLIEKAKVKGVKLLLPADVVVADKFAPDANSKVVAASEIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT N+AL+TTKT+IWNGPMGVFEF+KFA GTE++
Sbjct  304  SIKTFNEALDTTKTIIWNGPMGVFEFEKFAAGTEAI  339


 Score =   102 bits (255),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ ++KLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAIARKLAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVL  396

Query  282  ALDEA  268
            ALD+A
Sbjct  397  ALDDA  401



>gb|ABK92531.1| unknown [Populus trichocarpa]
Length=401

 Score =   167 bits (422),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAK KGV LLLP DV++ADKFAPDANSKVVPAS IPDGWMGLDIGPD
Sbjct  244  EEDKLDLATSLIEKAKVKGVKLLLPADVLVADKFAPDANSKVVPASEIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TTKT+IWNGPMGVFEF+KFA GTE++
Sbjct  304  SIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAI  339


 Score =   102 bits (255),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ ++KLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAIARKLAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVL  396

Query  282  ALDEA  268
            ALD+A
Sbjct  397  ALDDA  401



>ref|XP_008226131.1| PREDICTED: phosphoglycerate kinase, cytosolic [Prunus mume]
Length=401

 Score =   168 bits (426),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SLLEKAKAKGVS+LLPTDVVIADKFA DANSKVVPASAIPDGWMGLDIGPD
Sbjct  244  EEDKLDLAKSLLEKAKAKGVSILLPTDVVIADKFAADANSKVVPASAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL TT+T+IWNGPMGVFEF+KFA GTE++
Sbjct  304  SIKTFSEALVTTQTIIWNGPMGVFEFEKFAAGTEAI  339


 Score =   100 bits (250),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELS KGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD
Sbjct  340  AKKLAELSDKGVTTIIGGGDSVAAVEKAGLAEKMSHISTGGGASLELLEGKSLPGVLALD  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>ref|XP_010936568.1| PREDICTED: phosphoglycerate kinase, cytosolic [Elaeis guineensis]
Length=401

 Score =   165 bits (418),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAK+KGVSLLLPTDVV+ADKFA DA+SKVVPAS IPDGWMGLDIGPD
Sbjct  244  EEDKLDLATSLLEKAKSKGVSLLLPTDVVVADKFAADADSKVVPASGIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT  + LE+TK +IWNGPMGVFEF+KFAVGTE++
Sbjct  304  SIKTFCETLESTKAIIWNGPMGVFEFEKFAVGTEAI  339


 Score =   103 bits (258),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLA+LSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAIAKKLADLSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKSLPGVL  396

Query  282  ALDEA  268
            ALD+A
Sbjct  397  ALDDA  401



>ref|XP_007213914.1| hypothetical protein PRUPE_ppa005669mg [Prunus persica]
 gb|EMJ15113.1| hypothetical protein PRUPE_ppa005669mg [Prunus persica]
Length=449

 Score =   168 bits (425),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SLLEKAKAKGVS+LLPTDVVIADKFA DANSKVVPASAIPDGWMGLDIGPD
Sbjct  292  EEDKLDLAKSLLEKAKAKGVSILLPTDVVIADKFAADANSKVVPASAIPDGWMGLDIGPD  351

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL TT+T+IWNGPMGVFEF+KFA GTE++
Sbjct  352  SIKTFSEALVTTQTIIWNGPMGVFEFEKFAAGTEAI  387


 Score =   100 bits (250),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELS KGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD
Sbjct  388  AKKLAELSDKGVTTIIGGGDSVAAVEKAGLAEKMSHISTGGGASLELLEGKSLPGVLALD  447

Query  273  EA  268
            +A
Sbjct  448  DA  449



>emb|CDY52872.1| BnaCnng23600D [Brassica napus]
Length=797

 Score =   164 bits (414),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAKAKGVSLLLPTDVV+ADKFAPDANSKVV AS I DGWMGLDIGPD
Sbjct  640  EEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDANSKVVSASGIEDGWMGLDIGPD  699

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT N+AL+TT+TVIWNGPMGVFE +KFA GTE++
Sbjct  700  SIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAI  735


 Score =   105 bits (261),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            + KLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEGK LPGVIALD
Sbjct  736  ANKLAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIALD  795

Query  273  EA  268
            EA
Sbjct  796  EA  797



>emb|CBI24183.3| unnamed protein product [Vitis vinifera]
Length=349

 Score =   169 bits (428),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAK+KGVSLLLP DVVIADKFA DANSKVVPAS IPDGWMGLDIGPD
Sbjct  192  EEDKLDLATSLLEKAKSKGVSLLLPADVVIADKFAADANSKVVPASCIPDGWMGLDIGPD  251

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT  ++L+TTKT+IWNGPMGVFEFDKFA+GTE++
Sbjct  252  SIKTFGESLDTTKTIIWNGPMGVFEFDKFALGTEAI  287


 Score =   100 bits (248),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLA+LS KGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  285  EAIAKKLADLSEKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKTLPGVL  344

Query  282  ALDEA  268
            ALD+A
Sbjct  345  ALDDA  349



>ref|XP_009777860.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Nicotiana 
sylvestris]
Length=401

 Score =   162 bits (411),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAKAKGVSLLLP DVVIADKF+ DANSK+VPAS IPDGWMGLDIGPD
Sbjct  244  EEDKLDLATSLIEKAKAKGVSLLLPADVVIADKFSADANSKIVPASEIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++K+  +AL+TTKT+IWNGPMGVFEF+ FA GTE++
Sbjct  304  AIKSFGEALDTTKTIIWNGPMGVFEFENFAAGTEAI  339


 Score =   106 bits (264),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+ALD
Sbjct  340  AKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLPGVLALD  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>ref|XP_002513352.1| phosphoglycerate kinase, putative [Ricinus communis]
 gb|EEF48755.1| phosphoglycerate kinase, putative [Ricinus communis]
Length=401

 Score =   164 bits (414),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            E DKL LA+SL+EKAKAKGV LLLPTDVVIADKFA DANSKVVPAS+IPDGWMGLD+GPD
Sbjct  244  EGDKLDLASSLIEKAKAKGVDLLLPTDVVIADKFAADANSKVVPASSIPDGWMGLDVGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++KT  +AL+TT+T+IWNGPMGVFEFDKFAVGTE++
Sbjct  304  AIKTFCEALDTTQTIIWNGPMGVFEFDKFAVGTEAI  339


 Score =   104 bits (260),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVL  396

Query  282  ALDEA  268
            ALD+A
Sbjct  397  ALDDA  401



>gb|ABR16231.1| unknown [Picea sitchensis]
Length=472

 Score =   159 bits (401),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            E+DK+ LA++L++KAK KGVSLLLPTDVVIADKFA DANSKVVPAS IPDGWMGLDIG D
Sbjct  310  EDDKIELASTLMKKAKEKGVSLLLPTDVVIADKFAADANSKVVPASDIPDGWMGLDIGAD  369

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TTKTVIWNGPMGVFEFDKF++GT S+
Sbjct  370  SIKTFSEALDTTKTVIWNGPMGVFEFDKFSLGTTSI  405


 Score =   110 bits (274),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -1

Query  459  SQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  280
            S +KKLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+A
Sbjct  404  SIAKKLAELSGKGVTTIIGGGDSVAAVEKAGLAEKMSHISTGGGASLELLEGKTLPGVLA  463

Query  279  LDEAVPV  259
            LD+AVPV
Sbjct  464  LDDAVPV  470



>gb|EEC71648.1| hypothetical protein OsI_04088 [Oryza sativa Indica Group]
Length=449

 Score =   157 bits (397),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            E+DKL LATSLL KAK KGVSL+LPTDV++ADKFAP+AN +VV A AIPDGWMGLDIGPD
Sbjct  292  EDDKLELATSLLAKAKEKGVSLMLPTDVIVADKFAPEANCQVVSAYAIPDGWMGLDIGPD  351

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SV   + ALETT+TVIWNGPMGVFEF+KFAVGTE++
Sbjct  352  SVAAFSSALETTQTVIWNGPMGVFEFEKFAVGTEAI  387


 Score =   111 bits (277),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGG DSVAAVEKVGVA+VMSHISTGGGASLELLEGKELPGV+ALD
Sbjct  388  AKKLAELSGKGVTTIIGGKDSVAAVEKVGVANVMSHISTGGGASLELLEGKELPGVVALD  447

Query  273  EA  268
            EA
Sbjct  448  EA  449



>gb|ABK24564.1| unknown [Picea sitchensis]
Length=507

 Score =   159 bits (401),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            E+DK+ LA++L++KAK KGVSLLLPTDVVIADKFA DANSKVVPAS IPDGWMGLDIG D
Sbjct  345  EDDKIELASTLMKKAKEKGVSLLLPTDVVIADKFAADANSKVVPASDIPDGWMGLDIGAD  404

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TTKTVIWNGPMGVFEFDKF++GT S+
Sbjct  405  SIKTFSEALDTTKTVIWNGPMGVFEFDKFSLGTTSI  440


 Score =   109 bits (273),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -1

Query  459  SQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  280
            S +KKLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+A
Sbjct  439  SIAKKLAELSGKGVTTIIGGGDSVAAVEKAGLAEKMSHISTGGGASLELLEGKTLPGVLA  498

Query  279  LDEAVPV  259
            LD+AVPV
Sbjct  499  LDDAVPV  505



>ref|XP_002315067.1| cytosolic phosphoglycerate kinase family protein [Populus trichocarpa]
 gb|EEF01238.1| cytosolic phosphoglycerate kinase family protein [Populus trichocarpa]
Length=401

 Score =   166 bits (419),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAK KGV LLLPTDVV+ADKFAPDANSKVVPAS I DGWMGLDIGPD
Sbjct  244  EEDKLDLATSLIEKAKVKGVKLLLPTDVVVADKFAPDANSKVVPASEIADGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TTKT+IWNGPMGVFEF+KFA GTE++
Sbjct  304  SIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAI  339


 Score =   102 bits (255),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -1

Query  447  KLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            KLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  342  KLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_009124670.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Brassica 
rapa]
Length=480

 Score =   165 bits (418),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAKAKGVSLLLPTDVV+ADKFAPDANSKVV AS I DGWMGLDIGPD
Sbjct  318  EEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDANSKVVSASGIEDGWMGLDIGPD  377

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT N+AL+TT+TVIWNGPMGVFE +KFA GTE++
Sbjct  378  SIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAI  413


 Score =   102 bits (255),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            + KLAELS KGVTTIIGGGDSVAAV KVGVA VMSHISTGGGASLELLEGK LPGVIALD
Sbjct  414  ANKLAELSEKGVTTIIGGGDSVAAVGKVGVAGVMSHISTGGGASLELLEGKVLPGVIALD  473

Query  273  EAVPV  259
            EA+ V
Sbjct  474  EAIAV  478



>ref|XP_010537804.1| PREDICTED: phosphoglycerate kinase, cytosolic [Tarenaya hassleriana]
 ref|XP_010537805.1| PREDICTED: phosphoglycerate kinase, cytosolic [Tarenaya hassleriana]
Length=401

 Score =   162 bits (410),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL+EKAKAKGVSLLLP+DVVIA+KFA DA+SKVV AS IPDGWMGLDIGPD
Sbjct  244  EEDKLELAKSLMEKAKAKGVSLLLPSDVVIANKFAADADSKVVSASDIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT  +AL+TT+T+IWNGPMGVFEFDKFAVGTE++
Sbjct  304  SIKTFGEALDTTQTIIWNGPMGVFEFDKFAVGTETI  339


 Score =   105 bits (263),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ ++KLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+
Sbjct  337  ETIARKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLPGVL  396

Query  282  ALDEA  268
            ALD+A
Sbjct  397  ALDDA  401



>ref|XP_009618219.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Nicotiana 
tomentosiformis]
Length=401

 Score =   162 bits (409),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            E+DKL LATSL+EKAKAKGVSLLLP DVVIADKFA DANSKVVPA+ IPDGWMGLDIGPD
Sbjct  244  EDDKLDLATSLIEKAKAKGVSLLLPADVVIADKFAVDANSKVVPATEIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++K+  +AL+TTKT+IWNGPMGVFEF+KFA GTE++
Sbjct  304  AIKSFGEALDTTKTIIWNGPMGVFEFEKFASGTEAI  339


 Score =   106 bits (264),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+
Sbjct  337  EAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKQLPGVL  396

