BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF011O10

Length=728
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009801071.1|  PREDICTED: EIN3-binding F-box protein 1            118   1e-26   Nicotiana sylvestris
ref|XP_009614726.1|  PREDICTED: EIN3-binding F-box protein 1-like       118   2e-26   Nicotiana tomentosiformis
emb|CDP13516.1|  unnamed protein product                                115   4e-26   Coffea canephora [robusta coffee]
ref|XP_006358273.1|  PREDICTED: EIN3-binding F-box protein 1-like       115   8e-26   Solanum tuberosum [potatoes]
ref|XP_004242782.1|  PREDICTED: EIN3-binding F-box protein 1-like       115   1e-25   Solanum lycopersicum
ref|XP_007161212.1|  hypothetical protein PHAVU_001G051300g             114   4e-25   Phaseolus vulgaris [French bean]
ref|XP_002308665.2|  grr1 family protein                                112   1e-24   
ref|XP_011039690.1|  PREDICTED: EIN3-binding F-box protein 1-like       112   2e-24   Populus euphratica
ref|XP_009625259.1|  PREDICTED: EIN3-binding F-box protein 1-like       112   2e-24   Nicotiana tomentosiformis
ref|XP_002515516.1|  grr1, plant, putative                              111   3e-24   Ricinus communis
ref|XP_009758784.1|  PREDICTED: EIN3-binding F-box protein 1-like       111   3e-24   Nicotiana sylvestris
ref|NP_001234858.1|  EIN3-binding F-box protein 1                       111   4e-24   Solanum lycopersicum
ref|XP_003544614.1|  PREDICTED: EIN3-binding F-box protein 1-like...    111   4e-24   Glycine max [soybeans]
gb|AFU61111.1|  F-box protein                                           111   4e-24   Capsicum annuum
gb|KDP33594.1|  hypothetical protein JCGZ_07165                         110   5e-24   Jatropha curcas
ref|XP_011069870.1|  PREDICTED: EIN3-binding F-box protein 1            110   6e-24   Sesamum indicum [beniseed]
gb|KHN33913.1|  EIN3-binding F-box protein 1                            110   7e-24   Glycine soja [wild soybean]
ref|XP_010696236.1|  PREDICTED: EIN3-binding F-box protein 1            110   9e-24   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU20264.1|  hypothetical protein MIMGU_mgv1a002548mg                110   1e-23   Erythranthe guttata [common monkey flower]
ref|XP_002324298.2|  hypothetical protein POPTR_0018s01710g             109   1e-23   Populus trichocarpa [western balsam poplar]
ref|NP_001234864.1|  EIN3-binding F-box protein 2                       109   2e-23   
ref|XP_006345227.1|  PREDICTED: EIN3-binding F-box protein 1-like       109   2e-23   Solanum tuberosum [potatoes]
ref|XP_002325221.1|  hypothetical protein POPTR_0018s13070g             108   2e-23   
ref|XP_011020134.1|  PREDICTED: EIN3-binding F-box protein 1-like       108   2e-23   Populus euphratica
ref|XP_006450435.1|  hypothetical protein CICLE_v10007708mg             108   3e-23   Citrus clementina [clementine]
ref|XP_006483363.1|  PREDICTED: EIN3-binding F-box protein 1-like       108   3e-23   Citrus sinensis [apfelsine]
ref|XP_011017769.1|  PREDICTED: EIN3-binding F-box protein 1-like       108   4e-23   Populus euphratica
ref|XP_011016246.1|  PREDICTED: EIN3-binding F-box protein 1-like       108   4e-23   Populus euphratica
ref|XP_011036551.1|  PREDICTED: EIN3-binding F-box protein 1-like       108   5e-23   Populus euphratica
ref|XP_006364926.1|  PREDICTED: EIN3-binding F-box protein 1-like       107   7e-23   Solanum tuberosum [potatoes]
ref|XP_002285126.1|  PREDICTED: EIN3-binding F-box protein 1-like       107   9e-23   Vitis vinifera
ref|XP_002308982.2|  hypothetical protein POPTR_0006s06770g             106   2e-22   
ref|XP_004508488.1|  PREDICTED: EIN3-binding F-box protein 2-like       105   2e-22   Cicer arietinum [garbanzo]
ref|XP_011078374.1|  PREDICTED: EIN3-binding F-box protein 1-like       105   3e-22   Sesamum indicum [beniseed]
ref|XP_010102671.1|  EIN3-binding F-box protein 1                       106   3e-22   
ref|XP_011081561.1|  PREDICTED: EIN3-binding F-box protein 1-like       105   3e-22   Sesamum indicum [beniseed]
ref|XP_004173614.1|  PREDICTED: EIN3-binding F-box protein 1-like       105   5e-22   
gb|KCW80001.1|  hypothetical protein EUGRSUZ_C01334                     104   5e-22   Eucalyptus grandis [rose gum]
gb|EYU32346.1|  hypothetical protein MIMGU_mgv1a002758mg                105   5e-22   Erythranthe guttata [common monkey flower]
ref|XP_010047961.1|  PREDICTED: EIN3-binding F-box protein 1-like       104   7e-22   Eucalyptus grandis [rose gum]
ref|XP_010048082.1|  PREDICTED: EIN3-binding F-box protein 1-like       104   7e-22   Eucalyptus grandis [rose gum]
ref|XP_003588766.1|  Ein3-binding f-box protein                         103   1e-21   Medicago truncatula
ref|XP_009791397.1|  PREDICTED: EIN3-binding F-box protein 2-like       103   1e-21   Nicotiana sylvestris
ref|XP_010254418.1|  PREDICTED: EIN3-binding F-box protein 1-like       103   1e-21   Nelumbo nucifera [Indian lotus]
ref|NP_001281254.1|  EIN3-binding F-box protein 1-like                  103   1e-21   Cucumis sativus [cucumbers]
ref|XP_006450916.1|  hypothetical protein CICLE_v10007739mg             102   3e-21   
gb|KDO80236.1|  hypothetical protein CISIN_1g006749mg                   102   3e-21   Citrus sinensis [apfelsine]
ref|XP_006475854.1|  PREDICTED: EIN3-binding F-box protein 2-like       102   3e-21   
ref|XP_010250120.1|  PREDICTED: EIN3-binding F-box protein 1-like       102   3e-21   Nelumbo nucifera [Indian lotus]
ref|XP_010048202.1|  PREDICTED: EIN3-binding F-box protein 1-like       102   4e-21   
ref|XP_008219497.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    102   5e-21   Prunus mume [ume]
ref|XP_004498740.1|  PREDICTED: EIN3-binding F-box protein 1-like       101   6e-21   Cicer arietinum [garbanzo]
gb|KCW81401.1|  hypothetical protein EUGRSUZ_C02778                     101   8e-21   Eucalyptus grandis [rose gum]
ref|XP_010048972.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    101   8e-21   Eucalyptus grandis [rose gum]
ref|XP_007013466.1|  Ein3-binding f-box protein 4                       101   8e-21   
gb|KDP32417.1|  hypothetical protein JCGZ_13342                         101   9e-21   Jatropha curcas
ref|XP_002524506.1|  grr1, plant, putative                              101   1e-20   Ricinus communis
ref|XP_003542675.1|  PREDICTED: EIN3-binding F-box protein 1-like       101   1e-20   Glycine max [soybeans]
ref|XP_003522913.1|  PREDICTED: EIN3-binding F-box protein 1-like       101   1e-20   Glycine max [soybeans]
ref|XP_009376923.1|  PREDICTED: EIN3-binding F-box protein 1-like       101   1e-20   Pyrus x bretschneideri [bai li]
ref|XP_007138419.1|  hypothetical protein PHAVU_009G207300g             101   1e-20   Phaseolus vulgaris [French bean]
gb|EPS63568.1|  ein3-binding f-box protein 3                            100   1e-20   Genlisea aurea
ref|XP_007204219.1|  hypothetical protein PRUPE_ppa003009mg             100   1e-20   
ref|XP_009607234.1|  PREDICTED: EIN3-binding F-box protein 2-like       100   1e-20   Nicotiana tomentosiformis
ref|XP_009376911.1|  PREDICTED: EIN3-binding F-box protein 1-like       100   1e-20   Pyrus x bretschneideri [bai li]
ref|XP_010687976.1|  PREDICTED: EIN3-binding F-box protein 2-like       100   1e-20   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS63879.1|  f-box family protein                                    100   1e-20   Genlisea aurea
ref|XP_008337284.1|  PREDICTED: EIN3-binding F-box protein 1-like       100   1e-20   
ref|XP_003549759.1|  PREDICTED: EIN3-binding F-box protein 1-like       100   2e-20   Glycine max [soybeans]
ref|XP_007225116.1|  hypothetical protein PRUPE_ppa002673mg             100   2e-20   Prunus persica
ref|XP_010526214.1|  PREDICTED: EIN3-binding F-box protein 1-like       100   2e-20   Tarenaya hassleriana [spider flower]
dbj|BAF01819.1|  putative glucose regulated repressor protein         97.8    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009355743.1|  PREDICTED: EIN3-binding F-box protein 1-like     99.8    3e-20   Pyrus x bretschneideri [bai li]
ref|XP_008394083.1|  PREDICTED: EIN3-binding F-box protein 1-like     99.8    3e-20   
ref|XP_008805624.1|  PREDICTED: EIN3-binding F-box protein 1-like     99.8    4e-20   Phoenix dactylifera
ref|XP_007011864.1|  EIN3-binding F box protein 1                     99.4    5e-20   
ref|XP_008362900.1|  PREDICTED: EIN3-binding F-box protein 1-like     99.4    5e-20   
gb|AFT92041.1|  EIN3 binding F-box 1                                  99.4    5e-20   Malus domestica [apple tree]
ref|XP_008805623.1|  PREDICTED: EIN3-binding F-box protein 1-like     99.4    5e-20   Phoenix dactylifera
ref|XP_008466405.1|  PREDICTED: EIN3-binding F-box protein 1 isof...  99.0    6e-20   
ref|XP_004291457.1|  PREDICTED: EIN3-binding F-box protein 1-like     99.0    6e-20   Fragaria vesca subsp. vesca
ref|XP_008466407.1|  PREDICTED: EIN3-binding F-box protein 1 isof...  99.0    6e-20   
ref|XP_010541601.1|  PREDICTED: EIN3-binding F-box protein 2          98.6    8e-20   Tarenaya hassleriana [spider flower]
gb|KJB27084.1|  hypothetical protein B456_004G276800                  98.6    9e-20   Gossypium raimondii
ref|XP_008365191.1|  PREDICTED: EIN3-binding F-box protein 1-like...  98.6    1e-19   
ref|XP_008378376.1|  PREDICTED: EIN3-binding F-box protein 1-like...  98.6    1e-19   
ref|XP_008365190.1|  PREDICTED: EIN3-binding F-box protein 1-like...  98.2    1e-19   
ref|XP_008378375.1|  PREDICTED: EIN3-binding F-box protein 1-like...  98.2    1e-19   
dbj|BAH20224.1|  AT2G25490                                            97.8    1e-19   Arabidopsis thaliana [mouse-ear cress]
gb|KJB82811.1|  hypothetical protein B456_013G215000                  98.2    1e-19   Gossypium raimondii
ref|NP_565597.1|  EIN3-binding F-box protein 1                        97.8    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008457494.1|  PREDICTED: EIN3-binding F-box protein 1-like     97.8    2e-19   Cucumis melo [Oriental melon]
ref|XP_004139306.1|  PREDICTED: EIN3-binding F-box protein 1-like     97.1    3e-19   Cucumis sativus [cucumbers]
ref|XP_008792024.1|  PREDICTED: EIN3-binding F-box protein 1-like     97.1    3e-19   
ref|XP_009364023.1|  PREDICTED: EIN3-binding F-box protein 1-like     97.1    3e-19   Pyrus x bretschneideri [bai li]
ref|XP_010907279.1|  PREDICTED: EIN3-binding F-box protein 1-like     97.1    3e-19   Elaeis guineensis
gb|KJB65824.1|  hypothetical protein B456_010G114900                  97.1    3e-19   Gossypium raimondii
gb|KHM99176.1|  EIN3-binding F-box protein 1                          91.7    4e-19   Glycine soja [wild soybean]
ref|XP_010417316.1|  PREDICTED: EIN3-binding F-box protein 1-like     96.3    4e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010429542.1|  PREDICTED: EIN3-binding F-box protein 1          96.3    5e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010472548.1|  PREDICTED: EIN3-binding F-box protein 1          96.3    5e-19   Camelina sativa [gold-of-pleasure]
ref|XP_006405190.1|  hypothetical protein EUTSA_v10000087mg           95.9    6e-19   Eutrema salsugineum [saltwater cress]
gb|EYU23011.1|  hypothetical protein MIMGU_mgv1a002803mg              95.9    6e-19   Erythranthe guttata [common monkey flower]
gb|KHG24906.1|  EIN3-binding F-box 1 -like protein                    95.9    6e-19   Gossypium arboreum [tree cotton]
ref|XP_010525963.1|  PREDICTED: EIN3-binding F-box protein 1-like     95.9    8e-19   Tarenaya hassleriana [spider flower]
ref|XP_009368857.1|  PREDICTED: EIN3-binding F-box protein 1-like     95.5    1e-18   Pyrus x bretschneideri [bai li]
gb|KJB65823.1|  hypothetical protein B456_010G114900                  95.5    1e-18   Gossypium raimondii
ref|XP_009140675.1|  PREDICTED: EIN3-binding F-box protein 1          94.7    1e-18   Brassica rapa
ref|XP_004287307.1|  PREDICTED: EIN3-binding F-box protein 1-like     94.7    2e-18   Fragaria vesca subsp. vesca
gb|KJB07737.1|  hypothetical protein B456_001G042600                  94.4    2e-18   Gossypium raimondii
ref|XP_002880682.1|  ein3-binding F box protein 1                     94.4    2e-18   
ref|XP_006293838.1|  hypothetical protein CARUB_v10022822mg           94.4    2e-18   Capsella rubella
ref|XP_007137020.1|  hypothetical protein PHAVU_009G093200g           94.0    3e-18   Phaseolus vulgaris [French bean]
gb|KJB54023.1|  hypothetical protein B456_009G017100                  94.0    3e-18   Gossypium raimondii
gb|KHG15742.1|  EIN3-binding F-box 1 -like protein                    94.0    3e-18   Gossypium arboreum [tree cotton]
emb|CDY35358.1|  BnaA04g14890D                                        94.0    3e-18   Brassica napus [oilseed rape]
gb|KJB55011.1|  hypothetical protein B456_009G058000                  93.6    4e-18   Gossypium raimondii
ref|XP_007155011.1|  hypothetical protein PHAVU_003G165500g           93.6    5e-18   Phaseolus vulgaris [French bean]
gb|KEH32121.1|  EIN3-binding F-box-like protein                       93.6    5e-18   Medicago truncatula
gb|KEH32122.1|  EIN3-binding F-box-like protein                       93.2    6e-18   Medicago truncatula
ref|XP_006842065.1|  hypothetical protein AMTR_s00078p00046140        93.2    6e-18   Amborella trichopoda
gb|KHG28503.1|  EIN3-binding F-box 1 -like protein                    93.2    7e-18   Gossypium arboreum [tree cotton]
ref|XP_003609344.1|  Ein3-binding f-box protein                       93.2    7e-18   
gb|AES73649.2|  EIN3-binding F-box-like protein                       92.8    8e-18   Medicago truncatula
gb|KFK32577.1|  hypothetical protein AALP_AA6G261300                  92.8    8e-18   Arabis alpina [alpine rockcress]
ref|XP_010907280.1|  PREDICTED: EIN3-binding F-box protein 1-like     92.8    9e-18   Elaeis guineensis
ref|XP_002874252.1|  ein3-binding F box protein 2                     92.0    1e-17   
emb|CDX80503.1|  BnaC07g29410D                                        92.0    1e-17   
emb|CDX87090.1|  BnaC09g04050D                                        91.7    2e-17   
ref|XP_006287278.1|  hypothetical protein CARUB_v10000473mg           91.7    2e-17   Capsella rubella
ref|XP_009111664.1|  PREDICTED: EIN3-binding F-box protein 2-like     91.3    2e-17   Brassica rapa
ref|XP_006648432.1|  PREDICTED: EIN3-binding F-box protein 1-like     90.5    2e-17   
gb|KHG14715.1|  EIN3-binding F-box 1 -like protein                    91.3    3e-17   Gossypium arboreum [tree cotton]
ref|XP_009397481.1|  PREDICTED: EIN3-binding F-box protein 1-like     91.3    3e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010533156.1|  PREDICTED: EIN3-binding F-box protein 1-like     90.5    4e-17   Tarenaya hassleriana [spider flower]
ref|XP_010454859.1|  PREDICTED: EIN3-binding F-box protein 2          90.5    4e-17   Camelina sativa [gold-of-pleasure]
dbj|BAJ34438.1|  unnamed protein product                              89.4    4e-17   Eutrema halophilum
ref|XP_010322126.1|  PREDICTED: EIN3-binding F-box protein 1-like     90.5    4e-17   
ref|XP_010493788.1|  PREDICTED: EIN3-binding F-box protein 2-like     90.5    5e-17   Camelina sativa [gold-of-pleasure]
ref|NP_197917.1|  EIN3-binding F-box protein 2                        90.5    5e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010421385.1|  PREDICTED: EIN3-binding F-box protein 2-like     90.5    5e-17   Camelina sativa [gold-of-pleasure]
gb|KHN07078.1|  EIN3-binding F-box protein 1                          90.1    5e-17   Glycine soja [wild soybean]
gb|AEK81539.1|  EIN3 binding F-box 1                                  90.1    6e-17   Dianthus caryophyllus [carnation]
emb|CDP10419.1|  unnamed protein product                              89.7    7e-17   Coffea canephora [robusta coffee]
ref|XP_010086585.1|  hypothetical protein L484_002248                 89.7    8e-17   Morus notabilis
gb|ACB59221.1|  F-box protein                                         89.7    9e-17   Brassica oleracea
ref|XP_009151059.1|  PREDICTED: EIN3-binding F-box protein 2          89.4    1e-16   Brassica rapa
emb|CDX88173.1|  BnaA06g27640D                                        89.4    1e-16   
gb|KJB07621.1|  hypothetical protein B456_001G033400                  89.4    1e-16   Gossypium raimondii
ref|XP_006394785.1|  hypothetical protein EUTSA_v10003828mg           89.4    1e-16   Eutrema salsugineum [saltwater cress]
ref|XP_009381112.1|  PREDICTED: EIN3-binding F-box protein 1-like     89.4    1e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002285249.2|  PREDICTED: EIN3-binding F-box protein 1-like     89.4    1e-16   Vitis vinifera
emb|CBI21043.3|  unnamed protein product                              89.0    1e-16   Vitis vinifera
gb|ABK25485.1|  unknown                                               88.6    1e-16   Picea sitchensis
gb|ADW83728.1|  EIN3-binding F-box protein 1                          87.8    2e-16   Musa acuminata AAA Group [Cavendish banana]
ref|XP_009388655.1|  PREDICTED: EIN3-binding F-box protein 1-like     88.6    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004170235.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...  88.2    2e-16   
emb|CDY19807.1|  BnaA09g04600D                                        88.2    2e-16   Brassica napus [oilseed rape]
ref|XP_004150592.1|  PREDICTED: EIN3-binding F-box protein 1-like     88.2    2e-16   Cucumis sativus [cucumbers]
ref|XP_010555012.1|  PREDICTED: EIN3-binding F-box protein 2-like     88.2    3e-16   Tarenaya hassleriana [spider flower]
ref|XP_008445218.1|  PREDICTED: EIN3-binding F-box protein 1          88.2    3e-16   Cucumis melo [Oriental melon]
ref|XP_004138725.1|  PREDICTED: EIN3-binding F-box protein 1-like     88.2    3e-16   Cucumis sativus [cucumbers]
ref|XP_010541915.1|  PREDICTED: EIN3-binding F-box protein 1-like     87.8    3e-16   Tarenaya hassleriana [spider flower]
ref|XP_008443991.1|  PREDICTED: EIN3-binding F-box protein 1-like     87.4    5e-16   Cucumis melo [Oriental melon]
gb|ACF81449.1|  unknown                                               83.2    8e-16   Zea mays [maize]
ref|XP_009403463.1|  PREDICTED: EIN3-binding F-box protein 1-like     86.7    9e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003522614.1|  PREDICTED: EIN3-binding F-box protein 1-like...  86.7    1e-15   Glycine max [soybeans]
gb|AES91540.2|  EIN3-binding F-box-like protein                       86.3    1e-15   Medicago truncatula
emb|CAN83761.1|  hypothetical protein VITISV_043743                   86.3    1e-15   Vitis vinifera
ref|NP_001046222.1|  Os02g0200900                                     85.9    1e-15   
dbj|BAD15849.1|  putative F-box protein                               85.9    2e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EAY84905.1|  hypothetical protein OsI_06273                        85.5    2e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_003609343.1|  Ein3-binding f-box protein                       85.9    2e-15   
emb|CAN82790.1|  hypothetical protein VITISV_030601                   85.1    3e-15   Vitis vinifera
ref|NP_001132560.1|  F-box family member                              83.2    3e-15   
ref|XP_002437255.1|  hypothetical protein SORBIDRAFT_10g023670        82.4    3e-15   
gb|AFW87207.1|  hypothetical protein ZEAMMB73_795948                  84.3    5e-15   
gb|ACR35519.1|  unknown                                               82.8    1e-14   Zea mays [maize]
ref|XP_009419280.1|  PREDICTED: EIN3-binding F-box protein 1-like     83.2    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008681226.1|  PREDICTED: F-box family member isoform X1        82.8    1e-14   
ref|XP_004951542.1|  PREDICTED: EIN3-binding F-box protein 1-like     82.8    2e-14   Setaria italica
ref|NP_001147557.1|  LOC100281166                                     82.0    3e-14   Zea mays [maize]
ref|XP_004965933.1|  PREDICTED: EIN3-binding F-box protein 1-like     81.6    4e-14   Setaria italica
ref|NP_001058023.1|  Os06g0605900                                     75.9    7e-14   
ref|XP_003603398.1|  Ein3-binding f-box protein                       80.5    8e-14   
ref|NP_001145991.1|  uncharacterized protein LOC100279520             79.7    1e-13   
ref|XP_002453497.1|  hypothetical protein SORBIDRAFT_04g006870        79.7    1e-13   Sorghum bicolor [broomcorn]
ref|XP_008677099.1|  PREDICTED: uncharacterized protein LOC100279...  79.7    2e-13   
ref|NP_001237471.1|  grr1 protein                                     79.3    2e-13   
gb|AFW66152.1|  hypothetical protein ZEAMMB73_923849                  79.3    2e-13   
gb|EMS45959.1|  hypothetical protein TRIUR3_29988                     76.3    1e-12   Triticum urartu
ref|XP_003571400.1|  PREDICTED: EIN3-binding F-box protein 1-like     76.6    2e-12   Brachypodium distachyon [annual false brome]
gb|EMT19526.1|  hypothetical protein F775_07091                       75.9    3e-12   
dbj|BAD35544.1|  putative F-box protein Fbl2                          75.5    4e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006657116.1|  PREDICTED: EIN3-binding F-box protein 1-like     75.1    4e-12   Oryza brachyantha
gb|EAZ01599.1|  hypothetical protein OsI_23635                        75.5    4e-12   Oryza sativa Indica Group [Indian rice]
gb|EMT32544.1|  hypothetical protein F775_30491                       74.3    6e-12   
dbj|BAJ88579.1|  predicted protein                                    73.2    2e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003563656.1|  PREDICTED: EIN3-binding F-box protein 1          72.4    3e-11   Brachypodium distachyon [annual false brome]
gb|EMS68820.1|  hypothetical protein TRIUR3_29831                     72.0    4e-11   Triticum urartu
gb|AFA36487.1|  EIN3-binding F-box protein                            69.7    6e-11   Lolium perenne [perennial ryegrass]
ref|XP_010264613.1|  PREDICTED: EIN3-binding F-box protein 2-like     70.9    1e-10   Nelumbo nucifera [Indian lotus]
ref|XP_001775242.1|  predicted protein                                67.8    1e-09   
emb|CDX76980.1|  BnaC04g37750D                                        64.3    1e-08   
ref|XP_010251723.1|  PREDICTED: EIN3-binding F-box protein 1-like     63.5    3e-08   Nelumbo nucifera [Indian lotus]
ref|XP_001783097.1|  predicted protein                                62.8    5e-08   
ref|XP_002986021.1|  hypothetical protein SELMODRAFT_123441           60.5    3e-07   
ref|XP_002981899.1|  hypothetical protein SELMODRAFT_233861           60.1    4e-07   
ref|XP_010908612.1|  PREDICTED: EIN3-binding F-box protein 1-like     59.7    5e-07   Elaeis guineensis
ref|XP_007136869.1|  hypothetical protein PHAVU_009G080700g           57.4    4e-06   Phaseolus vulgaris [French bean]
ref|XP_009032915.1|  hypothetical protein AURANDRAFT_11299            54.3    2e-05   Aureococcus anophagefferens
ref|XP_006849175.1|  hypothetical protein AMTR_s00027p00189050        52.8    1e-04   
ref|XP_009386195.1|  PREDICTED: EIN3-binding F-box protein 1-like     51.2    4e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002974778.1|  hypothetical protein SELMODRAFT_442539           50.8    5e-04   Selaginella moellendorffii
ref|XP_002963689.1|  hypothetical protein SELMODRAFT_62165            50.8    6e-04   
emb|CBI28209.3|  unnamed protein product                              50.4    7e-04   Vitis vinifera
ref|XP_785847.3|  PREDICTED: F-box/LRR-repeat protein 7-like          50.1    9e-04   Strongylocentrotus purpuratus [purple urchin]



