BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF011O03

Length=742
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004245560.1|  PREDICTED: reticulon-like protein B4               299   6e-98   Solanum lycopersicum
ref|XP_006343915.1|  PREDICTED: reticulon-like protein B1-like          298   2e-97   Solanum tuberosum [potatoes]
ref|XP_009793558.1|  PREDICTED: reticulon-like protein B4               295   1e-96   Nicotiana sylvestris
ref|XP_009598008.1|  PREDICTED: reticulon-like protein B2               288   8e-95   
gb|KHG24129.1|  Reticulon-like protein B3                               281   4e-91   Gossypium arboreum [tree cotton]
ref|XP_002509881.1|  conserved hypothetical protein                     281   6e-91   Ricinus communis
emb|CDP12094.1|  unnamed protein product                                279   3e-90   Coffea canephora [robusta coffee]
ref|XP_010251601.1|  PREDICTED: reticulon-like protein B2               279   3e-90   Nelumbo nucifera [Indian lotus]
ref|XP_009597328.1|  PREDICTED: reticulon-like protein B5               278   1e-89   Nicotiana tomentosiformis
ref|XP_010658515.1|  PREDICTED: reticulon-like protein B2               276   2e-89   Vitis vinifera
ref|XP_006339640.1|  PREDICTED: reticulon-like protein B1-like          276   8e-89   Solanum tuberosum [potatoes]
ref|XP_009766982.1|  PREDICTED: reticulon-like protein B5               275   1e-88   Nicotiana sylvestris
gb|KDP25363.1|  hypothetical protein JCGZ_20519                         275   2e-88   Jatropha curcas
ref|XP_004229935.1|  PREDICTED: reticulon-like protein B1               274   4e-88   
ref|XP_008796064.1|  PREDICTED: reticulon-like protein B2               273   6e-88   Phoenix dactylifera
ref|XP_009763462.1|  PREDICTED: reticulon-like protein B1 isoform X2    273   1e-87   Nicotiana sylvestris
gb|AFK41983.1|  unknown                                                 271   2e-87   Medicago truncatula
ref|XP_010915765.1|  PREDICTED: reticulon-like protein B2               272   2e-87   Elaeis guineensis
ref|XP_003633964.1|  PREDICTED: reticulon-like protein B1               271   2e-87   Vitis vinifera
ref|XP_008805646.1|  PREDICTED: reticulon-like protein B3               271   2e-87   Phoenix dactylifera
ref|XP_007160119.1|  hypothetical protein PHAVU_002G294100g             271   4e-87   Phaseolus vulgaris [French bean]
ref|NP_001239711.1|  uncharacterized protein LOC100811024               270   6e-87   Glycine max [soybeans]
gb|ACJ84486.1|  unknown                                                 270   8e-87   Medicago truncatula
ref|XP_003525365.1|  PREDICTED: reticulon-like protein B2-like is...    270   1e-86   Glycine max [soybeans]
gb|ACU23452.1|  unknown                                                 270   1e-86   Glycine max [soybeans]
ref|XP_010055800.1|  PREDICTED: reticulon-like protein B1               270   1e-86   Eucalyptus grandis [rose gum]
ref|XP_006439447.1|  hypothetical protein CICLE_v10021801mg             270   1e-86   Citrus clementina [clementine]
ref|XP_011026963.1|  PREDICTED: reticulon-like protein B2               270   2e-86   Populus euphratica
ref|XP_008792381.1|  PREDICTED: reticulon-like protein B2 isoform X2    269   2e-86   
gb|KCW72347.1|  hypothetical protein EUGRSUZ_E00805                     270   2e-86   Eucalyptus grandis [rose gum]
gb|KCW72348.1|  hypothetical protein EUGRSUZ_E00805                     270   3e-86   Eucalyptus grandis [rose gum]
ref|XP_010925814.1|  PREDICTED: reticulon-like protein B2               268   4e-86   Elaeis guineensis
ref|XP_006476478.1|  PREDICTED: reticulon-like protein B2-like          268   5e-86   Citrus sinensis [apfelsine]
ref|XP_009626480.1|  PREDICTED: reticulon-like protein B2 isoform X1    268   6e-86   Nicotiana tomentosiformis
ref|XP_010924771.1|  PREDICTED: reticulon-like protein B2               267   1e-85   Elaeis guineensis
ref|XP_009765582.1|  PREDICTED: reticulon-like protein B2               267   1e-85   Nicotiana sylvestris
ref|XP_009603968.1|  PREDICTED: reticulon-like protein B1               267   2e-85   Nicotiana tomentosiformis
ref|XP_009763461.1|  PREDICTED: reticulon-like protein B6 isoform X1    267   2e-85   Nicotiana sylvestris
ref|XP_008810936.1|  PREDICTED: reticulon-like protein B5               266   3e-85   Phoenix dactylifera
ref|XP_011093062.1|  PREDICTED: reticulon-like protein B1               265   6e-85   Sesamum indicum [beniseed]
ref|XP_007038874.1|  VIRB2-interacting protein 2                        264   2e-84   Theobroma cacao [chocolate]
ref|XP_002299504.1|  reticulon family protein                           263   5e-84   Populus trichocarpa [western balsam poplar]
ref|XP_004503660.1|  PREDICTED: reticulon-like protein B2-like          263   6e-84   Cicer arietinum [garbanzo]
gb|AEZ00899.1|  putative 24 kDa seed maturation protein                 263   7e-84   Elaeis guineensis
gb|KJB52210.1|  hypothetical protein B456_008G250900                    262   1e-83   Gossypium raimondii
ref|XP_006358652.1|  PREDICTED: reticulon-like protein B1-like          261   3e-83   Solanum tuberosum [potatoes]
ref|XP_010053196.1|  PREDICTED: reticulon-like protein B1               261   4e-83   Eucalyptus grandis [rose gum]
ref|XP_010676393.1|  PREDICTED: reticulon-like protein B2               260   5e-83   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG04885.1|  Reticulon-like protein B5                               260   5e-83   Gossypium arboreum [tree cotton]
ref|XP_004234204.1|  PREDICTED: reticulon-like protein B2               260   9e-83   Solanum lycopersicum
ref|XP_004248066.1|  PREDICTED: reticulon-like protein B1               259   1e-82   Solanum lycopersicum
gb|EYU19605.1|  hypothetical protein MIMGU_mgv1a012182mg                259   2e-82   Erythranthe guttata [common monkey flower]
gb|KJB24634.1|  hypothetical protein B456_004G154600                    259   2e-82   Gossypium raimondii
ref|XP_010916969.1|  PREDICTED: reticulon-like protein B3               261   3e-82   Elaeis guineensis
gb|ABC01908.1|  putative 24 kDa seed maturation protein-like protein    258   3e-82   Solanum tuberosum [potatoes]
gb|KJB06451.1|  hypothetical protein B456_001G157900                    258   3e-82   Gossypium raimondii
ref|XP_010545343.1|  PREDICTED: reticulon-like protein B3               258   4e-82   Tarenaya hassleriana [spider flower]
ref|XP_003528823.2|  PREDICTED: reticulon-like protein B1-like          260   4e-82   Glycine max [soybeans]
ref|XP_006645662.1|  PREDICTED: reticulon-like protein B1-like          257   7e-82   Oryza brachyantha
gb|KJB19087.1|  hypothetical protein B456_003G084400                    257   8e-82   Gossypium raimondii
gb|KDO56851.1|  hypothetical protein CISIN_1g023137mg                   257   1e-81   Citrus sinensis [apfelsine]
ref|XP_006422079.1|  hypothetical protein CICLE_v10005564mg             257   1e-81   Citrus clementina [clementine]
ref|NP_001149653.1|  LOC100283279                                       256   2e-81   Zea mays [maize]
ref|XP_007051689.1|  Reticulon family protein                           256   2e-81   
gb|KHG29253.1|  Reticulon-like protein B5                               256   2e-81   Gossypium arboreum [tree cotton]
gb|KHG15548.1|  Reticulon-like protein B3                               256   3e-81   Gossypium arboreum [tree cotton]
gb|EAY73097.1|  hypothetical protein OsI_00974                          257   3e-81   Oryza sativa Indica Group [Indian rice]
ref|NP_001150474.1|  seed maturation protein                            257   4e-81   
ref|XP_010533622.1|  PREDICTED: reticulon-like protein B4               256   5e-81   Tarenaya hassleriana [spider flower]
tpg|DAA52789.1|  TPA: seed maturation protein                           256   5e-81   
ref|XP_003565836.1|  PREDICTED: reticulon-like protein B1               256   6e-81   Brachypodium distachyon [annual false brome]
gb|KHG09260.1|  Reticulon-like protein B3                               255   7e-81   Gossypium arboreum [tree cotton]
ref|XP_009388111.1|  PREDICTED: reticulon-like protein B1               255   9e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011022600.1|  PREDICTED: reticulon-like protein B1               254   1e-80   Populus euphratica
ref|XP_006288443.1|  hypothetical protein CARUB_v10001704mg             255   1e-80   Capsella rubella
ref|XP_010541290.1|  PREDICTED: reticulon-like protein B1               255   1e-80   Tarenaya hassleriana [spider flower]
emb|CDP08746.1|  unnamed protein product                                254   1e-80   Coffea canephora [robusta coffee]
ref|XP_008437352.1|  PREDICTED: reticulon-like protein B2               254   1e-80   Cucumis melo [Oriental melon]
ref|XP_002511930.1|  conserved hypothetical protein                     254   2e-80   Ricinus communis
ref|XP_002303615.1|  reticulon family protein                           254   2e-80   Populus trichocarpa [western balsam poplar]
ref|XP_009415169.1|  PREDICTED: reticulon-like protein B2               254   2e-80   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAB32723.1|  unknown protein                                        254   2e-80   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010529625.1|  PREDICTED: reticulon-like protein B1               254   2e-80   Tarenaya hassleriana [spider flower]
gb|KHG20258.1|  Reticulon-like protein B3                               253   4e-80   Gossypium arboreum [tree cotton]
ref|XP_006366650.1|  PREDICTED: putative 24 kDa seed maturation p...    258   4e-80   
ref|XP_008655792.1|  PREDICTED: reticulon-like protein B1               254   4e-80   
gb|KDP28552.1|  hypothetical protein JCGZ_14323                         253   4e-80   Jatropha curcas
ref|XP_008792378.1|  PREDICTED: reticulon-like protein B3 isoform X1    253   6e-80   
ref|NP_001056102.1|  Os05g0526400                                       253   6e-80   
ref|XP_004143883.1|  PREDICTED: reticulon-like protein B2-like          252   8e-80   Cucumis sativus [cucumbers]
ref|XP_004969875.1|  PREDICTED: reticulon-like protein B1-like          252   8e-80   Setaria italica
ref|XP_009416410.1|  PREDICTED: reticulon-like protein B2               252   1e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002874678.1|  VIRB2-interacting protein 2                        253   1e-79   Arabidopsis lyrata subsp. lyrata
ref|XP_008234814.1|  PREDICTED: reticulon-like protein B1               252   1e-79   Prunus mume [ume]
ref|XP_010261408.1|  PREDICTED: reticulon-like protein B2               251   1e-79   Nelumbo nucifera [Indian lotus]
ref|XP_004967455.1|  PREDICTED: reticulon-like protein B1-like          252   2e-79   Setaria italica
gb|EYU23406.1|  hypothetical protein MIMGU_mgv1a012325mg                251   2e-79   Erythranthe guttata [common monkey flower]
gb|EMS62606.1|  Reticulon-like protein B1                               251   3e-79   Triticum urartu
ref|XP_011073407.1|  PREDICTED: reticulon-like protein B2 isoform X1    251   3e-79   Sesamum indicum [beniseed]
ref|XP_006360189.1|  PREDICTED: reticulon-like protein B2-like          251   3e-79   Solanum tuberosum [potatoes]
ref|XP_008232963.1|  PREDICTED: reticulon-like protein B6               250   4e-79   Prunus mume [ume]
gb|EMT19773.1|  Reticulon-like protein B1                               251   5e-79   
ref|XP_009772131.1|  PREDICTED: reticulon-like protein B2               250   6e-79   Nicotiana sylvestris
ref|XP_006847055.1|  hypothetical protein AMTR_s00017p00194840          251   6e-79   
ref|XP_006374289.1|  hypothetical protein POPTR_0015s05710g             249   8e-79   
ref|XP_006374290.1|  hypothetical protein POPTR_0015s05710g             250   8e-79   
emb|CDJ26559.1|  unnamed protein product                                251   9e-79   Triticum aestivum [Canadian hard winter wheat]
emb|CDP05124.1|  unnamed protein product                                249   9e-79   Coffea canephora [robusta coffee]
ref|XP_010092876.1|  Reticulon-like protein                             249   1e-78   Morus notabilis
ref|XP_009134231.1|  PREDICTED: reticulon-like protein B2               249   1e-78   Brassica rapa
ref|XP_004240710.1|  PREDICTED: reticulon-like protein B6               249   1e-78   Solanum lycopersicum
ref|XP_008376662.1|  PREDICTED: reticulon-like protein B1               249   1e-78   Malus domestica [apple tree]
ref|XP_010422067.1|  PREDICTED: reticulon-like protein B2               249   2e-78   Camelina sativa [gold-of-pleasure]