Query  282  ALDEA  268
            ALD+A
Sbjct  397  ALDDA  401



>gb|AGV54662.1| phosphoglycerate kinase chloroplastic-like protein [Phaseolus 
vulgaris]
Length=477

 Score =   165 bits (418),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT+LL KAK KGV  LLP+DVVIADKFAPDANSKVVPA AIPDGWMGLDIGPD
Sbjct  315  EEDKLDLATTLLAKAKEKGVFFLLPSDVVIADKFAPDANSKVVPAFAIPDGWMGLDIGPD  374

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
             VK+ N+AL+TTKT+IWNGPMGVFEFDKFAVGTE++
Sbjct  375  FVKSFNEALDTTKTIIWNGPMGVFEFDKFAVGTEAI  410


 Score =   102 bits (255),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLA+ S KGV  IIGGGD VAAVEKVGVA+VMSHI TGGGASLELLEGKELPGV+
Sbjct  408  EAIAKKLADFSEKGVPPIIGGGDFVAAVEKVGVANVMSHIFTGGGASLELLEGKELPGVV  467

Query  282  ALDEAVPV  259
            A DEA PV
Sbjct  468  AFDEAPPV  475



>sp|P29409.2|PGKH_SPIOL RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor, partial [Spinacia oleracea]
 emb|CAA48479.1| phosphoglycerate kinase [Spinacia oleracea]
Length=433

 Score =   164 bits (415),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAK KGVSLLLPTDVVIADKFA DA+SK+VPAS IPDGWMGLDIGPD
Sbjct  271  EEDKLDLATSLLAKAKEKGVSLLLPTDVVIADKFAADADSKIVPASGIPDGWMGLDIGPD  330

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TT+TVIWNGPMGVFEF+KFA GTE++
Sbjct  331  SIKTFSEALDTTQTVIWNGPMGVFEFEKFAAGTEAI  366


 Score =   103 bits (257),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKL E+S KG TTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK+LPGV+AL+
Sbjct  367  AKKLEEISKKGATTIIGGGDSVAAVEKVGVAEAMSHISTGGGASLELLEGKQLPGVLALN  426

Query  273  EAVPV  259
            EA PV
Sbjct  427  EADPV  431



>ref|XP_009414502.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   166 bits (420),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAK+KGVSLLLPTDV+IADKFA DANS VVPAS IPDGWMGLDIGPD
Sbjct  244  EEDKLDLATSLLEKAKSKGVSLLLPTDVLIADKFAADANSMVVPASGIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT +++L+TTKT+IWNGPMGVFEF+KFA+GTE++
Sbjct  304  SIKTFSESLDTTKTIIWNGPMGVFEFEKFALGTEAI  339


 Score =   101 bits (251),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAELS  GVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAIAKKLAELSASGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVL  396

Query  282  ALDEA  268
            ALD+A
Sbjct  397  ALDDA  401



>ref|XP_002312237.1| hypothetical protein POPTR_0008s08400g [Populus trichocarpa]
 gb|EEE89604.1| hypothetical protein POPTR_0008s08400g [Populus trichocarpa]
Length=401

 Score =   164 bits (416),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAK KGV LLLP DV++ADKFAPDANSKVVPAS IPDGWMGLDIGPD
Sbjct  244  EEDKLDLATSLIEKAKVKGVKLLLPADVLVADKFAPDANSKVVPASEIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+ T ++AL+TTKT+IWNGPMGVFEF+KFA GTE++
Sbjct  304  SITTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAI  339


 Score =   102 bits (255),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ ++KLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAIARKLAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVL  396

Query  282  ALDEA  268
            ALD+A
Sbjct  397  ALDDA  401



>ref|XP_009399252.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   165 bits (418),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAK+KGVSLLLPTDVV+ADKFA DA SK+VPAS IPDGWMGLDIGPD
Sbjct  244  EEDKLNLATSLLEKAKSKGVSLLLPTDVVVADKFAADAESKIVPASGIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+K+ +  LE+TKT+IWNGPMGVFE++KFAVGTE++
Sbjct  304  SIKSFSGTLESTKTIIWNGPMGVFEYEKFAVGTEAI  339


 Score =   101 bits (252),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLA+LSG GVTTIIGGGDSVAAVEKVG+A+ MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAIAKKLADLSGSGVTTIIGGGDSVAAVEKVGLAAKMSHISTGGGASLELLEGKTLPGVL  396

Query  282  ALDEA  268
            ALD+A
Sbjct  397  ALDDA  401



>gb|ABB86242.1| phosphoglycerate kinase-like [Solanum tuberosum]
Length=402

 Score =   162 bits (409),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            +EDKL LATSL+EKAK KGVSLLLPTDVVIADKFA +ANSK+VPAS IPDGWMGLD GPD
Sbjct  245  KEDKLDLATSLMEKAKTKGVSLLLPTDVVIADKFAANANSKIVPASEIPDGWMGLDFGPD  304

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++K+   AL+TTKT+IWNGPMGVFEFDKFA GTE++
Sbjct  305  AIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAI  340


 Score =   105 bits (261),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD
Sbjct  341  AKKLAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKPLPGVLALD  400

Query  273  EA  268
            +A
Sbjct  401  DA  402



>ref|XP_004139837.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Cucumis sativus]
 ref|XP_004159164.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Cucumis sativus]
 gb|KGN44288.1| hypothetical protein Csa_7G239010 [Cucumis sativus]
Length=401

 Score =   162 bits (409),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAKAKGVSLLLPTDVV+ADKFA DA+SKVV AS+IPDGWMGLDIGPD
Sbjct  244  EEDKLDLATSLIEKAKAKGVSLLLPTDVVVADKFAADADSKVVAASSIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+K+  +AL++T+T+IWNGPMGVFEF+KFA GTE++
Sbjct  304  SIKSFGEALDSTQTIIWNGPMGVFEFEKFAAGTEAI  339


 Score =   105 bits (261),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD
Sbjct  340  AKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVLALD  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>ref|XP_006858233.1| hypothetical protein AMTR_s00062p00191350 [Amborella trichopoda]
 gb|ERN19700.1| hypothetical protein AMTR_s00062p00191350 [Amborella trichopoda]
Length=401

 Score =   167 bits (423),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAKAKGV+LLLPTDVV+ADKFAPDA SKVVPAS IP+GWMGLDIGPD
Sbjct  244  EEDKLDLATSLLEKAKAKGVALLLPTDVVVADKFAPDAESKVVPASEIPEGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT NDALE  KT+IWNGPMGVFEF+KFA GT+++
Sbjct  304  SIKTFNDALEPAKTIIWNGPMGVFEFEKFAAGTKAI  339


 Score = 99.4 bits (246),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELS KGVTTIIGGGDSVAAVE+ G+A  MSHISTGGGASLELLEGK LPGV+ALD
Sbjct  340  AKKLAELSEKGVTTIIGGGDSVAAVEQAGLADKMSHISTGGGASLELLEGKPLPGVLALD  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>ref|XP_007149209.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
 ref|XP_007149210.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
 gb|ESW21203.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
 gb|ESW21204.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
Length=401

 Score =   165 bits (418),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAKAKGVSLLLPTDVVIADKFA DANSK V AS+IPDGWMGLDIGPD
Sbjct  244  EEDKLDLATSLLEKAKAKGVSLLLPTDVVIADKFAADANSKTVSASSIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+ T+TVIWNGPMGVFEF+KFA GTE++
Sbjct  304  SIKTFSEALDATQTVIWNGPMGVFEFEKFAAGTEAI  339


 Score =   101 bits (252),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+AL+
Sbjct  340  AKKLAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALN  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>ref|XP_008447095.1| PREDICTED: phosphoglycerate kinase, cytosolic [Cucumis melo]
Length=401

 Score =   163 bits (413),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAKAKGVSLLLPTDVV+ADKFA DA+SKVV AS+IPDGWMGLDIGPD
Sbjct  244  EEDKLDLATSLIEKAKAKGVSLLLPTDVVVADKFAADADSKVVAASSIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+K+  +AL++T+T+IWNGPMGVFEFDKFA GTE++
Sbjct  304  SIKSFGEALDSTQTIIWNGPMGVFEFDKFAAGTEAI  339


 Score =   103 bits (256),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV ALD
Sbjct  340  AKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVSALD  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>ref|XP_011013857.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Populus euphratica]
Length=481

 Score =   177 bits (450),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKLGLATSLLEKAKAKGVSLLLP+DV+IADKFAPDANSK VPASAIPDGWMGLDIGP+
Sbjct  319  EEDKLGLATSLLEKAKAKGVSLLLPSDVIIADKFAPDANSKTVPASAIPDGWMGLDIGPE  378

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT ++AL TT+TVIWNGPMGVFEFDKFAVGTE++
Sbjct  379  SVKTFSEALGTTQTVIWNGPMGVFEFDKFAVGTEAI  414


 Score = 88.6 bits (218),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 58/66 (88%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELS KGVTTIIGGGDSVAAVEKVGVA VMSHISTGGGASLELLEG+ELPGV+ALD
Sbjct  415  AKKLAELSSKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGEELPGVLALD  474

Query  273  EAVPVA  256
            E   VA
Sbjct  475  EVERVA  480



>ref|XP_009146585.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic [Brassica 
rapa]
Length=477

 Score =   165 bits (417),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLL KAKAKGVSLLLPTDVV+ADKFAPDANSKVV AS I DGWMGLDIGPD
Sbjct  320  EEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDANSKVVSASGIEDGWMGLDIGPD  379

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT N+AL+TT+TVIWNGPMGVFE +KFA GTE++
Sbjct  380  SIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAI  415


 Score =   101 bits (251),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            + KLAELS KGVTTIIGGGDSVAAV KVGVA VMSHISTGGGASLELLEGK LPGVIALD
Sbjct  416  ANKLAELSEKGVTTIIGGGDSVAAVGKVGVAGVMSHISTGGGASLELLEGKVLPGVIALD  475

Query  273  EA  268
            EA
Sbjct  476  EA  477



>gb|AAX57302.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57303.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57304.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57305.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57306.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57307.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57308.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57309.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57310.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57311.1| putative phospho-glycerate kinase, partial [Solanum peruvianum]
 gb|AAX57312.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57313.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57314.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57315.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57316.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57317.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57318.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57319.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57320.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57321.1| putative phospho-glycerate kinase, partial [Solanum chilense]
 gb|AAX57322.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAX57324.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAX57325.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAX57326.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAX57327.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAX57328.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAX57329.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAZ85283.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85284.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85285.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85286.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85287.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85288.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85289.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85290.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85291.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|AAZ85292.1| putative phosphoglycerate kinase, partial [Solanum pimpinellifolium]
 gb|ABS19549.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19552.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19557.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   166 bits (421),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DANSK+VPAS IPDGWMGLDIGPD
Sbjct  71   EEDKLDLATSLMEKAKTKGVSLLLPTDVVIADKFAADANSKIVPASEIPDGWMGLDIGPD  130

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++K+   AL+TTKT+IWNGPMGVFEFDKFA GTE++
Sbjct  131  AIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAI  166


 Score = 99.4 bits (246),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 52/58 (90%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  280
            +KKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  167  AKKLAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>gb|ABS19535.1| CT114 [Solanum chilense]
Length=224

 Score =   166 bits (421),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DANSK+VPAS IPDGWMGLDIGPD
Sbjct  71   EEDKLDLATSLMEKAKTKGVSLLLPTDVVIADKFAADANSKIVPASEIPDGWMGLDIGPD  130

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++K+   AL+TTKT+IWNGPMGVFEFDKFA GTE++
Sbjct  131  AIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAI  166


 Score = 99.4 bits (246),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 52/58 (90%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  280
            +KKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  167  AKKLAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>gb|AGT16255.1| phosphoglycerate kinase [Saccharum hybrid cultivar R570]
Length=489

 Score =   158 bits (400),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            E+DKL LA SLL+KAK KGVSL+LP DVVIADKFAPDA+S+VVPASAIPD WMGLDIGPD
Sbjct  332  EDDKLELAISLLKKAKEKGVSLMLPIDVVIADKFAPDASSQVVPASAIPDAWMGLDIGPD  391

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+   + ALETT+TVIWNGPMGVFEFDKF+VGT+++
Sbjct  392  SISAFSSALETTQTVIWNGPMGVFEFDKFSVGTKAI  427


 Score =   107 bits (267),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGGGDSVAAVEK GVA  MSHISTGGGASLELLEGKELPGV ALD
Sbjct  428  AKKLAELSGKGVTTIIGGGDSVAAVEKAGVADSMSHISTGGGASLELLEGKELPGVAALD  487