>ref|XP_009801071.1| PREDICTED: EIN3-binding F-box protein 1 [Nicotiana sylvestris]
Length=669

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  SCEEglvkvnxngcvnvGDLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLC  545
            SCE GLVKVN +GCVNV D +VSAI + HG +LE LN+DGC YVTD +LVAI+++C +L 
Sbjct  529  SCEAGLVKVNLSGCVNVTDKSVSAITELHGGSLEFLNVDGCKYVTDATLVAISNNCWLLS  588

Query  544  ELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCP  365
            ELD+SK  ITDSGI +L  AVQL+L +LSLSGC+M+SNK+LP L KLG +L+GLNIQ+C 
Sbjct  589  ELDLSKCGITDSGIASLAGAVQLNLQILSLSGCSMLSNKSLPFLQKLGQTLMGLNIQHCN  648

Query  364  GISSSGVDSLGEKLWRYDVLS  302
            GISSS VD L E+LWR D+L+
Sbjct  649  GISSSAVDLLLEQLWRCDILA  669



>ref|XP_009614726.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=669

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  SCEEglvkvnxngcvnvGDLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLC  545
            SCE GLVK+N +GCVNV D +VSAI + HG +LE LN+DGC YVTD +LVAI+++C +L 
Sbjct  529  SCEAGLVKMNLSGCVNVTDKSVSAITELHGGSLEFLNVDGCRYVTDATLVAISNNCWLLS  588

Query  544  ELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCP  365
            ELD+SK  ITDSGI +L  AVQL+L +LSLSGC+M+S+K+LP L KLG +L+GLNIQ+C 
Sbjct  589  ELDLSKCGITDSGIASLAGAVQLNLQILSLSGCSMLSDKSLPFLQKLGQTLMGLNIQHCN  648

Query  364  GISSSGVDSLGEKLWRYDVLS  302
            GISSS VD L E+LWR D+L+
Sbjct  649  GISSSAVDLLLEQLWRCDILA  669



>emb|CDP13516.1| unnamed protein product [Coffea canephora]
Length=540

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 91/122 (75%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D   +AIAK HG TLE LNLDGC  VTD +L AIA+HCS+L ELDVSKSRITD+G  AL 
Sbjct  418  DKVTAAIAKLHGCTLEELNLDGCKCVTDATLFAIAEHCSLLSELDVSKSRITDAGTAALA  477

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL L +LSLSGC +VSN+ L  + KLG +L+GLNIQ+C G+ S  +D L E+LWR D
Sbjct  478  GADQLCLRILSLSGCNLVSNRGLLSVEKLGQTLMGLNIQHCYGVKSDALDLLAERLWRCD  537

Query  310  VL  305
            +L
Sbjct  538  IL  539



>ref|XP_006358273.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=642

 Score =   115 bits (289),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V ++A+ HGETLE LNLDGC  VTD SLVAIAD+C +L +LDVSK  ITDSG+ AL+
Sbjct  520  DEVVLSLARLHGETLELLNLDGCRRVTDASLVAIADNCLLLNDLDVSKCSITDSGLAALS  579

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
            + VQL+L VLSLSGC+MV+NK+   L  LG SL+GLN+Q+C  I SS +++L E LWR D
Sbjct  580  QGVQLNLQVLSLSGCSMVTNKSFSSLRTLGESLIGLNLQHCNAIGSSRIEALVEDLWRCD  639

Query  310  VLS  302
            +LS
Sbjct  640  ILS  642



>ref|XP_004242782.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=641

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V ++A+ HGETLE LNLDGC  VTD SLVAIAD+C +L +LDVSK  ITDSG+ AL+
Sbjct  519  DEVVLSLARLHGETLELLNLDGCRKVTDASLVAIADNCLLLNDLDVSKCSITDSGVAALS  578

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
            + VQ++L VLSLSGC+MV+NK+   L  LG SL+GLN+Q+C  I SS V++L E LWR D
Sbjct  579  QGVQMNLQVLSLSGCSMVTNKSFSSLRTLGESLIGLNLQHCSSIGSSRVEALVEDLWRCD  638

Query  310  VLS  302
            +LS
Sbjct  639  ILS  641



>ref|XP_007161212.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
 gb|ESW33206.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
Length=643

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS++A  HG TLE LNLDGC  ++D SL+AIA++C++LC+LDVSK  ITD+GI AL 
Sbjct  521  DKVVSSLANLHGWTLENLNLDGCKNISDASLMAIAENCALLCDLDVSKCSITDAGIAALA  580

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A Q++L +LSLSGCA+VS+++LP L K+G +L+GLNIQ+C  I+SS VD L E LWR D
Sbjct  581  HAQQINLQILSLSGCALVSDRSLPALRKVGRTLLGLNIQHCNAINSSTVDMLVELLWRCD  640

Query  310  VLS  302
            +LS
Sbjct  641  ILS  643



>ref|XP_002308665.2| grr1 family protein [Populus trichocarpa]
 gb|EEE92188.2| grr1 family protein [Populus trichocarpa]
Length=646

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS + +QHG TLE LNLDGC  +TD SLVAIA++C +L +LDVSK   TDSGI A+ 
Sbjct  524  DKVVSVMTEQHGWTLEVLNLDGCRRITDASLVAIAENCFLLSDLDVSKCATTDSGIAAMA  583

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + QL+L VLS+SGC+M+S+K+L  L+KLG +L+GLN+Q+C  ISSS VD L E+LWR D
Sbjct  584  RSNQLNLQVLSMSGCSMISDKSLLALIKLGRTLLGLNLQHCNAISSSTVDVLVERLWRCD  643

Query  310  VLS  302
            +LS
Sbjct  644  ILS  646



>ref|XP_011039690.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS + +QHG TLE LNLDGC  +TD SLVAIA++C +L +LDVSK   TDSGI A+ 
Sbjct  524  DKVVSVMTEQHGWTLEVLNLDGCRRITDASLVAIAENCFLLSDLDVSKCAATDSGIAAMA  583

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + QL+L VLS+SGC+MVS+K+LP L+KLG +L+GLN+Q+C  ISSS VD L E+LWR D
Sbjct  584  RSNQLNLQVLSMSGCSMVSDKSLPALIKLGGTLLGLNLQHCNAISSSTVDVLVERLWRCD  643

Query  310  VLS  302
            +LS
Sbjct  644  ILS  646



>ref|XP_009625259.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=646

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V ++A+ H ETLE LNLDGC  VTD SLVAIAD+C +L +LDVSK  ITDSG+ AL+
Sbjct  524  DEVVLSLARLHSETLEVLNLDGCRKVTDASLVAIADNCPLLNDLDVSKCSITDSGVAALS  583

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
              VQ++L +LS+SGC+MV+NK++P L KLG SLVGLN+Q+C  ISSS V+ L E LWR D
Sbjct  584  HGVQVNLQILSISGCSMVTNKSVPALKKLGESLVGLNLQHCNAISSSRVEILVEDLWRCD  643

Query  310  VLS  302
            +LS
Sbjct  644  ILS  646



>ref|XP_002515516.1| grr1, plant, putative [Ricinus communis]
 gb|EEF46965.1| grr1, plant, putative [Ricinus communis]
Length=651

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D AVSA+ +QHG TLE LNL+GC  +TD SL AIA++C +L ELDVSKS I+DSG++ L 
Sbjct  529  DKAVSALTEQHGWTLEVLNLEGCEKITDASLAAIAENCFLLSELDVSKSAISDSGLMVLA  588

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + QL+L + S SGC+M+S+++LP L+KLG +L+GLN+Q+C  IS+S +D L E+LWR D
Sbjct  589  RSKQLNLQIFSASGCSMISDRSLPALVKLGQTLLGLNLQHCNAISTSAIDLLVERLWRCD  648

Query  310  VLS  302
            +LS
Sbjct  649  ILS  651



>ref|XP_009758784.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana sylvestris]
Length=645

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V ++A+ HGETLE LNLDGC  VTD SLVAIA++C +L +LDVSK  ITDSG+ AL+
Sbjct  523  DEVVLSLARLHGETLELLNLDGCRKVTDASLVAIANNCPLLNDLDVSKCSITDSGVAALS  582

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
              VQ++L +LS+SGC+MV+ K++P L+KLG SLVGLN+Q+C  ISSS V+ + E LWR D
Sbjct  583  HGVQVNLQILSISGCSMVTKKSVPSLIKLGESLVGLNLQHCNAISSSRVEIIVEDLWRCD  642

Query  310  VLS  302
            +LS
Sbjct  643  ILS  645



>ref|NP_001234858.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABB89717.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABC24971.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ACS44350.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
Length=637

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 96/123 (78%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V ++A +HGETLE LNLDGC  VTD SLVAIAD+C +L +LDVSKS ITDSG+ AL+
Sbjct  516  DQVVLSLAMRHGETLELLNLDGCRKVTDASLVAIADYCPLLIDLDVSKSAITDSGVAALS  575

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
              VQ++L VLSLSGC+MVSNK++  L KLG +L+GLN+Q+C  +S S V+ L E LWR D
Sbjct  576  RGVQVNLQVLSLSGCSMVSNKSVLSLKKLGENLLGLNLQHC-SVSCSSVELLVEALWRCD  634

Query  310  VLS  302
            +LS
Sbjct  635  ILS  637



>ref|XP_003544614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN13750.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = -2

Query  661  VSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAV  482
            VS++A  HG TLE LNLDGC  ++D SL+AIA++C++LC+LDVSK  ITD+GI AL  A 
Sbjct  525  VSSLANLHGWTLENLNLDGCKNISDASLMAIAENCALLCDLDVSKCAITDAGIEALAHAK  584

Query  481  QLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  302
            Q++L VLSLSGC +VS+++LP L +LG +L+GLNIQ+C  I+SS VD+L E LWR D+LS
Sbjct  585  QINLQVLSLSGCTLVSDRSLPALRELGHTLLGLNIQHCNAINSSTVDTLVELLWRCDILS  644



>gb|AFU61111.1| F-box protein [Capsicum annuum]
Length=637

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 95/123 (77%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V ++A +HGETLE LNLDGC  VTD SLVAIAD+CS+L +LDVSK  ITDSG+ AL+
Sbjct  516  DQVVLSLAARHGETLELLNLDGCRKVTDASLVAIADNCSLLNDLDVSKCAITDSGVAALS  575

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
              VQ++L VLSLSGC+MVSNK++P L KLG  L+GLN+Q+C  IS S V+ L E LWR D
Sbjct  576  RGVQVNLQVLSLSGCSMVSNKSVPSLKKLGECLLGLNLQHC-SISCSSVELLAEDLWRCD  634

Query  310  VLS  302
            + S
Sbjct  635  IFS  637



>gb|KDP33594.1| hypothetical protein JCGZ_07165 [Jatropha curcas]
Length=645

 Score =   110 bits (276),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSA+ +QHG TLE LNLDGCG +TD SL AIA++C +L +LDVSK  I+DSG++ L 
Sbjct  523  DKVVSALTEQHGWTLEVLNLDGCGKITDESLTAIAENCLMLSDLDVSKCAISDSGLMVLA  582

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + QL+L + S++GC+M+S+K+LP ++K+G +L+GLNIQ+C  ISSS VD L E+LWR D
Sbjct  583  RSNQLNLQIFSVAGCSMISDKSLPAIVKMGHTLLGLNIQHCNAISSSTVDLLVERLWRCD  642

Query  310  VLS  302
            +LS
Sbjct  643  ILS  645



>ref|XP_011069870.1| PREDICTED: EIN3-binding F-box protein 1 [Sesamum indicum]
Length=666

 Score =   110 bits (276),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V AI++ HGETLE L+LDGC Y+TD+S++AIA +CSVL ELDVS+  ITDSG+  L 
Sbjct  544  DNVVMAISELHGETLEVLHLDGCQYITDLSMLAIARNCSVLSELDVSQCGITDSGVAVLA  603

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QLSL + SL+GC++VS+K+LP L+ LG +LVGLNIQ+C GIS   VD L ++LWR D
Sbjct  604  SAEQLSLQIFSLAGCSLVSDKSLPFLVLLGKTLVGLNIQHCRGISCGTVDLLVDQLWRCD  663

Query  310  VLS  302
            +LS
Sbjct  664  ILS  666



>gb|KHN33913.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   110 bits (275),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS++A  HG TLE LNLDGC  ++D SL+AIA++C++LC+LDVSK  ITD+GI  L 
Sbjct  522  DKVVSSLANLHGWTLENLNLDGCKNISDASLMAIAENCALLCDLDVSKCTITDAGIAVLA  581

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A Q++L +LSLSGC +VS+++L  L KLG +L+GLNIQ+C  I++S VD+L E LWR D
Sbjct  582  HAEQINLQILSLSGCTLVSDRSLTALRKLGHTLLGLNIQHCNAINNSTVDTLVEFLWRCD  641

Query  310  VLS  302
            +LS
Sbjct  642  ILS  644



>ref|XP_010696236.1| PREDICTED: EIN3-binding F-box protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=641

 Score =   110 bits (274),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V A+AK HG TLE LNL+GCG VTD  LVAIAD C VL ELDVSK  ITD G+  L 
Sbjct  519  DNVVIALAKYHGGTLEVLNLEGCGKVTDAGLVAIADDCLVLNELDVSKCAITDFGVATLA  578

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + QLSL +LSLSGC+M+S+K LP L+KLG SL+G+N+QNC  ISSS +D L  +L+R D
Sbjct  579  RSKQLSLQILSLSGCSMLSDKCLPFLVKLGQSLMGMNLQNCNSISSSVIDMLVGRLFRCD  638

Query  310  VLS  302
            +LS
Sbjct  639  ILS  641



>gb|EYU20264.1| hypothetical protein MIMGU_mgv1a002548mg [Erythranthe guttata]
Length=660

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V  IAK HGETLE LNLDGC +VTDVSL+AIA +C  + ELDVS+  ITD GI  L 
Sbjct  538  DNVVVEIAKVHGETLEVLNLDGCRFVTDVSLMAIAKNCLFMSELDVSQCGITDYGIAVLA  597

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QLSL + S++GC++VS+K+L  L  LG SL+GLNIQ+C G+S   V+ L EKLWR D
Sbjct  598  RAEQLSLQIFSIAGCSLVSDKSLSSLGMLGKSLLGLNIQHCSGLSYGAVNLLLEKLWRCD  657

Query  310  VLS  302
            +LS
Sbjct  658  ILS  660



>ref|XP_002324298.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
 gb|EEF02863.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
Length=646

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS + +QHG TLE LNLDGC  +TD SLVAIA++C +L +LDVSK   TDSGI A+ 
Sbjct  524  DKVVSVMTEQHGWTLEMLNLDGCRRITDASLVAIAENCFLLYDLDVSKCATTDSGIAAMA  583

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + QL L VLS+SGC+M+S+K+LP L+KLG +L+GLN+Q+C  ISSS VD L E+LWR D
Sbjct  584  RSKQLCLQVLSVSGCSMISDKSLPALVKLGQTLLGLNLQHCNAISSSTVDILVERLWRCD  643

Query  310  VL  305
            +L
Sbjct  644  IL  645



>ref|NP_001234864.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ABC24972.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ACS44349.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
Length=665

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  SCEEglvkvnxngcvnvGDLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLC  545
            SCE GLVKVN +GCVNV D +VS I + HG +LE+LN+D C YVTD++L+AI+++C +L 
Sbjct  525  SCEAGLVKVNLSGCVNVTDRSVSFITELHGGSLESLNVDECRYVTDMTLLAISNNCWLLK  584

Query  544  ELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCP  365
            ELDVSK  ITDSG+ +L   V+L+L +LSLSGC+M+S+K++P L KLG +L+GLNIQ+C 
Sbjct  585  ELDVSKCGITDSGVASLASTVRLNLQILSLSGCSMLSDKSVPFLQKLGQTLMGLNIQHCN  644

Query  364  GISSSGVDSLGEKLWRYDVLS  302
            G+SSS VD L E+LWR D+LS
Sbjct  645  GVSSSCVDLLLEQLWRCDILS  665



>ref|XP_006345227.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=637

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 96/123 (78%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V ++A +HGETLE LNLDGC  VTD SLVAIAD+C +L +LDVSK  ITDSG+ AL+
Sbjct  516  DQVVLSLATRHGETLELLNLDGCRKVTDASLVAIADYCPLLNDLDVSKCAITDSGVAALS  575

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
              VQ++L VLSLSGC+MVSNK++P L KLG +L+GLN+Q+C  +S S V+ L E LWR D
Sbjct  576  RGVQVNLQVLSLSGCSMVSNKSVPSLKKLGENLLGLNLQHC-SVSCSSVELLVEDLWRCD  634

Query  310  VLS  302
            +LS
Sbjct  635  ILS  637



>ref|XP_002325221.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
 gb|EEF03786.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
Length=632

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSA+A+ HG TLE LNLDGC  +TD SL+AIA++C  L +LDVSK  +TDSGI  L+
Sbjct  510  DEVVSALARLHGGTLELLNLDGCRKITDASLLAIAENCLFLSDLDVSKCAVTDSGITILS  569

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L VLSLSGC+ VSNK LP L K+G +LVGLN+QNC  ISSS V+ L E LWR D
Sbjct  570  SAEQLNLQVLSLSGCSEVSNKILPCLKKMGRTLVGLNLQNCSSISSSTVELLVESLWRCD  629

Query  310  VLS  302
            +LS
Sbjct  630  ILS  632



>ref|XP_011020134.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=656

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSA+A+ HG TLE LNLDGC  +TD SLVAIA++C  L +LD+SK  +TDSGI  ++
Sbjct  534  DEVVSALARLHGGTLELLNLDGCRKITDASLVAIAENCLFLSDLDLSKCAVTDSGIAVMS  593

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L VLSLSGC+ VSNK+LP L K+G +LVGLN+QNC  ISSS V+ L E LWR D
Sbjct  594  SAEQLNLQVLSLSGCSEVSNKSLPCLKKMGRTLVGLNLQNCSSISSSTVELLVESLWRCD  653

Query  310  VLS  302
            +LS
Sbjct  654  ILS  656



>ref|XP_006450435.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
 gb|ESR63675.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
Length=645

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 107/141 (76%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  SCEEglvkvnxngcvnvGDLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLC  545
            SCE GL KVN +GCVN+ D  VS +A+ HG TLE LNLDGC  ++D SL+AIAD+C +LC
Sbjct  505  SCEAGLAKVNLSGCVNLTDKVVSTMAELHGWTLEMLNLDGCRKISDASLMAIADNCPLLC  564

Query  544  ELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCP  365
            +LDVSK  +TD GI +L     L+L +LSLSGC+MVS+K+L  L KLG +L+GLN+Q+C 
Sbjct  565  DLDVSKCAVTDFGIASLAHGNYLNLQILSLSGCSMVSDKSLGALRKLGQTLLGLNLQHCN  624

Query  364  GISSSGVDSLGEKLWRYDVLS  302
             IS++ VD L E+LWR DVLS
Sbjct  625  AISTNSVDMLVEQLWRCDVLS  645



>ref|XP_006483363.1| PREDICTED: EIN3-binding F-box protein 1-like [Citrus sinensis]
 gb|KDO61730.1| hypothetical protein CISIN_1g006426mg [Citrus sinensis]
Length=645

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 107/141 (76%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  SCEEglvkvnxngcvnvGDLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLC  545
            SCE GL KVN +GCVN+ D  VS +A+ HG TLE LNLDGC  ++D SL+AIAD+C +LC
Sbjct  505  SCEAGLAKVNLSGCVNLTDKVVSTMAELHGWTLEMLNLDGCRKISDASLMAIADNCPLLC  564

Query  544  ELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCP  365
            +LDVSK  +TD GI +L     L+L +LSLSGC+MVS+K+L  L KLG +L+GLN+Q+C 
Sbjct  565  DLDVSKCAVTDFGIASLAHGNYLNLQILSLSGCSMVSDKSLGALRKLGQTLLGLNLQHCN  624

Query  364  GISSSGVDSLGEKLWRYDVLS  302
             IS++ VD L E+LWR DVLS
Sbjct  625  AISTNSVDMLVEQLWRCDVLS  645



>ref|XP_011017769.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=655

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSA+A+ HG TLE LNLDGC  +TD SL+AIA++C  L +LDVSK  +TDSGI  L+
Sbjct  533  DEVVSALARLHGGTLELLNLDGCRKITDASLLAIAENCLFLSDLDVSKCAVTDSGITMLS  592

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L VLSLSGC+ VSNK LP L K+G +LVGLN+QNC  ISSS V+ L E LWR D
Sbjct  593  SAEQLNLQVLSLSGCSEVSNKILPCLKKMGRTLVGLNLQNCCSISSSTVELLVESLWRCD  652

Query  310  VLS  302
            +LS
Sbjct  653  ILS  655



>ref|XP_011016246.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V  + +QHG TLE LNLDGC  +TD SLVAIA++C +L +LDVSK   TDSGI A+ 
Sbjct  524  DKVVGVMTEQHGWTLEMLNLDGCKRITDASLVAIAENCFLLYDLDVSKCATTDSGIAAMA  583

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + QL L VLS+SGC+M+S+K+LP L+KLG +L+GLN+Q+C  ISSS VD L E+LWR D
Sbjct  584  RSQQLCLQVLSVSGCSMISDKSLPALVKLGQTLLGLNLQHCNAISSSTVDILVERLWRCD  643