ref|XP_009406786.1|  PREDICTED: reticulon-like protein B1 isoform X2    249   2e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007218819.1|  hypothetical protein PRUPE_ppa010065mg             249   2e-78   Prunus persica
ref|XP_010455527.1|  PREDICTED: reticulon-like protein B2               248   3e-78   Camelina sativa [gold-of-pleasure]
ref|XP_010544774.1|  PREDICTED: reticulon-like protein B6               248   4e-78   Tarenaya hassleriana [spider flower]
ref|XP_010669728.1|  PREDICTED: reticulon-like protein B4               249   4e-78   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009368711.1|  PREDICTED: reticulon-like protein B1               248   5e-78   Pyrus x bretschneideri [bai li]
gb|EAY75742.1|  hypothetical protein OsI_03655                          248   5e-78   Oryza sativa Indica Group [Indian rice]
gb|KHN15986.1|  Reticulon-like protein B5                               247   7e-78   Glycine soja [wild soybean]
ref|NP_001241367.1|  uncharacterized protein LOC100796111               247   1e-77   Glycine max [soybeans]
gb|EAZ13460.1|  hypothetical protein OsJ_03377                          246   1e-77   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010435260.1|  PREDICTED: reticulon-like protein B2               247   1e-77   Camelina sativa [gold-of-pleasure]
ref|XP_009380544.1|  PREDICTED: reticulon-like protein B2               246   1e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003568063.1|  PREDICTED: reticulon-like protein B1               246   2e-77   Brachypodium distachyon [annual false brome]
ref|NP_001044177.1|  Os01g0736900                                       246   2e-77   
ref|XP_011080892.1|  PREDICTED: reticulon-like protein B2               246   2e-77   Sesamum indicum [beniseed]
gb|EMT18983.1|  Reticulon-like protein B1                               245   2e-77   
ref|XP_008354289.1|  PREDICTED: reticulon-like protein B1               246   3e-77   
ref|XP_007218268.1|  hypothetical protein PRUPE_ppa008259mg             248   3e-77   
gb|EAY98759.1|  hypothetical protein OsI_20691                          245   4e-77   Oryza sativa Indica Group [Indian rice]
ref|XP_006644671.1|  PREDICTED: reticulon-like protein B1-like          245   4e-77   Oryza brachyantha
ref|XP_011047748.1|  PREDICTED: reticulon-like protein B1               245   4e-77   Populus euphratica
ref|XP_011084470.1|  PREDICTED: reticulon-like protein B2               245   5e-77   Sesamum indicum [beniseed]
gb|ACF87936.1|  unknown                                                 243   8e-77   Zea mays [maize]
ref|XP_009375555.1|  PREDICTED: reticulon-like protein B1               245   8e-77   Pyrus x bretschneideri [bai li]
ref|XP_008343772.1|  PREDICTED: reticulon-like protein B1               244   9e-77   Malus domestica [apple tree]
dbj|BAJ89699.1|  predicted protein                                      244   9e-77   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_192861.1|  reticulon-like protein B2                             245   1e-76   Arabidopsis thaliana [mouse-ear cress]
gb|EYU25170.1|  hypothetical protein MIMGU_mgv1a012274mg                244   1e-76   Erythranthe guttata [common monkey flower]
ref|XP_002320163.1|  reticulon family protein                           244   1e-76   Populus trichocarpa [western balsam poplar]
gb|ABK94480.1|  unknown                                                 244   2e-76   Populus trichocarpa [western balsam poplar]
gb|EYU32181.1|  hypothetical protein MIMGU_mgv1a012219mg                244   2e-76   Erythranthe guttata [common monkey flower]
gb|KJB24285.1|  hypothetical protein B456_004G137000                    243   2e-76   Gossypium raimondii
ref|XP_006654676.1|  PREDICTED: reticulon-like protein B1-like          243   2e-76   Oryza brachyantha
ref|NP_001130478.1|  Seed maturation protein                            243   2e-76   Zea mays [maize]
gb|KDO86331.1|  hypothetical protein CISIN_1g025719mg                   243   2e-76   Citrus sinensis [apfelsine]
ref|XP_009406784.1|  PREDICTED: reticulon-like protein B1 isoform X1    243   3e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010035177.1|  PREDICTED: reticulon-like protein B1               243   5e-76   Eucalyptus grandis [rose gum]
gb|KFK31901.1|  hypothetical protein AALP_AA6G173800                    242   7e-76   Arabis alpina [alpine rockcress]
ref|XP_006444935.1|  hypothetical protein CICLE_v10021860mg             242   7e-76   Citrus clementina [clementine]
ref|XP_004149448.1|  PREDICTED: reticulon-like protein B1-like          242   8e-76   Cucumis sativus [cucumbers]
gb|KJB06453.1|  hypothetical protein B456_001G157900                    243   1e-75   Gossypium raimondii
ref|NP_194094.1|  VIRB2-interacting protein 1                           241   3e-75   Arabidopsis thaliana [mouse-ear cress]
gb|ABR17571.1|  unknown                                                 240   4e-75   Picea sitchensis
ref|XP_010433883.1|  PREDICTED: reticulon-like protein B1               241   6e-75   Camelina sativa [gold-of-pleasure]
ref|XP_002869770.1|  VIRB2-interacting protein 1                        240   6e-75   Arabidopsis lyrata subsp. lyrata
gb|KDO56850.1|  hypothetical protein CISIN_1g023137mg                   240   1e-74   Citrus sinensis [apfelsine]
ref|XP_006422078.1|  hypothetical protein CICLE_v10005564mg             240   1e-74   
ref|XP_010439152.1|  PREDICTED: reticulon-like protein B1 isoform X1    239   1e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010509305.1|  PREDICTED: reticulon-like protein B1               239   1e-74   Camelina sativa [gold-of-pleasure]
gb|ACN40158.1|  unknown                                                 239   1e-74   Picea sitchensis
gb|KJB24288.1|  hypothetical protein B456_004G137000                    238   2e-74   Gossypium raimondii
gb|KHN29299.1|  Reticulon-like protein B5                               238   2e-74   Glycine soja [wild soybean]
ref|XP_006284300.1|  hypothetical protein CARUB_v10005469mg             238   4e-74   
ref|XP_010112604.1|  Reticulon-like protein                             237   5e-74   Morus notabilis
ref|XP_008375931.1|  PREDICTED: reticulon-like protein B1               237   6e-74   Malus domestica [apple tree]
emb|CDY57657.1|  BnaC01g15350D                                          238   7e-74   Brassica napus [oilseed rape]
ref|XP_002870630.1|  VIRB2-interacting protein 3                        237   8e-74   
ref|NP_001042463.1|  Os01g0226300                                       234   8e-74   
gb|EMS62854.1|  Reticulon-like protein B1                               236   9e-74   Triticum urartu
gb|KHN40449.1|  Reticulon-like protein B5                               237   1e-73   Glycine soja [wild soybean]
ref|NP_001240231.1|  uncharacterized protein LOC100778096               236   1e-73   Glycine max [soybeans]
ref|XP_006396933.1|  hypothetical protein EUTSA_v10028886mg             236   1e-73   Eutrema salsugineum [saltwater cress]
ref|XP_009341126.1|  PREDICTED: reticulon-like protein B1               236   1e-73   Pyrus x bretschneideri [bai li]
ref|XP_008344578.1|  PREDICTED: reticulon-like protein B1               236   2e-73   
emb|CDY10954.1|  BnaA03g46130D                                          237   2e-73   Brassica napus [oilseed rape]
ref|XP_009338786.1|  PREDICTED: reticulon-like protein B1               236   2e-73   Pyrus x bretschneideri [bai li]
gb|KDP22201.1|  hypothetical protein JCGZ_26032                         235   2e-73   Jatropha curcas
dbj|BAJ98297.1|  predicted protein                                      236   3e-73   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004298843.1|  PREDICTED: reticulon-like protein B2               235   3e-73   Fragaria vesca subsp. vesca
emb|CDY44123.1|  BnaA01g13310D                                          236   3e-73   Brassica napus [oilseed rape]
ref|NP_001239653.1|  uncharacterized protein LOC100793862               236   3e-73   Glycine max [soybeans]
ref|XP_010538815.1|  PREDICTED: reticulon-like protein B1               236   3e-73   Tarenaya hassleriana [spider flower]
ref|XP_009345612.1|  PREDICTED: reticulon-like protein B1               235   4e-73   Pyrus x bretschneideri [bai li]
ref|XP_009137263.1|  PREDICTED: reticulon-like protein B1               236   4e-73   Brassica rapa
ref|XP_009137373.1|  PREDICTED: reticulon-like protein B1               236   4e-73   Brassica rapa
ref|NP_198975.1|  reticulon-like protein B4                             234   8e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007139767.1|  hypothetical protein PHAVU_008G057300g             234   8e-73   Phaseolus vulgaris [French bean]
ref|XP_004306726.1|  PREDICTED: reticulon-like protein B5               234   1e-72   Fragaria vesca subsp. vesca
emb|CDY05135.1|  BnaC03g29330D                                          236   1e-72   
ref|XP_006413535.1|  hypothetical protein EUTSA_v10025959mg             234   1e-72   Eutrema salsugineum [saltwater cress]
emb|CDY25557.1|  BnaC09g11820D                                          234   1e-72   Brassica napus [oilseed rape]
ref|XP_003569752.1|  PREDICTED: reticulon-like protein B1               233   2e-72   Brachypodium distachyon [annual false brome]
ref|XP_011003673.1|  PREDICTED: reticulon-like protein B1               233   3e-72   Populus euphratica
dbj|BAH57206.1|  AT1G64090                                              232   3e-72   Arabidopsis thaliana [mouse-ear cress]
emb|CDX90792.1|  BnaA03g24720D                                          233   3e-72   
ref|XP_006391670.1|  hypothetical protein EUTSA_v10023649mg             233   3e-72   Eutrema salsugineum [saltwater cress]
gb|KFK37395.1|  hypothetical protein AALP_AA4G251600                    233   3e-72   Arabis alpina [alpine rockcress]
dbj|BAJ33905.1|  unnamed protein product                                233   4e-72   Eutrema halophilum
ref|XP_010418453.1|  PREDICTED: reticulon-like protein B3               233   4e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010518282.1|  PREDICTED: reticulon-like protein B5               233   4e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010430525.1|  PREDICTED: reticulon-like protein B3               233   4e-72   Camelina sativa [gold-of-pleasure]
ref|NP_176592.1|  reticulon-like protein B3                             233   5e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010473658.1|  PREDICTED: reticulon-like protein B3 isoform X3    233   5e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010506615.1|  PREDICTED: reticulon-like protein B5               232   5e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010508058.1|  PREDICTED: reticulon-like protein B5               232   5e-72   Camelina sativa [gold-of-pleasure]
emb|CDY41666.1|  BnaC03g62180D                                          233   7e-72   Brassica napus [oilseed rape]
emb|CDY24806.1|  BnaA08g15040D                                          233   7e-72   Brassica napus [oilseed rape]
ref|XP_008377768.1|  PREDICTED: reticulon-like protein B2               232   1e-71   Malus domestica [apple tree]
ref|XP_006294850.1|  hypothetical protein CARUB_v10023902mg             231   1e-71   Capsella rubella
ref|XP_007040378.1|  Reticulan like protein B3, putative isoform 3      232   1e-71   
ref|XP_006397801.1|  hypothetical protein EUTSA_v10001599mg             231   1e-71   Eutrema salsugineum [saltwater cress]
emb|CDM81762.1|  unnamed protein product                                231   2e-71   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008367699.1|  PREDICTED: reticulon-like protein B2               231   3e-71   Malus domestica [apple tree]
ref|XP_002887921.1|  reticulon family protein                           230   3e-71   Arabidopsis lyrata subsp. lyrata
ref|XP_004965478.1|  PREDICTED: reticulon-like protein B2-like          231   3e-71   Setaria italica
ref|XP_007040377.1|  Reticulan like protein B3, putative isoform 2      231   3e-71   
ref|XP_009334492.1|  PREDICTED: reticulon-like protein B2               230   3e-71   Pyrus x bretschneideri [bai li]
ref|XP_007209494.1|  hypothetical protein PRUPE_ppa010244mg             230   4e-71   Prunus persica
emb|CDY34396.1|  BnaA09g11380D                                          230   4e-71   Brassica napus [oilseed rape]
ref|XP_009142682.1|  PREDICTED: reticulon-like protein B5               230   4e-71   Brassica rapa
ref|XP_002301382.1|  hypothetical protein POPTR_0002s16690g             229   5e-71   Populus trichocarpa [western balsam poplar]
gb|AFK42059.1|  unknown                                                 230   5e-71   Lotus japonicus