Query  273  EA  268
            EA
Sbjct  488  EA  489



>gb|AAX57323.1| putative phospho-glycerate kinase, partial [Solanum habrochaites]
 gb|AAZ85276.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85278.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85282.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|ABS19539.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19540.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19541.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19542.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19543.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19545.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19546.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19548.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19550.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19551.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19553.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19554.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19555.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19558.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
 gb|ABS19559.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   166 bits (421),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DANSK+VPAS IPDGWMGLDIGPD
Sbjct  71   EEDKLELATSLMEKAKTKGVSLLLPTDVVIADKFAADANSKIVPASEIPDGWMGLDIGPD  130

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++K+   AL+TTKT+IWNGPMGVFEFDKFA GTE++
Sbjct  131  AIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAI  166


 Score = 99.4 bits (246),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 52/58 (90%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  280
            +KKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  167  AKKLAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>ref|XP_008805982.1| PREDICTED: phosphoglycerate kinase, cytosolic [Phoenix dactylifera]
 ref|XP_008776888.1| PREDICTED: phosphoglycerate kinase, cytosolic [Phoenix dactylifera]
Length=400

 Score =   163 bits (412),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = -3

Query  736  EDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPDS  557
            ED+L LAT+LLEKAK+KGVSLLLPTDVV+ADKFA DA+SKVVPAS IPDGWMGLDIGPDS
Sbjct  244  EDQLDLATALLEKAKSKGVSLLLPTDVVVADKFAADADSKVVPASGIPDGWMGLDIGPDS  303

Query  556  VKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            +KT +++L++TKT+IWNGPMGVFEF+KFAVGTE++
Sbjct  304  IKTFSESLDSTKTIIWNGPMGVFEFEKFAVGTEAI  338


 Score =   102 bits (255),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLA+LSGKGVTTIIGGGDSVAAVEK+G+A  MSHISTGGGASLELLEGK LPGV+ALD
Sbjct  339  AKKLADLSGKGVTTIIGGGDSVAAVEKMGLADKMSHISTGGGASLELLEGKSLPGVLALD  398

Query  273  EA  268
            +A
Sbjct  399  DA  400



>emb|CDP13576.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   162 bits (411),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EED+L LA SL+EKAKAKGV LLLPTDVV ADKFAPDANSKVVPAS IPDGWMGLDIGPD
Sbjct  244  EEDRLDLALSLIEKAKAKGVPLLLPTDVVAADKFAPDANSKVVPASGIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++K+ ++AL+ TKT+IWNGPMGVFE+DKFA GTE++
Sbjct  304  AIKSFSEALDATKTIIWNGPMGVFEYDKFATGTEAI  339


 Score =   103 bits (256),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAELSG GVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAIAKKLAELSGNGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKSLPGVL  396

Query  282  ALDEA  268
            ALD+A
Sbjct  397  ALDDA  401



>gb|ABS19537.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   167 bits (423),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DANSK+VPAS IPDGWMGLDIGPD
Sbjct  71   EEDKLELATSLMEKAKTKGVSLLLPTDVVIADKFAADANSKIVPASEIPDGWMGLDIGPD  130

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++K+   AL+TTKT+IWNGPMGVFEFDKFA GTE++
Sbjct  131  AIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAI  166


 Score = 98.6 bits (244),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  280
            ++KLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  167  ARKLAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>ref|NP_001167912.1| phosphoglycerate kinase [Zea mays]
 gb|ACN26497.1| unknown [Zea mays]
 tpg|DAA57247.1| TPA: phosphoglycerate kinase [Zea mays]
Length=371

 Score =   159 bits (402),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            E+DKL LATSLL KAK KGVSL+LP D+V+ADKFAPDA+S+VVPASAIPD WMGLDIGPD
Sbjct  214  EDDKLELATSLLRKAKEKGVSLMLPFDLVVADKFAPDASSQVVPASAIPDAWMGLDIGPD  273

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESVKE  446
            S+   + ALETT+TVIWNGPMGVFEFDKFAVGT+++ +
Sbjct  274  SISAFSSALETTQTVIWNGPMGVFEFDKFAVGTKAIAK  311


 Score =   106 bits (265),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTI+GGGDS+AAVEKVGVA  +SHISTGGGASLELLEGKELPGV ALD
Sbjct  310  AKKLAELSGKGVTTIVGGGDSIAAVEKVGVADSLSHISTGGGASLELLEGKELPGVAALD  369

Query  273  EA  268
            EA
Sbjct  370  EA  371



>gb|ABS19536.1| CT114 [Solanum chilense]
Length=224

 Score =   166 bits (421),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DANSK+VPAS IPDGWMGLDIGPD
Sbjct  71   EEDKLDLATSLMEKAKTKGVSLLLPTDVVIADKFAADANSKIVPASEIPDGWMGLDIGPD  130

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++K+   AL+TTKT+IWNGPMGVFEFDKFA GTE++
Sbjct  131  AIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAI  166


 Score = 99.4 bits (246),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+
Sbjct  164  EAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVL  223

Query  282  A  280
            A
Sbjct  224  A  224



>gb|EPS64076.1| phosphoglycerate kinase [Genlisea aurea]
Length=401

 Score =   160 bits (405),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            E DKL LATSL++KAKAKGVSLLLP+DVVIADKFA DA+SKVVPAS IPDGWMGLDIGPD
Sbjct  244  EADKLDLATSLIDKAKAKGVSLLLPSDVVIADKFAADASSKVVPASEIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+K+  +AL++T+T+IWNGPMGVFEFDKFA GTE++
Sbjct  304  SIKSFGEALDSTETIIWNGPMGVFEFDKFAAGTEAI  339


 Score =   105 bits (261),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            ++KLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD
Sbjct  340  ARKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVLALD  399

Query  273  EA  268
            EA
Sbjct  400  EA  401



>gb|ABS19544.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   166 bits (421),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DANSK+VPAS IPDGWMGLDIGPD
Sbjct  71   EEDKLELATSLMEKAKTKGVSLLLPTDVVIADKFAADANSKIVPASEIPDGWMGLDIGPD  130

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++K+   AL+TTKT+IWNGPMGVFEFDKFA GTE++
Sbjct  131  AIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAI  166


 Score = 98.6 bits (244),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  280
            +KKLAELSG+GVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  167  AKKLAELSGRGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>dbj|BAA33802.1| cytosolic phosphoglycerate kinase 1 [Populus nigra]
Length=401

 Score =   162 bits (410),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKA+ KGV LLLPTDVV+ADKFA DANSKVVPAS I DGWMGLDIGPD
Sbjct  244  EEDKLDLATSLIEKARVKGVKLLLPTDVVVADKFASDANSKVVPASEIADGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TTKT+IWNGPMGVFEF+KFA GTE++
Sbjct  304  SIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAI  339


 Score =   102 bits (255),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -1

Query  447  KLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            KLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  342  KLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_011013882.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X2 
[Populus euphratica]
Length=401

 Score =   164 bits (415),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAK KGV LLLP DVV+ADKFAPDANSKVVPAS I DGWMGLDIGPD
Sbjct  244  EEDKLDLATSLIEKAKVKGVKLLLPADVVVADKFAPDANSKVVPASEIADGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+TTKT+IWNGPMGVFEF+KFA GTE++
Sbjct  304  SIKTFSEALDTTKTIIWNGPMGVFEFEKFAAGTEAI  339


 Score =   100 bits (250),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -1

Query  447  KLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            KLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  342  KLAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  401



>ref|XP_009104523.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Brassica 
rapa]
Length=401

 Score =   167 bits (423),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL+EKAKAKGVSLLLPTDVVIADKFAPDANSK+V A+AIPDGWMGLDIGPD
Sbjct  244  EEDKLDLARSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVLATAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++AL+T KT+IWNGPMGVFEF+KFA GTE+V
Sbjct  304  SIKTFSEALDTAKTIIWNGPMGVFEFEKFAAGTEAV  339


 Score = 97.8 bits (242),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -1

Query  450  KKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDE  271
            K+LAELSGKGVT IIGGGDSVAAVEKVG+A  MSHISTGGGA LELLEGK  PGV+ALD+
Sbjct  341  KQLAELSGKGVTKIIGGGDSVAAVEKVGLADKMSHISTGGGARLELLEGKPRPGVLALDD  400

Query  270  A  268
            A
Sbjct  401  A  401



>gb|ABF69999.1| phosphoglycerate kinase, putative [Musa acuminata]
Length=401

 Score =   165 bits (418),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAK+KGVSLLLPTDVV+ADKFA DA SK+VPAS IPDGWMGLDIGPD
Sbjct  244  EEDKLNLATSLLEKAKSKGVSLLLPTDVVVADKFAADAESKIVPASGIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+K+ +  LE+TKT+IWNGPMGVFE++KFAVGTE++
Sbjct  304  SIKSFSGTLESTKTIIWNGPMGVFEYEKFAVGTEAI  339


 Score = 99.4 bits (246),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -1

Query  462  QSQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVI  283
            ++ +KKLA+LSG GVTTIIGGGDSVAAVEKVG+A+ MSHISTGGGASLELLEGK LPGV+
Sbjct  337  EAIAKKLADLSGSGVTTIIGGGDSVAAVEKVGLAAKMSHISTGGGASLELLEGKTLPGVL  396

Query  282  ALDEA  268
            AL++A
Sbjct  397  ALEDA  401



>ref|XP_010557291.1| PREDICTED: phosphoglycerate kinase, cytosolic [Tarenaya hassleriana]
Length=432

 Score =   161 bits (407),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL+EKAKAKGVSLLLPTDVV+ADKFA DANSK V AS IP+GWMGLDIGPD
Sbjct  275  EEDKLSLANSLMEKAKAKGVSLLLPTDVVVADKFAADANSKTVSASEIPEGWMGLDIGPD  334

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S++T ++AL+ T+T+IWNGPMGVFEFDKFAVGTE++
Sbjct  335  SIETFSEALDETQTIIWNGPMGVFEFDKFAVGTEAI  370


 Score =   103 bits (257),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELS KGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD
Sbjct  371  AKKLAELSDKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALD  430

Query  273  EA  268
            +A
Sbjct  431  DA  432



>gb|AAZ85273.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85274.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85275.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85277.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85279.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85280.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
 gb|AAZ85281.1| putative phosphoglycerate kinase, partial [Solanum chmielewskii]
Length=224

 Score =   165 bits (417),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAK KGVSLLLPT+VVIADKFA DANSK+VPAS IPDGWMGLDIGPD
Sbjct  71   EEDKLELATSLMEKAKTKGVSLLLPTNVVIADKFAADANSKIVPASEIPDGWMGLDIGPD  130

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++K+   AL+TTKT+IWNGPMGVFEFDKFA GTE++
Sbjct  131  AIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAI  166


 Score = 99.4 bits (246),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 52/58 (90%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  280
            +KKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  167  AKKLAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>gb|ABS19556.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   165 bits (417),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATS +EKAK KGVSLLLPTDVVIADKFA DANSK+VPAS IPDGWMGLDIGPD
Sbjct  71   EEDKLELATSFMEKAKTKGVSLLLPTDVVIADKFAADANSKIVPASEIPDGWMGLDIGPD  130

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++K+   AL+TTKT+IWNGPMGVFEFDKFA GTE++
Sbjct  131  AIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAI  166


 Score = 99.4 bits (246),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 52/58 (90%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  280
            +KKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  167  AKKLAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>gb|ABS19538.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   167 bits (422),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DANSK+VPAS IPDGWMGLDIGPD
Sbjct  71   EEDKLELATSLMEKAKTKGVSLLLPTDVVIADKFAADANSKIVPASEIPDGWMGLDIGPD  130

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++K+   AL+TTKT+IWNGPMGVFEFDKFA GTE++
Sbjct  131  AIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAI  166


 Score = 97.4 bits (241),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  280
            +KKLAELSGKGVTTIIGG DSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  167  AKKLAELSGKGVTTIIGGSDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>ref|XP_008798227.1| PREDICTED: phosphoglycerate kinase, cytosolic [Phoenix dactylifera]
Length=401

 Score =   161 bits (408),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT+L+EKAK+KGVSLLLPTDVV+A+KFA DA++KVVPAS IPDGWMGLDIGPD
Sbjct  244  EEDKLDLATALIEKAKSKGVSLLLPTDVVVANKFAADADTKVVPASGIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+K  ++ L++TKT+IWNGPMGVFEFDKFAVGTE++
Sbjct  304  SIKIFSETLDSTKTIIWNGPMGVFEFDKFAVGTEAI  339