Query  310  VL  305
            +L
Sbjct  644  IL  645



>ref|XP_011036551.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V  + +QHG TLE LNLDGC  +TD SLVAIA++C +L +LDVSK   TDSGI A+ 
Sbjct  524  DKVVGVMTEQHGWTLEMLNLDGCKRITDASLVAIAENCFLLYDLDVSKCATTDSGIAAMA  583

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + QL L VLS+SGC+M+S+K+LP L+KLG +L+GLN+Q+C  ISSS VD L E+LWR D
Sbjct  584  RSQQLCLQVLSVSGCSMISDKSLPALVKLGQTLLGLNLQHCNAISSSTVDILVERLWRCD  643

Query  310  VL  305
            +L
Sbjct  644  IL  645



>ref|XP_006364926.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=669

 Score =   107 bits (268),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 112/141 (79%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  SCEEglvkvnxngcvnvGDLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLC  545
            SCE GLVKVN +GCVNV D +VS I + HG +LE+LN+D C YVTD +L+AI+++C +L 
Sbjct  529  SCEAGLVKVNLSGCVNVTDRSVSFITELHGGSLESLNVDECPYVTDATLLAISNNCWLLK  588

Query  544  ELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCP  365
            ELD+SK  ITDSGI +L   V+L+L +LSLSGC+M+S+K++P L KLG +LVGLNIQ+C 
Sbjct  589  ELDISKCGITDSGIASLASTVRLNLQILSLSGCSMLSDKSVPFLQKLGQTLVGLNIQHCN  648

Query  364  GISSSGVDSLGEKLWRYDVLS  302
            G+SS  VD L E+LWR D+LS
Sbjct  649  GVSSRCVDLLLEQLWRCDILS  669



>ref|XP_002285126.1| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=667

 Score =   107 bits (267),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = -2

Query  724  SCEEglvkvnxngcvnvGDLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLC  545
            SCE  L+KVN +GC+N+ D  VSA+AK HG TLE LNLDGC  +TD S+ AIA++C++L 
Sbjct  527  SCEASLIKVNLSGCMNLTDNVVSALAKVHGGTLEQLNLDGCQKITDASMFAIAENCALLS  586

Query  544  ELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCP  365
            +LDVSK+ ITD G+ AL  A  L++ +LSLSGC+++SN+++P L KLG +L+GLN+Q C 
Sbjct  587  DLDVSKTAITDYGVAALASAKHLNVQILSLSGCSLISNQSVPFLRKLGQTLLGLNLQQCN  646

Query  364  GISSSGVDSLGEKLWRYDVL  305
             ISSS V+ L E+LWR D+L
Sbjct  647  TISSSMVNMLVEQLWRCDIL  666



>ref|XP_002308982.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
 gb|EEE92505.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
Length=656

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSA+A+ HG TLE LNLDGC  +TD SLVAIA++C  L +LD+SK  +TDSGI  ++
Sbjct  534  DEVVSALARLHGGTLELLNLDGCRKITDASLVAIAENCLFLSDLDLSKCAVTDSGIAVMS  593

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L VLSLSGC+ VSNK+LP L K+G +LVGLN+Q C  ISSS V+ L E LWR D
Sbjct  594  SAEQLNLQVLSLSGCSEVSNKSLPCLKKMGRTLVGLNLQKCSSISSSTVELLVESLWRCD  653

Query  310  VLS  302
            +LS
Sbjct  654  ILS  656



>ref|XP_004508488.1| PREDICTED: EIN3-binding F-box protein 2-like [Cicer arietinum]
Length=639

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSA+A+ HG TLE LNLDGC  +TD SL AIAD+C +L +LDVS+  ITD+GI  L+
Sbjct  517  DHIVSALARLHGGTLELLNLDGCWNITDASLAAIADNCLLLNDLDVSRCAITDAGIAVLS  576

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  LSL VLSLSGC+ VSNK+ P L  LG +L+GLN+QNC  ISS+ ++ L E LWR D
Sbjct  577  NANHLSLQVLSLSGCSEVSNKSSPFLTTLGQTLLGLNLQNCNAISSNTIELLVENLWRCD  636

Query  310  VLS  302
            +L+
Sbjct  637  ILA  639



>ref|XP_011078374.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=647

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V A+A+ HGETLE LNLDGC  +TD SL A+A+ C +L +LDVSK  ITD+G+VAL+
Sbjct  525  DEVVLALARLHGETLELLNLDGCQKITDASLAALAESCPLLNDLDVSKCSITDTGVVALS  584

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
               Q +L +LS SGC+M+SNK  P L +LG +LVGLN+Q+C  ISS+ ++ L E LWR D
Sbjct  585  HGSQHNLQILSFSGCSMISNKCRPALEQLGRTLVGLNLQHCNSISSNSIELLTENLWRCD  644

Query  310  VLS  302
            +LS
Sbjct  645  ILS  647



>ref|XP_010102671.1| EIN3-binding F-box protein 1 [Morus notabilis]
 gb|EXC46038.1| EIN3-binding F-box protein 1 [Morus notabilis]
Length=697

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSA+A+ HG TLE LNL+GC  ++DV LVAIAD C +L ELDVS+  ITD G+ AL 
Sbjct  575  DKVVSAMAESHGWTLEMLNLEGCVKISDVGLVAIADDCPLLSELDVSRCAITDFGLAALA  634

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  L+L +LSLSGC+++++K++  L K G +LVGLN+Q+C  IS+S VD L  +LWR D
Sbjct  635  RANHLNLQILSLSGCSLITDKSMAALGKTGQTLVGLNLQHCKAISNSTVDRLLGELWRCD  694

Query  310  VLS  302
            +LS
Sbjct  695  ILS  697



>ref|XP_011081561.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=669

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V+ I K HG TLE LNLDGC  +TDVSL AIA +CS+L ELDVS+ RITDSGI  L 
Sbjct  547  DNLVAEITKLHGGTLEILNLDGCRCITDVSLKAIARNCSLLSELDVSQCRITDSGIAILA  606

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL L VLS++GC++VS+K+LP L  +G SLVGLNIQ+C GIS   V+ L E LWR D
Sbjct  607  GAEQLFLRVLSVAGCSLVSDKSLPFLALVGKSLVGLNIQHCCGISCGTVNQLLEHLWRCD  666

Query  310  VLS  302
            +LS
Sbjct  667  ILS  669



>ref|XP_004173614.1| PREDICTED: EIN3-binding F-box protein 1-like, partial [Cucumis 
sativus]
Length=631

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 89/123 (72%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS+I + HG TL+ LNLD C  +TD S+ +IA++C +L +LDVSK  ITDSGI  L 
Sbjct  509  DEVVSSIMEHHGSTLKMLNLDSCKKITDASMTSIANNCPLLSDLDVSKCSITDSGIATLA  568

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L + S+SGC+ VS K+L  L+ LG +LVGLNIQ+C  ISSS VD L E+LWR D
Sbjct  569  HAKQLNLQIFSISGCSFVSEKSLADLINLGETLVGLNIQHCNAISSSTVDLLVEQLWRCD  628

Query  310  VLS  302
            +LS
Sbjct  629  ILS  631



>gb|KCW80001.1| hypothetical protein EUGRSUZ_C01334 [Eucalyptus grandis]
Length=584

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D AVS + + HG TLE LNLDGC  V+D SLVAIAD+C +L +LD+SK  ITDSG+  L+
Sbjct  462  DEAVSTLVRLHGGTLELLNLDGCRKVSDASLVAIADNCLLLNDLDMSKCSITDSGVSVLS  521

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  L+L VLSL+GC+MVSNK++P L KL  SL+GLN+Q+C  ISS  V+ L E LWR D
Sbjct  522  LAGHLNLQVLSLAGCSMVSNKSVPFLKKLAGSLIGLNLQHCRSISSGMVEQLAESLWRCD  581

Query  310  VLS  302
            +LS
Sbjct  582  ILS  584



>gb|EYU32346.1| hypothetical protein MIMGU_mgv1a002758mg [Erythranthe guttata]
Length=640

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V+ IAK HG+TL+ L LDGC  VTD SL+ IA +C VL ELDVS+  ITDSGI  L 
Sbjct  518  DNTVTVIAKLHGDTLDLLKLDGCRCVTDASLIEIASNCMVLSELDVSRCGITDSGIKVLA  577

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
            EAVQ+SL   S++GC++VS+++LP L++LG ++VGLN+Q C GI+S  VD L ++LWR D
Sbjct  578  EAVQMSLLTFSIAGCSLVSDESLPFLVELGKTMVGLNVQYCGGITSGAVDLLVDQLWRCD  637

Query  310  VLS  302
            +LS
Sbjct  638  ILS  640



>ref|XP_010047961.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
Length=654

 Score =   104 bits (260),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D AVS + + HG TLE LNLDGC  V+D SLVAIAD+C +L +LD+SK  ITDSG+  L+
Sbjct  532  DEAVSTLVRLHGGTLELLNLDGCRKVSDASLVAIADNCLLLNDLDMSKCSITDSGVSVLS  591

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  L+L VLSL+GC+MVSNK++P L KL  SL+GLN+Q+C  ISS  V+ L E LWR D
Sbjct  592  LAGHLNLQVLSLAGCSMVSNKSVPFLKKLAGSLIGLNLQHCRSISSGMVEQLAESLWRCD  651

Query  310  VLS  302
            +LS
Sbjct  652  ILS  654



>ref|XP_010048082.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80181.1| hypothetical protein EUGRSUZ_C01524 [Eucalyptus grandis]
Length=657

 Score =   104 bits (260),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D AVS + + HG TLE LNLDGC  V+D SLVAIAD+C +L +LD+SK  ITDSG+  L+
Sbjct  535  DEAVSTLVRLHGGTLELLNLDGCRKVSDASLVAIADNCLLLNDLDMSKCSITDSGVSVLS  594

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  L+L VLSL+GC+MVSNK++P L KL  SL+GLN+Q+C  ISS  V+ L E LWR D
Sbjct  595  LAGHLNLQVLSLAGCSMVSNKSVPFLKKLAGSLIGLNLQHCRSISSGMVEQLAESLWRCD  654

Query  310  VLS  302
            +LS
Sbjct  655  ILS  657



>ref|XP_003588766.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES59017.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=643

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS++   HG TLE LNL+GC  +++ SL AIA+HC +LC+LD S   I+DSGI AL 
Sbjct  521  DKVVSSLVNLHGWTLEILNLEGCINISNASLAAIAEHCQLLCDLDFSMCTISDSGITALA  580

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A Q++L +LSLSGC +V++++LP L KLG +L+GLNIQ+C  ISSS V+ L E LWR D
Sbjct  581  HAKQINLQILSLSGCTLVTDRSLPALRKLGHTLLGLNIQHCNSISSSAVEMLVEHLWRCD  640

Query  310  VLS  302
            +LS
Sbjct  641  ILS  643



>ref|XP_009791397.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana sylvestris]
Length=637

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 94/123 (76%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V ++A+ HGETLE LNLDGC  VTD SLVAIAD+C +L +LDVS   ITDSG+ AL+
Sbjct  516  DRVVLSLARLHGETLELLNLDGCRKVTDASLVAIADNCPLLNDLDVSTCAITDSGVAALS  575

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
              VQ +L VLSLSGC+MVSNK++P L KLG +L+GLN+Q+C  +S S V+ L E LWR D
Sbjct  576  CGVQANLQVLSLSGCSMVSNKSVPSLKKLGENLLGLNLQHC-SVSCSAVELLVEDLWRCD  634

Query  310  VLS  302
            +LS
Sbjct  635  ILS  637



>ref|XP_010254418.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=673

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 90/122 (74%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D+ V+ +A+ HGETL+ LNLDGC  +TD SL+AIA +C VL +LD+SK  ITD GIVAL+
Sbjct  551  DVVVTTMARLHGETLQLLNLDGCRKITDASLMAIASNCLVLRDLDISKCAITDFGIVALS  610

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
               QL L +LSLSGC  VS+K++P L  +G +LVGLN+Q C  ISSS ++ L E LWR D
Sbjct  611  STKQLDLQILSLSGCLHVSDKSMPFLKNMGQNLVGLNLQRCNSISSSTIEILVEHLWRCD  670

Query  310  VL  305
            +L
Sbjct  671  IL  672



>ref|NP_001281254.1| EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|AHZ89385.1| EIN3-binding-Fbox protein 1 [Cucumis sativus]
 gb|KGN60100.1| Grr1 [Cucumis sativus]
Length=640

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 89/123 (72%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS++ + HG TL+ LNLD C  +TD S+ +IA++C +L +LDVSK  ITDSGI  L 
Sbjct  518  DEVVSSLMEHHGSTLKMLNLDSCKKITDASMTSIANNCPLLSDLDVSKCSITDSGIATLA  577

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L + S+SGC+ VS K+L  L+ LG +LVGLNIQ+C  ISSS VD L E+LWR D
Sbjct  578  HAKQLNLQIFSISGCSFVSEKSLADLINLGETLVGLNIQHCNAISSSTVDLLVEQLWRCD  637

Query  310  VLS  302
            +LS
Sbjct  638  ILS  640



>ref|XP_006450916.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|ESR64156.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|KDO80237.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=632

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 89/123 (72%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V A+A+ H ETLE LNLDGC  +TD SLVAI ++C  L  LDVSK  ITD GI AL+
Sbjct  510  DEVVLALARLHSETLELLNLDGCRKITDASLVAIGNNCMFLSYLDVSKCAITDMGISALS  569

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L VLSLS C+ VSNK++P L KLG +LVGLN+QNC  I+SS V  L E LWR D
Sbjct  570  HAEQLNLQVLSLSSCSEVSNKSMPALKKLGKTLVGLNLQNCNSINSSTVARLVESLWRCD  629

Query  310  VLS  302
            +LS
Sbjct  630  ILS  632



>gb|KDO80236.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=631

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 89/123 (72%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V A+A+ H ETLE LNLDGC  +TD SLVAI ++C  L  LDVSK  ITD GI AL+
Sbjct  509  DEVVLALARLHSETLELLNLDGCRKITDASLVAIGNNCMFLSYLDVSKCAITDMGISALS  568

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L VLSLS C+ VSNK++P L KLG +LVGLN+QNC  I+SS V  L E LWR D
Sbjct  569  HAEQLNLQVLSLSSCSEVSNKSMPALKKLGKTLVGLNLQNCNSINSSTVARLVESLWRCD  628

Query  310  VLS  302
            +LS
Sbjct  629  ILS  631



>ref|XP_006475854.1| PREDICTED: EIN3-binding F-box protein 2-like [Citrus sinensis]
Length=729

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 89/123 (72%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V A+A+ H ETLE LNLDGC  +TD SLVAI ++C  L  LDVSK  ITD GI AL+
Sbjct  607  DEVVLALARLHSETLELLNLDGCRKITDASLVAIGNNCMFLSYLDVSKCAITDMGISALS  666

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L VLSLS C+ VSNK++P L KLG +LVGLN+QNC  I+SS V  L E LWR D
Sbjct  667  HAEQLNLQVLSLSSCSEVSNKSMPALKKLGKTLVGLNLQNCNSINSSTVARLVESLWRCD  726

Query  310  VLS  302
            +LS
Sbjct  727  ILS  729



>ref|XP_010250120.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=671

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V+ +AK HG TL+ LNLDGC  +TD SL+AIA++CSVL +LD+SK  ITD G+ A++
Sbjct  549  DAVVTTMAKHHGGTLQLLNLDGCRKITDASLIAIANNCSVLRDLDISKCVITDLGVAAMS  608

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  L L +LSLSGC  VS+K++P L  LG +LVGLN+Q C  ISSS ++ L E LWR D
Sbjct  609  SANLLDLQILSLSGCYQVSDKSMPFLKSLGQNLVGLNLQQCNSISSSTIELLMEHLWRCD  668

Query  310  VLS  302
            +LS
Sbjct  669  ILS  671



>ref|XP_010048202.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80383.1| hypothetical protein EUGRSUZ_C01744 [Eucalyptus grandis]
Length=643

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSA+AK HG TLE L LDGC  V+D+ L+AIA++C +L +LDVSK  I+D G++AL 
Sbjct  521  DQVVSAMAKLHGRTLEVLILDGCTKVSDLGLLAIAENCQLLSDLDVSKCAISDFGLMALA  580

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + QLSL VLS+SGC++VS+K LP L K+G +L+GLN+Q+C  IS+  VD L E+LWR D
Sbjct  581  RSSQLSLQVLSVSGCSLVSDKCLPALKKVGRTLLGLNLQHCTAISTRSVDLLLEELWRCD  640

Query  310  VLS  302
            +L+
Sbjct  641  ILA  643



>ref|XP_008219497.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Prunus mume]
Length=630

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS++AK HG TLE +NL+GC  ++D  LVAIA +C +L +LDVS+  ITD GI +L 
Sbjct  508  DKMVSSMAKLHGWTLEMVNLEGCKMISDAGLVAIAGNCPLLSDLDVSRCAITDFGIASLA  567

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L +L++SGC +VS+K+LP L+K+G +L+GLN+Q+C  ISSS VD L E+LWR D
Sbjct  568  CADQLNLQILAMSGCPLVSDKSLPALVKMGQTLLGLNLQHCKAISSSTVDRLVEQLWRCD  627

Query  310  VLS  302
            +LS
Sbjct  628  ILS  630



>ref|XP_004498740.1| PREDICTED: EIN3-binding F-box protein 1-like [Cicer arietinum]
Length=641

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS++   HG TLE LNL+GC  +++ SLVAIA+HC +L +LDVS   I+D+GI +L 
Sbjct  519  DKVVSSLVNLHGWTLELLNLEGCKNISNASLVAIAEHCQLLSDLDVSMCAISDAGIASLA  578

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L VLSLSGC +V++++LP L KLG +L+GLNIQ+C  ISSS V+ L E LWR D
Sbjct  579  HAKQLNLQVLSLSGCTLVTDRSLPALRKLGHTLLGLNIQHCNSISSSAVEMLVELLWRCD  638

Query  310  VLS  302
            +LS
Sbjct  639  ILS  641



>gb|KCW81401.1| hypothetical protein EUGRSUZ_C02778 [Eucalyptus grandis]
Length=635

 Score =   101 bits (252),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 88/122 (72%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D A+SA+A+ HG TLE LNL+GC  V + SLVAIA++C +L +LDVS   +TD G+ AL 
Sbjct  513  DKAISAVAEMHGWTLEVLNLEGCRKVGNTSLVAIAENCPLLNDLDVSLCAVTDFGVAALA  572

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L +LSLSGC  +S K LP L KLG  LVGLN+Q+C GIS   VD L E+LWR D
Sbjct  573  RADQLNLQILSLSGCTEISEKCLPALRKLGQLLVGLNLQHCSGISKKSVDLLVEQLWRCD  632

Query  310  VL  305
            +L
Sbjct  633  IL  634



>ref|XP_010048972.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Eucalyptus grandis]
Length=653

 Score =   101 bits (252),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 88/122 (72%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D A+SA+A+ HG TLE LNL+GC  V + SLVAIA++C +L +LDVS   +TD G+ AL 
Sbjct  531  DKAISAVAEMHGWTLEVLNLEGCRKVGNTSLVAIAENCPLLNDLDVSLCAVTDFGVAALA  590

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L +LSLSGC  +S K LP L KLG  LVGLN+Q+C GIS   VD L E+LWR D
Sbjct  591  RADQLNLQILSLSGCTEISEKCLPALRKLGQLLVGLNLQHCSGISKKSVDLLVEQLWRCD  650

Query  310  VL  305
            +L
Sbjct  651  IL  652



>ref|XP_007013466.1| Ein3-binding f-box protein 4 [Theobroma cacao]
 gb|EOY31085.1| Ein3-binding f-box protein 4 [Theobroma cacao]
Length=692

 Score =   101 bits (252),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 89/122 (73%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V A+ + HG TLE LNLDGC  +TD SLVA+AD+C  L +LDVS+  ITDSG+ AL+
Sbjct  570  DEVVLALTRLHGGTLELLNLDGCRRITDASLVAVADNCVFLSDLDVSRCAITDSGVAALS  629

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L VLS SGC+ VSNK++P L KLG +LVGLN+Q+C  ISS  V+ L E LWR D
Sbjct  630  HAEQLNLQVLSFSGCSGVSNKSMPFLKKLGKTLVGLNLQHCNSISSRTVELLVESLWRCD  689

Query  310  VL  305
             L
Sbjct  690  TL  691



>gb|KDP32417.1| hypothetical protein JCGZ_13342 [Jatropha curcas]
Length=651

 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 103/141 (73%), Gaps = 0/141 (0%)
 Frame = -2

Query  724  SCEEglvkvnxngcvnvGDLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLC  545
            SCE GLVKVN +GC+++ D  VS +A+ HG TLE LNLDGC  +TD S+ AIA  C  L 
Sbjct  511  SCEAGLVKVNLSGCMSLTDEVVSVLARLHGGTLELLNLDGCRKITDSSVAAIARGCLFLS  570

Query  544  ELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCP  365
            +LD+SK  +TDSGI  L  A QL+L VLSLSGC+ VSNK+ P L KLG +L+GLN+Q+C 
Sbjct  571  DLDLSKCAVTDSGIAVLASADQLNLQVLSLSGCSEVSNKSFPFLKKLGRTLLGLNLQHCS  630

Query  364  GISSSGVDSLGEKLWRYDVLS  302
             ISSS VD L E LWR D+LS
Sbjct  631  AISSSTVDLLVENLWRCDILS  651



>ref|XP_002524506.1| grr1, plant, putative [Ricinus communis]
 gb|EEF37946.1| grr1, plant, putative [Ricinus communis]
Length=648

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  +SA+A+ HG +LE LNLDGC  +TD SL AI  +C  L +LDVSK  +TDSGI  L+
Sbjct  526  DEVISALARIHGGSLELLNLDGCRKITDASLKAITHNCLFLSDLDVSKCAVTDSGIATLS  585

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A +L+L VLSLSGC+ VSNK+ P L KLG +L+GLN+QNC  ISS+ V+ L E LWR D
Sbjct  586  SADRLNLQVLSLSGCSEVSNKSFPFLKKLGRTLMGLNLQNCSSISSNTVELLVESLWRCD  645

Query  310  VLS  302
            +LS
Sbjct  646  ILS  648



>ref|XP_003542675.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN47145.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSA+A+ HG TLE LNLDGC  +TD SLVAIA++  VL +LDVSK  ITD+G+  L+
Sbjct  517  DNIVSALARLHGGTLEVLNLDGCWKITDASLVAIANNFLVLNDLDVSKCAITDAGVAVLS  576

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A   SL VLSLSGC+ VSNK+ P L KLG +L+GLN+QNC  I SS ++ L EKLWR D
Sbjct  577  RASLPSLQVLSLSGCSDVSNKSAPFLTKLGQTLLGLNLQNCNSIGSSTMELLVEKLWRCD  636

Query  310  VLS  302
            +L+
Sbjct  637  ILA  639



>ref|XP_003522913.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN36400.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=650

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 89/123 (72%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS +A  HG TLE LNLDGC  +TD SLVAIAD+C +L +LDVSK  ITD+GI  L+
Sbjct  528  DNIVSVLATLHGGTLELLNLDGCRKITDASLVAIADNCLLLNDLDVSKCAITDAGIAVLS  587

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L VLSLS C+ V+NK+ P L KLG +LVGLN+QNC  I  + V+ L E LWR D
Sbjct  588  SAKQLTLQVLSLSNCSGVTNKSAPSLKKLGQTLVGLNLQNCNSIGCNTVEFLVENLWRCD  647