ref|XP_010447719.1|  PREDICTED: reticulon-like protein B4               229   8e-71   Camelina sativa [gold-of-pleasure]
ref|XP_009349323.1|  PREDICTED: reticulon-like protein B1               229   1e-70   Pyrus x bretschneideri [bai li]
emb|CDY38194.1|  BnaA09g11950D                                          228   1e-70   Brassica napus [oilseed rape]
emb|CDY42012.1|  BnaC04g00900D                                          228   2e-70   Brassica napus [oilseed rape]
ref|XP_009395750.1|  PREDICTED: reticulon-like protein B2               228   2e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006284372.1|  hypothetical protein CARUB_v10005543mg             228   2e-70   Capsella rubella
ref|NP_001185307.1|  reticulon-like protein B3                          228   3e-70   Arabidopsis thaliana [mouse-ear cress]
gb|KFK40472.1|  hypothetical protein AALP_AA2G000200                    228   3e-70   Arabis alpina [alpine rockcress]
ref|XP_009112901.1|  PREDICTED: reticulon-like protein B3               228   3e-70   Brassica rapa
ref|XP_006302727.1|  hypothetical protein CARUB_v10020840mg             228   4e-70   Capsella rubella
ref|XP_010671578.1|  PREDICTED: reticulon-like protein B4               228   4e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002880222.1|  reticulon family protein                           227   4e-70   Arabidopsis lyrata subsp. lyrata
ref|XP_006656127.1|  PREDICTED: reticulon-like protein B2-like          228   5e-70   Oryza brachyantha
gb|ACG32549.1|  seed maturation protein                                 227   5e-70   Zea mays [maize]
ref|NP_001046501.1|  Os02g0265900                                       226   9e-70   
ref|XP_004308034.1|  PREDICTED: reticulon-like protein B2               227   1e-69   Fragaria vesca subsp. vesca
ref|XP_010441324.1|  PREDICTED: reticulon-like protein B4               226   1e-69   Camelina sativa [gold-of-pleasure]
emb|CDY52012.1|  BnaC06g42920D                                          226   1e-69   Brassica napus [oilseed rape]
ref|XP_010436110.1|  PREDICTED: reticulon-like protein B4               226   1e-69   Camelina sativa [gold-of-pleasure]
ref|XP_002441411.1|  hypothetical protein SORBIDRAFT_09g026210          226   1e-69   Sorghum bicolor [broomcorn]
ref|NP_001057713.1|  Os06g0503400                                       226   1e-69   
ref|XP_009104316.1|  PREDICTED: reticulon-like protein B6               225   3e-69   Brassica rapa
gb|EPS71452.1|  hypothetical protein M569_03311                         225   3e-69   Genlisea aurea
gb|ABB51093.1|  reticulon                                               223   3e-69   Hordeum vulgare [barley]
gb|EAY85291.1|  hypothetical protein OsI_06662                          224   3e-69   Oryza sativa Indica Group [Indian rice]
ref|NP_566065.1|  reticulon-like protein B5                             225   3e-69   Arabidopsis thaliana [mouse-ear cress]
gb|KFK33000.1|  hypothetical protein AALP_AA6G316900                    225   3e-69   Arabis alpina [alpine rockcress]
ref|XP_007135152.1|  hypothetical protein PHAVU_010G105400g             225   3e-69   Phaseolus vulgaris [French bean]
ref|XP_006647139.1|  PREDICTED: reticulon-like protein B2-like          224   4e-69   Oryza brachyantha
ref|XP_009112802.1|  PREDICTED: reticulon-like protein B3               224   4e-69   Brassica rapa
ref|XP_011037168.1|  PREDICTED: reticulon-like protein B5               224   5e-69   Populus euphratica
emb|CDY08353.1|  BnaC09g12430D                                          224   6e-69   Brassica napus [oilseed rape]
gb|AFK34557.1|  unknown                                                 224   1e-68   Medicago truncatula
ref|XP_004133840.1|  PREDICTED: reticulon-like protein B5-like          224   1e-68   Cucumis sativus [cucumbers]
ref|NP_001130268.1|  uncharacterized protein LOC100191362               223   1e-68   Zea mays [maize]
ref|XP_002438444.1|  hypothetical protein SORBIDRAFT_10g019720          224   1e-68   Sorghum bicolor [broomcorn]
gb|ACG36034.1|  reticulon                                               223   2e-68   Zea mays [maize]
ref|XP_008437980.1|  PREDICTED: reticulon-like protein B5               223   3e-68   Cucumis melo [Oriental melon]
ref|NP_001130603.1|  uncharacterized protein LOC100191702               222   3e-68   Zea mays [maize]
gb|EMT25698.1|  Reticulon-like protein B2                               223   3e-68   
ref|XP_006402470.1|  hypothetical protein EUTSA_v10006190mg             222   3e-68   Eutrema salsugineum [saltwater cress]
dbj|BAJ94514.1|  predicted protein                                      222   4e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011023265.1|  PREDICTED: reticulon-like protein B5               222   4e-68   Populus euphratica
ref|XP_004510697.1|  PREDICTED: reticulon-like protein B1-like          222   5e-68   Cicer arietinum [garbanzo]
gb|KCW72350.1|  hypothetical protein EUGRSUZ_E00805                     221   6e-68   Eucalyptus grandis [rose gum]
ref|XP_009109295.1|  PREDICTED: reticulon-like protein B1               222   6e-68   Brassica rapa
gb|EPS73616.1|  hypothetical protein M569_01145                         221   1e-67   Genlisea aurea
gb|EMT06999.1|  Reticulon-like protein B1                               221   2e-67   
ref|XP_004961431.1|  PREDICTED: reticulon-like protein B1-like          220   3e-67   Setaria italica
ref|NP_001130091.1|  uncharacterized protein LOC100191184               220   4e-67   Zea mays [maize]
ref|XP_010523772.1|  PREDICTED: reticulon-like protein B5               220   4e-67   Tarenaya hassleriana [spider flower]
ref|XP_008458672.1|  PREDICTED: reticulon-like protein B2               220   4e-67   Cucumis melo [Oriental melon]
ref|XP_010105716.1|  Reticulon-like protein                             220   4e-67   
ref|XP_006291739.1|  hypothetical protein CARUB_v10017909mg             218   1e-66   Capsella rubella
gb|ABK22748.1|  unknown                                                 218   2e-66   
ref|XP_004159803.1|  PREDICTED: reticulon-like protein B2-like          218   2e-66   
gb|AFW77088.1|  hypothetical protein ZEAMMB73_846644                    216   3e-66   
gb|EMS50148.1|  Reticulon-like protein B2                               217   3e-66   
ref|XP_010469092.1|  PREDICTED: reticulon-like protein B6               217   4e-66   
ref|XP_010413382.1|  PREDICTED: reticulon-like protein B6               217   4e-66   
ref|XP_003563831.1|  PREDICTED: reticulon-like protein B1               217   7e-66   
ref|NP_191715.2|  reticulon-like protein B6                             216   1e-65   
ref|XP_002876621.1|  reticulon family protein                           215   2e-65   
ref|XP_007040376.1|  Reticulan like protein B3, putative isoform 1      216   3e-65   
ref|XP_008788043.1|  PREDICTED: reticulon-like protein B5               214   3e-65   
ref|XP_009419823.1|  PREDICTED: reticulon-like protein B2               214   6e-65   
ref|XP_008239009.1|  PREDICTED: reticulon-like protein B2               213   1e-64   
ref|XP_003572248.1|  PREDICTED: reticulon-like protein B2               213   1e-64   
ref|XP_003592173.1|  Reticulon family protein                           213   1e-64   
ref|XP_004951242.1|  PREDICTED: reticulon-like protein B2-like          212   2e-64   
ref|XP_010512508.1|  PREDICTED: reticulon-like protein B6               213   2e-64   
gb|KJB52679.1|  hypothetical protein B456_008G272900                    211   5e-64   
ref|XP_006842617.1|  hypothetical protein AMTR_s00077p00178230          212   5e-64   
ref|XP_002317731.1|  hypothetical protein POPTR_0012s00980g             211   6e-64   
ref|XP_010938076.1|  PREDICTED: reticulon-like protein B1               211   6e-64   
gb|EEE65781.1|  hypothetical protein OsJ_21474                          224   8e-64   
gb|ABK23818.1|  unknown                                                 205   1e-62   
ref|XP_004496510.1|  PREDICTED: reticulon-like protein B1-like          208   1e-62   
ref|XP_002275520.1|  PREDICTED: reticulon-like protein B5               207   2e-62   
ref|XP_009399837.1|  PREDICTED: reticulon-like protein B5               207   2e-62   
ref|XP_010931411.1|  PREDICTED: reticulon-like protein B6               207   3e-62   
gb|KHN21799.1|  Reticulon-like protein B1                               206   7e-62   
ref|XP_006589518.1|  PREDICTED: reticulon-like protein B1-like          206   9e-62   
ref|XP_010921231.1|  PREDICTED: reticulon-like protein B1 isoform X1    205   2e-61   
ref|XP_008793405.1|  PREDICTED: reticulon-like protein B1               205   2e-61   
ref|XP_007143486.1|  hypothetical protein PHAVU_007G075900g             202   1e-60   
ref|XP_010278922.1|  PREDICTED: reticulon-like protein B5               202   2e-60   
gb|KHN12926.1|  Reticulon-like protein B1                               202   3e-60   
ref|XP_003555396.1|  PREDICTED: reticulon-like protein B1-like          202   3e-60   
gb|EMS49910.1|  Reticulon-like protein B3                               204   3e-60   
ref|XP_009404680.1|  PREDICTED: reticulon-like protein B2               200   1e-59   
gb|EPS64109.1|  hypothetical protein M569_10676                         200   2e-59   
gb|ABK26525.1|  unknown                                                 200   2e-59   
gb|EPS69502.1|  hypothetical protein M569_05265                         197   1e-58   
ref|XP_009400146.1|  PREDICTED: reticulon-like protein B1               197   2e-58   
ref|XP_009787619.1|  PREDICTED: reticulon-like protein B5               197   2e-58   
gb|EEC80692.1|  hypothetical protein OsI_23118                          209   3e-58   
ref|XP_004247011.1|  PREDICTED: reticulon-like protein B5               196   8e-58   
gb|KCW46475.1|  hypothetical protein EUGRSUZ_K00300                     192   1e-57   
ref|XP_006654252.1|  PREDICTED: reticulon-like protein B1-like          194   3e-57   
ref|XP_009621222.1|  PREDICTED: reticulon-like protein B5               194   4e-57   
dbj|BAH20346.1|  AT4G11220                                              189   9e-57   
gb|EAY97489.1|  hypothetical protein OsI_19418                          192   1e-56   
ref|XP_009783850.1|  PREDICTED: reticulon-like protein B8               192   2e-56   
ref|NP_001055164.1|  Os05g0312500                                       191   3e-56   
ref|XP_009601019.1|  PREDICTED: reticulon-like protein B8               191   4e-56   
ref|XP_004962474.1|  PREDICTED: reticulon-like protein B1-like          191   5e-56   
ref|NP_001149072.1|  LOC100282693                                       190   1e-55   
gb|KJB39437.1|  hypothetical protein B456_007G013600                    189   2e-55   
ref|XP_008647873.1|  PREDICTED: LOC100282693 isoform X1                 189   2e-55   
ref|XP_009631245.1|  PREDICTED: reticulon-like protein B2 isoform X2    189   2e-55   
ref|XP_009631244.1|  PREDICTED: reticulon-like protein B2 isoform X1    189   2e-55   
ref|XP_009793495.1|  PREDICTED: reticulon-like protein B2               189   2e-55   
dbj|BAK06264.1|  predicted protein                                      189   3e-55   
gb|EPS67049.1|  hypothetical protein M569_07727                         187   6e-55   
ref|NP_001150935.1|  seed maturation protein                            187   2e-54   
gb|EYU36885.1|  hypothetical protein MIMGU_mgv1a013116mg                186   2e-54   
ref|XP_004161550.1|  PREDICTED: reticulon-like protein B8-like          186   7e-54   
ref|XP_010904667.1|  PREDICTED: reticulon-like protein B8               185   7e-54   
ref|XP_010054120.1|  PREDICTED: reticulon-like protein B8 isoform X2    185   9e-54   
ref|XP_010323110.1|  PREDICTED: reticulon-like protein B2               183   1e-53   
ref|XP_002521590.1|  conserved hypothetical protein                     184   1e-53   
ref|XP_003568686.1|  PREDICTED: reticulon-like protein B1               184   2e-53   
gb|KCW89791.1|  hypothetical protein EUGRSUZ_A02040                     185   2e-53   
ref|XP_006836413.1|  hypothetical protein AMTR_s00092p00151450          184   3e-53   
ref|XP_004499535.1|  PREDICTED: reticulon-like protein B8-like is...    184   3e-53   
ref|XP_006366828.1|  PREDICTED: reticulon-like protein B2-like          184   6e-53   
ref|XP_002302126.2|  reticulon family protein                           183   6e-53   
ref|XP_011026205.1|  PREDICTED: reticulon-like protein B8               182   9e-53   
gb|EMS52545.1|  Reticulon-like protein B1                               183   9e-53   