 Score =   102 bits (253),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLA+LSGKG TTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD
Sbjct  340  AKKLADLSGKGATTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKSLPGVLALD  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>emb|CDP16886.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   162 bits (409),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL+EKAKAKGVSLLLPTDVV ADKFA DANSKVVPAS IPDGWMGLDIGP 
Sbjct  244  EEDKLDLALSLIEKAKAKGVSLLLPTDVVAADKFAADANSKVVPASGIPDGWMGLDIGPV  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+K+ ++AL+TTKT+IWNGPMGVFEFDKFA GT+++
Sbjct  304  SIKSFSEALDTTKTIIWNGPMGVFEFDKFAAGTDTI  339


 Score =   100 bits (249),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSG GVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD
Sbjct  340  AKKLAELSGNGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKSLPGVLALD  399

Query  273  EA  268
             A
Sbjct  400  NA  401



>gb|ADV16380.1| cytosolic phosphoglycerate kinase 2 [Helianthus annuus]
Length=400

 Score =   165 bits (418),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAKAKGVSLLLP+DVVIADKFA DANSKVVPA  IPDGWMGLDIGPD
Sbjct  244  EEDKLDLATSLIEKAKAKGVSLLLPSDVVIADKFAADANSKVVPAKEIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+K+ ++ L+TTKTVIWNGPMGVFEF+KFA GTE++
Sbjct  304  SIKSFSETLDTTKTVIWNGPMGVFEFEKFAAGTEAI  339


 Score = 97.1 bits (240),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLAELSGKGVTTIIGG DSVAAVEKVG+A  MSHISTGGGASL+LLEGK LPGV+AL+
Sbjct  340  AKKLAELSGKGVTTIIGG-DSVAAVEKVGLADKMSHISTGGGASLQLLEGKTLPGVLALN  398

Query  273  EA  268
            EA
Sbjct  399  EA  400



>gb|ABS19547.1| CT114, partial [Lycopersicon peruvianum var. humifusum]
Length=224

 Score =   163 bits (412),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAK KGVSLLLPTDVVIADKFA DANSK+VPAS IPDG MGLDIGPD
Sbjct  71   EEDKLELATSLMEKAKTKGVSLLLPTDVVIADKFAADANSKIVPASEIPDGRMGLDIGPD  130

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++K+   AL+TTKT+IWNGPMGVFEFDKFA GTE++
Sbjct  131  AIKSFGSALDTTKTIIWNGPMGVFEFDKFAAGTEAI  166


 Score = 99.4 bits (246),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 52/58 (90%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  280
            +KKLAELSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK+LPGV+A
Sbjct  167  AKKLAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKQLPGVLA  224



>sp|P12783.1|PGKY_WHEAT RecName: Full=Phosphoglycerate kinase, cytosolic [Triticum aestivum]
 emb|CAA33302.1| unnamed protein product [Triticum aestivum]
Length=401

 Score =   159 bits (403),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+E AK+KGV LLLPTDVV+ADKFA DA SK+VPA+AIPDGWMGLD+GPD
Sbjct  244  EEDKLELATSLIETAKSKGVKLLLPTDVVVADKFAADAESKIVPATAIPDGWMGLDVGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT  +AL+TTKTVIWNGPMGVFEF+KFA GT+++
Sbjct  304  SIKTFAEALDTTKTVIWNGPMGVFEFEKFAAGTDAI  339


 Score =   102 bits (254),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +K+LAEL+GKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD
Sbjct  340  AKQLAELTGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALD  399

Query  273  EA  268
            EA
Sbjct  400  EA  401



>dbj|BAJ88371.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=382

 Score =   159 bits (403),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+E AK+KGV LLLPTDVV+ADKFA DA SK+VPA+AIPDGWMGLD+GPD
Sbjct  225  EEDKLELATSLIETAKSKGVKLLLPTDVVVADKFAADAESKIVPATAIPDGWMGLDVGPD  284

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT  +AL+TTKTVIWNGPMGVFEF+KFA GT+++
Sbjct  285  SIKTFAEALDTTKTVIWNGPMGVFEFEKFAAGTDAI  320


 Score =   102 bits (255),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +K+LAEL+GKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD
Sbjct  321  AKQLAELTGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALD  380

Query  273  EA  268
            EA
Sbjct  381  EA  382



>ref|XP_004951776.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Setaria italica]
Length=402

 Score =   165 bits (417),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAKAKGVSLLLPTD+V+ADKFAPDA SK+VPA+AIPD WMGLD+GPD
Sbjct  244  EEDKLELATSLIEKAKAKGVSLLLPTDIVVADKFAPDAESKIVPATAIPDDWMGLDVGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            + KT NDAL+ T+T+IWNGPMGVFEF+KFA GTE++
Sbjct  304  ATKTFNDALDKTQTIIWNGPMGVFEFEKFAAGTEAI  339


 Score = 96.7 bits (239),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 59/66 (89%), Gaps = 1/66 (2%)
 Frame = -1

Query  462  QSQSKKLAELSG-KGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV  286
            ++ +KKLAEL+  KGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV
Sbjct  337  EAIAKKLAELTTTKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGV  396

Query  285  IALDEA  268
            +ALDEA
Sbjct  397  LALDEA  402



>ref|XP_009417722.1| PREDICTED: phosphoglycerate kinase, cytosolic [Musa acuminata 
subsp. malaccensis]
 ref|XP_009417729.1| PREDICTED: phosphoglycerate kinase, cytosolic [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   163 bits (412),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSLLEKAK+KGVSLLLPTDVV ADKFA DAN  VVPAS IPDGWMGLDIGPD
Sbjct  244  EEDKLNLATSLLEKAKSKGVSLLLPTDVVAADKFAADANCMVVPASGIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+K  +++L+TTKT+IWNGPMGVFEF+KFAVGTE++
Sbjct  304  SIKAFSESLDTTKTIIWNGPMGVFEFEKFAVGTEAI  339


 Score = 97.8 bits (242),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLA+LS  GVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD
Sbjct  340  AKKLADLSAAGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKSLPGVLALD  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>ref|NP_001058317.1| Os06g0668200 [Oryza sativa Japonica Group]
 dbj|BAD45436.1| putative cytosolic phosphoglycerate kinase 1 [Oryza sativa Japonica 
Group]
 dbj|BAD45421.1| putative cytosolic phosphoglycerate kinase 1 [Oryza sativa Japonica 
Group]
 dbj|BAF20231.1| Os06g0668200 [Oryza sativa Japonica Group]
 gb|EAZ02017.1| hypothetical protein OsI_24050 [Oryza sativa Indica Group]
 gb|EAZ37949.1| hypothetical protein OsJ_22300 [Oryza sativa Japonica Group]
 dbj|BAG95158.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92099.1| unnamed protein product [Oryza sativa Japonica Group]
Length=401

 Score =   163 bits (413),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAK+KGVSLLLPTD+V+ADKFA DA SK VPASAIPDGWMGLDIGPD
Sbjct  244  EEDKLELATSLIEKAKSKGVSLLLPTDIVVADKFAADAESKTVPASAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++ L+TTKTVIWNGPMGVFEF+KFA GT+++
Sbjct  304  SIKTFSETLDTTKTVIWNGPMGVFEFEKFAAGTDAI  339


 Score = 96.3 bits (238),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLA+++ KGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+AL+
Sbjct  340  AKKLADITAKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALN  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>gb|AFW70281.1| phosphoglycerate kinase [Zea mays]
Length=572

 Score =   162 bits (409),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAKAKGVSLLLPTD+V+ADKFA DA SK+VPA+AIPD WMGLD+GPD
Sbjct  414  EEDKLELATSLIEKAKAKGVSLLLPTDIVVADKFAADAESKIVPATAIPDDWMGLDVGPD  473

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            + KT ++AL+TTKTVIWNGPMGVFEF KFA GTE++
Sbjct  474  ATKTFDEALDTTKTVIWNGPMGVFEFQKFAAGTEAI  509


 Score = 96.3 bits (238),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 57/63 (90%), Gaps = 1/63 (2%)
 Frame = -1

Query  453  SKKLAELSG-KGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIAL  277
            +KKLAEL+  KGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+AL
Sbjct  510  AKKLAELTTTKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLAL  569

Query  276  DEA  268
            D+A
Sbjct  570  DDA  572



>ref|XP_003570108.1| PREDICTED: phosphoglycerate kinase, cytosolic [Brachypodium distachyon]
Length=401

 Score =   157 bits (397),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+E AKAKGV LLLP DVV+ADKFA DA SKVVPASAIPDGWMGLD+GPD
Sbjct  244  EEDKLELATSLIETAKAKGVKLLLPIDVVVADKFAADAESKVVPASAIPDGWMGLDVGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++KT ++AL+T KT+IWNGPMGVFEF+KFA GT+++
Sbjct  304  AIKTFSEALDTCKTIIWNGPMGVFEFEKFAAGTDAI  339


 Score =   100 bits (249),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +K+LAEL+ KGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD
Sbjct  340  AKQLAELTAKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALD  399

Query  273  EA  268
            EA
Sbjct  400  EA  401



>gb|AAC32142.1| phosphoglycerate kinase [Picea mariana]
Length=151

 Score =   144 bits (364),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -3

Query  703  EKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPDSVKTCNDALETT  524
            +KAK KGVSLLLPTDVVIADKFA DANSKVVPAS IPDGWMGLDIG DS+KT ++AL+TT
Sbjct  1    KKAKEKGVSLLLPTDVVIADKFAADANSKVVPASDIPDGWMGLDIGADSIKTFSEALDTT  60

Query  523  KTVIWNGPMGVFEFDKFAVGTESV  452
            KTVIWNGPMGVFEFDKF++GT S+
Sbjct  61   KTVIWNGPMGVFEFDKFSLGTTSI  84


 Score =   113 bits (283),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = -1

Query  459  SQSKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIA  280
            S +KKLAELSGKGVTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPGV+A
Sbjct  83   SIAKKLAELSGKGVTTIIGGGDSVAAVEKVGVAEKMSHISTGGGASLELLEGKTLPGVLA  142

Query  279  LDEAVPV  259
            LDEAVPV
Sbjct  143  LDEAVPV  149



>ref|XP_004966316.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Setaria italica]
Length=401

 Score =   159 bits (402),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAK+KGVSLLLPTDVV+ADKF  +A SK+VPAS+IPDGWMGLDIGPD
Sbjct  244  EEDKLELATSLIEKAKSKGVSLLLPTDVVVADKFDANAESKIVPASSIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT +  L+TTKTVIWNGPMGVFEF+KFA GT+++
Sbjct  304  SIKTFSQTLDTTKTVIWNGPMGVFEFEKFAAGTDAI  339


 Score = 98.6 bits (244),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -1

Query  447  KLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            KLAEL+ KGVTTIIGGGDSVAAVEK G+A+ MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  342  KLAELTAKGVTTIIGGGDSVAAVEKAGLANKMSHISTGGGASLELLEGKTLPGVLALDDA  401



>ref|NP_001142404.1| uncharacterized protein LOC100274579 [Zea mays]
 ref|XP_008681565.1| PREDICTED: uncharacterized protein LOC100274579 isoform X1 [Zea 
mays]
 ref|XP_008681566.1| PREDICTED: uncharacterized protein LOC100274579 isoform X1 [Zea 
mays]
 gb|ACF87897.1| unknown [Zea mays]
 gb|ACF88413.1| unknown [Zea mays]
 gb|ACG36709.1| phosphoglycerate kinase, cytosolic [Zea mays]
 gb|AFW70282.1| phosphoglycerate kinase isoform 1 [Zea mays]
 gb|AFW70283.1| phosphoglycerate kinase isoform 2 [Zea mays]
 gb|AFW70284.1| phosphoglycerate kinase isoform 3 [Zea mays]
Length=402

 Score =   161 bits (407),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAKAKGVSLLLPTD+V+ADKFA DA SK+VPA+AIPD WMGLD+GPD
Sbjct  244  EEDKLELATSLIEKAKAKGVSLLLPTDIVVADKFAADAESKIVPATAIPDDWMGLDVGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            + KT ++AL+TTKTVIWNGPMGVFEF KFA GTE++
Sbjct  304  ATKTFDEALDTTKTVIWNGPMGVFEFQKFAAGTEAI  339


 Score = 95.1 bits (235),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 59/66 (89%), Gaps = 1/66 (2%)
 Frame = -1