Query  310  VLS  302
            +L+
Sbjct  648  ILA  650



>ref|XP_009376923.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS++A  HG TLE LNL+GC  V+D  L AIA +C++L +LDVS+  ITD GI +L 
Sbjct  525  DKVVSSMAGLHGWTLEVLNLEGCRMVSDAGLAAIAGNCTLLSDLDVSRCAITDFGIASLG  584

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L +LS+SGC +VS+K+LP L+K+G +L GLN+Q+C  ISSS VD L E+LWR D
Sbjct  585  HADQLNLQILSVSGCPLVSDKSLPALVKMGQTLHGLNLQHCNAISSSTVDRLVEQLWRCD  644

Query  310  VLS  302
            +LS
Sbjct  645  ILS  647



>ref|XP_007138419.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
 gb|ESW10413.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
Length=650

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 88/123 (72%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS +A+ HG TLE LNLDGC  +TD SLVAIAD+C +L +LDVSK  ITD+GI  L+
Sbjct  528  DNIVSELARLHGGTLELLNLDGCRKITDASLVAIADYCHLLKDLDVSKCGITDAGIAVLS  587

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L VLSLS C+ V+ K+ P L  LG +LVGLN+Q C  I S+ V+ L E LWR D
Sbjct  588  NARQLTLQVLSLSNCSGVTCKSGPSLTNLGQTLVGLNLQYCNSIGSNTVELLVENLWRCD  647

Query  310  VLS  302
            +L+
Sbjct  648  ILA  650



>gb|EPS63568.1| ein3-binding f-box protein 3, partial [Genlisea aurea]
Length=596

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 89/122 (73%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D AV++I + HGE LE LNLDGCG +TD+SL AIA +C  L ELD+S+ RITD+GI  L 
Sbjct  474  DNAVASIVELHGENLEVLNLDGCGNITDLSLDAIARNCWSLNELDISRCRITDTGIAILA  533

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A +L++ VLSL  C +V++K+L  L+ LG +LVGLNIQ+C GISS  +  L + LWR D
Sbjct  534  AAKRLNMKVLSLGSCPLVTDKSLNSLIALGRTLVGLNIQHCRGISSETISVLLDDLWRCD  593

Query  310  VL  305
            VL
Sbjct  594  VL  595



>ref|XP_007204219.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
 gb|EMJ05418.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
Length=612

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V A+A+ HGETLE L+LDGC  +TD SL AIAD+C  L ELDVSK  ITDSG+  L 
Sbjct  490  DEVVVALARLHGETLEVLSLDGCRKITDASLAAIADNCLFLRELDVSKCAITDSGLAFLA  549

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A +++L VLS+SGC+ +S+K+L  L KLG +LVGLN+QNC  IS+  V+ L E LWR D
Sbjct  550  CADRINLQVLSISGCSEISHKSLSSLKKLGKTLVGLNLQNCTAISNRSVELLVESLWRCD  609

Query  310  VLS  302
            +L+
Sbjct  610  ILA  612



>ref|XP_009607234.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana tomentosiformis]
Length=637

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 94/123 (76%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V ++A+ HGETLE LNLDGC  VTD SL+AIAD+C +L +LDVS   ITDSG+  L+
Sbjct  516  DQVVLSLARLHGETLELLNLDGCRKVTDESLMAIADNCPLLNDLDVSTCAITDSGVAGLS  575

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
              VQ++L VLSLSGC+MVSNK++P L KLG +L+GLN+Q+C  +S S V+ L E LWR D
Sbjct  576  CGVQVNLQVLSLSGCSMVSNKSVPYLKKLGENLLGLNLQHC-SVSCSAVELLVEDLWRCD  634

Query  310  VLS  302
            +LS
Sbjct  635  ILS  637



>ref|XP_009376911.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=651

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS++A  HG TLE LNL+GC  V+D  L AIA +C++L +LDVS+  ITD GI +L 
Sbjct  529  DKVVSSMAGLHGWTLEVLNLEGCRMVSDAGLAAIAGNCTLLSDLDVSRCAITDFGIASLG  588

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L +LS+SGC +VS+K+LP L+K+G +L GLN+Q+C  ISSS VD L E+LWR D
Sbjct  589  HADQLNLQILSVSGCPLVSDKSLPALVKMGQTLHGLNLQHCNAISSSTVDRLVEQLWRCD  648

Query  310  VLS  302
            +LS
Sbjct  649  ILS  651



>ref|XP_010687976.1| PREDICTED: EIN3-binding F-box protein 2-like [Beta vulgaris subsp. 
vulgaris]
Length=615

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 92/122 (75%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V+A+A+ HGET++ LNLDGC  +TDVSL  IA  C +L +LDVS S +TDSGI AL+
Sbjct  493  DECVTAVARLHGETIKVLNLDGCRKITDVSLSTIASSCPLLSDLDVSNSAVTDSGIAALS  552

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + QL+L +LS+SGC+ +SNK+LP L++LG SLVGLN+Q C  +SSS VD L   LWR D
Sbjct  553  CSEQLNLQILSISGCSKISNKSLPYLIQLGKSLVGLNLQYCNSLSSSSVDMLMGNLWRCD  612

Query  310  VL  305
            +L
Sbjct  613  IL  614



>gb|EPS63879.1| f-box family protein, partial [Genlisea aurea]
Length=680

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 89/121 (74%), Gaps = 0/121 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  +++IA+ HG+TLE LNLDGC  +TD+SL AIA++CSVL ELD+S SRITD GI  L 
Sbjct  560  DDIIASIAELHGKTLEILNLDGCKSITDLSLAAIAENCSVLSELDISTSRITDIGISTLA  619

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QLS+ + SL GC+ V+ K+LP L+ LG +L+GLNI+ C GIS   +D L + LWR +
Sbjct  620  AAKQLSMQIFSLGGCSSVTGKSLPSLVSLGRTLIGLNIRQCDGISFETIDILLDDLWRCN  679

Query  310  V  308
            +
Sbjct  680  I  680



>ref|XP_008337284.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V ++   HGETLE LNLDGC  +TD SLVAIA++C  L ELDVSK  ITDSG+ AL+
Sbjct  525  DKXVVSLVSLHGETLEVLNLDGCRKITDASLVAIANNCLFLRELDVSKCAITDSGLAALS  584

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A Q++L VLS+SGC+ +S+K+LP L KLG +L+GLN+Q+C  IS+  ++ L + LWR D
Sbjct  585  SAEQINLQVLSISGCSEISHKSLPSLKKLGXTLMGLNLQHCTAISNRSIELLVDSLWRCD  644

Query  310  VLS  302
            +L+
Sbjct  645  ILA  647



>ref|XP_003549759.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN15084.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSA+A+ HG TLE LNLDGC  +TD SLVAIA++  VL +LDVSK  I+D+GI  L+
Sbjct  517  DKVVSALARLHGGTLEVLNLDGCWKITDASLVAIANNFLVLNDLDVSKCAISDAGIALLS  576

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A   SL VLSLSGC+ VSNK+ P L KLG +L+GLN+QNC  I SS ++ L EKLWR D
Sbjct  577  RASLPSLQVLSLSGCSDVSNKSAPFLTKLGQTLLGLNLQNCNSIGSSTMELLVEKLWRCD  636

Query  310  VLS  302
            +L+
Sbjct  637  ILA  639



>ref|XP_007225116.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
 gb|EMJ26315.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
Length=646

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS++AK HG TLE +NL+GC  ++D  LVAI  +C +L +LDVS+  ITD GI +L 
Sbjct  524  DKMVSSMAKLHGWTLEMVNLEGCKMISDAGLVAITGNCPLLSDLDVSRCAITDFGIASLA  583

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L +L++SGC +VS+K+LP L+K+G +L+GLN+Q+C  ISSS VD L E+LWR D
Sbjct  584  CADQLNLQILAMSGCPLVSDKSLPALVKMGQTLLGLNLQHCKAISSSTVDRLVEQLWRCD  643

Query  310  VLS  302
            +LS
Sbjct  644  ILS  646



>ref|XP_010526214.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=641

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 91/122 (75%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSAI+ Q   TLE LNL+GC  +TD SL++IA++C +L +LDVS   +TD G+  L 
Sbjct  519  DRVVSAISVQSDWTLEALNLEGCTKITDASLISIAENCQILSDLDVSNCAVTDFGVQGLA  578

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + +LSL +LSLSGC+MV++K++P L KLG +L+GLN+QNC  IS++ VD L E+LWR D
Sbjct  579  SSNKLSLQILSLSGCSMVTDKSMPALGKLGRTLLGLNVQNCQSISTANVDLLIEQLWRCD  638

Query  310  VL  305
            +L
Sbjct  639  IL  640



>dbj|BAF01819.1| putative glucose regulated repressor protein [Arabidopsis thaliana]
Length=384

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  +SAI  ++G TLE LN+DGC  +TD SLV+IA +C +L +LD+SK  I+DSGI AL 
Sbjct  262  DRVISAITARNGWTLEVLNIDGCSNITDASLVSIAANCQILSDLDISKCAISDSGIQALA  321

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + +L L +LS++GC+MV++K+LP ++ LGS+L+GLN+Q C  IS+S VD L E+L++ D
Sbjct  322  SSDKLKLQILSVAGCSMVTDKSLPAIVGLGSTLLGLNLQQCRSISNSTVDFLVERLYKCD  381

Query  310  VLS  302
            +LS
Sbjct  382  ILS  384



>ref|XP_009355743.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=646

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS++A  HG TLE +NLDGC  V+D  L AIA +C++L +LDVSK  ITD GI +L 
Sbjct  524  DKVVSSLADLHGWTLEVVNLDGCRRVSDAGLAAIAGNCTLLSDLDVSKCAITDFGIASLA  583

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  L+L +LS+SGC +VS+K+LP L+K+G +L+GLN+Q+C  ISSS VD L E+LWR D
Sbjct  584  HADLLNLQILSVSGCPLVSDKSLPALVKMGQTLLGLNLQHCNAISSSTVDRLVEQLWRCD  643

Query  310  VLS  302
            +LS
Sbjct  644  ILS  646



>ref|XP_008394083.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
 ref|XP_008352056.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=646

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS++A  HG TL+ +NL+GC  V+D  L AIA +C++L +LDVSK  ITD GI +L 
Sbjct  524  DKVVSSLADLHGWTLKAVNLEGCRRVSDAGLAAIAGNCTLLSDLDVSKCAITDFGIASLA  583

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L +LS+SGC +VS+K+LP L+K+G +L+GLN+Q+C  ISSS VD L E+LWR D
Sbjct  584  HADQLNLQILSVSGCPLVSDKSLPALVKIGQTLLGLNLQHCNAISSSTVDRLVEQLWRCD  643

Query  310  VLS  302
            +LS
Sbjct  644  ILS  646



>ref|XP_008805624.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 90/122 (74%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D A++A+AK HG TL+ LNL+ C  VTD SL+AIAD CS+L +LD+S+  I+D G+  L 
Sbjct  538  DAAITALAKAHGTTLQMLNLESCKNVTDKSLLAIADCCSLLDDLDMSRCTISDHGVADLA  597

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A+QL L VLSL+GC+ ++ K+LP L  +G SLVGLN+QNC  IS+ G+ +L EKLW  D
Sbjct  598  SAMQLKLRVLSLAGCSTLTQKSLPFLGNMGRSLVGLNLQNCNLISTQGIGALEEKLWWCD  657

Query  310  VL  305
            +L
Sbjct  658  IL  659



>ref|XP_007011864.1| EIN3-binding F box protein 1 [Theobroma cacao]
 gb|EOY29483.1| EIN3-binding F box protein 1 [Theobroma cacao]
Length=696

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 92/122 (75%), Gaps = 1/122 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D AV  +A  HG TLE +NLDGC  ++D S+VAIA++C +L +LDVSK  ITDSGI AL 
Sbjct  575  DKAVCVMADLHGWTLEMINLDGC-KISDGSVVAIAENCLLLSDLDVSKCSITDSGIAALA  633

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + Q++L +LS+SGC MVS+K+LP L KLG +L+GLN+Q C  ISSS VD L E+LWR D
Sbjct  634  RSNQINLQILSVSGCTMVSDKSLPSLGKLGQTLLGLNLQQCKAISSSAVDLLVEQLWRCD  693

Query  310  VL  305
            +L
Sbjct  694  IL  695



>ref|XP_008362900.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V A+ + HGETLE LNLDGC  +TD SL  IA++C  L ELDVSK  ITDSG+ AL+
Sbjct  525  DEVVMALVRLHGETLEVLNLDGCRKITDASLATIANNCLFLRELDVSKCAITDSGLAALS  584

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A Q++L VLS+SGC+ +S+K+LP L KLG +LVGLN+Q+C  +S   ++ L E LWR D
Sbjct  585  SADQINLQVLSISGCSEISHKSLPSLKKLGQTLVGLNLQHCTALSYRSIELLVESLWRCD  644

Query  310  VLS  302
            +L+
Sbjct  645  ILA  647



>gb|AFT92041.1| EIN3 binding F-box 1 [Malus domestica]
Length=646

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS++A  HG T+E LNL+GC  V+D  L AIA +C++L +LDVS+  IT+ GI +L 
Sbjct  524  DKVVSSMADLHGWTMEVLNLEGCRLVSDAGLAAIAGNCTLLSDLDVSRCAITNFGIASLA  583

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L +LS+SGC +VS+K+LP L+K+G +L+GLN+Q+C  ISSS VD L E+LWR D
Sbjct  584  HADQLNLQMLSISGCPLVSDKSLPALVKMGQTLLGLNLQHCNAISSSTVDRLVEQLWRCD  643

Query  310  VLS  302
            +LS
Sbjct  644  ILS  646



>ref|XP_008805623.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 90/122 (74%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D A++A+AK HG TL+ LNL+ C  VTD SL+AIAD CS+L +LD+S+  I+D G+  L 
Sbjct  538  DAAITALAKAHGTTLQMLNLESCKNVTDKSLLAIADCCSLLDDLDMSRCTISDHGVAVLA  597

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A+QL L VLSL+GC+ ++ K+LP L  +G SLVGLN+QNC  IS+ G+ +L EKLW  D
Sbjct  598  YAMQLKLRVLSLAGCSGLTQKSLPFLGNMGRSLVGLNLQNCNLISTQGIGALEEKLWWCD  657

Query  310  VL  305
            +L
Sbjct  658  IL  659



>ref|XP_008466405.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
 ref|XP_008466406.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
Length=640

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  +S+I + HG TL+ LNLD C  +TD S+ +IA++C +L +LDVSK  ITDSGI  L 
Sbjct  518  DEVISSIIEHHGWTLKVLNLDSCKKITDASMTSIANNCPLLSDLDVSKCSITDSGIATLA  577

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A Q +L + S+SGC+ VS+K+L  L+KLG +LVGLNIQ+C  ISSS VD L E+LWR D
Sbjct  578  CAKQPNLQIFSISGCSFVSDKSLADLIKLGETLVGLNIQHCNAISSSTVDLLVEQLWRCD  637

Query  310  VLS  302
            +LS
Sbjct  638  ILS  640



>ref|XP_004291457.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=645

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D AVS +A+ HG TLE +NL+GC  ++D  LVAI ++C +L +LD+S+  ITD GI +L 
Sbjct  523  DKAVSVMAELHGWTLEKVNLEGCRMISDSGLVAIGENCPLLSDLDISRCAITDFGIASLA  582

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L +LS+SGC+ VS+K+LP L+K+G +L+GLN+Q C  ISSS VD L E+LWR D
Sbjct  583  LAGQLNLQILSVSGCSCVSDKSLPALVKMGETLLGLNLQQCNAISSSTVDRLVEQLWRCD  642

Query  310  VLS  302
            +LS
Sbjct  643  ILS  645



>ref|XP_008466407.1| PREDICTED: EIN3-binding F-box protein 1 isoform X2 [Cucumis melo]
Length=690

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  +S+I + HG TL+ LNLD C  +TD S+ +IA++C +L +LDVSK  ITDSGI  L 
Sbjct  568  DEVISSIIEHHGWTLKVLNLDSCKKITDASMTSIANNCPLLSDLDVSKCSITDSGIATLA  627

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A Q +L + S+SGC+ VS+K+L  L+KLG +LVGLNIQ+C  ISSS VD L E+LWR D
Sbjct  628  CAKQPNLQIFSISGCSFVSDKSLADLIKLGETLVGLNIQHCNAISSSTVDLLVEQLWRCD  687

Query  310  VLS  302
            +LS
Sbjct  688  ILS  690



>ref|XP_010541601.1| PREDICTED: EIN3-binding F-box protein 2 [Tarenaya hassleriana]
Length=624

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 89/123 (72%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVAL-  494
            D AVSAI  +HG TLE+LNLDGC  +TD SLV++A +C  + +LDVS SR++D GI AL 
Sbjct  501  DSAVSAIVTRHGLTLESLNLDGCRNITDASLVSVAKNCYSINDLDVSNSRVSDLGIEALA  560

Query  493  TEAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRY  314
            T    L+L + S+ GC+ V++++   + KLG +L+GLNIQ C  ISSS +D+L E+LWR 
Sbjct  561  TSPNHLNLQIFSIGGCSAVTDESQASIQKLGRTLLGLNIQRCSKISSSTIDALLEQLWRC  620

Query  313  DVL  305
            D+L
Sbjct  621  DIL  623



>gb|KJB27084.1| hypothetical protein B456_004G276800 [Gossypium raimondii]
Length=636

 Score = 98.6 bits (244),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 88/122 (72%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V A+ + HG TLE LNLDGC  +TD SL+AIA+ C  L +LDVS+S +TDSG+ AL+
Sbjct  514  DKVVLALTRLHGGTLELLNLDGCRRITDASLMAIAESCVFLSDLDVSRSAVTDSGVAALS  573

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L VLS SGC+ VSNK+L  L KLG +L+GLN+Q+C  IS   V+ L E LW+ D
Sbjct  574  RAEQLNLQVLSFSGCSRVSNKSLSSLKKLGKTLLGLNLQHCNSISIRTVELLVETLWKCD  633

Query  310  VL  305
            +L
Sbjct  634  IL  635



>ref|XP_008365191.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS++A  HG T+E LNL+GC  V+D  L AIA +C++L +LDVS+  IT+ GI +L 
Sbjct  572  DKVVSSMADLHGWTMEVLNLEGCRLVSDAGLAAIAGNCTLLSDLDVSRCAITNFGIASLA  631

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L  LS+SGC +VS+K+LP L+K+G +L+GLN+Q+C  ISSS VD L E+LWR D
Sbjct  632  HADQLNLQXLSISGCPLVSDKSLPALVKMGQTLLGLNLQHCNAISSSTVDRLVEQLWRCD  691

Query  310  VLS  302
            +LS
Sbjct  692  ILS  694



>ref|XP_008378376.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS++A  HG T+E LNL+GC  V+D  L AIA +C++L +LDVS+  IT+ GI +L 
Sbjct  572  DKVVSSMADLHGWTMEVLNLEGCRLVSDAGLAAIAGNCTLLSDLDVSRCAITNFGIASLA  631

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L  LS+SGC +VS+K+LP L+K+G +L+GLN+Q+C  ISSS VD L E+LWR D
Sbjct  632  HADQLNLQXLSISGCPLVSDKSLPALVKMGQTLLGLNLQHCNAISSSTVDRLVEQLWRCD  691

Query  310  VLS  302
            +LS
Sbjct  692  ILS  694



>ref|XP_008365190.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS++A  HG T+E LNL+GC  V+D  L AIA +C++L +LDVS+  IT+ GI +L 
Sbjct  524  DKVVSSMADLHGWTMEVLNLEGCRLVSDAGLAAIAGNCTLLSDLDVSRCAITNFGIASLA  583

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L  LS+SGC +VS+K+LP L+K+G +L+GLN+Q+C  ISSS VD L E+LWR D
Sbjct  584  HADQLNLQXLSISGCPLVSDKSLPALVKMGQTLLGLNLQHCNAISSSTVDRLVEQLWRCD  643

Query  310  VLS  302
            +LS
Sbjct  644  ILS  646



>ref|XP_008378375.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS++A  HG T+E LNL+GC  V+D  L AIA +C++L +LDVS+  IT+ GI +L 
Sbjct  524  DKVVSSMADLHGWTMEVLNLEGCRLVSDAGLAAIAGNCTLLSDLDVSRCAITNFGIASLA  583

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L  LS+SGC +VS+K+LP L+K+G +L+GLN+Q+C  ISSS VD L E+LWR D
Sbjct  584  HADQLNLQXLSISGCPLVSDKSLPALVKMGQTLLGLNLQHCNAISSSTVDRLVEQLWRCD  643

Query  310  VLS  302
            +LS
Sbjct  644  ILS  646



>dbj|BAH20224.1| AT2G25490 [Arabidopsis thaliana]
Length=604

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  +SAI  ++G TLE LN+DGC  +TD SLV+IA +C +L +LD+SK  I+DSGI AL 
Sbjct  482  DRVISAITARNGWTLEVLNIDGCSNITDASLVSIAANCQILSDLDISKCAISDSGIQALA  541

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + +L L +LS++GC+MV++K+LP ++ LGS+L+GLN+Q C  IS+S VD L E+L++ D
Sbjct  542  SSDKLKLQILSVAGCSMVTDKSLPAIVGLGSTLLGLNLQQCRSISNSTVDFLVERLYKCD  601

Query  310  VLS  302
            +LS
Sbjct  602  ILS  604



>gb|KJB82811.1| hypothetical protein B456_013G215000 [Gossypium raimondii]
Length=639

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 89/122 (73%), Gaps = 1/122 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D AV  +A  HG TLE LNL+GC  ++D SLVAIA +C +L +LDVSK  ITDSGI AL 
Sbjct  518  DKAVCIMADLHGWTLEMLNLEGC-KISDASLVAIAKNCQLLSDLDVSKCAITDSGIAALA  576

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + Q+ L +LS+SGC+ VS+K++P L KLG +L+GLN+Q C  ISSS VD   E+LWR D
Sbjct  577  RSNQIKLQILSMSGCSKVSDKSMPSLRKLGQTLLGLNLQQCKAISSSTVDLFVEQLWRCD  636

Query  310  VL  305
            +L
Sbjct  637  IL  638



>ref|NP_565597.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
 sp|Q9SKK0.1|EBF1_ARATH RecName: Full=EIN3-binding F-box protein 1; AltName: Full=F-box/LRR-repeat 
protein 6 [Arabidopsis thaliana]
 gb|AAD20708.1| F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAL60026.1| putative F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAM14272.1| unknown protein [Arabidopsis thaliana]
 emb|CAE75864.1| F-box protein [Arabidopsis thaliana]
 gb|AEC07708.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
Length=628

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  +SAI  ++G TLE LN+DGC  +TD SLV+IA +C +L +LD+SK  I+DSGI AL 
Sbjct  506  DRVISAITARNGWTLEVLNIDGCSNITDASLVSIAANCQILSDLDISKCAISDSGIQALA  565

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + +L L +LS++GC+MV++K+LP ++ LGS+L+GLN+Q C  IS+S VD L E+L++ D
Sbjct  566  SSDKLKLQILSVAGCSMVTDKSLPAIVGLGSTLLGLNLQQCRSISNSTVDFLVERLYKCD  625

Query  310  VLS  302
            +LS
Sbjct  626  ILS  628



>ref|XP_008457494.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=657

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 89/122 (73%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS + + HG T+E LNLDGC  +TD SLVAIAD C +L ELD SK  +TD+G+  L+
Sbjct  535  DETVSTLVRLHGGTIEVLNLDGCRKITDASLVAIADACLLLNELDASKCAVTDAGLAVLS  594