ref|XP_008451843.1|  PREDICTED: reticulon-like protein B8 isoform X2    182   1e-52   
ref|XP_006437080.1|  hypothetical protein CICLE_v10032550mg             182   1e-52   
ref|XP_006339395.1|  PREDICTED: reticulon-like protein B5-like          182   2e-52   
ref|XP_007048924.1|  Reticulon family protein                           182   2e-52   
ref|XP_008451841.1|  PREDICTED: reticulon-like protein B8 isoform X1    182   2e-52   
ref|XP_006485002.1|  PREDICTED: reticulon-like protein B8-like is...    181   3e-52   
ref|XP_007017116.1|  VIRB2-interacting protein 2, putative              181   4e-52   
ref|XP_010054092.1|  PREDICTED: reticulon-like protein B8 isoform X1    181   6e-52   
ref|XP_011080610.1|  PREDICTED: reticulon-like protein B5               179   8e-52   
gb|KDP36280.1|  hypothetical protein JCGZ_10290                         179   1e-51   
gb|ABC69764.1|  unknown                                                 178   1e-51   
ref|NP_566371.1|  reticulon-like protein B8                             179   1e-51   
ref|XP_002306759.1|  reticulon family protein                           179   2e-51   
ref|NP_850552.1|  reticulon-like protein B8                             179   3e-51   
gb|KCW46474.1|  hypothetical protein EUGRSUZ_K00300                     177   4e-51   
ref|XP_009777726.1|  PREDICTED: reticulon-like protein B8               178   5e-51   
ref|XP_011032749.1|  PREDICTED: reticulon-like protein B8 isoform X2    178   5e-51   
ref|XP_007215866.1|  hypothetical protein PRUPE_ppa010481mg             178   5e-51   
ref|XP_008229593.1|  PREDICTED: reticulon-like protein B8               178   6e-51   
ref|XP_011032748.1|  PREDICTED: reticulon-like protein B8 isoform X1    178   6e-51   
gb|KFK30707.1|  hypothetical protein AALP_AA6G017300                    177   1e-50   
ref|XP_010906987.1|  PREDICTED: reticulon-like protein B2               176   1e-50   
ref|XP_010247587.1|  PREDICTED: reticulon-like protein B8               177   1e-50   
gb|KCW72351.1|  hypothetical protein EUGRSUZ_E00805                     176   2e-50   
emb|CDY41331.1|  BnaA01g31880D                                          177   2e-50   
ref|XP_006407589.1|  hypothetical protein EUTSA_v10021400mg             176   2e-50   
ref|XP_009596514.1|  PREDICTED: reticulon-like protein B8               176   2e-50   
ref|XP_011467620.1|  PREDICTED: reticulon-like protein B8 isoform X2    176   3e-50   
ref|XP_008461104.1|  PREDICTED: reticulon-like protein B9               175   3e-50   
ref|XP_010486627.1|  PREDICTED: reticulon-like protein B8               176   4e-50   
gb|KDP45665.1|  hypothetical protein JCGZ_17272                         173   6e-50   
ref|XP_009123032.1|  PREDICTED: reticulon-like protein B8               175   8e-50   
ref|XP_002283026.1|  PREDICTED: reticulon-like protein B8               175   8e-50   
gb|ABK26009.1|  unknown                                                 174   1e-49   
ref|XP_010482050.1|  PREDICTED: reticulon-like protein B8               174   2e-49   
gb|KDO44767.1|  hypothetical protein CISIN_1g025770mg                   174   2e-49   
ref|XP_002463790.1|  hypothetical protein SORBIDRAFT_01g006220          173   3e-49   
emb|CDP18758.1|  unnamed protein product                                173   3e-49   
ref|XP_009146855.1|  PREDICTED: reticulon-like protein B8 isoform X2    173   4e-49   
gb|KHN11998.1|  Reticulon-like protein B8                               173   4e-49   
ref|XP_010464699.1|  PREDICTED: reticulon-like protein B8               172   5e-49   
ref|XP_009146854.1|  PREDICTED: reticulon-like protein B8 isoform X1    173   6e-49   
ref|NP_001051461.1|  Os03g0781700                                       172   6e-49   
ref|XP_004963616.1|  PREDICTED: reticulon-like protein B9-like          172   6e-49   
emb|CDY56712.1|  BnaC01g38700D                                          176   7e-49   
emb|CDY00916.1|  BnaC05g42840D                                          172   1e-48   
ref|XP_009356582.1|  PREDICTED: reticulon-like protein B8 isoform X2    172   1e-48   
ref|XP_009415631.1|  PREDICTED: reticulon-like protein B2               171   1e-48   
gb|EAY92056.1|  hypothetical protein OsI_13754                          172   1e-48   
ref|XP_011467618.1|  PREDICTED: reticulon-like protein B8 isoform X1    171   2e-48   
ref|XP_010036176.1|  PREDICTED: reticulon-like protein B8               171   2e-48   
ref|XP_010552962.1|  PREDICTED: reticulon-like protein B8               171   2e-48   
gb|EMT10142.1|  Reticulon-like protein B1                               172   2e-48   
ref|XP_010906857.1|  PREDICTED: reticulon-like protein B8 isoform X1    171   3e-48   
ref|XP_006650682.1|  PREDICTED: reticulon-like protein B8-like          171   3e-48   
ref|NP_001241930.1|  uncharacterized protein LOC100787981               171   3e-48   
ref|XP_008811812.1|  PREDICTED: reticulon-like protein B8               171   4e-48   
ref|XP_003532073.1|  PREDICTED: reticulon-like protein B8-like is...    170   4e-48   
ref|XP_008782310.1|  PREDICTED: reticulon-like protein B1               169   5e-48   
ref|XP_004137485.1|  PREDICTED: reticulon-like protein B9-like          169   6e-48   
gb|KHG28741.1|  Reticulon-like protein B8                               170   7e-48   
ref|XP_009403393.1|  PREDICTED: reticulon-like protein B8               170   8e-48   
ref|XP_006366629.1|  PREDICTED: reticulon-like protein B8-like is...    170   8e-48   
ref|XP_006351999.1|  PREDICTED: reticulon-like protein B8-like          169   1e-47   
ref|XP_004981542.1|  PREDICTED: reticulon-like protein B8-like          171   1e-47   
ref|XP_007146289.1|  hypothetical protein PHAVU_006G028000g             169   1e-47   
ref|XP_007141449.1|  hypothetical protein PHAVU_008G196600g             169   1e-47   
ref|XP_006366628.1|  PREDICTED: reticulon-like protein B8-like is...    169   1e-47   
sp|Q9M145.2|RTNLG_ARATH  RecName: Full=Reticulon-like protein B7;...    169   1e-47   
gb|ACG31942.1|  seed maturation protein                                 169   2e-47   
emb|CDY07184.1|  BnaCnng01990D                                          169   2e-47   
ref|XP_009376960.1|  PREDICTED: reticulon-like protein B8               169   2e-47   
ref|XP_009111430.1|  PREDICTED: reticulon-like protein B7 isoform X1    169   2e-47   
gb|AGT16133.1|  hypothetical protein SHCRBa_127_N06_F_30                168   2e-47   
ref|XP_011008495.1|  PREDICTED: reticulon-like protein B2               168   3e-47   
ref|XP_004251554.1|  PREDICTED: reticulon-like protein B8 isoform X2    168   3e-47   
gb|EAY98925.1|  hypothetical protein OsI_20880                          167   4e-47   
emb|CDY13240.1|  BnaC09g24160D                                          165   4e-47   
ref|XP_008380166.1|  PREDICTED: reticulon-like protein B8 isoform X4    168   4e-47   
ref|XP_006855801.1|  hypothetical protein AMTR_s00044p00221140          167   4e-47   
ref|XP_008792884.1|  PREDICTED: reticulon-like protein B6               167   5e-47   
ref|XP_008380160.1|  PREDICTED: reticulon-like protein B8 isoform X2    168   5e-47   
ref|NP_001137021.1|  seed maturation protein isoform 1                  167   5e-47   
tpg|DAA51729.1|  TPA: seed maturation protein                           167   6e-47   
ref|NP_001150885.1|  seed maturation protein                            167   6e-47   
gb|AFK34561.1|  unknown                                                 167   6e-47   
ref|XP_010926506.1|  PREDICTED: reticulon-like protein B2               167   6e-47   
gb|ACG26944.1|  seed maturation protein                                 167   6e-47   
ref|XP_010313685.1|  PREDICTED: reticulon-like protein B8 isoform X1    167   6e-47   
ref|XP_011096983.1|  PREDICTED: reticulon-like protein B9               166   7e-47   
ref|XP_010023631.1|  PREDICTED: reticulon-like protein B8 isoform X2    168   1e-46   
gb|KJB52212.1|  hypothetical protein B456_008G250900                    166   1e-46   
ref|NP_192032.1|  reticulon-like protein B7                             166   1e-46   
ref|XP_004243617.1|  PREDICTED: reticulon-like protein B8               166   2e-46   
ref|XP_011085435.1|  PREDICTED: reticulon-like protein B8               166   2e-46   
ref|XP_008342327.1|  PREDICTED: reticulon-like protein B8               166   3e-46   
ref|XP_011100485.1|  PREDICTED: reticulon-like protein B8               166   3e-46   
ref|XP_009111438.1|  PREDICTED: reticulon-like protein B7 isoform X2    166   3e-46   
ref|XP_010279360.1|  PREDICTED: reticulon-like protein B9               165   3e-46   
ref|XP_006654743.1|  PREDICTED: reticulon-like protein B9-like          164   6e-46   
ref|XP_009356580.1|  PREDICTED: reticulon-like protein B8 isoform X1    164   8e-46   
gb|KDP35031.1|  hypothetical protein JCGZ_09319                         164   1e-45   
ref|XP_003519525.1|  PREDICTED: uncharacterized LOC100500122 isof...    164   1e-45   
gb|KJB71174.1|  hypothetical protein B456_011G126300                    164   1e-45   
ref|XP_002441477.1|  hypothetical protein SORBIDRAFT_09g027580          163   1e-45   
ref|XP_002319442.2|  hypothetical protein POPTR_0013s15680g             164   1e-45   
emb|CDP04019.1|  unnamed protein product                                164   1e-45   
ref|XP_002884786.1|  reticulon family protein                           163   3e-45   
dbj|BAK05980.1|  predicted protein                                      162   3e-45   
ref|XP_002872901.1|  reticulon family protein                           163   3e-45   
ref|XP_004299572.1|  PREDICTED: reticulon-like protein B9               162   4e-45   
ref|XP_010093192.1|  Reticulon-like protein                             162   4e-45   
ref|XP_006298417.1|  hypothetical protein CARUB_v10014488mg             162   4e-45   
gb|KJB71173.1|  hypothetical protein B456_011G126300                    164   4e-45   
ref|XP_010688858.1|  PREDICTED: reticulon-like protein B8               162   4e-45   
ref|XP_006289795.1|  hypothetical protein CARUB_v10003398mg             162   7e-45   
ref|XP_009385406.1|  PREDICTED: reticulon-like protein B2 isoform X1    161   7e-45   
ref|XP_010228928.1|  PREDICTED: reticulon-like protein B8               162   7e-45   
ref|XP_010023623.1|  PREDICTED: reticulon-like protein B8 isoform X1    163   7e-45   
ref|NP_001058867.1|  Os07g0142000                                       162   8e-45   
ref|XP_007209013.1|  hypothetical protein PRUPE_ppa023407mg             161   8e-45   
gb|KHN28537.1|  Reticulon-like protein B8                               160   2e-44   
ref|XP_007139766.1|  hypothetical protein PHAVU_008G057300g             159   3e-44   
ref|XP_008380161.1|  PREDICTED: reticulon-like protein B8 isoform X3    160   3e-44   
ref|XP_008380159.1|  PREDICTED: reticulon-like protein B8 isoform X1    160   4e-44   
gb|EYU42855.1|  hypothetical protein MIMGU_mgv1a012522mg                160   5e-44   
ref|XP_009347494.1|  PREDICTED: reticulon-like protein B9               159   5e-44   
emb|CAN77759.1|  hypothetical protein VITISV_034907                     159   7e-44   
ref|XP_003565315.1|  PREDICTED: reticulon-like protein B4               158   7e-44   
ref|XP_008240229.1|  PREDICTED: reticulon-like protein B9               158   9e-44   
ref|XP_006432015.1|  hypothetical protein CICLE_v10002112mg             160   9e-44   
ref|XP_006491909.1|  PREDICTED: reticulon-like protein B5-like is...    160   1e-43   
ref|XP_010036908.1|  PREDICTED: reticulon-like protein B9               158   1e-43   
gb|KEH33647.1|  reticulon-like protein B2                               158   1e-43   
ref|XP_006602275.1|  PREDICTED: reticulon-like protein B8-like is...    158   2e-43   
ref|XP_006413534.1|  hypothetical protein EUTSA_v10025959mg             157   2e-43   
ref|XP_006396287.1|  hypothetical protein EUTSA_v10029354mg             157   3e-43   
ref|XP_006491907.1|  PREDICTED: reticulon-like protein B5-like is...    160   4e-43   
ref|XP_006491906.1|  PREDICTED: reticulon-like protein B5-like is...    160   4e-43   
ref|XP_009416749.1|  PREDICTED: reticulon-like protein B8 isoform X1    157   4e-43   
ref|XP_010456226.1|  PREDICTED: reticulon-like protein B7 isoform X1    156   8e-43   
ref|XP_008374784.1|  PREDICTED: reticulon-like protein B9               155   1e-42   
gb|KJB41425.1|  hypothetical protein B456_007G104000                    152   1e-42   
ref|XP_002527026.1|  conserved hypothetical protein                     155   1e-42   
emb|CDM83893.1|  unnamed protein product                                155   2e-42   