Query  462  QSQSKKLAELSG-KGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGV  286
            ++ +KKLAEL+  KGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV
Sbjct  337  EAIAKKLAELTTTKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGV  396

Query  285  IALDEA  268
            +ALD+A
Sbjct  397  LALDDA  402



>gb|EMT08517.1| Phosphoglycerate kinase, cytosolic [Aegilops tauschii]
Length=401

 Score =   158 bits (400),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL+EKAK+KGVSLLLPTD+V+AD FA DA SK+VPASAIPDGWMGLDIGPD
Sbjct  244  EEDKLELANSLIEKAKSKGVSLLLPTDIVVADNFAADAESKIVPASAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+K  ++ L+TTKTVIWNGPMGVFEF+KFA GT+++
Sbjct  304  SIKKFSETLDTTKTVIWNGPMGVFEFEKFAAGTDAI  339


 Score = 97.8 bits (242),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLA+++ KGVTTIIGGGDSVAAVEK G+AS MSHISTGGGASLELLEGK LPGV++LD
Sbjct  340  AKKLADITAKGVTTIIGGGDSVAAVEKAGLASKMSHISTGGGASLELLEGKTLPGVLSLD  399

Query  273  EA  268
             A
Sbjct  400  NA  401



>ref|XP_002977295.1| hypothetical protein SELMODRAFT_107116 [Selaginella moellendorffii]
 gb|EFJ21299.1| hypothetical protein SELMODRAFT_107116 [Selaginella moellendorffii]
Length=402

 Score =   158 bits (399),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT L+EKAK KGV+LLLPTDVV+ADKFAPDA+SK+V ASAIPDGWMGLDIGPD
Sbjct  245  EEDKLILATKLMEKAKLKGVTLLLPTDVVVADKFAPDASSKIVSASAIPDGWMGLDIGPD  304

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+K  ++AL++T T+IWNGPMGVFEF  FAVGTE++
Sbjct  305  SIKAFSEALDSTNTIIWNGPMGVFEFKNFAVGTEAI  340


 Score = 97.1 bits (240),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -1

Query  447  KLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            KLAELS KGVTTIIGGGDSVAAVEK GVA  MSHISTGGGASLELLEG+ LPGV ALD+A
Sbjct  343  KLAELSDKGVTTIIGGGDSVAAVEKAGVADQMSHISTGGGASLELLEGRILPGVAALDDA  402



>ref|XP_006656354.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Oryza brachyantha]
Length=401

 Score =   156 bits (395),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKA +KGVSLLLPTDVV+ADKF  DA SK V ASAIPDGWMGLDIGPD
Sbjct  244  EEDKLELATSLIEKANSKGVSLLLPTDVVVADKFTADAESKTVLASAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT ++ L+TTKTVIWNGPMGVFEF+KFA GT+++
Sbjct  304  SIKTFSETLDTTKTVIWNGPMGVFEFEKFAAGTDAI  339


 Score = 98.2 bits (243),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLA+++ KGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD
Sbjct  340  AKKLADITAKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALD  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>ref|XP_002972143.1| hypothetical protein SELMODRAFT_96742 [Selaginella moellendorffii]
 gb|EFJ27060.1| hypothetical protein SELMODRAFT_96742 [Selaginella moellendorffii]
Length=402

 Score =   157 bits (397),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LAT L+EKAK KGV+LLLPTDVV+ADKFAPDA+SK+V ASAIPDGWMGLDIGPD
Sbjct  245  EEDKLILATKLMEKAKLKGVTLLLPTDVVVADKFAPDASSKIVSASAIPDGWMGLDIGPD  304

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+K  + AL +T T+IWNGPMGVFEF  FAVGTE++
Sbjct  305  SIKAFSQALNSTNTIIWNGPMGVFEFKNFAVGTEAI  340


 Score = 97.1 bits (240),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -1

Query  447  KLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            KLAELS KGVTTIIGGGDSVAAVEK GVA  MSHISTGGGASLELLEG+ LPGV ALD+A
Sbjct  343  KLAELSDKGVTTIIGGGDSVAAVEKAGVADRMSHISTGGGASLELLEGRILPGVAALDDA  402



>gb|ABR25550.1| phosphoglycerate kinase [Oryza sativa Indica Group]
Length=176

 Score =   159 bits (401),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAKAKGVSLLLPTDVV+ADKFA DA SK V ASAIPDGWMGLD+GPD
Sbjct  18   EEDKLELATSLIEKAKAKGVSLLLPTDVVVADKFAADAESKTVAASAIPDGWMGLDVGPD  77

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++KT ++AL+T  T+IWNGPMGVFEFDKFA GT+++
Sbjct  78   AIKTSSEALDTCNTIIWNGPMGVFEFDKFAAGTDAI  113


 Score = 93.6 bits (231),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 56/63 (89%), Gaps = 1/63 (2%)
 Frame = -1

Query  453  SKKLAELSG-KGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIAL  277
            +KKLA+L+  KG TTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+AL
Sbjct  114  AKKLADLTTTKGATTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLAL  173

Query  276  DEA  268
            DEA
Sbjct  174  DEA  176



>dbj|BAJ85222.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   153 bits (387),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            E+DKL LA SL+EKAK+KGVSLLLPTD+V+A+ FA DA SK VPASAIPDGWMGLDIGPD
Sbjct  244  EDDKLELANSLIEKAKSKGVSLLLPTDIVVANNFAADAESKTVPASAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S++  ++ L+TTKTVIWNGPMGVFEF+KFA GT+++
Sbjct  304  SIRKFSETLDTTKTVIWNGPMGVFEFEKFAAGTDAI  339


 Score = 98.2 bits (243),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +KKLA+++ +GVTTIIGGGDSVAAVEK G+AS MSHISTGGGASLELLEGK LPGV+ALD
Sbjct  340  AKKLADITAQGVTTIIGGGDSVAAVEKAGLASKMSHISTGGGASLELLEGKTLPGVLALD  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>ref|NP_001046020.1| Os02g0169300 [Oryza sativa Japonica Group]
 dbj|BAD25722.1| putative phosphoglycerate kinase, cytosolic [Oryza sativa Japonica 
Group]
 dbj|BAF07934.1| Os02g0169300 [Oryza sativa Japonica Group]
 gb|ABL74575.1| phosphoglycerate kinase [Oryza sativa Japonica Group]
 gb|EEC72574.1| hypothetical protein OsI_06015 [Oryza sativa Indica Group]
 gb|EEE56393.1| hypothetical protein OsJ_05543 [Oryza sativa Japonica Group]
Length=402

 Score =   157 bits (398),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAKAKGVSLLLPTDVV+ADKFA DA SK V ASAIPDGWMGLD+GPD
Sbjct  244  EEDKLELATSLIEKAKAKGVSLLLPTDVVVADKFAADAESKTVAASAIPDGWMGLDVGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++KT ++AL+T  T+IWNGPMGVFEF+KFA GT+++
Sbjct  304  AIKTSSEALDTCNTIIWNGPMGVFEFEKFAAGTDAI  339


 Score = 93.6 bits (231),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 56/63 (89%), Gaps = 1/63 (2%)
 Frame = -1

Query  453  SKKLAELSG-KGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIAL  277
            +KKLA+L+  KG TTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+AL
Sbjct  340  AKKLADLTTTKGATTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLAL  399

Query  276  DEA  268
            DEA
Sbjct  400  DEA  402



>ref|XP_011013868.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Populus euphratica]
 ref|XP_011013875.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Populus euphratica]
Length=429

 Score =   149 bits (377),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 88/124 (71%), Gaps = 28/124 (23%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKV------------------  614
            EEDKL LATSL+EKAK KGV LLLP DVV+ADKFAPDANSKV                  
Sbjct  244  EEDKLDLATSLIEKAKVKGVKLLLPADVVVADKFAPDANSKVCIIVRLNYVHSLEYVHVN  303

Query  613  ----------VPASAIPDGWMGLDIGPDSVKTCNDALETTKTVIWNGPMGVFEFDKFAVG  464
                      VPAS I DGWMGLDIGPDS+KT ++AL+TTKT+IWNGPMGVFEF+KFA G
Sbjct  304  LLFSAIFLQVVPASEIADGWMGLDIGPDSIKTFSEALDTTKTIIWNGPMGVFEFEKFAAG  363

Query  463  TESV  452
            TE++
Sbjct  364  TEAI  367


 Score =   101 bits (251),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -1

Query  447  KLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            KLAELSGKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct  370  KLAELSGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALDDA  429



>ref|XP_006646936.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Oryza brachyantha]
Length=402

 Score =   154 bits (389),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAKAKGVSLLLPTDVV+ADKFA DA SK V ASAIP+GWMGLD+GPD
Sbjct  244  EEDKLELATSLIEKAKAKGVSLLLPTDVVVADKFAADAESKTVAASAIPEGWMGLDVGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++KT + AL+T  T+IWNGPMGVFEF+KFA GT+++
Sbjct  304  AIKTFSGALDTCNTIIWNGPMGVFEFEKFAAGTDAI  339


 Score = 96.3 bits (238),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 57/63 (90%), Gaps = 1/63 (2%)
 Frame = -1

Query  453  SKKLAELSG-KGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIAL  277
            +KKLAEL+  KGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+AL
Sbjct  340  AKKLAELTTTKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLAL  399

Query  276  DEA  268
            DEA
Sbjct  400  DEA  402



>gb|ABI74567.1| phosphoglycerate kinase [Oryza sativa Indica Group]
Length=402

 Score =   157 bits (396),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAKAKGVSLLLPTDVV+ADKFA DA S+ V ASAIPDGWMGLD+GPD
Sbjct  244  EEDKLELATSLIEKAKAKGVSLLLPTDVVVADKFAADAESRTVAASAIPDGWMGLDVGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++KT ++AL+T  T+IWNGPMGVFEF+KFA GT+++
Sbjct  304  AIKTSSEALDTCNTIIWNGPMGVFEFEKFAAGTDAI  339


 Score = 93.6 bits (231),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 56/63 (89%), Gaps = 1/63 (2%)
 Frame = -1

Query  453  SKKLAELSG-KGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIAL  277
            +KKLA+L+  KG TTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+AL
Sbjct  340  AKKLADLTTTKGATTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLAL  399

Query  276  DEA  268
            DEA
Sbjct  400  DEA  402



>gb|EMT29203.1| Phosphoglycerate kinase, cytosolic [Aegilops tauschii]
Length=494

 Score =   160 bits (404),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+E AK+KGV LLLPTDVV+ADKFA DA SK+VPA+AIPDGWMGLD+GPD
Sbjct  244  EEDKLELATSLIETAKSKGVKLLLPTDVVVADKFAADAESKIVPATAIPDGWMGLDVGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT  +AL+TTKTVIWNGPMGVFEF+KFA GT+++
Sbjct  304  SIKTFAEALDTTKTVIWNGPMGVFEFEKFAAGTDAI  339


 Score = 89.7 bits (221),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELP  292
            +K+LAEL+GKGVTTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LP
Sbjct  340  AKQLAELTGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLP  393



>gb|ABI74568.1| phosphoglycerate kinase [Oryza sativa Indica Group]
Length=402

 Score =   155 bits (391),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LATSL+EKAKAKGVSLLLPTDVV+ADKFA DA SK V ASAIPDGWMGLD+GPD
Sbjct  244  EEDKLELATSLIEKAKAKGVSLLLPTDVVVADKFAADAESKTVAASAIPDGWMGLDVGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++KT ++AL+T  T+IWNGPMGVFEF+K A GT+++
Sbjct  304  AIKTSSEALDTCNTIIWNGPMGVFEFEKLAAGTDAI  339


 Score = 93.6 bits (231),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 56/63 (89%), Gaps = 1/63 (2%)
 Frame = -1

Query  453  SKKLAELSG-KGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIAL  277
            +KKLA+L+  KG TTIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV+AL
Sbjct  340  AKKLADLTTTKGATTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLAL  399

Query  276  DEA  268
            DEA
Sbjct  400  DEA  402



>ref|WP_035992253.1| phosphoglycerate kinase [Leptolyngbya sp. KIOST-1]
Length=401

 Score =   147 bits (372),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA +L  KAK KGV LLLPTDVV+AD FA DANS+ V   AIPDGWMGLDIGPD
Sbjct  244  EEDKLELAKALEAKAKEKGVDLLLPTDVVLADNFAADANSQTVSVDAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVK   DAL+  K+VIWNGPMGVFEFDKFAVGTE++
Sbjct  304  SVKVFQDALKQCKSVIWNGPMGVFEFDKFAVGTEAI  339