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + Q++L VLSLSGC+ VSNK+LP L +LG SLVGLN++NC  ISS  V ++ E LWR D
Sbjct  595  SSEQINLQVLSLSGCSEVSNKSLPFLERLGKSLVGLNLKNCHSISSGTVGTIVENLWRCD  654

Query  310  VL  305
            +L
Sbjct  655  IL  656



>ref|XP_004139306.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004169733.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN60684.1| Grr1 [Cucumis sativus]
Length=661

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 89/122 (73%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS + + HG T+E LNLDGC  ++D SLVAIAD C +L ELD SK  ITD+G+  L+
Sbjct  539  DETVSTLVRLHGGTIEVLNLDGCRKISDASLVAIADACLLLNELDASKCAITDAGLAVLS  598

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + Q++L VLSLSGC+ VSNK+LP L +LG SLVGLN++NC  ISS  V ++ E LWR D
Sbjct  599  SSEQINLQVLSLSGCSEVSNKSLPFLERLGKSLVGLNLKNCHSISSGTVGTIVENLWRCD  658

Query  310  VL  305
            +L
Sbjct  659  IL  660



>ref|XP_008792024.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=673

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 87/122 (71%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V+A+ K HG TL+ LNL+GC  VTD SL+ IAD CS+L +LD+S+  I D G+  L 
Sbjct  551  DAVVTALVKAHGTTLQMLNLEGCKKVTDKSLLVIADSCSLLDDLDMSRCMIGDYGVAILA  610

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL L VLSL+GC+ ++ K+LPLL  +G SLVGLN+QNC  IS+ G+ +L EKLW  D
Sbjct  611  SASQLKLRVLSLAGCSKLTQKSLPLLGNMGRSLVGLNLQNCKLISTQGIGALEEKLWWCD  670

Query  310  VL  305
            +L
Sbjct  671  IL  672



>ref|XP_009364023.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 89/123 (72%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V A+ + HGETLE LNLDGC  +TD SL  IA +C  L ELDVSK  ITDSG+ AL+
Sbjct  525  DEVVMALVRLHGETLEVLNLDGCRKITDASLATIASNCLFLRELDVSKCAITDSGLAALS  584

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A Q++L VLS+SGC+ +S+K+LP L KLG +LVGLN+Q+C  + +  ++ L E LWR D
Sbjct  585  SADQINLQVLSVSGCSEISHKSLPSLKKLGQTLVGLNLQHCTALGNGSIELLVESLWRCD  644

Query  310  VLS  302
            +L+
Sbjct  645  ILA  647



>ref|XP_010907279.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 83/122 (68%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V+A+ K HG TL+ LNL+GC  VTD SL+ IAD CS L +LD+S+  I D GI  L 
Sbjct  540  DAVVTALVKAHGSTLQMLNLEGCKKVTDKSLLVIADSCSFLDDLDMSRCMIGDYGIAVLA  599

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL L VLSL+GC+ ++ K LP L  +G SLVGLN+QNC  IS+ G+ +L EKLW  D
Sbjct  600  SASQLKLRVLSLAGCSNLTQKILPFLGNMGRSLVGLNLQNCKLISTQGIGALEEKLWWCD  659

Query  310  VL  305
            + 
Sbjct  660  IF  661



>gb|KJB65824.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=651

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 89/122 (73%), Gaps = 1/122 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V  I+  HG TLE LNLDGC  ++D SLVAIA++C +L +LD+SK  ITDSGI AL 
Sbjct  530  DKVVQTISNLHGWTLELLNLDGC-KISDASLVAIAENCQLLTDLDISKCTITDSGIAALA  588

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
                ++L +LS+SGC+MVS+K+LP L KLG +L+GLN+Q C  ISS  V+ L E+LWR D
Sbjct  589  HFNPINLQILSVSGCSMVSDKSLPSLGKLGETLLGLNLQQCKAISSRAVELLTEQLWRCD  648

Query  310  VL  305
            +L
Sbjct  649  IL  650



>gb|KHM99176.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=161

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 86/120 (72%), Gaps = 0/120 (0%)
 Frame = -2

Query  661  VSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAV  482
            VSA+ K HG TLE LNLDGC  +TD S VAIA +  V+ +LDVSK  IT++GI  L+ A 
Sbjct  42   VSALVKIHGGTLELLNLDGCWKITDASSVAIAKNFIVINDLDVSKCAITNAGIAILSRAN  101

Query  481  QLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  302
            Q SL VLSLSGC+ VSNK+ P L KLG +L+GLN+QNC  I S  ++ L EKLWR  +L+
Sbjct  102  QPSLQVLSLSGCSDVSNKSAPFLTKLGQTLLGLNLQNCNSIGSDIMELLVEKLWRCHILA  161



>ref|XP_010417316.1| PREDICTED: EIN3-binding F-box protein 1-like [Camelina sativa]
Length=632

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSAI  ++G TLE LN+DGC  ++D S+V+IA +C +L +LD+SK  I+DSGI AL 
Sbjct  510  DKVVSAITARNGWTLEVLNIDGCSNISDASMVSIAANCQILSDLDLSKCSISDSGIQALA  569

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + +L L +LS++GC+MV++K+L  +++LGS+L+GLN+Q C  IS+S VD L E+L++ D
Sbjct  570  SSDKLKLQILSMAGCSMVTDKSLAAIVRLGSTLLGLNLQQCRSISNSTVDFLVERLYKCD  629

Query  310  VLS  302
            +LS
Sbjct  630  ILS  632



>ref|XP_010429542.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=636

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  +SAI  ++G TLE LN+DGC  ++D S+V+IA +C +L +LD+SK  I+DSGI AL 
Sbjct  514  DKVISAITARNGWTLEVLNIDGCSNISDASMVSIAANCQILSDLDLSKCSISDSGIQALA  573

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + +L L +LS++GC+MV++K+LP +++LGS+L+GLN+Q C  IS+S VD L E+L++ D
Sbjct  574  SSEKLKLQILSMAGCSMVTDKSLPAIVRLGSTLLGLNLQQCRSISNSTVDFLVERLYKCD  633

Query  310  VLS  302
            +LS
Sbjct  634  ILS  636



>ref|XP_010472548.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=631

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  +SAI  ++G TLE LN+DGC  ++D S+V+IA +C +L +LD+SK  I+DSGI AL 
Sbjct  509  DKVISAITARNGWTLEVLNIDGCSNISDASMVSIAANCQILSDLDLSKCSISDSGIQALA  568

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + +L L +LS++GC+MV++K+LP +++LGS+L+GLN+Q C  IS+S VD L E+L++ D
Sbjct  569  SSEKLKLQILSMAGCSMVTDKSLPAIVRLGSTLLGLNLQQCRSISNSTVDFLVERLYKCD  628

Query  310  VLS  302
            +LS
Sbjct  629  ILS  631



>ref|XP_006405190.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
 gb|ESQ46643.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
Length=633

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  +SAI+ ++G TLE L +DGC  +TD SLV+IA++C +L +LD+SK  I+D GI AL 
Sbjct  511  DKVISAISARNGWTLEVLTVDGCNKITDASLVSIAENCQILSDLDLSKCSISDIGIQALA  570

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + +L L +LS+SGC+MV++K+LP L++LGS+L+GLN+Q C  +SSS VD L E+L++ D
Sbjct  571  SSDKLKLQILSMSGCSMVTDKSLPALVRLGSTLLGLNLQQCRSVSSSTVDFLVERLYKCD  630

Query  310  VLS  302
            +LS
Sbjct  631  ILS  633



>gb|EYU23011.1| hypothetical protein MIMGU_mgv1a002803mg [Erythranthe guttata]
Length=636

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 88/120 (73%), Gaps = 0/120 (0%)
 Frame = -2

Query  661  VSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAV  482
            V A+A+ HG TLE LNL+ C  +TD SL A+AD C +L +LD+++  ITD+G+ AL+  V
Sbjct  517  VFALARCHGGTLELLNLENCQKITDESLTALADSCPLLNDLDLARCTITDAGVNALSRGV  576

Query  481  QLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  302
              +L +LSLSGC+MVSN+++  L K+G +L+GLNIQ+C  ISS  ++ L E LWR D+LS
Sbjct  577  HTNLQILSLSGCSMVSNESMHALEKMGKTLLGLNIQHCNSISSGKIEILTENLWRCDILS  636



>gb|KHG24906.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=641

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  724  SCEEglvkvnxngcvnvGDLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLC  545
            SC+EGL KVN +GC+N+ D  V A+ + HG T+E LNLDGC  +TD SLVA+AD+C  L 
Sbjct  501  SCKEGLAKVNLSGCLNLTDEVVLALTRLHGGTVELLNLDGCRRITDASLVAVADNCVFLN  560

Query  544  ELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCP  365
            +LDVS+  I+DSG+ AL+ A QL+L V+S SGC  VSNK++P L +LG +LVGLN+Q+C 
Sbjct  561  DLDVSRCAISDSGVAALSHAEQLNLQVVSFSGCLGVSNKSMPFLKQLGKTLVGLNLQHCN  620

Query  364  GISSSGVDSLGEKLWRYDVL  305
             IS+  V+ L E LWR D+L
Sbjct  621  SISARTVELLVECLWRCDIL  640



>ref|XP_010525963.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=640

 Score = 95.9 bits (237),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 87/122 (71%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS I+ Q G TLE LNL+GC  +TD +LV+IA  C +L +LDVS   ITD G+ AL 
Sbjct  518  DKVVSVISAQSGWTLEALNLEGCTKITDATLVSIAGSCQILSDLDVSNCSITDFGVQALA  577

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + QL+L +LSL+GC +V++K++P L KLG +L+GLN+Q C  ISS+ +D L E LWR D
Sbjct  578  SSNQLTLQILSLAGCPLVTDKSVPALRKLGRTLLGLNVQQCRSISSATIDLLIEHLWRCD  637

Query  310  VL  305
            +L
Sbjct  638  IL  639



>ref|XP_009368857.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V ++   HG+TLE LNLDGC  +TD SLV IA++C  L ELDVSK  ITDSG+ AL+
Sbjct  525  DKVVVSLVSLHGDTLEVLNLDGCRKITDASLVTIANNCLFLRELDVSKCAITDSGLAALS  584

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A Q++L VLS+S C+ +S+K+LP L KLG +L+GLN+Q+C  IS+  ++ L + LWR D
Sbjct  585  SAEQINLQVLSISSCSEISHKSLPSLKKLGQTLMGLNLQHCTAISNRSIELLVDSLWRCD  644

Query  310  VLS  302
            +L+
Sbjct  645  ILA  647



>gb|KJB65823.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=672

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 87/119 (73%), Gaps = 1/119 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V  I+  HG TLE LNLDGC  ++D SLVAIA++C +L +LD+SK  ITDSGI AL 
Sbjct  530  DKVVQTISNLHGWTLELLNLDGC-KISDASLVAIAENCQLLTDLDISKCTITDSGIAALA  588

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRY  314
                ++L +LS+SGC+MVS+K+LP L KLG +L+GLN+Q C  ISS  V+ L E+LWR+
Sbjct  589  HFNPINLQILSVSGCSMVSDKSLPSLGKLGETLLGLNLQQCKAISSRAVELLTEQLWRF  647



>ref|XP_009140675.1| PREDICTED: EIN3-binding F-box protein 1 [Brassica rapa]
Length=622

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSAI+ ++G TLE LN+DGC  ++D SLV+IA +C +L +LD+SK  ++D GI AL 
Sbjct  500  DRVVSAISARNGLTLEVLNMDGCSKISDASLVSIAANCQILSDLDLSKCSVSDFGIQALA  559

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + +L L +LS++GCAMV++K+LP ++KLGS+L+GLN+Q C  +S S VD L E+L++ D
Sbjct  560  SSDKLKLQILSMAGCAMVTDKSLPSIVKLGSTLLGLNLQQCRSVSCSTVDFLVERLYKCD  619

Query  310  VLS  302
            +LS
Sbjct  620  ILS  622



>ref|XP_004287307.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=640

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 91/123 (74%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            ++AV+A A+ H ETLE LNLDGC  +TD SL AIA +C  L ELDVSKS ITDSG+  L+
Sbjct  519  EVAVAA-ARLHRETLEVLNLDGCRKITDASLEAIAANCLFLRELDVSKSGITDSGLAVLS  577

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
               Q++L VLS+SGC+ VSNK+L  L ++G SL+GLN+Q+C  IS+  V+ L E LWR D
Sbjct  578  CTEQVALQVLSISGCSEVSNKSLSSLKRMGQSLLGLNLQHCTAISNRSVELLIESLWRCD  637

Query  310  VLS  302
            +L+
Sbjct  638  ILA  640



>gb|KJB07737.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
 gb|KJB07738.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
Length=641

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 102/140 (73%), Gaps = 0/140 (0%)
 Frame = -2

Query  724  SCEEglvkvnxngcvnvGDLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLC  545
            SC EGL KVN +GC+N+ D  V A+ + HG TLE LNLDG   +TD SLVA+AD+C  L 
Sbjct  501  SCREGLAKVNLSGCLNLTDEIVLALTRLHGGTLELLNLDGRPRITDASLVAVADNCVFLS  560

Query  544  ELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCP  365
            +LDVS+  I+DSG+ AL+ A QL+L V+S SGC  VSNK++P L +LG +LVGLN+Q+C 
Sbjct  561  DLDVSRCAISDSGVAALSHAEQLNLQVVSFSGCLGVSNKSMPFLKQLGKTLVGLNLQHCN  620

Query  364  GISSSGVDSLGEKLWRYDVL  305
             IS+  V+ L E LWR D+L
Sbjct  621  SISARTVELLVESLWRCDIL  640



>ref|XP_002880682.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56941.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=629

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  +SAI  ++G TLE LN+DGC  +TD SLV+IA +C +L +LD+SK  I+DSG+ AL 
Sbjct  507  DRVISAITARNGWTLEVLNIDGCSNITDASLVSIAANCQILSDLDLSKCAISDSGVHALA  566

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + +L L +LS++GC+MV++K++P ++ LGS+L+GLN+Q C  IS+S V+ L E+L++ D
Sbjct  567  SSDKLKLQILSVAGCSMVTDKSMPAIVGLGSTLLGLNLQQCRSISNSTVEFLVERLYKCD  626

Query  310  VLS  302
            +LS
Sbjct  627  ILS  629



>ref|XP_006293838.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
 gb|EOA26736.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
Length=628

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  +SAI  ++G TLE LN+DGC  ++D SLV+IA +C +L +LD+SK  I+D GI AL 
Sbjct  506  DRVISAITARNGWTLEVLNVDGCSKISDASLVSIAANCQILSDLDLSKCSISDCGIQALA  565

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             +  L L +LSL+GC+MV++++LP ++ LGS+L+GLN+Q C  IS+S VD L E+L++ D
Sbjct  566  SSDNLKLQILSLAGCSMVTDESLPAIVSLGSTLLGLNLQQCRSISNSTVDFLVERLYKCD  625

Query  310  VLS  302
            +LS
Sbjct  626  ILS  628



>ref|XP_007137020.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
 gb|ESW09014.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
Length=643

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 82/122 (67%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V  I   HG TL+ L LDGC  VTD S++AIA +C +L +LDVSK  ITD+GI AL 
Sbjct  521  DRVVLPIVNSHGWTLQVLCLDGCKRVTDASMMAIAGNCPMLSDLDVSKCAITDTGIAALA  580

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
               Q+SL +LSL+GC  VS+K++P L KLG SL GLNI+ C  ISS GV  L E LW  D
Sbjct  581  RGNQISLEILSLAGCISVSDKSMPALKKLGQSLAGLNIKRCSAISSRGVSKLQEHLWTCD  640

Query  310  VL  305
            +L
Sbjct  641  IL  642



>gb|KJB54023.1| hypothetical protein B456_009G017100 [Gossypium raimondii]
Length=645

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 86/122 (70%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V  + K HG TLE LNL+GC  +TD SL A+A++C  L +LDVS+  ITD GI AL+
Sbjct  523  DEVVLHLTKLHGATLELLNLNGCRRITDASLAAVAENCVFLSDLDVSRCAITDVGIAALS  582

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L VLS SGC+ VSNK++  L KLG +LVGLN+Q+C  IS+  ++ L E LWR D
Sbjct  583  HAEQLNLQVLSFSGCSGVSNKSMTFLKKLGKTLVGLNLQHCNSISTQTIELLVESLWRCD  642

Query  310  VL  305
            +L
Sbjct  643  IL  644



>gb|KHG15742.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=651

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 88/122 (72%), Gaps = 1/122 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V  I+  HG TLE LNL+GC  ++D SLVAI ++C +L +LD+SK  ITDSGI AL 
Sbjct  530  DKVVQTISNLHGWTLELLNLNGC-KISDASLVAIGENCQLLTDLDISKCTITDSGIAALA  588

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
                ++L +LS+SGC+MVS+K+LP L KLG +L+GLN+Q C  ISS  V+ L E+LWR D
Sbjct  589  HFNPINLQILSVSGCSMVSDKSLPSLGKLGETLLGLNLQQCKAISSRAVELLTEQLWRCD  648

Query  310  VL  305
            +L
Sbjct  649  IL  650



>emb|CDY35358.1| BnaA04g14890D [Brassica napus]
Length=623

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSAI+ ++G TLE LN+DGC  ++D SLV+IA +C +L +LD+SK  ++D GI AL 
Sbjct  501  DRVVSAISARNGLTLEVLNMDGCSKISDASLVSIAANCQILSDLDLSKCSVSDFGIQALA  560

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + +L L +LS++GCAMV++K+LP ++KLGS+L+GLN+Q C  +S S VD + E+L++ D
Sbjct  561  SSEKLKLQILSMAGCAMVTDKSLPSIVKLGSTLLGLNLQQCRSVSCSTVDFVVERLYKCD  620

Query  310  VLS  302
            +LS
Sbjct  621  ILS  623



>gb|KJB55011.1| hypothetical protein B456_009G058000 [Gossypium raimondii]
Length=652

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 88/122 (72%), Gaps = 1/122 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V  +A  HG TLE LNLDGC  V+D  LVAIA++C VL +LDVSK  ITDSGI AL 
Sbjct  531  DKVVCKMADLHGWTLEMLNLDGC-KVSDAGLVAIAENCRVLSDLDVSKCTITDSGIAALA  589

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             +  ++L +LS+SGC +VS+K+LP L KLG +L+GLN+Q C  ISS  VD L E+LWR D
Sbjct  590  CSNLINLQILSVSGCNLVSDKSLPSLGKLGQTLLGLNLQQCKAISSGAVDLLVEQLWRCD  649

Query  310  VL  305
            +L
Sbjct  650  IL  651



>ref|XP_007155011.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
 gb|ESW27005.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
Length=639

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 91/122 (75%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSA+A+ HG TLE LNLDGC  +TD SLV IA++C VL +LDVSK  ITD+GI  L+
Sbjct  517  DNIVSALARLHGGTLEVLNLDGCMKITDASLVTIANNCLVLNDLDVSKCAITDAGIAVLS  576

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  LSL VLSLSGC+ VSNK +P L  LG +L+GLNIQNC  ISSS ++ L EKLWR D
Sbjct  577  RASLLSLQVLSLSGCSDVSNKCVPFLTILGQTLIGLNIQNCNSISSSTMELLVEKLWRCD  636

Query  310  VL  305
            +L
Sbjct  637  IL  638



>gb|KEH32121.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=688

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 87/122 (71%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS +A+ HG TLE LNLDGC  +TD SLVA+ D+C +L +LDVSK  ITD+GI  LT
Sbjct  481  DNIVSELARLHGGTLEILNLDGCQNITDASLVAVEDNCLLLNDLDVSKCAITDAGIAVLT  540

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  +S+ VLS+S C+ +SN  +P L+KLG +L+GLNI+ C  I S+ ++ L E LWR D
Sbjct  541  RADHVSMRVLSMSDCSGISNNCVPFLMKLGQALLGLNIKYCNAIGSNEIEFLVENLWRCD  600

Query  310  VL  305
            +L
Sbjct  601  IL  602



>gb|KEH32122.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=684

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 87/122 (71%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS +A+ HG TLE LNLDGC  +TD SLVA+ D+C +L +LDVSK  ITD+GI  LT
Sbjct  477  DNIVSELARLHGGTLEILNLDGCQNITDASLVAVEDNCLLLNDLDVSKCAITDAGIAVLT  536

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  +S+ VLS+S C+ +SN  +P L+KLG +L+GLNI+ C  I S+ ++ L E LWR D
Sbjct  537  RADHVSMRVLSMSDCSGISNNCVPFLMKLGQALLGLNIKYCNAIGSNEIEFLVENLWRCD  596

Query  310  VL  305
            +L
Sbjct  597  IL  598



>ref|XP_006842065.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
 gb|ERN03740.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
Length=649

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 86/122 (70%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D +V A+AK HGE+LE L+ +GCG VTD  L+A++  C  L +LD+S+  ITD+G+  L+
Sbjct  527  DRSVMALAKLHGESLELLSFEGCGKVTDSGLMAVSSFCVCLKDLDISRCTITDNGLAYLS  586

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  L L +LSLS C  +++K+LPLL     SLVGLN+QNC  +S+  V+ LGE+LWR D
Sbjct  587  RAKGLRLQILSLSACLGITDKSLPLLGNFAGSLVGLNLQNCKMVSNGAVELLGEQLWRCD  646

Query  310  VL  305
            +L
Sbjct  647  IL  648



>gb|KHG28503.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=652

 Score = 93.2 bits (230),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 87/119 (73%), Gaps = 1/119 (1%)
 Frame = -2

Query  661  VSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAV  482
            V  +A  HG TLE LNLDGC  ++D  LVAIA++C +L +LDVSK  ITDSGI AL  + 
Sbjct  534  VCKMADLHGWTLEMLNLDGC-KISDAGLVAIAENCQLLSDLDVSKCTITDSGIAALARSN  592

Query  481  QLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  305
             ++L +LS+SGC +VS+K+LP L KLG +L+GLN+Q C  ISS  VD L E+LWR D+L
Sbjct  593  LINLQILSVSGCNLVSDKSLPSLGKLGQTLLGLNLQQCKAISSGAVDLLVEQLWRCDIL  651



>ref|XP_003609344.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES91541.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=739

 Score = 93.2 bits (230),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 87/122 (71%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS +A+ HG TLE LNLDGC  +TD SLVA+ D+C +L +LDVSK  ITD+GI  LT
Sbjct  532  DNIVSELARLHGGTLEILNLDGCQNITDASLVAVEDNCLLLNDLDVSKCAITDAGIAVLT  591

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  +S+ VLS+S C+ +SN  +P L+KLG +L+GLNI+ C  I S+ ++ L E LWR D
Sbjct  592  RADHVSMRVLSMSDCSGISNNCVPFLMKLGQALLGLNIKYCNAIGSNEIEFLVENLWRCD  651

Query  310  VL  305
            +L
Sbjct  652  IL  653



>gb|AES73649.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=641

 Score = 92.8 bits (229),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 85/122 (70%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D+ V ++ K H  TL  LNL+GC  V D SL AIAD+C VL +LDVS+  ITD+GI ALT
Sbjct  519  DVGVLSMVKLHCSTLGVLNLNGCKKVGDASLTAIADNCIVLSDLDVSECAITDAGISALT  578

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
              V  +L VLSL+GC++VSNK+L  L KLG SL GLNI+NC  ISS  V+ L E LW  D
Sbjct  579  RGVLFNLDVLSLAGCSLVSNKSLSALKKLGDSLEGLNIKNCKSISSRTVNKLVEHLWMCD  638