>ref|XP_004245560.1| PREDICTED: reticulon-like protein B4 [Solanum lycopersicum]
Length=270

 Score =   299 bits (765),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS G LGGATAIW+LFEV+EYHLLT +CHGL++ALA LFLWSNAS+F
Sbjct  82   GKPADVFLWRNKKISAGFLGGATAIWVLFEVVEYHLLTLLCHGLMIALAGLFLWSNASTF  141

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KSAPHIPEVHIPE+PVL+FASALRN++N  LAVLR+IASGRDLKMFL+VI GLW+ SI
Sbjct  142  IHKSAPHIPEVHIPEKPVLEFASALRNEINRALAVLREIASGRDLKMFLLVIGGLWLASI  201

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G CCDFLTLFYI VV+LHTVPVLYEKYED+VDAFAEKA+HELKKQYAV DAKVLSKIPR
Sbjct  202  LGGCCDFLTLFYIIVVVLHTVPVLYEKYEDQVDAFAEKALHELKKQYAVLDAKVLSKIPR  261

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  262  GPLKDKK  268



>ref|XP_006343915.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=270

 Score =   298 bits (762),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS G LGGATAIW+LFEV+EYHLLT +CHGL++ALA LFLWSNAS+F
Sbjct  82   GKPADVFLWRNKKISAGFLGGATAIWVLFEVVEYHLLTLLCHGLMVALAGLFLWSNASTF  141

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KSAPHIPEVHIPE+PVL FASALRN++N  LAVLR+IASGRDLK FL+VI GLW+ SI
Sbjct  142  IHKSAPHIPEVHIPEKPVLAFASALRNEINRALAVLREIASGRDLKTFLLVIGGLWLASI  201

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G CCDFLTLFYI VV+LHTVPVLYEKYED+VDAFAEKA+HELKKQYAVFDAKVLSKIPR
Sbjct  202  LGGCCDFLTLFYIIVVVLHTVPVLYEKYEDQVDAFAEKALHELKKQYAVFDAKVLSKIPR  261

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  262  GPLKDKK  268



>ref|XP_009793558.1| PREDICTED: reticulon-like protein B4 [Nicotiana sylvestris]
Length=268

 Score =   295 bits (756),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS G LGGATAIW+LFEV+EYH LT +CHGLI+ALA LFLWSNAS+F
Sbjct  80   GKPADVFLWRNKKISAGFLGGATAIWVLFEVVEYHFLTLLCHGLIVALAGLFLWSNASAF  139

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KSAPHIPEVHIPE+PVL+FA+ LRN++N   AVLR+IA+GRDLK FLMVI GLWI+S+
Sbjct  140  IHKSAPHIPEVHIPEKPVLEFATGLRNEINRAFAVLREIAAGRDLKTFLMVIGGLWILSV  199

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCCDFL+LFYI VV+LHTVPVLYEKYED++D+FAEKA+HELKKQYAVFDAKVLSKIPR
Sbjct  200  LGSCCDFLSLFYIIVVVLHTVPVLYEKYEDQIDSFAEKALHELKKQYAVFDAKVLSKIPR  259

Query  202  GPLKDKKLA  176
            GPL+DKK A
Sbjct  260  GPLRDKKKA  268



>ref|XP_009598008.1| PREDICTED: reticulon-like protein B2, partial [Nicotiana tomentosiformis]
Length=197

 Score =   288 bits (738),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            G  ADVFLWRNKKIS G LGGATAIW+LFEV+EYH LT +CH LI+ALA LFLWSNAS+F
Sbjct  9    GAAADVFLWRNKKISAGFLGGATAIWVLFEVVEYHFLTLLCHCLIVALAGLFLWSNASAF  68

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KSAPHIPEVHIPE+PVL+FA+ LRN++N   AVLR+IA+GRDLKMFLMVI GLWI+S+
Sbjct  69   IHKSAPHIPEVHIPEKPVLEFATGLRNEINRAFAVLREIAAGRDLKMFLMVIGGLWILSV  128

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCCDFL+LFYI VV+LHTVPVLYEKYED++D+FAEKA HELKKQYAVFDAKVLSKIPR
Sbjct  129  LGSCCDFLSLFYIIVVVLHTVPVLYEKYEDQIDSFAEKAFHELKKQYAVFDAKVLSKIPR  188

Query  202  GPLKDKKLA  176
            GPL+DKK A
Sbjct  189  GPLRDKKKA  197



>gb|KHG24129.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=250

 Score =   281 bits (719),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKKIS G LG AT IWILFE+LEYHLLT VCH LILALAVLFLWSNA++F
Sbjct  62   GKPADIFLWRNKKISAGALGVATVIWILFEMLEYHLLTLVCHLLILALAVLFLWSNAATF  121

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV IP++PV++FA ALR ++N   AVLRDIASGR+LK FL VI GLW++SI
Sbjct  122  INKSPPRIPEVQIPKDPVMEFAQALRFEINRAFAVLRDIASGRELKKFLSVIAGLWVLSI  181

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKAMHE+KKQYAVFDAKVLSKIPR
Sbjct  182  VGSWCNFLTLFYIVFVLLHTVPVLYEKYEDKVDPFAEKAMHEIKKQYAVFDAKVLSKIPR  241

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  242  GPLKEKK  248



>ref|XP_002509881.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51268.1| conserved hypothetical protein [Ricinus communis]
Length=260

 Score =   281 bits (718),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKK+S GVLG ATA+W+LFE++EYHLLT +CHG ILALA+LFLWSNAS+F
Sbjct  72   GKPADIFLWRNKKVSAGVLGFATAVWVLFELIEYHLLTLICHGFILALAILFLWSNASTF  131

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS PHIPEVHIPEEPVLQ A+ALR ++N+  A+LRDIASGRDLK FL VI GLW++SI
Sbjct  132  INKSPPHIPEVHIPEEPVLQVAAALRMEINYAFAILRDIASGRDLKKFLSVIAGLWVLSI  191

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFYIA VLLHTVPV YEKYED+VDAFAEKA  E+KKQYAVFDAKVLSKIPR
Sbjct  192  VGSWCNFLTLFYIAFVLLHTVPVFYEKYEDKVDAFAEKAAIEIKKQYAVFDAKVLSKIPR  251

Query  202  GPLKDKKLA  176
            GPLKDKK A
Sbjct  252  GPLKDKKKA  260



>emb|CDP12094.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   279 bits (713),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVF+WRNK+IS GVLG ATAIW+LFE+LEYHLLT VCHGLI+ LAVLFLWSNAS+F
Sbjct  64   GKPADVFMWRNKQISAGVLGVATAIWVLFEILEYHLLTLVCHGLIIVLAVLFLWSNASTF  123

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV +PE+PVLQFAS  R  +N   A+LRD+ASGR+LK FL VI GLWI SI
Sbjct  124  INKSPPRIPEVSVPEKPVLQFASDARVAINQTFALLRDVASGRNLKKFLSVIAGLWIFSI  183

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCCDFLTL YI+ VLLHTVPV+Y+KYED+VD+FAEKA+ ELKKQYAVFD KVLSKIPR
Sbjct  184  LGSCCDFLTLLYISAVLLHTVPVIYDKYEDQVDSFAEKALAELKKQYAVFDKKVLSKIPR  243

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  244  GPLKDKK  250



>ref|XP_010251601.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
Length=254

 Score =   279 bits (713),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS GVLGGATA W+LFE+LEYHLLT VCH LI++LAVLFL+SNA +F
Sbjct  66   GKPADVFLWRNKKISAGVLGGATATWVLFELLEYHLLTLVCHCLIVSLAVLFLYSNAIAF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            + K+ P IPEV+IPE+PVLQFASALR ++N   AVLRDIASGRDLK FL VI GLW++SI
Sbjct  126  MHKTPPRIPEVYIPEDPVLQFASALRIEINRAFAVLRDIASGRDLKKFLAVIAGLWVLSI  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFYIA VLLHTVPVLYEKYED+VD+FAEKAM E+KKQY +FDAKVLSKIP+
Sbjct  186  VGSWCNFLTLFYIAFVLLHTVPVLYEKYEDQVDSFAEKAMAEIKKQYVIFDAKVLSKIPK  245

Query  202  GPLKDKKLA  176
            GPLKDKK A
Sbjct  246  GPLKDKKHA  254



>ref|XP_009597328.1| PREDICTED: reticulon-like protein B5 [Nicotiana tomentosiformis]
Length=268

 Score =   278 bits (711),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 166/187 (89%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLLT +CH LI++LAVLFLWSNA++F
Sbjct  80   GKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLTLICHILIISLAVLFLWSNATTF  139