 Score = 99.4 bits (246),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = -1

Query  444  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            LAEL+G GVTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGKELPG+ ALD+A
Sbjct  343  LAELTGTGVTTIIGGGDSVAAVEKVGVADKMSHISTGGGASLELLEGKELPGIAALDDA  401



>ref|WP_015184203.1| phosphoglycerate kinase [Microcoleus sp. PCC 7113]
 gb|AFZ20067.1| 3-phosphoglycerate kinase [Microcoleus sp. PCC 7113]
Length=401

 Score =   151 bits (382),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL  KAK +GV+LLLPTDVV+AD FAPDANS+ V   +IPDGWMGLDIGPD
Sbjct  244  EEDKLELAKSLEAKAKERGVALLLPTDVVVADNFAPDANSQTVSIDSIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVK   DAL   KTVIWNGPMGVFEFDKFAVGTE++
Sbjct  304  SVKVFQDALSDCKTVIWNGPMGVFEFDKFAVGTEAI  339


 Score = 94.7 bits (234),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -1

Query  444  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            +A+L+ +G TTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGKELPG+ ALD+A
Sbjct  343  MADLTKQGATTIIGGGDSVAAVEKVGVAEQMSHISTGGGASLELLEGKELPGITALDDA  401



>ref|WP_017300589.1| phosphoglycerate kinase [Nodosilinea nodulosa]
Length=401

 Score =   149 bits (376),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL  KAK KGV LLLPTDVV+AD FAPDAN++ V   AIPDGWMGLDIGPD
Sbjct  244  EEDKLELAKSLEAKAKEKGVDLLLPTDVVLADNFAPDANAQTVSVEAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+K   DAL+  K+VIWNGPMGVFEFDKFA GTE++
Sbjct  304  SIKVFQDALKQCKSVIWNGPMGVFEFDKFAAGTEAI  339


 Score = 97.1 bits (240),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -1

Query  444  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            LAEL+  GVTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGKELPG+ ALD+A
Sbjct  343  LAELTDTGVTTIIGGGDSVAAVEKVGVAEKMSHISTGGGASLELLEGKELPGIAALDDA  401



>ref|WP_041032823.1| phosphoglycerate kinase [Tolypothrix campylonemoides]
 gb|KIJ78650.1| phosphoglycerate kinase [Tolypothrix campylonemoides VB511288]
Length=400

 Score =   147 bits (371),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL  KAK +GV LLLPTDVV+AD FAPDANS+ V    IPDGWMGLDIGP+
Sbjct  243  EEDKLELAKSLEAKAKERGVDLLLPTDVVVADNFAPDANSQTVSVENIPDGWMGLDIGPE  302

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVK    AL  TKTVIWNGPMGVFEFDKFAVGTE++
Sbjct  303  SVKFFQQALADTKTVIWNGPMGVFEFDKFAVGTEAI  338


 Score = 97.4 bits (241),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            ++ LA++S  G TTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGKELPG++ALD
Sbjct  339  ARTLADISKTGATTIIGGGDSVAAVEKVGLADQMSHISTGGGASLELLEGKELPGIVALD  398

Query  273  EA  268
            EA
Sbjct  399  EA  400



>ref|WP_011377868.1| MULTISPECIES: phosphoglycerate kinase [Synechococcus]
 sp|Q31P73.1|PGK_SYNE7 RecName: Full=Phosphoglycerate kinase [Synechococcus elongatus 
PCC 7942]
 gb|ABB57146.1| phosphoglycerate kinase [Synechococcus elongatus PCC 7942]
 gb|AJD58338.1| phosphoglycerate kinase [Synechococcus sp. UTEX 2973]
Length=402

 Score =   147 bits (372),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL+ KA+ KGV LLLP DVV+ADKFAPDAN+K V   AIPDGWMGLDIGP+
Sbjct  244  EEDKLDLARSLMAKAQEKGVQLLLPVDVVVADKFAPDANAKTVAIDAIPDGWMGLDIGPE  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESVKEA  443
            SVK   +AL   ++VIWNGPMGVFEFD+FAVGTE++  +
Sbjct  304  SVKQFEEALADCRSVIWNGPMGVFEFDQFAVGTEAIARS  342


 Score = 94.4 bits (233),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            ++ LA L+ KG TTIIGGGDSVAAVEKVGVAS MSHISTGGGASLELLEGK LPGV ALD
Sbjct  340  ARSLAGLTRKGATTIIGGGDSVAAVEKVGVASEMSHISTGGGASLELLEGKVLPGVAALD  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>ref|WP_029637902.1| phosphoglycerate kinase [[Scytonema hofmanni] UTEX B 1581]
Length=400

 Score =   147 bits (370),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDK+ LA SL  KAK +GV LLLPTDVV+ADKFAPDANS+ V    IPDGWMGLDIGPD
Sbjct  243  EEDKIELAKSLEAKAKERGVDLLLPTDVVVADKFAPDANSQTVSIENIPDGWMGLDIGPD  302

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+K   +AL   KTVIWNGPMGVFEFDKFA GTE++
Sbjct  303  SIKVFQEALADCKTVIWNGPMGVFEFDKFAAGTEAI  338


 Score = 95.1 bits (235),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -1

Query  444  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            LA++S KG  TIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGKELPG++ALD+A
Sbjct  342  LADISKKGAITIIGGGDSVAAVEKVGLADQMSHISTGGGASLELLEGKELPGIVALDDA  400



>ref|WP_015166011.1| phosphoglycerate kinase [Pseudanabaena sp. PCC 7367]
 gb|AFY71055.1| phosphoglycerate kinase [Pseudanabaena sp. PCC 7367]
Length=401

 Score =   146 bits (368),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL  KAK +GV LLLPTDVV+AD F+PDANS+ V   +IPDGWMGLDIGPD
Sbjct  244  EEDKLDLAKSLEAKAKERGVDLLLPTDVVVADNFSPDANSQTVSIESIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESVKEA  443
            SVKT   AL    TVIWNGPMGVFEFDKFAVGTE++  +
Sbjct  304  SVKTFQAALADCMTVIWNGPMGVFEFDKFAVGTEAIAHS  342


 Score = 95.1 bits (235),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -1

Query  444  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            LAEL+GKG  TIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPG+ ALD+A
Sbjct  343  LAELTGKGAITIIGGGDSVAAVEKVGVAEKMSHISTGGGASLELLEGKTLPGIAALDDA  401



>ref|WP_016865730.1| phosphoglycerate kinase [Fischerella muscicola]
Length=400

 Score =   145 bits (366),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL  KAK KGV+ LLPTDVV+AD FA DANS+ V    IPDGWMGLDIGPD
Sbjct  243  EEDKLELAKSLEAKAKEKGVTFLLPTDVVVADNFAADANSQTVSIENIPDGWMGLDIGPD  302

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVK   DAL   KTV+WNGPMGVFEFDKFAVGTE++
Sbjct  303  SVKLFQDALADCKTVVWNGPMGVFEFDKFAVGTEAI  338


 Score = 95.9 bits (237),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            ++ LA+LS KG TTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPG+ ALD
Sbjct  339  ARTLADLSKKGATTIIGGGDSVAAVEKVGLADQMSHISTGGGASLELLEGKVLPGIAALD  398

Query  273  EA  268
            EA
Sbjct  399  EA  400



>ref|WP_026135280.1| phosphoglycerate kinase [Scytonema hofmanni]
Length=400

 Score =   150 bits (378),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL  KAK KGV+ LLPTDVV+ADKFA DANS+VV    IPDGWMGLDIGPD
Sbjct  243  EEDKLELAESLEAKAKEKGVTFLLPTDVVVADKFAADANSQVVSVENIPDGWMGLDIGPD  302

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESVKE  446
            SVK   DAL   KTVIWNGPMGVFEFDKFA GTE+V +
Sbjct  303  SVKLFQDALADCKTVIWNGPMGVFEFDKFAAGTEAVAQ  340


 Score = 91.3 bits (225),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            ++ LAE+S  G  TIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPG+ ALD
Sbjct  339  AQTLAEISKTGAITIIGGGDSVAAVEKVGLADQMSHISTGGGASLELLEGKVLPGIAALD  398

Query  273  EA  268
            EA
Sbjct  399  EA  400



>ref|WP_039728851.1| MULTISPECIES: phosphoglycerate kinase [Oscillatoriophycideae]
 gb|KIF16377.1| phosphoglycerate kinase [Aphanocapsa montana BDHKU210001]
 gb|KIF41302.1| phosphoglycerate kinase [Lyngbya confervoides BDU141951]
Length=401

 Score =   145 bits (367),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA +L  KAK KGV LLLPTDVV+AD FAPDAN++ V   AIPDGWMGLDIGPD
Sbjct  244  EEDKLELAKALEAKAKEKGVELLLPTDVVVADNFAPDANAQTVSIEAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            +VK   +AL+  K+VIWNGPMGVFEFDKFA GTE++
Sbjct  304  AVKVFQEALKQCKSVIWNGPMGVFEFDKFAAGTEAI  339


 Score = 95.5 bits (236),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -1

Query  444  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            LAEL+  GVTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPG+ ALDEA
Sbjct  343  LAELTPSGVTTIIGGGDSVAAVEKVGVAEQMSHISTGGGASLELLEGKTLPGIAALDEA  401



>ref|WP_026734580.1| phosphoglycerate kinase [Fischerella sp. PCC 9605]
Length=400

 Score =   147 bits (370),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL  KAK KGV+ LLPTDVV+ADKFA DANS+ V    IPDGWMGLDIGPD
Sbjct  243  EEDKLELAKSLEAKAKEKGVTFLLPTDVVVADKFAADANSQTVSVENIPDGWMGLDIGPD  302

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVK   +AL   KT+IWNGPMGVFEFDKFAVGTE++
Sbjct  303  SVKLFQEALSDCKTIIWNGPMGVFEFDKFAVGTEAI  338


 Score = 94.0 bits (232),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            ++ LA+LS  G TTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPG+ ALD
Sbjct  339  ARTLADLSKNGATTIIGGGDSVAAVEKVGLADQMSHISTGGGASLELLEGKVLPGIAALD  398

Query  273  EA  268
            EA
Sbjct  399  EA  400



>ref|WP_011242745.1| phosphoglycerate kinase [Synechococcus elongatus]
 sp|Q5N4Z6.1|PGK_SYNP6 RecName: Full=Phosphoglycerate kinase [Synechococcus elongatus 
PCC 6301]
 dbj|BAD78623.1| phosphoglycerate kinase [Synechococcus elongatus PCC 6301]
Length=402

 Score =   146 bits (369),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL+ KA+ KGV LLLP DVV+ADKFAPDAN+K V   AIPDGWMGLDIGP+
Sbjct  244  EEDKLDLARSLMAKAQEKGVQLLLPVDVVVADKFAPDANAKTVAIDAIPDGWMGLDIGPE  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESVKEA  443
            SVK    AL   ++VIWNGPMGVFEFD+FAVGTE++  +
Sbjct  304  SVKQFEGALADCRSVIWNGPMGVFEFDQFAVGTEAIARS  342


 Score = 94.0 bits (232),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            ++ LA L+ KG TTIIGGGDSVAAVEKVGVAS MSHISTGGGASLELLEGK LPGV ALD
Sbjct  340  ARSLAGLTRKGATTIIGGGDSVAAVEKVGVASEMSHISTGGGASLELLEGKVLPGVAALD  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>ref|WP_026097925.1| phosphoglycerate kinase [Geitlerinema sp. PCC 7105]
Length=401

 Score =   145 bits (365),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA +L  KAK +GV LLLPTDV++AD FAPDAN + V   AIPDGWMGLDIGPD
Sbjct  244  EEDKLELAKALEAKAKERGVELLLPTDVIVADNFAPDANDRTVAVDAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT  DAL   K+VIWNGPMGVFEF+KFA GTE++
Sbjct  304  SVKTFQDALADCKSVIWNGPMGVFEFEKFAKGTEAI  339


 Score = 95.9 bits (237),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            ++ LA+L+G+G TTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPG+ ALD
Sbjct  340  ARTLADLTGQGTTTIIGGGDSVAAVEKVGVADKMSHISTGGGASLELLEGKVLPGIAALD  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>ref|WP_035831895.1| phosphoglycerate kinase [Cyanobium sp. CACIAM 14]
 gb|KEF41737.1| phosphoglycerate kinase [Cyanobium sp. CACIAM 14]
Length=401