Query  310  VL  305
            +L
Sbjct  639  IL  640



>gb|KFK32577.1| hypothetical protein AALP_AA6G261300 [Arabis alpina]
Length=630

 Score = 92.8 bits (229),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  +SAI+ ++G TLE LN+DGC  ++D SLVAIA +C +L +LD+SK  I+D GI AL 
Sbjct  508  DRVISAISARNGWTLEVLNVDGCTQISDASLVAIAANCQILSDLDISKCAISDCGIQALA  567

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             +  L L +LS++GC++V++K+LP +++LGS+L+GLN+Q C  IS S VD L E+L++ D
Sbjct  568  SSDNLKLQILSMAGCSLVTDKSLPAIVRLGSTLLGLNLQQCRSISFSTVDFLVEQLYKCD  627

Query  310  VLS  302
            +LS
Sbjct  628  ILS  630



>ref|XP_010907280.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score = 92.8 bits (229),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 82/122 (67%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V+A+ K HG TL+ LNL+GC  VTD SL+ IAD CS L +LD+S+  I D GI  L 
Sbjct  540  DAVVTALVKAHGSTLQMLNLEGCKKVTDKSLLLIADSCSFLDDLDMSRCMIGDYGIAVLA  599

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL + VLSL+GC+ ++ K +P L  +G SLVGLN+QNC  IS+  + +L EKLW  D
Sbjct  600  SASQLKMRVLSLAGCSNLTQKIVPFLGNMGRSLVGLNLQNCKLISTQEIGALEEKLWWCD  659

Query  310  VL  305
            + 
Sbjct  660  IF  661



>ref|XP_002874252.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50511.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=590

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 87/123 (71%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSAI+  HG TLE+LNLDGC  +TD SLVA+A +C  + +LD+S + ++D GI AL 
Sbjct  467  DNTVSAISVCHGRTLESLNLDGCKNITDTSLVAVAKNCYSVNDLDISNTLVSDHGIKALA  526

Query  490  EAVQ-LSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRY  314
             +   L+L VLS+ GC+ +++K+   + KLG +L+GLNIQ C  ISSS VD+L E LWR 
Sbjct  527  SSPNHLNLQVLSVGGCSAITDKSKACIQKLGRTLLGLNIQRCGRISSSTVDTLIENLWRC  586

Query  313  DVL  305
            D+L
Sbjct  587  DIL  589



>emb|CDX80503.1| BnaC07g29410D [Brassica napus]
Length=621

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 88/123 (72%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D AVSAI+  HG TLE+LN+DGC  +TD SLVA+A +C  + +LDVS + ++D G+ AL 
Sbjct  498  DNAVSAISVCHGRTLESLNVDGCKNITDASLVAVAKNCYSVNDLDVSNTLVSDQGVKALA  557

Query  490  EAVQ-LSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRY  314
             +   L+L VLS+ GC+ +++K+   + KLG +L+GLNIQ C  ISSS VD+L E LWR 
Sbjct  558  SSPNHLNLQVLSVGGCSAITDKSKACIQKLGRTLLGLNIQRCGRISSSTVDNLLEHLWRC  617

Query  313  DVL  305
            D+L
Sbjct  618  DIL  620



>emb|CDX87090.1| BnaC09g04050D [Brassica napus]
Length=616

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 87/123 (71%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSA++  HG TLE+L+LDGC  +TD SLV +A +C  + +LDVS + ++D GI AL 
Sbjct  493  DNTVSAVSFSHGSTLESLSLDGCKNITDASLVTVAKNCYSVNDLDVSNTLVSDHGIKALA  552

Query  490  EAV-QLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRY  314
             +   LSL VLSL GC+ +++K+   + KLG +L+GLNIQ C  ISSS VDSL E+LWR 
Sbjct  553  SSPNHLSLQVLSLGGCSGITDKSKACIQKLGRTLLGLNIQRCGRISSSTVDSLLEQLWRC  612

Query  313  DVL  305
            D+L
Sbjct  613  DIL  615



>ref|XP_006287278.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
 gb|EOA20176.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
Length=621

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 88/123 (72%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSA++  HG TLE+LNLDGC  +TD SLVA+A +C  + +LD+S + ++D GI AL 
Sbjct  498  DNTVSAVSVCHGHTLESLNLDGCKNITDTSLVAVAKNCYSVNDLDISNTLVSDQGIKALA  557

Query  490  EAVQ-LSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRY  314
             +   L+L VLS+ GC+ +++K+   + KLG +L+GLNIQ C  ISSS VD+L E+LWR 
Sbjct  558  SSPNHLNLQVLSVGGCSAITDKSKACIQKLGRTLLGLNIQRCGRISSSTVDTLLEQLWRC  617

Query  313  DVL  305
            D+L
Sbjct  618  DIL  620



>ref|XP_009111664.1| PREDICTED: EIN3-binding F-box protein 2-like [Brassica rapa]
Length=616

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 88/123 (72%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D AVSA++  HG TLE+L+LDGC  +TD SLV ++ +C  + +LDVS + ++D GI AL 
Sbjct  493  DNAVSAVSFSHGSTLESLSLDGCKNITDASLVTVSKNCYSVNDLDVSNTLVSDHGIKALA  552

Query  490  EAVQ-LSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRY  314
             +   L+L VLSL GC+ +++K+   + KLG +L+GLNIQ C  ISSS VDSL E+LWR 
Sbjct  553  SSPNHLNLQVLSLGGCSGITDKSKACIQKLGRTLLGLNIQRCGRISSSTVDSLLEQLWRC  612

Query  313  DVL  305
            D+L
Sbjct  613  DIL  615



>ref|XP_006648432.1| PREDICTED: EIN3-binding F-box protein 1-like [Oryza brachyantha]
Length=490

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 87/123 (71%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D AVSA+ K HG++L+ ++L+GCG +TD SL+AI+++CS L ELD+SK  ++D+G+  L 
Sbjct  368  DAAVSALVKGHGKSLKQVSLEGCGKITDASLLAISENCSELAELDLSKCMVSDNGVAMLA  427

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  L L VLSLSGC+ V+ K +P L  +G SL GLN+Q C  I +  + SL ++LW  D
Sbjct  428  SAKHLKLRVLSLSGCSKVTQKIVPFLGNMGQSLEGLNLQFCNMIGNHNIASLEKQLWWCD  487

Query  310  VLS  302
            +L+
Sbjct  488  ILA  490



>gb|KHG14715.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=645

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 84/122 (69%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V  + K HG TLE LNL+GC  +TD SL A A++C  L +LDVS   ITD GI AL+
Sbjct  523  DEVVLHLTKLHGATLELLNLNGCRRITDASLAAAAENCVFLSDLDVSSCAITDVGIAALS  582

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L VLS SGC+ VSNK++  L KLG +LVGLN+Q+C  IS+  ++ L E LWR D
Sbjct  583  HAEQLNLQVLSFSGCSGVSNKSMTFLKKLGKTLVGLNLQHCNSISTQTIELLVESLWRCD  642

Query  310  VL  305
            +L
Sbjct  643  IL  644



>ref|XP_009397481.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=652

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 85/120 (71%), Gaps = 0/120 (0%)
 Frame = -2

Query  661  VSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAV  482
            V+ + K HG TL+ LNL+GC  +TD SL+A+AD CS+L +LD+S   ++D G+  L  A 
Sbjct  533  VTLLVKAHGSTLKMLNLNGCKKITDRSLLAVADSCSMLDDLDLSCCSVSDYGVAVLASAR  592

Query  481  QLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  302
            QL+LHVLSLS C+ V+ K +P L  LG S+VGLN+QNC  IS+ G+  L EKLW  D++S
Sbjct  593  QLNLHVLSLSSCSKVTQKIVPFLGNLGKSMVGLNLQNCSLISTHGIVLLEEKLWWCDIIS  652



>ref|XP_010533156.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=632

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 88/124 (71%), Gaps = 1/124 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V  +AK HGETLE LNL+GC  +TD SL AIA+ C  L +LD+SK  ITDSG+ AL+
Sbjct  509  DEVVYYLAKFHGETLEVLNLEGCRRITDSSLSAIAESCLFLKDLDMSKCGITDSGVAALS  568

Query  490  EA-VQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRY  314
             A  +L+L VLS+SGC+ VSNK+L  L KLG +L+GLNI+ C  I++  +  L E LWR 
Sbjct  569  RAEKRLNLQVLSVSGCSEVSNKSLVPLKKLGRTLLGLNIRGCNSITNRIIQLLKESLWRC  628

Query  313  DVLS  302
            D+LS
Sbjct  629  DILS  632



>ref|XP_010454859.1| PREDICTED: EIN3-binding F-box protein 2 [Camelina sativa]
Length=622

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 87/123 (71%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSA++  HG TLE+LNLDGC  +TD SLVA+A +C  + +LD+S + ++D GI AL 
Sbjct  499  DNTVSAVSVCHGHTLESLNLDGCKNITDASLVAVAKNCYSVNDLDISNTLVSDHGIKALA  558

Query  490  EAV-QLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRY  314
             +   L+L VLS+ GC+ +++K+   + KLG +L+GLNIQ C  ISSS VD+  E+LWR 
Sbjct  559  SSPNHLNLQVLSVGGCSAITDKSKACIQKLGRTLLGLNIQRCGRISSSTVDTFLEQLWRC  618

Query  313  DVL  305
            D+L
Sbjct  619  DIL  621



>dbj|BAJ34438.1| unnamed protein product [Thellungiella halophila]
Length=430

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 86/123 (70%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSAI+  HG  +E+LNLDGC  +TD SLVA+A +C  + +LD+S + ++D GI AL 
Sbjct  307  DNTVSAISMCHGRFMESLNLDGCKNITDASLVAVAKNCYSVSDLDISNTLVSDHGIKALA  366

Query  490  EAV-QLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRY  314
             +   L+L VLS+ GC+ +++K+   + KLG +L+GLNIQ C  ISSS VD+L E LWR 
Sbjct  367  SSPNHLNLQVLSVGGCSAITDKSKACIQKLGRTLLGLNIQRCGRISSSTVDNLLEHLWRC  426

Query  313  DVL  305
            D+L
Sbjct  427  DIL  429



>ref|XP_010322126.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=613

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 85/123 (69%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D++VS I  + G++L+ L +DGC  VTD +LV I + C  L  LDVSK  ITDSGI  L+
Sbjct  491  DISVSYIVNKCGKSLKYLLVDGCKNVTDATLVEIWNSCWTLNVLDVSKCGITDSGITTLS  550

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A+QL L +LSLSGC +VS+ +LP LL L  +L GLNIQ+CP ISS  VD+L E   R D
Sbjct  551  SAIQLQLQILSLSGCPLVSDNSLPFLLDLTQNLQGLNIQHCPNISSKTVDALVEINPRCD  610

Query  310  VLS  302
            +LS
Sbjct  611  ILS  613



>ref|XP_010493788.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=622

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 87/123 (71%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSA++  HG TLE+LNLDGC  +TD SLVA+A +C  + +LD+S + ++D GI AL 
Sbjct  499  DSTVSAVSVCHGHTLESLNLDGCKNITDASLVAVAKNCYSVNDLDISNTLVSDHGIKALA  558

Query  490  EAV-QLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRY  314
             +   L+L VLS+ GC+ +++K+   + KLG +L+GLNIQ C  ISSS VD+  E+LWR 
Sbjct  559  SSPNHLNLQVLSVGGCSAITDKSKACIQKLGRTLLGLNIQRCGRISSSTVDTFLEQLWRC  618

Query  313  DVL  305
            D+L
Sbjct  619  DIL  621



>ref|NP_197917.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 sp|Q708Y0.1|EBF2_ARATH RecName: Full=EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 gb|AAR27072.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 emb|CAE75865.1| F-box protein [Arabidopsis thaliana]
 dbj|BAE99835.1| leucine-rich repeats containing protein [Arabidopsis thaliana]
 gb|AED93429.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
Length=623

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 87/123 (71%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSAI+  HG TLE+LNLDGC  +T+ SLVA+A +C  + +LD+S + ++D GI AL 
Sbjct  500  DNTVSAISVCHGRTLESLNLDGCKNITNASLVAVAKNCYSVNDLDISNTLVSDHGIKALA  559

Query  490  EAVQ-LSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRY  314
             +   L+L VLS+ GC+ +++K+   + KLG +L+GLNIQ C  ISSS VD+L E LWR 
Sbjct  560  SSPNHLNLQVLSIGGCSSITDKSKACIQKLGRTLLGLNIQRCGRISSSTVDTLLENLWRC  619

Query  313  DVL  305
            D+L
Sbjct  620  DIL  622



>ref|XP_010421385.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=618

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 87/123 (71%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSA++  HG TLE+LNLDGC  +TD SLVA+A +C  + +LD+S + ++D GI AL 
Sbjct  495  DNTVSAVSVCHGHTLESLNLDGCKNITDASLVAVAKNCYSVNDLDISNTLVSDHGIKALA  554

Query  490  EAV-QLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRY  314
             +   L+L VLS+ GC+ +++K+   + KLG +L+GLNIQ C  ISSS VD+  E+LWR 
Sbjct  555  SSPNHLNLQVLSVGGCSAITDKSKACIQKLGRTLLGLNIQRCGRISSSTVDTFLEQLWRC  614

Query  313  DVL  305
            D+L
Sbjct  615  DIL  617



>gb|KHN07078.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=635

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 84/122 (69%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V ++   HG TLE L+LDGC  V D SL+AIA  C +L +LDVS+  ITD+GI AL 
Sbjct  513  DRVVLSMVNSHGWTLEVLSLDGCKRVGDASLMAIAGSCPLLADLDVSRCAITDTGIAALA  572

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
               Q++L VLSL+GCA+VS+K++P L K+G SL GLNI+ C GISS  V+ L E L   D
Sbjct  573  RGKQINLEVLSLAGCALVSDKSVPALKKMGCSLAGLNIKRCKGISSRSVNKLQEHLCMCD  632

Query  310  VL  305
            +L
Sbjct  633  IL  634



>gb|AEK81539.1| EIN3 binding F-box 1 [Dianthus caryophyllus]
Length=625

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 89/122 (73%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D +V AI + HGE+++ L+LDGC  +TD SL AIA +C +L +LDVS   +TDSGI AL+
Sbjct  503  DASVLAIVRLHGESVKELSLDGCRKITDTSLFAIAGNCPLLNDLDVSNCSVTDSGIAALS  562

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + +L+L +LS+SGC  +SNK+LP L++LG  L+GLN+++C  +S S VD L   LWR D
Sbjct  563  SSQKLNLQILSISGCTNISNKSLPYLIQLGKRLIGLNLKHCSSLSLSTVDMLVGNLWRCD  622

Query  310  VL  305
            +L
Sbjct  623  IL  624



>emb|CDP10419.1| unnamed protein product [Coffea canephora]
Length=628

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 72/123 (59%), Gaps = 23/123 (19%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  + A+A+ HG TLE LNL+GC  VTD SLVAIAD C  L +LDVSK  ITDSG+ AL+
Sbjct  529  DKVIIALAELHGATLELLNLEGCKKVTDASLVAIADSCLFLNDLDVSKCSITDSGVAALS  588

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
              V L+L  L                       VGLN+Q+C  ISSS ++ L E LWR D
Sbjct  589  NGVHLNLQTL-----------------------VGLNLQHCNSISSSSIERLVENLWRCD  625

Query  310  VLS  302
            +LS
Sbjct  626  ILS  628



>ref|XP_010086585.1| hypothetical protein L484_002248 [Morus notabilis]
 gb|EXB21298.1| hypothetical protein L484_002248 [Morus notabilis]
Length=642

 Score = 89.7 bits (221),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V A+AK HGETLE LNLDGC  +TD SL AIA++C +L +LD+SK  ITDS I AL 
Sbjct  520  DEVVVALAKLHGETLEMLNLDGCRKITDASLAAIAENCLLLSDLDLSKCAITDSSISALA  579

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + +++L VLSLSGC+ V+NK+   L KLG +LVGLN+Q+C  ISSS  + L E LWR D
Sbjct  580  SSKKINLQVLSLSGCSDVTNKSASCLKKLGETLVGLNLQHCNSISSSTAELLVESLWRCD  639

Query  310  VLS  302
            +L+
Sbjct  640  ILA  642



>gb|ACB59221.1| F-box protein [Brassica oleracea]
Length=629

 Score = 89.7 bits (221),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 89/123 (72%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  +SAI  ++G TLE LN DGC  +TD SLV+IA +C +L +LD+S+  I+DSGI AL 
Sbjct  507  DRVISAITARNGWTLEVLNRDGCSNITDASLVSIAANCQILSDLDISECAISDSGIQALA  566

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             + +L L +LS++GC+MV++K LP ++ LGS+L+GLN+Q C  IS+S VD L   L++ D
Sbjct  567  SSDKLKLQILSVAGCSMVTDKRLPAIVGLGSTLLGLNLQQCRSISNSPVDFLVGSLYKCD  626

Query  310  VLS  302
             LS
Sbjct  627  ALS  629



>ref|XP_009151059.1| PREDICTED: EIN3-binding F-box protein 2 [Brassica rapa]
Length=622

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 87/123 (71%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSA++  HG TLE+LN+DGC  +TD SLVA+A +C  + +LDVS + ++D G+ AL 
Sbjct  499  DNTVSAVSVCHGRTLESLNVDGCKNITDASLVAVAKNCYSVNDLDVSNTLVSDQGVKALA  558

Query  490  EAVQ-LSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRY  314
             +   L+L VLS+ GC+ V++K+   + KLG +L+GLNIQ C  ISSS VD+L E LWR 
Sbjct  559  SSPNHLNLQVLSIGGCSGVTDKSKACIQKLGRALLGLNIQRCGRISSSTVDNLLEHLWRC  618

Query  313  DVL  305
            D+L
Sbjct  619  DIL  621



>emb|CDX88173.1| BnaA06g27640D [Brassica napus]
Length=622

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 87/123 (71%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSA++  HG TLE+LN+DGC  +TD SLVA+A +C  + +LDVS + ++D G+ AL 
Sbjct  499  DNTVSAVSVCHGRTLESLNVDGCKNITDASLVAVAKNCYSVNDLDVSNTLVSDQGVKALA  558

Query  490  EAVQ-LSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRY  314
             +   L+L VLS+ GC+ V++K+   + KLG +L+GLNIQ C  ISSS VD+L E LWR 
Sbjct  559  SSPNHLNLQVLSIGGCSGVTDKSKACIQKLGRTLLGLNIQRCGRISSSTVDNLLEHLWRC  618

Query  313  DVL  305
            D+L
Sbjct  619  DIL  621



>gb|KJB07621.1| hypothetical protein B456_001G033400 [Gossypium raimondii]
Length=613

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 87/122 (71%), Gaps = 1/122 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V  +   H  TLETLNLDGC  ++D SL AIA++C +L +LDVSK  ITDSGI AL 
Sbjct  492  DKGVCRLTNLHRWTLETLNLDGC-KISDASLFAIAENCRLLGDLDVSKCAITDSGIAALA  550

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             +  +++ +LS+SGC+MVS+K+LP L  LG +L+GLN+Q C  IS S +D L ++LWR +
Sbjct  551  HSDLINVQILSVSGCSMVSDKSLPSLRNLGKTLLGLNLQQCKAISRSAIDLLVQQLWRCN  610

Query  310  VL  305
            +L
Sbjct  611  IL  612



>ref|XP_006394785.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
 gb|ESQ32071.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
Length=621

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 86/123 (70%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSAI+  HG  +E+LNLDGC  +TD SLVA+A +C  + +LD+S + ++D GI AL 
Sbjct  498  DNTVSAISMCHGRFMESLNLDGCKNITDASLVAVAKNCYSVSDLDISNTLVSDHGIKALA  557

Query  490  EAV-QLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRY  314
             +   L+L VLS+ GC+ +++K+   + KLG +L+GLNIQ C  ISSS VD+L E LWR 
Sbjct  558  SSPNHLNLQVLSVGGCSAITDKSKACIQKLGRTLLGLNIQRCGRISSSTVDNLLEHLWRC  617

Query  313  DVL  305
            D+L
Sbjct  618  DIL  620



>ref|XP_009381112.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=650

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 85/123 (69%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D+ V+ + K HG TL+  NLDGC  +TD SL+AIAD CS L  LD+S   I+D G+  L 
Sbjct  528  DVLVAMLVKSHGGTLKVFNLDGCKQITDRSLLAIADGCSELDNLDLSSCSISDYGVAVLA  587

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L +LSL+ C+ V+ K+LP L  +GSS+VGLN+Q+C  IS+ G+  L EKLW  D
Sbjct  588  SARQLNLRILSLASCSKVTQKSLPFLGNMGSSMVGLNLQHCRLISTYGIGLLEEKLWWCD  647

Query  310  VLS  302
            +LS
Sbjct  648  ILS  650



>ref|XP_002285249.2| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=663

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = -2

Query  724  SCEEglvkvnxngcvnvGDLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLC  545
            SCE GL KVN +GC+N+ D  V A+A+ HGETLE LNLDGC  +TD SLVAIAD+C +L 
Sbjct  523  SCEAGLAKVNLSGCLNLTDEVVLAMARLHGETLELLNLDGCRKITDASLVAIADNCLLLN  582

Query  544  ELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCP  365
            +LD+SK  ITDSGI AL+   +L+L +LS+SGC+ VSNK++P L KLG +L+GLN+Q+C 
Sbjct  583  DLDLSKCAITDSGIAALSCGEKLNLQILSVSGCSKVSNKSMPSLCKLGKTLLGLNLQHCN  642

Query  364  GISSSGVDSLGEKLWRYDVL  305
             ISSS V+ L E LWR D+L
Sbjct  643  KISSSSVELLMESLWRCDIL  662



>emb|CBI21043.3| unnamed protein product [Vitis vinifera]
Length=610

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -2

Query  724  SCEEglvkvnxngcvnvGDLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLC  545
            SCE  L+KVN +GC+N+ D  VSA+AK HG TLE LNLDGC  +TD S+ AIA++C++L 
Sbjct  495  SCEASLIKVNLSGCMNLTDNVVSALAKVHGGTLEQLNLDGCQKITDASMFAIAENCALLS  554

Query  544  ELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCAM  440
            +LDVSK+ ITD G+ AL  A  L++ +LSLSGC++
Sbjct  555  DLDVSKTAITDYGVAALASAKHLNVQILSLSGCSL  589



>gb|ABK25485.1| unknown [Picea sitchensis]
Length=535

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 82/122 (67%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D AV  I    G+TL +LNL+GC  VTD SL  IA +C++L ELD+SK  ITD+G+V+L 
Sbjct  413  DRAVFVIVNLFGKTLLSLNLEGCRKVTDQSLGFIAHYCAILQELDISKCGITDNGLVSLA  472

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A    L +LSLSGC  +++K LP + K+G +L+GLN+Q C GISS   D L   LWR D
Sbjct  473  SAASYCLQILSLSGCMQITDKGLPFIGKIGETLIGLNLQQCRGISSRARDLLATHLWRCD  532

Query  310  VL  305
            +L
Sbjct  533  LL  534



>gb|ADW83728.1| EIN3-binding F-box protein 1 [Musa acuminata AAA Group]
Length=453

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = -2

Query  661  VSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAV  482
            V+ + K HG TL+ LNLDGC  +TD SLVAIAD CSV  +LD+S S I+D G+  L  A 
Sbjct  334  VTMLVKAHGSTLKMLNLDGCKRITDQSLVAIADSCSVFDDLDLSCSSISDYGVAVLASAR  393