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K  PHIPE+H+P++P LQ ASALR ++N  LA+LR+IASGR+LK FL V+ GLWIISI
Sbjct  140  INKKPPHIPEIHLPQDPFLQVASALRIEINRALALLREIASGRELKKFLGVVAGLWIISI  199

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFYI+ VLLHTVPVLYEKYED+VD  AEKAMHE+KKQYAVFD KVLSKIPR
Sbjct  200  VGSWCNFLTLFYISFVLLHTVPVLYEKYEDKVDPLAEKAMHEIKKQYAVFDKKVLSKIPR  259

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  260  GPLKDKK  266



>ref|XP_010658515.1| PREDICTED: reticulon-like protein B2 [Vitis vinifera]
 emb|CBI34409.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   276 bits (707),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LWRNKKIS GVLGGATA+WILFE+LEYHLLT VCH  ILALA+LFLWSNA++F
Sbjct  64   GKPADVVLWRNKKISAGVLGGATAVWILFELLEYHLLTLVCHCSILALAILFLWSNATTF  123

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ PHIPEVHIPE+PVLQFASALR ++N    +LR++ASG+DLK FL VI GLW++SI
Sbjct  124  INKAPPHIPEVHIPEDPVLQFASALRIEINRGFTLLRNVASGKDLKKFLSVIAGLWVVSI  183

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFYI  VLLHTVPVLYEKYED VD+FAEKAM E+K+QYAVFDAKVLS+IPR
Sbjct  184  VGSWCNFLTLFYIVFVLLHTVPVLYEKYEDPVDSFAEKAMVEIKRQYAVFDAKVLSRIPR  243

Query  202  GPLKDKKLA  176
            GPLKDKK+A
Sbjct  244  GPLKDKKIA  252



>ref|XP_006339640.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=265

 Score =   276 bits (705),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLLT +CH LI+ LAVLFLWSNA++F
Sbjct  77   GKPADVFLWRNKKISGTVLGGATAIWVLFELLEYHLLTLICHILIITLAVLFLWSNATTF  136

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K  PHIPEVH+PE P+LQ ASALR ++N  L +LR+IASGR+LK FL VI GLWI+SI
Sbjct  137  INKKPPHIPEVHLPEGPILQVASALRIEINRALDLLREIASGRELKKFLAVIAGLWILSI  196

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFYI+ VLLHT+PVLYEKYED+VD  AEKAMHE+KKQYAVFDAKVLSKIPR
Sbjct  197  VGSWCNFLTLFYISFVLLHTIPVLYEKYEDKVDPLAEKAMHEIKKQYAVFDAKVLSKIPR  256

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  257  GPLKDKK  263



>ref|XP_009766982.1| PREDICTED: reticulon-like protein B5 [Nicotiana sylvestris]
Length=266

 Score =   275 bits (704),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLLT +CH LI++LAVLFLWSNA++F
Sbjct  78   GKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLTLICHILIISLAVLFLWSNATTF  137

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K  PHIPE+H+P++P LQ ASALR ++N  LA+LR+IASGR+LK FL V+ GLWI+SI
Sbjct  138  INKKPPHIPEIHLPQDPFLQVASALRIEINRALALLREIASGRELKKFLGVVAGLWILSI  197

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFYI  VLLHTVPVLYEKYED+VD  AEKAMHE+KKQYAVFD KVLSKIPR
Sbjct  198  VGSWCNFLTLFYILFVLLHTVPVLYEKYEDKVDPLAEKAMHEIKKQYAVFDEKVLSKIPR  257

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  258  GPLKDKK  264



>gb|KDP25363.1| hypothetical protein JCGZ_20519 [Jatropha curcas]
Length=257

 Score =   275 bits (702),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CHGLIL+LAVLFLWSNAS+F
Sbjct  69   GKPADIFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLICHGLILSLAVLFLWSNASTF  128

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV+IPEEPVLQ A ALR+++N   AVLRDIASGRDLK FL VI GLW++SI
Sbjct  129  INKSPPRIPEVYIPEEPVLQVADALRSEINWGFAVLRDIASGRDLKKFLSVIAGLWVLSI  188

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS  +FLTLFYI  VLL+TVPV YEKYED+VD+ AEKA+ ELKKQYAV DAKVLSKIPR
Sbjct  189  VGSWVNFLTLFYIVFVLLYTVPVFYEKYEDKVDSLAEKALIELKKQYAVLDAKVLSKIPR  248

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  249  GPLKDKK  255



>ref|XP_004229935.1| PREDICTED: reticulon-like protein B1 [Solanum lycopersicum]
Length=263

 Score =   274 bits (700),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS  V+GGATAIW+LFE+LEYHLLT +CH LI+ LAVLFLWSNA++F
Sbjct  75   GKPADVFLWRNKKISATVIGGATAIWVLFELLEYHLLTLICHILIITLAVLFLWSNATTF  134

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K  PHIPEVH+PE P+LQ ASALR ++N  L +LR+IASGR+LK FL VI GLWI+SI
Sbjct  135  INKKPPHIPEVHLPEGPILQVASALRIEINRALDLLREIASGRELKKFLAVIAGLWILSI  194

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFYI+ VLLHTVPV+YEKYED+VD  AEKAMHE+KKQYAVFD KVLSKIPR
Sbjct  195  VGSWCNFLTLFYISFVLLHTVPVIYEKYEDKVDPLAEKAMHEIKKQYAVFDEKVLSKIPR  254

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  255  GPLKDKK  261



>ref|XP_008796064.1| PREDICTED: reticulon-like protein B2 [Phoenix dactylifera]
Length=253

 Score =   273 bits (698),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS GV+GGATA+W+LFE+LEYHLL+ VCH LIL+LA+LFLWSNAS+F
Sbjct  66   GKPADVFLWRNKKISAGVIGGATAVWVLFELLEYHLLSLVCHCLILSLAILFLWSNASTF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IPE  IPE+  +  A +LR ++N   AVLR+IASGRDLK FL+VI GLW++SI
Sbjct  126  INKAPPRIPEASIPEDLAVNVALSLRYEINRAFAVLREIASGRDLKKFLVVIAGLWVLSI  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTLFY  +V LHTVPVLYEKYED+VD+FAEKAM E+KKQY VFDAKVLSKIPR
Sbjct  186  LGSCCNFLTLFYTMLVTLHTVPVLYEKYEDKVDSFAEKAMAEIKKQYGVFDAKVLSKIPR  245

Query  202  GPLKDKK  182
             PLKDKK
Sbjct  246  SPLKDKK  252



>ref|XP_009763462.1| PREDICTED: reticulon-like protein B1 isoform X2 [Nicotiana sylvestris]
Length=263

 Score =   273 bits (697),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLL  VCH LI  LA+LFLWSNA++F
Sbjct  75   GKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLGLVCHLLIFTLAILFLWSNATTF  134

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K  PHIPE H+ EEP+L+ ASALR ++NH L VLR+IASGRDLK FL VI GLW++S+
Sbjct  135  INKKRPHIPEFHLLEEPILEIASALRIEINHILHVLREIASGRDLKKFLAVIAGLWVLSM  194

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G+CC+FLTLFYI+ VLLHTVPVLYEKYED+VD  AEKA+ E+KKQYAVFDA+VLSKIP+
Sbjct  195  LGNCCNFLTLFYISFVLLHTVPVLYEKYEDKVDPLAEKAVQEIKKQYAVFDARVLSKIPK  254

Query  202  GPLKDKKLA  176
            GPLKDKK A
Sbjct  255  GPLKDKKKA  263



>gb|AFK41983.1| unknown [Medicago truncatula]
Length=237

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS   LG ATA+W+LFE+LEYHLLT + H  ILALAVLFLWSNAS+F
Sbjct  49   GKPADVFLWRNKKISATTLGVATALWVLFELLEYHLLTLISHLAILALAVLFLWSNASTF  108

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IP+VHIPEEPVLQ ASA+R ++N   A+LRDIASGRDLK FL VI GLW++SI
Sbjct  109  INKSPPKIPQVHIPEEPVLQIASAIRIEINRAFAILRDIASGRDLKQFLSVIAGLWVLSI  168

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS  +FLTLFYIA VLLHTVPVLYEKYED VD+F EKA+HE KKQYAVFD KVLSKIP+
Sbjct  169  VGSWTNFLTLFYIAFVLLHTVPVLYEKYEDRVDSFGEKALHEFKKQYAVFDEKVLSKIPK  228

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  229  GPLKDKK  235



>ref|XP_010915765.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=254

 Score =   272 bits (695),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS GVLGGATA+W+LFE+L+YHLLT V H L+L+LA+LFLWSNAS+F
Sbjct  67   GKPADVFLWRNKKISAGVLGGATAVWVLFELLDYHLLTLVGHCLVLSLAILFLWSNASTF  126

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K  PHIPEV IPE+  +  A +LR ++N   AVLRDIASGRDLK FL VI GLW++SI
Sbjct  127  INKIPPHIPEVSIPEDVAINVALSLRYEINRAFAVLRDIASGRDLKKFLAVIAGLWVLSI  186

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTLFYI  V LHTVPVLYEKYED+VD+FAEKAM E+KKQY VFDAKVLSKIPR
Sbjct  187  LGSCCNFLTLFYILFVTLHTVPVLYEKYEDKVDSFAEKAMAEIKKQYVVFDAKVLSKIPR  246

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  247  GPLKDKK  253



>ref|XP_003633964.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 ref|XP_003633965.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 ref|XP_010661856.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 emb|CBI40444.3| unnamed protein product [Vitis vinifera]
Length=255

 Score =   271 bits (694),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS GVLGGATA+W+LFE+LEYHLLT VCH LIL+LA+LFLWSNA++F
Sbjct  67   GKHADVFLWRNKKISAGVLGGATAMWVLFELLEYHLLTLVCHILILSLAILFLWSNATTF  126

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPE+P LQ  +ALR ++N   AVLRDIASGRDLK FL++I GLW++SI
Sbjct  127  INKSPPRIPEVHIPEDPFLQAVNALRIEINCGFAVLRDIASGRDLKKFLIIIAGLWVLSI  186

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTLFYI  VLLHTVPV+YEKYED +D FAEKA  E+KKQYAVFDAKVLSKIP+
Sbjct  187  LGSCCNFLTLFYITFVLLHTVPVIYEKYEDRIDPFAEKATIEIKKQYAVFDAKVLSKIPK  246

Query  202  GPLKDKKLA  176
             PLK KK+A
Sbjct  247  VPLKYKKMA  255



>ref|XP_008805646.1| PREDICTED: reticulon-like protein B3 [Phoenix dactylifera]
Length=254

 Score =   271 bits (694),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LWRNKKIS GVLGGATA+W+LFE+LEYHLLT V H LIL+LA+LFLWSNAS+F
Sbjct  67   GKPADVLLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVGHCLILSLAILFLWSNASTF  126

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ PHIPEV IPE+  +  A +LR ++N   A+LRDIASGRDLK FL VI GLW++SI
Sbjct  127  ISKTPPHIPEVSIPEDLAVNVALSLRYEINRAFAILRDIASGRDLKKFLAVIAGLWVLSI  186

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTLFYI  V LHTVPVLYEKYED+VD FAEKAM E+KKQY VFDAKVLSKIPR
Sbjct  187  LGSCCNFLTLFYIVFVTLHTVPVLYEKYEDKVDPFAEKAMAEIKKQYVVFDAKVLSKIPR  246

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  247  GPLKDKK  253



>ref|XP_007160119.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
 gb|ESW32113.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
Length=254

 Score =   271 bits (692),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GKQADVFLWRNKKIS   LG AT IWILFE+LEYHLLT VCH +ILALA LFLWSNAS+F
Sbjct  66   GKQADVFLWRNKKISASTLGVATVIWILFELLEYHLLTLVCHFVILALAGLFLWSNASTF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K  P IP+VHIPE+P+LQFASALR ++N   +VLRDIASGRDLK FL VI GLW+ SI
Sbjct  126  INKRPPKIPQVHIPEDPILQFASALRIEINRAFSVLRDIASGRDLKKFLSVIAGLWVFSI  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GS  +FLTLFYIA VLLHTVPVLYEKYED+VD+F EKA+ E+KKQYAVFDAKVLSKIP+
Sbjct  186  LGSWANFLTLFYIAFVLLHTVPVLYEKYEDQVDSFGEKAIAEIKKQYAVFDAKVLSKIPK  245