 Score =   145 bits (366),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA  L  KA AKGV LLLPTDVV+AD FAPDANS   P  AIP+GWMGLDIGPD
Sbjct  244  EEDKLELARELEAKAAAKGVQLLLPTDVVLADNFAPDANSMTTPIDAIPEGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESVKE  446
            SVKT  DAL   +TVIWNGPMGVFEFD+FA GT ++  
Sbjct  304  SVKTFQDALADCQTVIWNGPMGVFEFDRFAAGTNAIAH  341


 Score = 95.1 bits (235),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -1

Query  444  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            LA+LS KG  TIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPGV ALDEA
Sbjct  343  LADLSAKGCCTIIGGGDSVAAVEKVGVADRMSHISTGGGASLELLEGKVLPGVAALDEA  401



>ref|WP_015149149.1| phosphoglycerate kinase [Oscillatoria acuminata]
 gb|AFY82513.1| 3-phosphoglycerate kinase [Oscillatoria acuminata PCC 6304]
Length=401

 Score =   142 bits (359),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            E+DKL LA SL  KAK +GV++LLPTDVVIADKF  DAN+++V    IPDGWMGLDIGPD
Sbjct  244  EDDKLELAKSLEAKAKERGVAMLLPTDVVIADKFGADANTQIVSVENIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT  DAL   KTVIWNGPMGVFE DKFA GTE++
Sbjct  304  SVKTFQDALADCKTVIWNGPMGVFEIDKFAKGTEAI  339


 Score = 97.1 bits (240),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -1

Query  444  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            L+EL+ KG TTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGKELPGV ALDEA
Sbjct  343  LSELTPKGTTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKELPGVAALDEA  401



>ref|WP_016924803.1| phosphoglycerate kinase [Prochlorothrix hollandica]
Length=401

 Score =   145 bits (367),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA +L  KAK KGV LLLPTDVV+ADKFA DAN+K V   AIPDGWMGLDIGPD
Sbjct  244  EEDKLELAQALEAKAKEKGVELLLPTDVVVADKFAADANAKTVAVDAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+KT  +AL+T K+VIWNGPMGVFEF +FA GTE V
Sbjct  304  SLKTFQEALKTCKSVIWNGPMGVFEFPQFAAGTEGV  339


 Score = 94.0 bits (232),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            +K LA L+ +GVTTIIGGGDSVAAVE+VG+A  MSHISTGGGASLELLEGK LPG+ ALD
Sbjct  340  AKTLASLTPQGVTTIIGGGDSVAAVEQVGLADQMSHISTGGGASLELLEGKVLPGIAALD  399

Query  273  EA  268
            EA
Sbjct  400  EA  401



>ref|WP_011936642.1| phosphoglycerate kinase [Synechococcus sp. RCC307]
 sp|A5GW73.1|PGK_SYNR3 RecName: Full=Phosphoglycerate kinase [Synechococcus sp. RCC307]
 emb|CAK29132.1| Phosphoglycerate kinase [Synechococcus sp. RCC307]
Length=402

 Score =   146 bits (368),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA  L  KAKAKGV LLLPTDVV+AD FAPDANS+V    AIP+GWMGLDIGPD
Sbjct  244  EEDKLELAKELEAKAKAKGVQLLLPTDVVLADNFAPDANSQVASIDAIPEGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+K   DAL   KTVIWNGPMGVFEFDKFA GT ++
Sbjct  304  SIKVFQDALGDCKTVIWNGPMGVFEFDKFAAGTNAI  339


 Score = 93.6 bits (231),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -1

Query  444  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            LAELS KG  TIIGGGDSVAAVEK G+A+ MSHISTGGGASLELLEGK LPGV ALDEA
Sbjct  343  LAELSAKGCCTIIGGGDSVAAVEKAGLAAQMSHISTGGGASLELLEGKVLPGVAALDEA  401



>ref|WP_017289328.1| phosphoglycerate kinase [Leptolyngbya boryana]
Length=401

 Score =   142 bits (359),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA +L  KAK KGV LLLPTDVV+AD F+PDAN++ V   +IPDGWMGLDIGPD
Sbjct  244  EEDKLELAKALEAKAKEKGVDLLLPTDVVVADNFSPDANTQTVSVDSIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT   ALE  K+VIWNGPMGVFE DKFA GTE++
Sbjct  304  SVKTFQAALEQCKSVIWNGPMGVFEMDKFAKGTEAI  339


 Score = 97.1 bits (240),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -1

Query  444  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            LAEL+ KG +TIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGKELPG+ ALDEA
Sbjct  343  LAELTPKGTSTIIGGGDSVAAVEKVGLADQMSHISTGGGASLELLEGKELPGIAALDEA  401



>sp|P74421.2|PGK_SYNY3 RecName: Full=Phosphoglycerate kinase [Synechocystis sp. PCC 
6803 substr. Kazusa]
Length=401

 Score =   150 bits (380),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 81/100 (81%), Gaps = 2/100 (2%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL+ KAK KGV  LLPTDVV+AD FAPDAN++ V   AIPDGWMGLDIGPD
Sbjct  244  EEDKLDLAKSLMAKAKEKGVEFLLPTDVVVADNFAPDANAQTVGVDAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESVKEAC  440
            SVKT  DAL    TVIWNGPMGVFEFDKFAVGTE++  AC
Sbjct  304  SVKTFQDALAGCGTVIWNGPMGVFEFDKFAVGTEAI--AC  341


 Score = 88.6 bits (218),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -1

Query  444  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDE  271
            LAEL+  G  TIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPG+ ALD+
Sbjct  343  LAELTASGTVTIIGGGDSVAAVEKVGVAEKMSHISTGGGASLELLEGKVLPGIAALDD  400



>ref|WP_010873144.1| phosphoglycerate kinase [Synechocystis sp. PCC 6803]
 ref|NP_441843.2| phosphoglycerate kinase [Synechocystis sp. PCC 6803]
 dbj|BAK50698.1| phosphoglycerate kinase [Synechocystis sp. PCC 6803]
 dbj|BAL29696.1| phosphoglycerate kinase [Synechocystis sp. PCC 6803 substr. GT-I]
 dbj|BAL32865.1| phosphoglycerate kinase [Synechocystis sp. PCC 6803 substr. PCC-N]
 dbj|BAL36034.1| phosphoglycerate kinase [Synechocystis sp. PCC 6803 substr. PCC-P]
 dbj|BAM54752.1| phosphoglycerate kinase [Bacillus subtilis BEST7613]
Length=400

 Score =   150 bits (379),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 81/100 (81%), Gaps = 2/100 (2%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL+ KAK KGV  LLPTDVV+AD FAPDAN++ V   AIPDGWMGLDIGPD
Sbjct  243  EEDKLDLAKSLMAKAKEKGVEFLLPTDVVVADNFAPDANAQTVGVDAIPDGWMGLDIGPD  302

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESVKEAC  440
            SVKT  DAL    TVIWNGPMGVFEFDKFAVGTE++  AC
Sbjct  303  SVKTFQDALAGCGTVIWNGPMGVFEFDKFAVGTEAI--AC  340


 Score = 88.6 bits (218),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -1

Query  444  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDE  271
            LAEL+  G  TIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPG+ ALD+
Sbjct  342  LAELTASGTVTIIGGGDSVAAVEKVGVAEKMSHISTGGGASLELLEGKVLPGIAALDD  399



>ref|WP_006105635.1| phosphoglycerate kinase [Coleofasciculus chthonoplastes]
 gb|EDX71471.1| phosphoglycerate kinase [Coleofasciculus chthonoplastes PCC 7420]
Length=401

 Score =   144 bits (362),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL  KAK KGV LLLPTDVV+AD FA DANS+ V   +IPDGWMGLDIGPD
Sbjct  244  EEDKLELAKSLEAKAKEKGVDLLLPTDVVVADNFAADANSQTVSVESIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVK   DAL   K+VIWNGPMGVFEFDKFA GTE++
Sbjct  304  SVKFFQDALGDCKSVIWNGPMGVFEFDKFAAGTEAI  339


 Score = 95.1 bits (235),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            ++ LA+L+ KG TTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPG+ ALD
Sbjct  340  ARTLADLTKKGTTTIIGGGDSVAAVEKVGVADQMSHISTGGGASLELLEGKVLPGIAALD  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>ref|WP_039739530.1| phosphoglycerate kinase [Hassallia byssoidea]
 gb|KIF37010.1| phosphoglycerate kinase [Hassallia byssoidea VB512170]
Length=400

 Score =   142 bits (359),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL  KAK +GV LLLPTDVV+AD FA DANS+ V    IPDGWMGLDIGPD
Sbjct  243  EEDKLELAKSLEAKAKERGVDLLLPTDVVVADNFAADANSQTVSIDNIPDGWMGLDIGPD  302

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+K   +AL   KTVIWNGPMGVFEFDKFA GTE++
Sbjct  303  SIKVFQEALADCKTVIWNGPMGVFEFDKFAAGTEAI  338


 Score = 96.3 bits (238),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -1

Query  444  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            LA++S KG  TIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGKELPG++ALDEA
Sbjct  342  LADISKKGAITIIGGGDSVAAVEKVGLADQMSHISTGGGASLELLEGKELPGIVALDEA  400



>ref|WP_007099195.1| phosphoglycerate kinase [Synechococcus sp. RS9916]
 gb|EAU75098.1| phosphoglycerate kinase [Synechococcus sp. RS9916]
Length=401

 Score =   147 bits (371),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA  L  KAKAKGV LLLPTDVV+AD FAPDANS+  P +AIPDGWMGLDIGPD
Sbjct  244  EEDKLELAKELEAKAKAKGVELLLPTDVVLADNFAPDANSQTAPVTAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVK   +AL   +TVIWNGPMGVFEFDKFA GT ++
Sbjct  304  SVKVFQNALADCQTVIWNGPMGVFEFDKFAAGTNAI  339


 Score = 91.3 bits (225),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -1

Query  444  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            LA+LSGKG  TIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV ALD A
Sbjct  343  LADLSGKGCCTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKVLPGVAALDAA  401



>dbj|BAA18521.1| phosphoglycerate kinase [Synechocystis sp. PCC 6803]
 gb|AGF52210.1| phosphoglycerate kinase [Synechocystis sp. PCC 6803]
Length=374

 Score =   150 bits (379),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 81/100 (81%), Gaps = 2/100 (2%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL+ KAK KGV  LLPTDVV+AD FAPDAN++ V   AIPDGWMGLDIGPD
Sbjct  217  EEDKLDLAKSLMAKAKEKGVEFLLPTDVVVADNFAPDANAQTVGVDAIPDGWMGLDIGPD  276

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESVKEAC  440
            SVKT  DAL    TVIWNGPMGVFEFDKFAVGTE++  AC
Sbjct  277  SVKTFQDALAGCGTVIWNGPMGVFEFDKFAVGTEAI--AC  314


 Score = 88.2 bits (217),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -1

Query  444  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDE  271
            LAEL+  G  TIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPG+ ALD+
Sbjct  316  LAELTASGTVTIIGGGDSVAAVEKVGVAEKMSHISTGGGASLELLEGKVLPGIAALDD  373



>ref|WP_017309094.1| MULTISPECIES: phosphoglycerate kinase [Stigonematales]
 gb|KIY12309.1| phosphoglycerate kinase [Mastigocladus laminosus UU774]
Length=400

 Score =   149 bits (375),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL  KAK KGV+ LLPTDVV+ADKFAPDANS+ V    IPDGWMGLDIGPD
Sbjct  243  EEDKLELAKSLEAKAKEKGVTFLLPTDVVVADKFAPDANSQTVSIENIPDGWMGLDIGPD  302

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVK   DAL   K+V+WNGPMGVFEFDKFAVGTE++
Sbjct  303  SVKLFQDALADCKSVVWNGPMGVFEFDKFAVGTEAI  338


 Score = 89.4 bits (220),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -1

Query  444  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            LA++   G TTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPG+ ALDEA
Sbjct  342  LADIGKNGATTIIGGGDSVAAVEKVGLADQMSHISTGGGASLELLEGKVLPGIAALDEA  400



>gb|KIE11439.1| phosphoglycerate kinase [Tolypothrix bouteillei VB521301]
Length=400

 Score =   149 bits (376),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL  KAK KGV+ LLPTDVV+ADKFA DANS+ V    IPDGWMGLDIGPD
Sbjct  243  EEDKLELAKSLEAKAKEKGVAFLLPTDVVVADKFAADANSQTVSVENIPDGWMGLDIGPD  302