Query  481  QLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  302
            QL+L  LSL+ C+ V++K+LP L  +G S+VGLN+Q+C  IS  G+  L EKLW  D++S
Sbjct  394  QLNLCTLSLASCSKVTDKSLPFLGNMGKSMVGLNLQHCSLISIHGIGLLEEKLWWCDIIS  453



>ref|XP_009388655.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=655

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 85/123 (69%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V+ + K HG TL+ LNLDGC  +TD SLVAIAD CSV  +LD+S S I+D G+  L 
Sbjct  533  DALVTMLVKAHGSTLKMLNLDGCKRITDQSLVAIADSCSVFDDLDLSCSSISDYGVAVLA  592

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL+L  LSL+ C+ V++K+LP L  +G S+VGLN+Q+C  IS  G+  L EKLW  D
Sbjct  593  SARQLNLCTLSLASCSKVTDKSLPFLGNMGKSMVGLNLQHCSLISIHGIGLLEEKLWWCD  652

Query  310  VLS  302
            ++S
Sbjct  653  IIS  655



>ref|XP_004170235.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like, 
partial [Cucumis sativus]
Length=509

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 85/122 (70%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D ++ A+A+ HG TL+ +NLDGC  +TD SLVAIAD+  VL ELDVS   ++D G++AL 
Sbjct  387  DESIIALARLHGATLQLVNLDGCRKITDQSLVAIADNLLVLNELDVSNCAVSDRGLIALA  446

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  ++L +LSL+GC  ++  +LP L  LG +LVGLN++ C  IS+  ++ L E LWR D
Sbjct  447  RAQHINLSILSLAGCCGITGTSLPCLEILGKTLVGLNLEGCNSISNGSIEVLVENLWRCD  506

Query  310  VL  305
            +L
Sbjct  507  IL  508



>emb|CDY19807.1| BnaA09g04600D [Brassica napus]
Length=616

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 87/123 (71%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSA++  HG TLE+L+LDGC  +TD S+V ++ +C  + +LDVS + ++D GI AL 
Sbjct  493  DNTVSAVSFSHGSTLESLSLDGCKNITDASVVTVSKNCYSVNDLDVSNTLVSDHGIKALA  552

Query  490  EAV-QLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRY  314
             +   L+L VLSL GC+ +++K+   + KLG +L+GLNIQ C  ISSS VDSL E+LWR 
Sbjct  553  SSPNHLNLQVLSLGGCSGITDKSKACIQKLGRTLLGLNIQRCGRISSSTVDSLLEQLWRC  612

Query  313  DVL  305
            D+L
Sbjct  613  DIL  615



>ref|XP_004150592.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
Length=614

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 85/122 (70%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D ++ A+A+ HG TL+ +NLDGC  +TD SLVAIAD+  VL ELDVS   ++D G++AL 
Sbjct  492  DESIIALARLHGATLQLVNLDGCRKITDQSLVAIADNLLVLNELDVSNCAVSDRGLIALA  551

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  ++L +LSL+GC  ++  +LP L  LG +LVGLN++ C  IS+  ++ L E LWR D
Sbjct  552  RAQHINLSILSLAGCCGITGTSLPCLEILGKTLVGLNLEGCNSISNGSIEVLVENLWRCD  611

Query  310  VL  305
            +L
Sbjct  612  IL  613



>ref|XP_010555012.1| PREDICTED: EIN3-binding F-box protein 2-like [Tarenaya hassleriana]
Length=624

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 88/123 (72%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D AV  I  +HG TLE+LNLD C  +TD SL+A++ +C  + +LDVS SR++D GI AL 
Sbjct  501  DNAVLTIVTRHGCTLESLNLDTCKNITDTSLIAVSKNCYSINDLDVSNSRVSDVGIEALA  560

Query  490  EAV-QLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRY  314
             +   L+L + S+ GC+ V++K+L  L KLG +L+GL+I++C  ISSS +D+L E+LWR 
Sbjct  561  SSPNHLNLQIFSIGGCSAVTDKSLASLQKLGHTLLGLSIRHCSKISSSAIDALLEQLWRC  620

Query  313  DVL  305
            D+L
Sbjct  621  DIL  623



>ref|XP_008445218.1| PREDICTED: EIN3-binding F-box protein 1 [Cucumis melo]
Length=646

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 89/122 (73%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  +S++ K HG TLE LNLDGC  VTD SLVAIA++C +L +LDVSK  ITD G+ AL 
Sbjct  524  DKVISSLTKLHGWTLELLNLDGCLKVTDSSLVAIAENCPLLNDLDVSKCCITDFGVAALA  583

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
            +A Q +L +LS+ GC+ +++++L  L+KLG SL+GLN+Q+C  IS+  ++ L  +L R D
Sbjct  584  QANQFNLQLLSVFGCSALTDQSLLALVKLGDSLLGLNLQHCNSISTRSIELLLAQLHRCD  643

Query  310  VL  305
            +L
Sbjct  644  IL  645



>ref|XP_004138725.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004160764.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN62950.1| hypothetical protein Csa_2G381760 [Cucumis sativus]
Length=646

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 89/122 (73%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  +S++ K HG TLE LNLDGC  VTD SLVAIA++C +L +LDVSK  ITD G+ AL 
Sbjct  524  DKVISSLTKLHGWTLELLNLDGCLKVTDSSLVAIAENCPLLNDLDVSKCCITDFGVAALA  583

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
            +A Q +L +LS+ GC+ +++++L  L+KLG SL+GLN+Q+C  IS+  ++ L  +L R D
Sbjct  584  QANQFNLQLLSVYGCSALTDQSLLALVKLGDSLLGLNLQHCNSISTRSIELLLAQLHRCD  643

Query  310  VL  305
            +L
Sbjct  644  IL  645



>ref|XP_010541915.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=637

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 88/124 (71%), Gaps = 1/124 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V ++AK  G TLE LNL+GC  +TD SL A+A++C  L +LDVSK  ITDSGI +L+
Sbjct  514  DGVVYSLAKLQGGTLEVLNLNGCRRITDSSLSAMAENCMFLRDLDVSKCGITDSGIASLS  573

Query  490  EA-VQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRY  314
             A  +L+L VLS+SGC+ VSNK+L  L KLG +L+GLNI+ C  I++  V  L E LWR 
Sbjct  574  RAEKRLNLQVLSVSGCSEVSNKSLVSLKKLGRTLLGLNIRGCDSITNETVQRLVESLWRC  633

Query  313  DVLS  302
            D+LS
Sbjct  634  DILS  637



>ref|XP_008443991.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=614

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 88/122 (72%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D ++ A+A+ HG TL+ +NL+GC  +TD SLVAIAD+  VL ELDVS   ++D G++AL 
Sbjct  492  DKSILALARLHGATLQLVNLEGCRKITDQSLVAIADNLLVLNELDVSNCAVSDRGLIALA  551

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  ++L +LSL+GC  +++++LP L +LG +LVGLN++ C  IS+  ++ L E LWR D
Sbjct  552  RAQHINLLILSLAGCCGITSRSLPSLERLGKTLVGLNLKGCNSISNGSIEVLVENLWRCD  611

Query  310  VL  305
            +L
Sbjct  612  IL  613



>gb|ACF81449.1| unknown [Zea mays]
Length=206

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 84/123 (68%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D+AVS++ K+HG++L+ ++L+GC  +TD SL  +++ C+ L ELD+S   ++D G+  L 
Sbjct  84   DVAVSSLVKRHGKSLKKVSLEGCSKITDASLFTMSESCTELAELDLSNCMVSDYGVAMLA  143

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  L L VLSLSGC+ V+ K++P L  LG SL GLN+Q C  I +  + SL +KLW  D
Sbjct  144  SARHLKLRVLSLSGCSKVTQKSVPFLGNLGQSLEGLNLQFCNMIGNHNIASLEKKLWWCD  203

Query  310  VLS  302
            +L+
Sbjct  204  ILA  206



>ref|XP_009403463.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = -2

Query  661  VSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAV  482
            V+ + K HG TL+ LNL GC  +TD SL+AIAD CSV+ +LD+S   ++D G+  L  A 
Sbjct  535  VTTLVKAHGSTLKMLNLRGCKKITDRSLLAIADGCSVIEDLDLSSCSVSDYGVAVLASAR  594

Query  481  QLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  302
            QL L +LSL+ C+ V+ K+LP L  LG S+VGLN+Q+C  IS+ G+  L EKLW  D++S
Sbjct  595  QLQLQILSLASCSKVTVKSLPFLGNLGQSMVGLNLQHCSLISTRGMKLLEEKLWWCDIIS  654



>ref|XP_003522614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN08132.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=636

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 82/122 (67%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V ++   HG TLE L+LDGC  V+D SL+AIA  C VL +LDVS+  ITD+GI AL 
Sbjct  514  DRVVLSMVNSHGWTLEVLSLDGCKRVSDASLMAIAGSCPVLADLDVSRCAITDTGIAALA  573

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
               Q +L VLSL+GCA+VS+K++P L KLG SL GLNI+ C  ISS  VD L   L   D
Sbjct  574  RGKQFNLEVLSLAGCALVSDKSVPALKKLGRSLAGLNIKLCNAISSRSVDKLLGHLCMCD  633

Query  310  VL  305
            +L
Sbjct  634  IL  635



>gb|AES91540.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=633

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 89/123 (72%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS +A+ HG TLE LNLDGC  +TD SLVA+AD C +L +LDVSK  ITD+GI  L+
Sbjct  511  DYIVSKVARLHGGTLEILNLDGCQNITDASLVAVADDCLLLNDLDVSKCAITDAGIAVLS  570

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  LS+ VLS+S C+ +SNK +P L+KLG +L GLNI+NC  I S+ ++ L E LWR D
Sbjct  571  RADHLSMRVLSMSDCSGISNKCVPFLVKLGPALSGLNIKNCNSIDSNAIEFLVENLWRCD  630

Query  310  VLS  302
            +L+
Sbjct  631  ILA  633



>emb|CAN83761.1| hypothetical protein VITISV_043743 [Vitis vinifera]
Length=669

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V A+A+ HG TLE LNLDGC  +TD SLVAIAD+C +L +LD+SK  ITDSGI AL+
Sbjct  516  DEVVLAMARLHGXTLELLNLDGCRKITDASLVAIADNCLLLNDLDLSKCAITDSGIAALS  575

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
               +L+L +LS+SGC+ VSNK++P L KLG +L+GLN+Q+C  ISSS V+ L E LWR+ 
Sbjct  576  CGEKLNLQILSVSGCSKVSNKSMPSLCKLGKTLLGLNLQHCNKISSSSVELLMESLWRFS  635

Query  310  VL  305
            ++
Sbjct  636  II  637



>ref|NP_001046222.1| Os02g0200900 [Oryza sativa Japonica Group]
 dbj|BAD15850.1| putative F-box protein [Oryza sativa Japonica Group]
 dbj|BAF08136.1| Os02g0200900 [Oryza sativa Japonica Group]
Length=511

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 84/123 (68%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D AVS + K HG++L+ ++L+GC  +TD SL AI+++C+ L ELD+SK  ++D+G+  L 
Sbjct  389  DAAVSTLVKGHGKSLKQVSLEGCSKITDASLFAISENCTELAELDLSKCMVSDNGVATLA  448

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  L L VLSLSGC+ V+ K++  L  +G SL GLN+Q C  I +  + SL ++LW  D
Sbjct  449  SAKHLKLRVLSLSGCSKVTPKSVSFLGNMGQSLEGLNLQFCNMIGNHNIASLEKQLWWCD  508

Query  310  VLS  302
            +L+
Sbjct  509  ILA  511



>dbj|BAD15849.1| putative F-box protein [Oryza sativa Japonica Group]
 gb|EAZ22129.1| hypothetical protein OsJ_05792 [Oryza sativa Japonica Group]
Length=660

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 84/123 (68%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D AVS + K HG++L+ ++L+GC  +TD SL AI+++C+ L ELD+SK  ++D+G+  L 
Sbjct  538  DAAVSTLVKGHGKSLKQVSLEGCSKITDASLFAISENCTELAELDLSKCMVSDNGVATLA  597

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  L L VLSLSGC+ V+ K++  L  +G SL GLN+Q C  I +  + SL ++LW  D
Sbjct  598  SAKHLKLRVLSLSGCSKVTPKSVSFLGNMGQSLEGLNLQFCNMIGNHNIASLEKQLWWCD  657

Query  310  VLS  302
            +L+
Sbjct  658  ILA  660



>gb|EAY84905.1| hypothetical protein OsI_06273 [Oryza sativa Indica Group]
Length=653

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 84/123 (68%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D AVS + K HG++L+ ++L+GC  +TD SL AI+++C+ L ELD+SK  ++D+G+  L 
Sbjct  531  DAAVSTLVKGHGKSLKQVSLEGCSKITDASLFAISENCTELAELDLSKCMVSDNGVATLA  590

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  L L VLSLSGC+ V+ K++  L  +G SL GLN+Q C  I +  + SL ++LW  D
Sbjct  591  SAKHLKLRVLSLSGCSKVTPKSVSFLGNMGQSLEGLNLQFCNMIGNHNIASLEKQLWWCD  650

Query  310  VLS  302
            +L+
Sbjct  651  ILA  653



>ref|XP_003609343.1| Ein3-binding f-box protein [Medicago truncatula]
Length=1052

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 88/122 (72%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VS +A+ HG TLE LNLDGC  +TD SLVA+AD C +L +LDVSK  ITD+GI  L+
Sbjct  511  DYIVSKVARLHGGTLEILNLDGCQNITDASLVAVADDCLLLNDLDVSKCAITDAGIAVLS  570

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  LS+ VLS+S C+ +SNK +P L+KLG +L GLNI+NC  I S+ ++ L E LWR D
Sbjct  571  RADHLSMRVLSMSDCSGISNKCVPFLVKLGPALSGLNIKNCNSIDSNAIEFLVENLWRCD  630

Query  310  VL  305
            +L
Sbjct  631  IL  632



>emb|CAN82790.1| hypothetical protein VITISV_030601 [Vitis vinifera]
Length=718

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSA+AK HG TLE LNLDGC  +TD S+ AIA++C++L +LDVSK+ ITD G+ AL 
Sbjct  645  DNVVSALAKVHGGTLEQLNLDGCQKITDASMFAIAENCALLSDLDVSKTAITDYGVAALA  704

Query  490  EAVQLSLHVLSLSG  449
             A  L++ +LSLSG
Sbjct  705  SAKHLNVQILSLSG  718



>ref|NP_001132560.1| F-box family member [Zea mays]
Length=375

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 84/123 (68%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D+AVS++ K+HG++L+ ++L+GC  +TD SL  +++ C+ L ELD+S   ++D G+  L 
Sbjct  253  DVAVSSLVKRHGKSLKKVSLEGCSKITDASLFTMSESCTELAELDLSNCMVSDYGVAMLA  312

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  L L VLSLSGC+ V+ K++P L  LG SL GLN+Q C  I +  + SL +KLW  D
Sbjct  313  SARHLKLRVLSLSGCSKVTQKSVPFLGNLGQSLEGLNLQFCNMIGNHNIASLEKKLWWCD  372

Query  310  VLS  302
            +L+
Sbjct  373  ILA  375



>ref|XP_002437255.1| hypothetical protein SORBIDRAFT_10g023670 [Sorghum bicolor]
 gb|EER88622.1| hypothetical protein SORBIDRAFT_10g023670 [Sorghum bicolor]
Length=303

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 81/123 (66%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D AVSA+ K HG +L  L+L+GC  +TD SL AI++ CS L ELD+S   ++D G+  L 
Sbjct  182  DAAVSALVKAHGASLAHLSLEGCSKITDASLFAISESCSQLAELDLSNCMVSDYGVAVLA  241

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL L +LSLSGC  V+ K++P L  + SSL GLN+Q    I +  + SL ++LWR D
Sbjct  242  AAKQLKLRILSLSGCMKVTQKSVPFLGSMSSSLEGLNLQF-NFIGNRNIASLEKQLWRCD  300

Query  310  VLS  302
            +L+
Sbjct  301  ILA  303



>gb|AFW87207.1| hypothetical protein ZEAMMB73_795948 [Zea mays]
Length=626

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 81/123 (66%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D AVSA+AK HG +L  L+L+GC  +TD SL AI++ CS L ELD+S   ++D G+  L 
Sbjct  505  DAAVSALAKAHGASLAHLSLEGCSKITDASLFAISESCSQLAELDLSNCMVSDYGVAVLA  564

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL L VLSLSGC  V+ K++P L  + SSL  LN+Q    I +  + SL ++LWR D
Sbjct  565  AARQLKLRVLSLSGCMKVTQKSVPFLGSMSSSLEALNLQF-NFIGNHNIASLEKQLWRCD  623

Query  310  VLS  302
            +L+
Sbjct  624  ILA  626



>gb|ACR35519.1| unknown [Zea mays]
Length=520

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 84/123 (68%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D+AVS++ K+HG++L+ ++L+GC  +TD SL  +++ C+ L ELD+S   ++D G+  L 
Sbjct  398  DVAVSSLVKRHGKSLKKVSLEGCSKITDASLFTMSESCTELAELDLSNCMVSDYGVAMLA  457

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  L L VLSLSGC+ V+ K++P L  LG SL GLN+Q C  I +  + SL +KLW  D
Sbjct  458  SARHLKLRVLSLSGCSKVTQKSVPFLGNLGQSLEGLNLQFCNMIGNHNIASLEKKLWWCD  517

Query  310  VLS  302
            +L+
Sbjct  518  ILA  520



>ref|XP_009419280.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = -2

Query  661  VSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAV  482
            V+ + K HG +L+ LNL GC  +TD SL+AI + CSVL +LD+S   ++D G+  L  A 
Sbjct  535  VTMLIKVHGSSLKMLNLHGCRKITDRSLLAITESCSVLDDLDLSSCSVSDYGVALLASAR  594

Query  481  QLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  302
            QL+LH+LSL+ C+ V+ K+LP L  LG S+VGLN+Q+C  IS+ G+  L EKLW  D++S
Sbjct  595  QLNLHILSLASCSQVTLKSLPFLGNLGLSIVGLNLQDCSLISAHGLRLLEEKLWWCDIIS  654



>ref|XP_008681226.1| PREDICTED: F-box family member isoform X1 [Zea mays]
 gb|AFW70693.1| F-box family member [Zea mays]
Length=643

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 84/123 (68%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D+AVS++ K+HG++L+ ++L+GC  +TD SL  +++ C+ L ELD+S   ++D G+  L 
Sbjct  521  DVAVSSLVKRHGKSLKKVSLEGCSKITDASLFTMSESCTELAELDLSNCMVSDYGVAMLA  580

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  L L VLSLSGC+ V+ K++P L  LG SL GLN+Q C  I +  + SL +KLW  D
Sbjct  581  SARHLKLRVLSLSGCSKVTQKSVPFLGNLGQSLEGLNLQFCNMIGNHNIASLEKKLWWCD  640

Query  310  VLS  302
            +L+
Sbjct  641  ILA  643



>ref|XP_004951542.1| PREDICTED: EIN3-binding F-box protein 1-like [Setaria italica]
Length=654

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 83/123 (67%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D+AVS++ K HG++L+ ++L+GC  +TD SL  IA+ C  L ELD+S   ++D G+  L+
Sbjct  532  DVAVSSLVKAHGKSLKKVSLEGCSKITDASLFTIAESCMELAELDLSNCMVSDYGVAILS  591

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  L L VLSLSGC+ V+ K++P L  LG SL GLN+Q C  I +  + SL +KLW  D
Sbjct  592  SARHLKLRVLSLSGCSKVTQKSVPFLGNLGQSLEGLNLQFCNMIGNHNIVSLEKKLWWCD  651

Query  310  VLS  302
            +L+
Sbjct  652  ILA  654



>ref|NP_001147557.1| LOC100281166 [Zea mays]
 gb|ACG27917.1| EIN3-binding F-box protein 1 [Zea mays]
 gb|AFW76402.1| EIN3-binding F-box protein 1 [Zea mays]
Length=626

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 81/123 (66%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D AVSA+ K HG +L  L+L+GC  +TD SL AI++ CS L ELD+S   ++D G+  L 
Sbjct  505  DAAVSALVKAHGASLAHLSLEGCSKITDASLFAISESCSQLAELDLSNCMVSDYGVAVLA  564

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL L VLSLSGC  V+ K++P L  + SSL GLN+Q    I +  + SL ++LWR D
Sbjct  565  AAKQLRLRVLSLSGCMKVTQKSVPFLGSMSSSLEGLNLQ-FNFIGNHNIASLEKQLWRCD  623

Query  310  VLS  302
            +L+
Sbjct  624  ILA  626



>ref|XP_004965933.1| PREDICTED: EIN3-binding F-box protein 1-like [Setaria italica]
Length=628

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 81/123 (66%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D AVSA+ K HG +L  L+L+GC  +TD SL AI++ CS L ELD+S   ++D G+  L 
Sbjct  507  DAAVSALVKAHGASLAHLSLEGCSRITDASLFAISESCSQLAELDLSNCMVSDYGVAVLA  566

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL L +LSLSGC  V+ K++P L  + SSL GLN+Q    I +  + SL ++LWR D
Sbjct  567  AAKQLKLRILSLSGCMKVTQKSVPFLGSMSSSLEGLNLQ-FNFIGNHNIASLEKQLWRCD  625

Query  310  VLS  302
            +L+
Sbjct  626  ILA  628



>ref|NP_001058023.1| Os06g0605900 [Oryza sativa Japonica Group]
 dbj|BAF19937.1| Os06g0605900, partial [Oryza sativa Japonica Group]
Length=122

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 79/123 (64%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSA+ K HG +L  L+L+GC  +TD SL AI++ C+ L ELD+S   ++D G+  L 
Sbjct  1    DATVSALVKAHGSSLARLSLEGCSRITDASLFAISEGCTDLAELDLSNCMVSDYGVAVLA  60

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL L VLSLSGC  V+ K++P L  + +SL GLN+Q    I +  + SL ++LW  D
Sbjct  61   SARQLKLRVLSLSGCLKVTQKSVPFLGSMSASLEGLNLQ-FNFIGNHNIASLEKQLWWCD  119

Query  310  VLS  302
            +L+
Sbjct  120  ILA  122



>ref|XP_003603398.1| Ein3-binding f-box protein, partial [Medicago truncatula]
Length=627

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 77/109 (71%), Gaps = 0/109 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D+ V ++ K H  TL  LNL+GC  V D SL AIAD+C VL +LDVS+  ITD+GI ALT
Sbjct  519  DVGVLSMVKLHCSTLGVLNLNGCKKVGDASLTAIADNCIVLSDLDVSECAITDAGISALT  578

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGV  344
              V  +L VLSL+GC++VSNK+L  L KLG SL GLNI+NC  ISS  V
Sbjct  579  RGVLFNLDVLSLAGCSLVSNKSLSALKKLGDSLEGLNIKNCKSISSRTV  627



>ref|NP_001145991.1| uncharacterized protein LOC100279520 [Zea mays]
 gb|ACL52991.1| unknown [Zea mays]
Length=522

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 81/123 (66%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D+AVS++ K HG++L+ +NL+GC  +TD  L  +++ C+ L EL++S   ++D G+  L 
Sbjct  400  DVAVSSLVKGHGKSLKKINLEGCSKITDAILFTMSESCTELAELNLSNCMVSDYGVAILA  459

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  L L VLSLSGC+ V+ K++  L  LG S+ GLN+Q C  I +  + SL +KLW  D
Sbjct  460  SARHLKLRVLSLSGCSKVTQKSVLFLGNLGQSIEGLNLQFCDMIGNHNIASLEKKLWWCD  519