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  246  GPLKDKK  252



>ref|NP_001239711.1| uncharacterized protein LOC100811024 [Glycine max]
 gb|ACU21063.1| unknown [Glycine max]
 gb|KHN16777.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score =   270 bits (691),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS   LG ATAIW+LFE+LEYHLLT VCH LIL LAVLFLWSNAS+F
Sbjct  66   GKPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVCHFLILGLAVLFLWSNASTF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IP+VHIPE+PVL+FASALR ++N   A+LRDIASGRDLK FL VI GLW+ SI
Sbjct  126  INKSPPKIPQVHIPEKPVLEFASALRVEINRAFALLRDIASGRDLKKFLSVIAGLWVFSI  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GS  +FLTLFYIA VLLHTVPVLYEKYED VD+F  KA+ E+KKQYAVFDAKVLSKIPR
Sbjct  186  LGSWANFLTLFYIAFVLLHTVPVLYEKYEDHVDSFGGKAIAEIKKQYAVFDAKVLSKIPR  245

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  246  GPLKDKK  252



>gb|ACJ84486.1| unknown [Medicago truncatula]
 gb|AFK36476.1| unknown [Medicago truncatula]
 gb|KEH21160.1| seed maturation protein [Medicago truncatula]
Length=260

 Score =   270 bits (691),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS   LG ATA+W+LFE+LEYHLLT + H  ILALAVLFLWSNAS+F
Sbjct  72   GKPADVFLWRNKKISATTLGVATALWVLFELLEYHLLTLISHLAILALAVLFLWSNASTF  131

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IP+VHIPEEPVLQ ASA+R ++N   A+LRDIASGRDLK FL VI GLW++SI
Sbjct  132  INKSPPKIPQVHIPEEPVLQIASAIRIEINRAFAILRDIASGRDLKQFLSVIAGLWVLSI  191

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS  +FLTLFYIA VLLHTVPVLYEKYED VD+F EKA+HE KKQYAVFD KVLSKIP+
Sbjct  192  VGSWTNFLTLFYIAFVLLHTVPVLYEKYEDRVDSFGEKALHEFKKQYAVFDEKVLSKIPK  251

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  252  GPLKDKK  258



>ref|XP_003525365.1| PREDICTED: reticulon-like protein B2-like isoform 1 [Glycine 
max]
 gb|KHM99936.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score =   270 bits (690),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS   LG ATAIW+LFE+LEYHLLT VCH LILALA LFLWSNAS+F
Sbjct  66   GKPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVCHFLILALAGLFLWSNASTF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IP+VHIPEEPVL+FASALR ++N   AVLRDIASGRDLK FL VI GLW+ SI
Sbjct  126  INKSPPKIPQVHIPEEPVLKFASALRIEINRAFAVLRDIASGRDLKKFLSVIAGLWVFSI  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G   +FLTLFYIA VLLHTVPVLYEKYED VD+F EKA+ E+KKQYAVFDAKVLSKIPR
Sbjct  186  LGCWANFLTLFYIAFVLLHTVPVLYEKYEDHVDSFGEKAIAEIKKQYAVFDAKVLSKIPR  245

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  246  GPLKDKK  252



>gb|ACU23452.1| unknown [Glycine max]
Length=253

 Score =   270 bits (689),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS   LG ATAIW+LFE+LEYHLLT VCH LILALA LFLWSNAS+F
Sbjct  65   GKPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVCHFLILALAGLFLWSNASTF  124

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IP+VHIPEEPVL+FASALR ++N   AVLRDIASGRDLK FL VI GLW+ SI
Sbjct  125  INKSPPKIPQVHIPEEPVLKFASALRIEINRAFAVLRDIASGRDLKKFLSVIAGLWVFSI  184

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G   +FLTLFYIA VLLHTVPVLYEKYED VD+F EKA+ E+KKQYAVFDAKVLSKIPR
Sbjct  185  LGCWANFLTLFYIAFVLLHTVPVLYEKYEDHVDSFGEKAIAEIKKQYAVFDAKVLSKIPR  244

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  245  GPLKDKK  251



>ref|XP_010055800.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW72349.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=262

 Score =   270 bits (690),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS G LG ATA+WILFE+LEYHLLT VCH LIL LA+LFLWSNA++F
Sbjct  74   GKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAILFLWSNATTF  133

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K  PHIPEV IPE+PVL+FAS L +++N  +A LR+IASGRDLK FL+V+   W+ SI
Sbjct  134  IHKMPPHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDLKKFLLVVAVFWVFSI  193

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGSCC+FLTLFYIA VLLHTVPVLYEKYED+VD FAEKA  E+KKQYAVFD KVLSKIPR
Sbjct  194  VGSCCNFLTLFYIAFVLLHTVPVLYEKYEDKVDPFAEKATIEIKKQYAVFDEKVLSKIPR  253

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  254  GPLKDKK  260



>ref|XP_006439447.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
 gb|ESR52687.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
Length=256

 Score =   270 bits (689),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 164/189 (87%), Gaps = 1/189 (1%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS GVLGGATAIW+LFE+LEYHLLT VCH LI+ALAVLFLWSNAS+F
Sbjct  69   GKPADVFLWRNKKISAGVLGGATAIWVLFELLEYHLLTLVCHCLIVALAVLFLWSNASTF  128

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV+IPEEPVLQ ASALR ++N    +LR+IASGRDLK FL VI GLW++SI
Sbjct  129  INKSPPRIPEVYIPEEPVLQLASALRFEINRAFPLLREIASGRDLKKFLSVIAGLWVVSI  188

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFYI  VLLHTVPV+YEKYED VD+F+EKA  E+KKQYAVFDAKVLSKIPR
Sbjct  189  VGSWCNFLTLFYIVFVLLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKVLSKIPR  248

Query  202  GPLKDKKLA  176
              LKDKK A
Sbjct  249  S-LKDKKKA  256



>ref|XP_011026963.1| PREDICTED: reticulon-like protein B2 [Populus euphratica]
Length=254

 Score =   270 bits (689),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS GVLGGATAIW+LFE+LEYHLLT VCH LILALA+LFLWSNAS+F
Sbjct  66   GKPADVFLWRNKKISAGVLGGATAIWVLFELLEYHLLTLVCHCLILALALLFLWSNASTF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPEEPVLQ A+ALR ++N   AVLRDIASGRDLK FL VI GLW++SI
Sbjct  126  INKSPPRIPEVHIPEEPVLQIAAALRIEINQGFAVLRDIASGRDLKKFLTVIAGLWVLSI  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+F+TLFYIA VLLHTVPV YEKYED+VDAFAEKAM E+KKQYAVFDAKVLSKIPR
Sbjct  186  VGSWCNFVTLFYIAFVLLHTVPVFYEKYEDQVDAFAEKAMIEIKKQYAVFDAKVLSKIPR  245

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  246  GPLKDKK  252



>ref|XP_008792381.1| PREDICTED: reticulon-like protein B2 isoform X2 [Phoenix dactylifera]
Length=251

 Score =   269 bits (688),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKKIS GVLGGATAIW+LF+++EYHLL  VCH LIL+LA+LFLWSNA++F
Sbjct  64   GKPADIFLWRNKKISAGVLGGATAIWVLFDLMEYHLLALVCHCLILSLAILFLWSNATTF  123

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV IPE+  + FA +LR ++N   AVLRDIASGRDLK FLMVI GLW++SI
Sbjct  124  INKSPPRIPEVSIPEDVAVSFALSLRYEINRGFAVLRDIASGRDLKKFLMVIAGLWVLSI  183

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGSCC+FLTLFYIA V LHT+PVLYEKYED+VD+FAEKAM ++KK YA F+AK LSKIPR
Sbjct  184  VGSCCNFLTLFYIAFVTLHTLPVLYEKYEDKVDSFAEKAMTKVKKNYATFNAKCLSKIPR  243

Query  202  GPLKDK  185
            GPLK K
Sbjct  244  GPLKKK  249



>gb|KCW72347.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=265

 Score =   270 bits (689),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS G LG ATA+WILFE+LEYHLLT VCH LIL LA+LFLWSNA++F
Sbjct  74   GKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAILFLWSNATTF  133

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K  PHIPEV IPE+PVL+FAS L +++N  +A LR+IASGRDLK FL+V+   W+ SI
Sbjct  134  IHKMPPHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDLKKFLLVVAVFWVFSI  193

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGSCC+FLTLFYIA VLLHTVPVLYEKYED+VD FAEKA  E+KKQYAVFD KVLSKIPR
Sbjct  194  VGSCCNFLTLFYIAFVLLHTVPVLYEKYEDKVDPFAEKATIEIKKQYAVFDEKVLSKIPR  253

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  254  GPLKDKK  260



>gb|KCW72348.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=296

 Score =   270 bits (691),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS G LG ATA+WILFE+LEYHLLT VCH LIL LA+LFLWSNA++F
Sbjct  74   GKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAILFLWSNATTF  133

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K  PHIPEV IPE+PVL+FAS L +++N  +A LR+IASGRDLK FL+V+   W+ SI
Sbjct  134  IHKMPPHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDLKKFLLVVAVFWVFSI  193

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGSCC+FLTLFYIA VLLHTVPVLYEKYED+VD FAEKA  E+KKQYAVFD KVLSKIPR
Sbjct  194  VGSCCNFLTLFYIAFVLLHTVPVLYEKYEDKVDPFAEKATIEIKKQYAVFDEKVLSKIPR  253

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  254  GPLKDKK  260



>ref|XP_010925814.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=253

 Score =   268 bits (686),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS GVLGGATA+W+LFE+LEYHLLT VCH LIL+LA+LFLWSNAS F
Sbjct  66   GKPADVFLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVCHCLILSLAILFLWSNASIF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P I EV IP++  +  A +LR ++N  +AVLR+I SG+DLK FL VI GLW++ +
Sbjct  126  INKAPPRILEVSIPKDLAVNVALSLRYEINRAIAVLREITSGQDLKKFLAVIAGLWVLLV  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+F+TLFYI VV LHTVPVLYEKYED+VD+FAEKAM E+KKQY VFDAKVLSKIPR
Sbjct  186  LGSCCNFMTLFYIMVVTLHTVPVLYEKYEDKVDSFAEKAMTEIKKQYKVFDAKVLSKIPR  245

Query  202  GPLKDKK  182
             PLKDKK
Sbjct  246  EPLKDKK  252



>ref|XP_006476478.1| PREDICTED: reticulon-like protein B2-like [Citrus sinensis]
 gb|KDO76366.1| hypothetical protein CISIN_1g039009mg [Citrus sinensis]
Length=256

 Score =   268 bits (685),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 164/189 (87%), Gaps = 1/189 (1%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS GVLGGATAIW+LF++LEYHLLT VCH LI+ALAVLFLWSNAS+F
Sbjct  69   GKPADVFLWRNKKISAGVLGGATAIWVLFQLLEYHLLTLVCHCLIVALAVLFLWSNASTF  128

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV+IPEEPVLQ ASALR ++N    +LR+IASGRDLK FL VI GLW++SI
Sbjct  129  INKSPPRIPEVYIPEEPVLQLASALRFEINRAFTLLREIASGRDLKKFLSVIAGLWVVSI  188

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFYI  VLLHTVPV+YEKYED VD+F+EKA  E+KKQYAVFDAKVLSKIPR
Sbjct  189  VGSWCNFLTLFYIVFVLLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKVLSKIPR  248

Query  202  GPLKDKKLA  176
              LKDKK A
Sbjct  249  S-LKDKKKA  256



>ref|XP_009626480.1| PREDICTED: reticulon-like protein B2 isoform X1 [Nicotiana tomentosiformis]
Length=254

 Score =   268 bits (685),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWR+KKI+ GVLG ATAIW+LFE+LEYHLLT VCH LILALAVLFLWSNAS+F
Sbjct  66   GKPADIFLWRDKKITAGVLGFATAIWVLFELLEYHLLTLVCHILILALAVLFLWSNASTF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV +PE+ VL  ASALR ++N  L +LRDIASG++LK FL VI GLW++SI
Sbjct  126  INKSPPQIPEVILPEDIVLGVASALRIEINRALEILRDIASGKELKKFLAVIAGLWVLSI  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G+C +FLTLFYI  VLLHTVPVLYEKYED+VDAFAEKA  E+KKQYAVF+ KVLSKIPR
Sbjct  186  LGNCWNFLTLFYICFVLLHTVPVLYEKYEDQVDAFAEKAEAEIKKQYAVFNVKVLSKIPR  245