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESVKE  446
            SVK   DAL   KTVIWNGPMGVFEFDKFAVGTE+V +
Sbjct  303  SVKLFQDALADCKTVIWNGPMGVFEFDKFAVGTEAVAQ  340


 Score = 89.0 bits (219),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            ++ LAE+   G  TIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPG+ ALD
Sbjct  339  AQTLAEIGKTGAITIIGGGDSVAAVEKVGLADQMSHISTGGGASLELLEGKVLPGIAALD  398

Query  273  EA  268
            EA
Sbjct  399  EA  400



>ref|WP_009454679.1| MULTISPECIES: phosphoglycerate kinase [Fischerella]
 gb|EHC18638.1| Phosphoglycerate kinase [Fischerella sp. JSC-11]
Length=400

 Score =   144 bits (362),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL  KAK KGV+ LLPTDVV+AD FA DANS+ V    IPDGWMGLDIGPD
Sbjct  243  EEDKLELAKSLEAKAKEKGVTFLLPTDVVVADNFAADANSQTVSIENIPDGWMGLDIGPD  302

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVK   +AL   KTV+WNGPMGVFEFDKFAVGTE++
Sbjct  303  SVKLFQEALADCKTVVWNGPMGVFEFDKFAVGTEAI  338


 Score = 94.4 bits (233),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            ++ LA+LS  G TTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPG+ ALD
Sbjct  339  ARTLADLSKNGATTIIGGGDSVAAVEKVGLADQMSHISTGGGASLELLEGKVLPGIAALD  398

Query  273  EA  268
            EA
Sbjct  399  EA  400



>ref|WP_027842190.1| phosphoglycerate kinase [Mastigocoleus testarum]
Length=401

 Score =   148 bits (373),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL  KAK KGV LLLPTDVV+AD FAPDANS+ V   +IPDGWMGLDIGPD
Sbjct  244  EEDKLELAKSLEAKAKEKGVQLLLPTDVVVADNFAPDANSQTVSIDSIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVKT   AL   K VIWNGPMGVFEFDKFAVGTE++
Sbjct  304  SVKTFQAALADCKAVIWNGPMGVFEFDKFAVGTEAI  339


 Score = 89.7 bits (221),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            ++ LA++   G TTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPG+ ALD
Sbjct  340  ARTLADIGKSGATTIIGGGDSVAAVEKVGLADQMSHISTGGGASLELLEGKTLPGIAALD  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>ref|WP_016861411.1| phosphoglycerate kinase [Fischerella muscicola]
Length=400

 Score =   147 bits (370),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL  KAK KGV+ LLPTDVV+AD FAPDANS+ V    IPDGWMGLDIGPD
Sbjct  243  EEDKLELAKSLEAKAKEKGVTFLLPTDVVVADNFAPDANSQTVSIENIPDGWMGLDIGPD  302

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVK   DAL   K+V+WNGPMGVFEFDKFAVGTE++
Sbjct  303  SVKLFQDALADCKSVVWNGPMGVFEFDKFAVGTEAI  338


 Score = 90.5 bits (223),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            ++ LA++   G TTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPG+ ALD
Sbjct  339  ARTLADIGKNGATTIIGGGDSVAAVEKVGLAEQMSHISTGGGASLELLEGKVLPGIAALD  398

Query  273  EA  268
            EA
Sbjct  399  EA  400



>ref|WP_026098466.1| phosphoglycerate kinase [Oscillatoria sp. PCC 10802]
Length=400

 Score =   143 bits (360),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA +L  KAK +GV+ LLPTDVV+ADKFAPDA ++ V   +IPDGWMGLDIGPD
Sbjct  243  EEDKLELAKTLEAKAKERGVAFLLPTDVVVADKFAPDAEAQTVSIESIPDGWMGLDIGPD  302

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVK   +AL   K VIWNGPMGVFEFDKFAVGTE++
Sbjct  303  SVKVFQEALADCKAVIWNGPMGVFEFDKFAVGTEAI  338


 Score = 94.7 bits (234),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            ++ LA+L+ KG TTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPG+ ALD
Sbjct  339  ARTLADLTPKGTTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKVLPGIAALD  398

Query  273  EA  268
            EA
Sbjct  399  EA  400



>ref|WP_016873269.1| phosphoglycerate kinase [Chlorogloeopsis fritschii]
Length=400

 Score =   144 bits (363),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL  KAK KGV+ LLPTDVV+ADKFA DANS+ V    IPDGWMGLDIGPD
Sbjct  243  EEDKLELAKSLEAKAKEKGVTFLLPTDVVVADKFAADANSQTVSIENIPDGWMGLDIGPD  302

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVK   +AL   K+++WNGPMGVFEFDKFAVGTE++
Sbjct  303  SVKLFQEALADCKSIVWNGPMGVFEFDKFAVGTEAI  338


 Score = 93.2 bits (230),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -1

Query  444  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            LAE+S +G TTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPG+ ALDEA
Sbjct  342  LAEVSKQGATTIIGGGDSVAAVEKVGLAEQMSHISTGGGASLELLEGKVLPGIAALDEA  400



>ref|WP_006528046.1| phosphoglycerate kinase [Gloeocapsa sp. PCC 73106]
 gb|ELR99128.1| 3-phosphoglycerate kinase [Gloeocapsa sp. PCC 73106]
Length=401

 Score =   141 bits (355),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL  KAK K V+LLLPTDVVIADKFA DANS+ V    IPDGWMGLDIGPD
Sbjct  244  EEDKLELAKSLEAKAKEKNVALLLPTDVVIADKFAADANSQTVSIENIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+K   +AL   KT++WNGPMGVFEF++FA GTE++
Sbjct  304  SIKLFQEALSDCKTIVWNGPMGVFEFEQFAAGTEAI  339


 Score = 95.9 bits (237),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -1

Query  444  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            LA+L+ +G TTIIGGGDSVAAVE+VGVA  MSHISTGGGASLELLEGKELPG+IALD A
Sbjct  343  LADLTKQGATTIIGGGDSVAAVEQVGVAEKMSHISTGGGASLELLEGKELPGIIALDNA  401



>ref|WP_013321558.1| phosphoglycerate kinase [Cyanothece sp. PCC 7822]
 gb|ADN13451.1| Phosphoglycerate kinase [Cyanothece sp. PCC 7822]
Length=401

 Score =   139 bits (349),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL  KAK KGV LLLPTDVV+AD F  DAN++ V    IPDGWMGLDIGPD
Sbjct  244  EEDKLDLAKSLEAKAKEKGVQLLLPTDVVVADAFKADANAQTVSIENIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            S+K   DAL   K+VIWNGPMGVFEFD+FA GTE++
Sbjct  304  SIKVFQDALADCKSVIWNGPMGVFEFDQFAKGTEAI  339


 Score = 98.6 bits (244),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = -1

Query  444  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            LA+L+GKGVTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGK LPG+ ALDEA
Sbjct  343  LADLTGKGVTTIIGGGDSVAAVEKVGVAEKMSHISTGGGASLELLEGKVLPGIAALDEA  401



>ref|WP_015119342.1| phosphoglycerate kinase [Rivularia sp. PCC 7116]
 gb|AFY55774.1| 3-phosphoglycerate kinase [Rivularia sp. PCC 7116]
Length=401

 Score =   143 bits (361),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA +L  KAK KGV LLLPTDVV+AD FA DANS+ V    IPDGWMGLDIGPD
Sbjct  244  EEDKLELAKTLEAKAKEKGVELLLPTDVVVADNFAADANSQTVSIENIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            +VKT  +AL   K+VIWNGPMGVFEFDKFAVGTE++
Sbjct  304  AVKTFQEALGDCKSVIWNGPMGVFEFDKFAVGTEAI  339


 Score = 93.6 bits (231),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            ++ LA+LS KG TTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPG+ AL+
Sbjct  340  ARTLADLSKKGATTIIGGGDSVAAVEKVGLAEQMSHISTGGGASLELLEGKTLPGIAALN  399

Query  273  EA  268
            +A
Sbjct  400  DA  401



>ref|WP_026719925.1| phosphoglycerate kinase [Fischerella sp. PCC 9431]
Length=400

 Score =   145 bits (365),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA SL  KAK KGV+ LLPTDVV+AD FAPDANS+ V    IPDGWMGLDIGPD
Sbjct  243  EEDKLELAKSLEAKAKEKGVTFLLPTDVVVADNFAPDANSQTVSIDNIPDGWMGLDIGPD  302

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVK   +AL   K+V+WNGPMGVFEFDKFAVGTE++
Sbjct  303  SVKLFQEALADCKSVVWNGPMGVFEFDKFAVGTEAI  338


 Score = 91.7 bits (226),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -1

Query  444  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            LA++S  G TTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPG+ ALDEA
Sbjct  342  LADISKNGATTIIGGGDSVAAVEKVGLADQMSHISTGGGASLELLEGKVLPGIAALDEA  400



>ref|WP_011620601.1| phosphoglycerate kinase [Synechococcus sp. CC9311]
 sp|Q0I6M5.1|PGK_SYNS3 RecName: Full=Phosphoglycerate kinase [Synechococcus sp. CC9311]
 gb|ABI46222.1| phosphoglycerate kinase [Synechococcus sp. CC9311]
Length=402

 Score =   142 bits (359),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA  L  KAKAKGV LLLPTDV++AD FAPDANS+V   +AIPDGWMGLDIGPD
Sbjct  244  EEDKLELAKELEAKAKAKGVELLLPTDVLLADNFAPDANSQVADVTAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++K    AL   KTVIWNGPMGVFEFDKFA GT ++
Sbjct  304  AIKVFQAALADCKTVIWNGPMGVFEFDKFAAGTNAI  339


 Score = 94.0 bits (232),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -1

Query  444  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            LAELSGKG  TIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV ALD+A
Sbjct  343  LAELSGKGCCTIIGGGDSVAAVEKAGLAEKMSHISTGGGASLELLEGKVLPGVAALDDA  401



>ref|WP_015190859.1| phosphoglycerate kinase [Gloeocapsa sp. PCC 7428]
 gb|AFZ32992.1| phosphoglycerate kinase [Gloeocapsa sp. PCC 7428]
Length=400

 Score =   136 bits (342),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            E+DKL LA SL  KAK +GV +LLPTDVV+ADKFA DAN++ V    IPD  MGLD+GPD
Sbjct  243  EDDKLELAKSLEAKAKERGVQMLLPTDVVVADKFAADANAETVSVENIPDDGMGLDVGPD  302

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            SVK   DAL   K+VIWNGPMGVFEFDKFAVGTE++
Sbjct  303  SVKMFQDALAECKSVIWNGPMGVFEFDKFAVGTEAI  338


 Score =   100 bits (248),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -1

Query  453  SKKLAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALD  274
            ++ LA+L+ +GVTTIIGGGDSVAAVEKVGVA  MSHISTGGGASLELLEGKELPG+ ALD
Sbjct  339  ARTLADLTKQGVTTIIGGGDSVAAVEKVGVADQMSHISTGGGASLELLEGKELPGIAALD  398

Query  273  EA  268
            EA
Sbjct  399  EA  400



>ref|WP_028953033.1| phosphoglycerate kinase [Synechococcus sp. CC9616]
Length=402

 Score =   142 bits (359),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -3

Query  739  EEDKLGLATSLLEKAKAKGVSLLLPTDVVIADKFAPDANSKVVPASAIPDGWMGLDIGPD  560
            EEDKL LA  L  KAKAKGV LLLPTDVV+AD FAPDANS++   +AIPDGWMGLDIGPD
Sbjct  244  EEDKLELAKELEAKAKAKGVELLLPTDVVLADNFAPDANSQIADVTAIPDGWMGLDIGPD  303

Query  559  SVKTCNDALETTKTVIWNGPMGVFEFDKFAVGTESV  452
            ++K    AL   +TVIWNGPMGVFEFDKFA GT ++
Sbjct  304  AIKVFQAALADCQTVIWNGPMGVFEFDKFATGTNAI  339


 Score = 93.6 bits (231),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -1

Query  444  LAELSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKELPGVIALDEA  268
            LAELSGKG  TIIGGGDSVAAVEK G+A  MSHISTGGGASLELLEGK LPGV ALD+A
Sbjct  343  LAELSGKGCCTIIGGGDSVAAVEKAGLAEKMSHISTGGGASLELLEGKVLPGVAALDDA  401



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1347639082210