Query  310  VLS  302
            +L+
Sbjct  520  ILA  522



>ref|XP_002453497.1| hypothetical protein SORBIDRAFT_04g006870 [Sorghum bicolor]
 gb|EES06473.1| hypothetical protein SORBIDRAFT_04g006870 [Sorghum bicolor]
Length=655

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 83/123 (67%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D+AVS++ K HG++L+ ++L+GC  +TD SL  +++ C+ L ELD+S   ++D G+  L 
Sbjct  533  DVAVSSLVKGHGKSLKKVSLEGCSKITDASLFTMSESCTELAELDLSNCMVSDHGVAILA  592

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  L L VLSLSGC+ V+ K++P L  LG SL GLN+Q C  I +  + SL ++LW  D
Sbjct  593  SARHLKLRVLSLSGCSKVTQKSVPFLGNLGQSLEGLNLQFCNMIGNHNIASLEKQLWWCD  652

Query  310  VLS  302
            +L+
Sbjct  653  ILA  655



>ref|XP_008677099.1| PREDICTED: uncharacterized protein LOC100279520 isoform X1 [Zea 
mays]
 ref|XP_008677100.1| PREDICTED: uncharacterized protein LOC100279520 isoform X1 [Zea 
mays]
Length=651

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 81/123 (66%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D+AVS++ K HG++L+ +NL+GC  +TD  L  +++ C+ L EL++S   ++D G+  L 
Sbjct  529  DVAVSSLVKGHGKSLKKINLEGCSKITDAILFTMSESCTELAELNLSNCMVSDYGVAILA  588

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  L L VLSLSGC+ V+ K++  L  LG S+ GLN+Q C  I +  + SL +KLW  D
Sbjct  589  SARHLKLRVLSLSGCSKVTQKSVLFLGNLGQSIEGLNLQFCDMIGNHNIASLEKKLWWCD  648

Query  310  VLS  302
            +L+
Sbjct  649  ILA  651



>ref|NP_001237471.1| grr1 protein [Glycine max]
 gb|AAB70660.1| grr1 [Glycine max]
Length=690

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  V ++   HG TLE L+LDGC  V D SL+AIA  C +L +LDVS+  ITD+GI AL 
Sbjct  558  DRVVLSMVNSHGWTLEVLSLDGCKRVGDASLMAIAGSCPLLADLDVSRCAITDTGIAALA  617

Query  490  EAVQLSLHVLSLSGCAM  440
               Q++L VLSL+GCA+
Sbjct  618  RGKQINLEVLSLAGCAI  634



>gb|AFW66152.1| hypothetical protein ZEAMMB73_923849 [Zea mays]
Length=754

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 81/123 (66%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D+AVS++ K HG++L+ +NL+GC  +TD  L  +++ C+ L EL++S   ++D G+  L 
Sbjct  632  DVAVSSLVKGHGKSLKKINLEGCSKITDAILFTMSESCTELAELNLSNCMVSDYGVAILA  691

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  L L VLSLSGC+ V+ K++  L  LG S+ GLN+Q C  I +  + SL +KLW  D
Sbjct  692  SARHLKLRVLSLSGCSKVTQKSVLFLGNLGQSIEGLNLQFCDMIGNHNIASLEKKLWWCD  751

Query  310  VLS  302
            +L+
Sbjct  752  ILA  754



>gb|EMS45959.1| hypothetical protein TRIUR3_29988 [Triticum urartu]
Length=383

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 81/123 (66%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D A+SA+ K HG +L  L+L+GC  +TD SL AI++ CS L ELD+S   ++D G+  L+
Sbjct  262  DAAISALVKAHGTSLAHLSLEGCSKITDASLFAISESCSELAELDLSNCMVSDYGVAVLS  321

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A +L L VLSLSGC  V+ K++P L  + +SL GLN+Q    I +  + SL ++LW  D
Sbjct  322  SAERLKLRVLSLSGCLKVTPKSVPFLGSMPASLEGLNLQF-NFIGNHNIASLEKQLWWCD  380

Query  310  VLS  302
            +L+
Sbjct  381  ILA  383



>ref|XP_003571400.1| PREDICTED: EIN3-binding F-box protein 1-like [Brachypodium distachyon]
Length=655

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 76/123 (62%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            DLAVS++ K HG++++ ++L+GC  +TD SL +I+++C+ L ELD+S   ++DSG+ +L 
Sbjct  534  DLAVSSLVKVHGKSVKQVSLEGCSKITDASLFSISENCTELAELDLSNCMVSDSGVASLA  593

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
                  L VLSL GC+    +     L     L GLNIQ C  I +  + SL ++LW  D
Sbjct  594  STSNFKLRVLSLFGCS-NVTQRSVPFLGNMGKLEGLNIQFCNMIGNHNIASLEKQLWWCD  652

Query  310  VLS  302
            +L+
Sbjct  653  ILA  655



>gb|EMT19526.1| hypothetical protein F775_07091 [Aegilops tauschii]
Length=939

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 76/123 (62%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D+AVS++ K HG++++ ++L+GC  +TD SL  I+++C+ L ELD+S   ++DSG+ +L 
Sbjct  818  DVAVSSLVKAHGKSVKQVSLEGCSKITDASLFCISENCTELAELDLSNCMVSDSGVASLA  877

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A    L VLSL GC+    +     L     L GLN+Q C  I +  + SL ++LW  D
Sbjct  878  SAKHFKLRVLSLFGCS-KVTQVGVQFLGSMGKLEGLNLQYCNMIGNHNIASLEKQLWWCD  936

Query  310  VLS  302
            +L+
Sbjct  937  ILA  939



>dbj|BAD35544.1| putative F-box protein Fbl2 [Oryza sativa Japonica Group]
 dbj|BAG89384.1| unnamed protein product [Oryza sativa Japonica Group]
Length=627

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 79/123 (64%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSA+ K HG +L  L+L+GC  +TD SL AI++ C+ L ELD+S   ++D G+  L 
Sbjct  506  DATVSALVKAHGSSLARLSLEGCSRITDASLFAISEGCTDLAELDLSNCMVSDYGVAVLA  565

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL L VLSLSGC  V+ K++P L  + +SL GLN+Q    I +  + SL ++LW  D
Sbjct  566  SARQLKLRVLSLSGCLKVTQKSVPFLGSMSASLEGLNLQF-NFIGNHNIASLEKQLWWCD  624

Query  310  VLS  302
            +L+
Sbjct  625  ILA  627



>ref|XP_006657116.1| PREDICTED: EIN3-binding F-box protein 1-like [Oryza brachyantha]
Length=590

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 79/123 (64%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSA+ K HG +L  L+L+GC  +TD SL AI++ C+ L ELD+S   ++D G+  L 
Sbjct  469  DATVSALVKAHGSSLARLSLEGCSKITDASLFAISEGCTDLAELDLSNCMVSDYGVAVLA  528

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL L VLSLSGC  V+ K++P L  + +SL GLN+Q    I +  + SL ++LW  D
Sbjct  529  SARQLKLRVLSLSGCLKVTQKSVPFLGSMSASLEGLNLQF-NFIGNHNIASLEKQLWWCD  587

Query  310  VLS  302
            +L+
Sbjct  588  ILA  590



>gb|EAZ01599.1| hypothetical protein OsI_23635 [Oryza sativa Indica Group]
 gb|EAZ37582.1| hypothetical protein OsJ_21915 [Oryza sativa Japonica Group]
Length=664

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 79/123 (64%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D  VSA+ K HG +L  L+L+GC  +TD SL AI++ C+ L ELD+S   ++D G+  L 
Sbjct  543  DATVSALVKAHGSSLARLSLEGCSRITDASLFAISEGCTDLAELDLSNCMVSDYGVAVLA  602

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL L VLSLSGC  V+ K++P L  + +SL GLN+Q    I +  + SL ++LW  D
Sbjct  603  SARQLKLRVLSLSGCLKVTQKSVPFLGSMSASLEGLNLQF-NFIGNHNIASLEKQLWWCD  661

Query  310  VLS  302
            +L+
Sbjct  662  ILA  664



>gb|EMT32544.1| hypothetical protein F775_30491 [Aegilops tauschii]
Length=452

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 80/123 (65%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D A+SA+ K HG +L  L+L+GC  ++D SL AI++ CS L ELD+S   ++D G+  L 
Sbjct  331  DAAISALVKAHGTSLAHLSLEGCSKISDASLFAISESCSELAELDLSNCMVSDYGVAVLA  390

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A +L L VLSLSGC  V+ K++P L  + +SL GLN+Q    I +  + SL ++LW  D
Sbjct  391  SAERLKLRVLSLSGCLKVTPKSVPFLGSMPASLEGLNLQF-NFIGNHNIASLEKQLWWCD  449

Query  310  VLS  302
            +L+
Sbjct  450  ILA  452



>dbj|BAJ88579.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97493.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=649

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 75/123 (61%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D+ VS++ K HG++++ ++L+GC  +TD SL  I+++C+ L ELD+S   ++DSG+ +L 
Sbjct  528  DVTVSSLVKAHGKSVKQVSLEGCSKITDASLFCISENCTELAELDLSNCMVSDSGVASLA  587

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A    L VLSL GC+    +     L     L GLN+Q C  I +  + SL ++LW  D
Sbjct  588  SAKHFKLRVLSLFGCS-NVTQASVQFLGSMGKLEGLNLQYCNMIGNHNIASLEKQLWWCD  646

Query  310  VLS  302
            +++
Sbjct  647  IVA  649



>ref|XP_003563656.1| PREDICTED: EIN3-binding F-box protein 1 [Brachypodium distachyon]
 gb|ACF22741.1| EIN3-binding F-box protein [Brachypodium distachyon]
Length=642

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 78/123 (63%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D ++SA+ K HG +L  L+L+GC  ++D SL AI++ C  L ELD+S   ++D G+  L 
Sbjct  521  DASISALVKAHGNSLTHLSLEGCSKISDASLFAISESCCELAELDLSNCMVSDYGVAVLA  580

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A QL L VLSLSGC  V+ K++P L  +  SL GLN+Q    I +  + SL ++LW  D
Sbjct  581  SAGQLKLRVLSLSGCFKVTQKSVPFLGSMPVSLEGLNLQF-NFIGNHNIASLEKQLWWCD  639

Query  310  VLS  302
            +L+
Sbjct  640  ILA  642



>gb|EMS68820.1| hypothetical protein TRIUR3_29831 [Triticum urartu]
Length=484

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 74/123 (60%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D+AVS++ K HG++++ ++L+GC  +TD SL  I+++C+ L  LD+S   ++DSG+ +L 
Sbjct  363  DVAVSSLVKAHGKSVKQISLEGCSKITDASLFCISENCTELAGLDLSNCMVSDSGVASLA  422

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A    L  LSL GC+    +     L     L GLN+Q C  I +  + SL ++LW  D
Sbjct  423  SAKHFKLRALSLFGCS-KVTQVSVQFLGSMGKLEGLNLQYCNMIGNHNIASLEKQLWWCD  481

Query  310  VLS  302
            +L+
Sbjct  482  ILA  484



>gb|AFA36487.1| EIN3-binding F-box protein, partial [Lolium perenne]
Length=263

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 77/123 (63%), Gaps = 1/123 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D A+SA+ K HG +L  L+L+ C  +TD SL AI++ C  L ELD+S   ++D G+  L 
Sbjct  142  DAAISALVKAHGGSLAHLSLESCSKITDASLFAISESCYELAELDLSNCMVSDYGVAVLA  201

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             A  L L +LSLSGC  V+ K++P L  + +SL GLN+Q    I +  + SL ++LW  D
Sbjct  202  SAAGLKLRILSLSGCLKVTQKSVPFLGSMPASLEGLNLQF-NFIGNHNIASLEKQLWWCD  260

Query  310  VLS  302
            +L+
Sbjct  261  ILA  263



>ref|XP_010264613.1| PREDICTED: EIN3-binding F-box protein 2-like [Nelumbo nucifera]
Length=645

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 76/122 (62%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            DL+V AI    GE L  L LDGC  ++D+SL  I++ C  L +L +S+  I+D GI  LT
Sbjct  522  DLSVYAITSIVGEKLRCLILDGCERLSDLSLKMISERCPCLIDLGLSRCCISDDGIFCLT  581

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
                  L VLSL GC  ++++ L  LL +  SLVGL++++CP ++  G+D++ E LW  D
Sbjct  582  STQMRCLKVLSLGGCVGITDRCLNYLLMIRGSLVGLDLKHCPQLTKEGIDAISETLWWCD  641

Query  310  VL  305
            +L
Sbjct  642  LL  643



>ref|XP_001775242.1| predicted protein [Physcomitrella patens]
 gb|EDQ59978.1| predicted protein [Physcomitrella patens]
Length=619

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 73/120 (61%), Gaps = 1/120 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D+AV+AIA + G+ LE L LDGC  V D  L  +A  C +L ELD+S + ITDSG+ +L 
Sbjct  496  DVAVAAIASRCGD-LERLILDGCYQVGDNGLQTLATECPLLKELDLSGTSITDSGLRSLV  554

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             +  L L  L+ +GC  +++++L  +      L  LN++NCP ++  G+ SL  +LW  D
Sbjct  555  TSQGLFLQGLTFTGCINLTDESLSSIEDFCPLLGSLNLRNCPLLTREGLSSLESQLWSCD  614



>emb|CDX76980.1| BnaC04g37750D [Brassica napus]
Length=599

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 80/114 (70%), Gaps = 3/114 (3%)
 Frame = -2

Query  634  ETLETLNLDGCGYVTDVSLVAIAD---HCSVLCELDVSKSRITDSGIVALTEAVQLSLHV  464
             +L  +N  GC  +TD  + AI+    +C +L +LD+SK  ++D GI AL  + +L L +
Sbjct  486  NSLVKVNFSGCSGLTDRVVSAISARNANCQILSDLDLSKCSVSDFGIQALASSEKLKLQI  545

Query  463  LSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  302
            LS++GCAMV++K+LP ++KLGS+L+GLN+Q C  +S S VD L E+L++ D+LS
Sbjct  546  LSMAGCAMVTDKSLPSIVKLGSTLLGLNLQQCRSVSCSTVDFLLERLYKCDILS  599



>ref|XP_010251723.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=655

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 72/122 (59%), Gaps = 0/122 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D +V  I    G+ L +L LD C  +TD+SL  IA+ C+ L +L +S  RI+D G+  L 
Sbjct  533  DWSVFVITSLIGDKLRSLMLDWCEKLTDLSLKMIAERCACLLDLGLSGCRISDDGVYCLV  592

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             +    L V+S +GC  +S+++L  L  L   LVGLN+ +CP ++  G+D + E LW  D
Sbjct  593  ASKLQCLEVVSFAGCVGISDQSLHYLRMLRCYLVGLNLMHCPKLTKEGIDRMRENLWWCD  652

Query  310  VL  305
            +L
Sbjct  653  LL  654



>ref|XP_001783097.1| predicted protein [Physcomitrella patens]
 gb|EDQ52100.1| predicted protein [Physcomitrella patens]
Length=633

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 73/120 (61%), Gaps = 1/120 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D+ V+AIA   G+ LE L LDGC  V D  L  +A  C  L ELD+S + ITDSG+ +L 
Sbjct  506  DVVVAAIASHCGD-LERLILDGCYQVGDSGLQMLAAACPSLKELDLSGTSITDSGLRSLV  564

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
             +  L L  L+L+GC  +++++L L+     SL  LN++NCP +S  G+ +L  +LW  D
Sbjct  565  ISRGLWLQGLTLTGCINLTDESLSLIEDYCPSLGALNLRNCPLLSREGLSALESQLWSCD  624



>ref|XP_002986021.1| hypothetical protein SELMODRAFT_123441 [Selaginella moellendorffii]
 gb|EFJ12840.1| hypothetical protein SELMODRAFT_123441 [Selaginella moellendorffii]
Length=647

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 78/123 (63%), Gaps = 2/123 (2%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D A+  ++++  E L+T+ LDGC  V+D S+  +A  C  L ELDVS   ITD GIVA+ 
Sbjct  524  DKAIVGVSRKCFE-LQTVILDGCVKVSDKSVGVLASQCRSLQELDVSNCSITDDGIVAVV  582

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLW-RY  314
             +V  +L  LSLSGC+ V++++LP + K+  SL  LN++NC G +++ ++     L  R 
Sbjct  583  ISVGPTLKTLSLSGCSRVTDESLPTIQKMCDSLTALNLKNCSGFTAAALEKFESDLGTRC  642

Query  313  DVL  305
            D+L
Sbjct  643  DIL  645



>ref|XP_002981899.1| hypothetical protein SELMODRAFT_233861 [Selaginella moellendorffii]
 gb|EFJ16992.1| hypothetical protein SELMODRAFT_233861 [Selaginella moellendorffii]
Length=595

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 78/123 (63%), Gaps = 2/123 (2%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D A+  ++++  E L+T+ LDGC  V+D S+  +A  C  L ELDVS   ITD GIVA+ 
Sbjct  472  DKAIVGVSRKCFE-LQTVILDGCVKVSDKSVGVLASQCRSLQELDVSNCSITDDGIVAVV  530

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLW-RY  314
             +V  +L  LSLSGC+ V++++LP + K+  SL  LN++NC G +++ ++     L  R 
Sbjct  531  ISVGPTLKTLSLSGCSRVTDESLPTIQKMCDSLTALNLKNCSGFTAAALEKFVSDLGTRC  590

Query  313  DVL  305
            D+L
Sbjct  591  DIL  593



>ref|XP_010908612.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=569

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 60/108 (56%), Gaps = 0/108 (0%)
 Frame = -2

Query  631  TLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLS  452
             +  L+L GC  VTD SL AIA  C  L ELD+S  RI+D G+  L       L  LSL+
Sbjct  460  NITKLDLSGCRLVTDRSLRAIAQRCQELEELDLSGCRISDQGVECLASEGPSWLQALSLA  519

Query  451  GCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDV  308
            GCA +++K+L  L  L  SL  LN+  CPGIS   + S  E  +  DV
Sbjct  520  GCAEITDKSLEALQTLCVSLESLNVTRCPGISQEAISSFKEVCFFCDV  567



>ref|XP_007136869.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
 gb|ESW08863.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
Length=601

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVAL  494
            D  V  I   HG T + L LDGC  VTD S +AIA +C +L +LDVSK  ITD+GI AL
Sbjct  522  DKVVLPIVNSHGCTRQVLCLDGCTRVTDASTMAIAGNCPMLSDLDVSKCAITDTGIAAL  580



>ref|XP_009032915.1| hypothetical protein AURANDRAFT_11299, partial [Aureococcus anophagefferens]
 gb|EGB11841.1| hypothetical protein AURANDRAFT_11299, partial [Aureococcus anophagefferens]
Length=330

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKS-RITDSGIVAL  494
            D+ VS +A Q G TLE  NL GC  +T+    AIADHC V+  +D+  + R+TD G+  L
Sbjct  104  DVGVSWVAHQAGATLEVFNLRGCNRLTNAGCRAIADHCHVIRVVDLRGARRVTDVGVRVL  163

Query  493  TEAVQLSLHVLSLS  452
              A+  +L  L +S
Sbjct  164  GAALGDTLETLDIS  177



>ref|XP_006849175.1| hypothetical protein AMTR_s00027p00189050 [Amborella trichopoda]
 gb|ERN10756.1| hypothetical protein AMTR_s00027p00189050 [Amborella trichopoda]
Length=620

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 73/123 (59%), Gaps = 0/123 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            D +V A+    G  + TL+LDGC  V D SL AIA  C+ + +LD+S+  ++D G+  L 
Sbjct  498  DDSVVALCNGCGGGIRTLSLDGCVQVGDASLEAIARLCTCINDLDLSQCAVSDLGLEFLA  557

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  311
                 SL + SLSGC+ +SN  +  L ++G+ LVGLN+ +C G+S   ++ L   L + D
Sbjct  558  RMGCTSLRIFSLSGCSRISNGCMSFLKEVGAGLVGLNLMHCGGLSRMAIERLKGSLSKCD  617

Query  310  VLS  302
            + S
Sbjct  618  IAS  620



>ref|XP_009386195.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=604

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            + +V AI ++   +L+ L L GCG V D     IA  C+ L ELD+    I+D G+  L 
Sbjct  483  NWSVWAITRECKASLKRLVLRGCGRVNDRGAAVIARRCAKLVELDLGGCDISDEGVKKLA  542

Query  490  EAVQLSLHVLSLSGC  446
                + L V+SL+GC
Sbjct  543  RDEPIDLEVISLAGC  557



>ref|XP_002974778.1| hypothetical protein SELMODRAFT_442539 [Selaginella moellendorffii]
 gb|EFJ24298.1| hypothetical protein SELMODRAFT_442539 [Selaginella moellendorffii]
Length=630

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 67/118 (57%), Gaps = 1/118 (1%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  491
            + A++A+A     +L  L LDGC  VTD  +  +A     + EL ++   +TD G+VAL 
Sbjct  509  NRALAAVA-SFCPSLGLLTLDGCASVTDQGIRYVAQGPQAVQELSLAGCDVTDDGMVALV  567

Query  490  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWR  317
             A   SL  LSL+GC  V++++L  +    ++L  LN+++C G+S + ++     LWR
Sbjct  568  LAKGSSLKTLSLAGCGRVTDRSLLAMKTACNTLEALNVKDCKGLSRAKLEWFEAGLWR  625



>ref|XP_002963689.1| hypothetical protein SELMODRAFT_62165, partial [Selaginella moellendorffii]
 gb|EFJ35560.1| hypothetical protein SELMODRAFT_62165, partial [Selaginella moellendorffii]
Length=542

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 67/116 (58%), Gaps = 1/116 (1%)
 Frame = -2

Query  664  AVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEA  485
            A++A+A     +L  L LDGC  VTD  +  +A     + EL ++   +TD G+VAL  A
Sbjct  425  ALAAVA-SFCPSLGLLTLDGCASVTDQGIRYVAQGPQAVQELSLAGCDVTDDGMVALVLA  483

Query  484  VQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWR  317
               SL  LSL+GC  V++++L ++    ++L  LN+++C G+S + ++     LWR
Sbjct  484  KGSSLKTLSLAGCGRVTDRSLLVMKTACNALEALNVKDCKGLSRAKLEWFEAGLWR  539



>emb|CBI28209.3| unnamed protein product [Vitis vinifera]
Length=546

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  532  SKSRITDSGIVALTEAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISS  353
            SK  ITDSGI AL+   +L+L +LS+SGC+ VSNK++P L KLG +L+GLN+Q+C  ISS
Sbjct  470  SKCAITDSGIAALSCGEKLNLQILSVSGCSKVSNKSMPSLCKLGKTLLGLNLQHCNKISS  529

Query  352  SGVDSLGEKLWRYDVL  305
            S V+ L E LWR D+L
Sbjct  530  SSVELLMESLWRCDIL  545



>ref|XP_785847.3| PREDICTED: F-box/LRR-repeat protein 7-like [Strongylocentrotus 
purpuratus]
Length=543

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 44/76 (58%), Gaps = 3/76 (4%)
 Frame = -2

Query  670  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSK-SRITDSGIVAL  494
            D+ V AIAK H   L  LN+ GC  V+D SL A++  C  L  LDV K   ITD G+V++
Sbjct  416  DMGVYAIAK-HCYKLRYLNVRGCVLVSDKSLEALSRGCPRLRSLDVGKCPLITDHGLVSI  474

Query  493  TEAVQLSLHVLSLSGC  446
                Q SL  LSL GC
Sbjct  475  ATNCQ-SLRKLSLKGC  489



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1300407706455