Query  202  GPLKDKKL  179
            GPLKDKKL
Sbjct  246  GPLKDKKL  253



>ref|XP_010924771.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=252

 Score =   267 bits (682),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            G  ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLL  VCH LIL+LA+LFLWSNAS+F
Sbjct  64   GTPADVFLWRNKKISAGVLGGATAIWVLFELMEYHLLALVCHCLILSLAILFLWSNASTF  123

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV IPE+  +  A +LR ++N    VLRDIASGRDLK FL+VI GLW++SI
Sbjct  124  IHKSPPRIPEVSIPEDVAVNVALSLRYEINRGFTVLRDIASGRDLKKFLVVIAGLWVLSI  183

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGSCC+FLTLFYIA V LHTVPVLYEKYED+VD FAEK M E+KK YA F AK LSKIPR
Sbjct  184  VGSCCNFLTLFYIAFVTLHTVPVLYEKYEDKVDPFAEKVMTEVKKHYATFHAKCLSKIPR  243

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  244  GPLKEKK  250



>ref|XP_009765582.1| PREDICTED: reticulon-like protein B2 [Nicotiana sylvestris]
Length=254

 Score =   267 bits (682),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWR+KKI+ GVLG ATAIW+LFE+LEYHLLT VCH LILALAVLFLWSNAS+F
Sbjct  66   GKPADVFLWRDKKITAGVLGFATAIWVLFELLEYHLLTLVCHILILALAVLFLWSNASTF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV +PE+ VL  ASALR ++N  L +LRDIASG++LK FL VI GLW++SI
Sbjct  126  INKSPPQIPEVILPEDIVLGVASALRIEINRALEILRDIASGKELKKFLAVIAGLWVLSI  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G+C +FLTLFYI  VLLHTVPVLYEKYED+VDAFAEKA  E+KKQYAVF+ KVLSKIPR
Sbjct  186  LGNCWNFLTLFYICFVLLHTVPVLYEKYEDQVDAFAEKAEAEIKKQYAVFNVKVLSKIPR  245

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  246  GPLKDKK  252



>ref|XP_009603968.1| PREDICTED: reticulon-like protein B1 [Nicotiana tomentosiformis]
 ref|XP_009603969.1| PREDICTED: reticulon-like protein B1 [Nicotiana tomentosiformis]
Length=263

 Score =   267 bits (682),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKK+S  VLGGATAIW+LFE+LEYHLL  VCH LI  LA+LFLWSNA++F
Sbjct  75   GKPADVFLWRNKKVSASVLGGATAIWVLFELLEYHLLGLVCHLLIFTLAILFLWSNATTF  134

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K  PHIPEVH+PEEP+L+ ASALR ++N+ L VLR+IASGRDL  FL VI GLW++S+
Sbjct  135  INKKRPHIPEVHLPEEPILEIASALRIEINYTLRVLREIASGRDLTKFLSVIAGLWVLSV  194

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G+CC+FLTLFYI+ VLLHTVPVLYEKYED+VD   EKA+ E+KKQYAVFDAKVLSKIP+
Sbjct  195  LGNCCNFLTLFYISFVLLHTVPVLYEKYEDKVDPLVEKAVKEIKKQYAVFDAKVLSKIPK  254

Query  202  GPLKDKKLA  176
            GPL+DKK A
Sbjct  255  GPLRDKKKA  263



>ref|XP_009763461.1| PREDICTED: reticulon-like protein B6 isoform X1 [Nicotiana sylvestris]
Length=267

 Score =   267 bits (682),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 164/193 (85%), Gaps = 4/193 (2%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLL  VCH LI  LA+LFLWSNA++F
Sbjct  75   GKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLGLVCHLLIFTLAILFLWSNATTF  134

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLM----VITGLW  395
            I K  PHIPE H+ EEP+L+ ASALR ++NH L VLR+IASGRDLK FL     VI GLW
Sbjct  135  INKKRPHIPEFHLLEEPILEIASALRIEINHILHVLREIASGRDLKKFLAVNCSVIAGLW  194

Query  394  IISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLS  215
            ++S++G+CC+FLTLFYI+ VLLHTVPVLYEKYED+VD  AEKA+ E+KKQYAVFDA+VLS
Sbjct  195  VLSMLGNCCNFLTLFYISFVLLHTVPVLYEKYEDKVDPLAEKAVQEIKKQYAVFDARVLS  254

Query  214  KIPRGPLKDKKLA  176
            KIP+GPLKDKK A
Sbjct  255  KIPKGPLKDKKKA  267



>ref|XP_008810936.1| PREDICTED: reticulon-like protein B5 [Phoenix dactylifera]
Length=253

 Score =   266 bits (680),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKKIS GVLG ATAIW+LFE++EYHLLT VCH LIL+LA+LFLWSNAS+F
Sbjct  65   GKPADIFLWRNKKISAGVLGVATAIWVLFELMEYHLLTLVCHCLILSLAILFLWSNASTF  124

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS+PHIPEV IPE+  +  A +LR ++N   AVLRDIASGR+LK FLMVI GLW++SI
Sbjct  125  INKSSPHIPEVSIPEDVAVDVALSLRYEINRGFAVLRDIASGRELKKFLMVIAGLWVLSI  184

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G+CC+FLTLFYI  V LHTVPVLYEKYED+VD FAEK M E+KK YA F AK LSKIPR
Sbjct  185  IGTCCNFLTLFYIVFVTLHTVPVLYEKYEDKVDPFAEKVMAEIKKHYATFHAKCLSKIPR  244

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  245  GPLKEKK  251



>ref|XP_011093062.1| PREDICTED: reticulon-like protein B1 [Sesamum indicum]
Length=257

 Score =   265 bits (678),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKKIS  VLGGATA+W+LFE+LEYHLLT VCH  ILAL++LFLWSNA++F
Sbjct  70   GKPADIFLWRNKKISATVLGGATAVWVLFELLEYHLLTLVCHVSILALSLLFLWSNATTF  129

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K  PHIPEV +PE+P L+ AS LR ++N   AVLR+IASGRDLK FLMV+ GLW +SI
Sbjct  130  INKRPPHIPEVRLPEDPFLEVASVLRTEINRGFAVLREIASGRDLKKFLMVVVGLWALSI  189

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFYI  +LLHTVPVLYEKY+D++DAFAEKAM ++KKQYAVFDAKVLSKIPR
Sbjct  190  VGSFCNFLTLFYIVFILLHTVPVLYEKYDDKIDAFAEKAMIQIKKQYAVFDAKVLSKIPR  249

Query  202  GPLKDKK  182
            GPL  K+
Sbjct  250  GPLGKKR  256



>ref|XP_007038874.1| VIRB2-interacting protein 2 [Theobroma cacao]
 gb|EOY23375.1| VIRB2-interacting protein 2 [Theobroma cacao]
Length=247

 Score =   264 bits (674),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWR+KKIS GVLGGATA+WILFE+LEYHL+T +CH LIL+LA+LFLWSNAS+F
Sbjct  59   GKPADVFLWRDKKISAGVLGGATALWILFEMLEYHLITLLCHTLILSLAILFLWSNASTF  118

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P+IPEV +PE+ VL+ ASALR +VN  L V+RDIASG DLK FL VI GLW +S+
Sbjct  119  INKSPPNIPEVVLPEKCVLEVASALRIEVNRALDVVRDIASGNDLKKFLGVIVGLWALSL  178

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG+CC+FLTLFYI  VLLHTVPV YE YED+VD+F+EKA+ E+KKQYA FD KVLSKIP+
Sbjct  179  VGNCCNFLTLFYIVFVLLHTVPVFYEIYEDQVDSFSEKAIIEIKKQYAAFDEKVLSKIPK  238

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  239  GPLKEKK  245



>ref|XP_002299504.1| reticulon family protein [Populus trichocarpa]
 gb|ABK93406.1| unknown [Populus trichocarpa]
 gb|EEE84309.1| reticulon family protein [Populus trichocarpa]
Length=254

 Score =   263 bits (672),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS GVLGGATAIW+LFE+LEY+L+T VCH LILALA+LFLWSNAS+F
Sbjct  66   GKPADVFLWRNKKISAGVLGGATAIWVLFELLEYNLVTLVCHCLILALALLFLWSNASTF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV IPEEPVLQ A+ALR ++N   +VLRDIASGRDLK FL VI GLW++SI
Sbjct  126  INKSPPRIPEVCIPEEPVLQTAAALRIEINQGFSVLRDIASGRDLKNFLTVIAGLWVLSI  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+F+TLFYIA VLLHTVPV YEKYED+VDAFAEKAM E+KKQYAVFDAKVLSKIPR
Sbjct  186  VGSWCNFVTLFYIAFVLLHTVPVFYEKYEDQVDAFAEKAMIEIKKQYAVFDAKVLSKIPR  245

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  246  GPLKDKK  252



>ref|XP_004503660.1| PREDICTED: reticulon-like protein B2-like [Cicer arietinum]
Length=255

 Score =   263 bits (672),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS  VLG ATA WILFE+LEYHLLT VCH  ILALAVLFLWSNAS+F
Sbjct  67   GKPADVFLWRNKKISATVLGVATASWILFELLEYHLLTLVCHLAILALAVLFLWSNASTF  126

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IP+VHIPEEPVLQ A+ALR ++N   AVLRDIASG+DLK FL VI GLW++SI
Sbjct  127  INKAPPKIPQVHIPEEPVLQIAAALRIEINRVFAVLRDIASGKDLKKFLSVIAGLWVLSI  186

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS  +FLTLFYIA VLLHTVPVLYEKYED VD+F EKA+ E KKQYAVFDAKVLSKIP+
Sbjct  187  VGSWANFLTLFYIAFVLLHTVPVLYEKYEDRVDSFGEKALAEFKKQYAVFDAKVLSKIPK  246

Query  202  GPLKDKK  182
            G LK+KK
Sbjct  247  GALKNKK  253



>gb|AEZ00899.1| putative 24 kDa seed maturation protein [Elaeis guineensis]
Length=253

 Score =   263 bits (671),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKKIS GVLGGATAIW+LFE++EYHLL+ VCH LIL+LA+LFLWSNA++F
Sbjct  65   GKPADIFLWRNKKISAGVLGGATAIWVLFELMEYHLLSLVCHCLILSLAILFLWSNATTF  124

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS PHIPEV IPE+  +  A +LR D+N   AVLRDIASGRDLK FL+VI GLW++SI
Sbjct  125  INKSPPHIPEVSIPEDVAVSVALSLRYDINRAFAVLRDIASGRDLKKFLLVIAGLWVLSI  184

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTLFYI  V LHTVPVLYEKYED+VD+F EKAM E+KK YA   AK LSKIP+
Sbjct  185  IGSCCNFLTLFYIVFVTLHTVPVLYEKYEDKVDSFGEKAMAEIKKHYATVHAKCLSKIPK  244

Query  202  GPLKDKK  182
            G LK+KK
Sbjct  245  GALKEKK  251



>gb|KJB52210.1| hypothetical protein B456_008G250900 [Gossypium raimondii]
Length=250

 Score =   262 bits (669),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKKIS G LG AT IWILFE+LEYHLLT VCH LILALA+LFLWSNA++F
Sbjct  62   GKPADIFLWRNKKISAGALGVATVIWILFEMLEYHLLTLVCHLLILALALLFLWSNAATF  121

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            + KS P IPEV IP++PV++FA ALR ++N   AVLRDIASGRDLK FL VI GLWI+SI
Sbjct  122  VNKSPPRIPEVQIPKDPVMEFAQALRFEINRAFAVLRDIASGRDLKKFLSVIAGLWILSI  181

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKAMHE+KKQYAVFDAKVL KIPR
Sbjct  182  VGSWCNFLTLFYIVFVLLHTVPVLYEKYEDKVDPFAEKAMHEIKKQYAVFDAKVLRKIPR  241

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  242  GPLKEKK  248



>ref|XP_006358652.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=255

 Score =   261 bits (667),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS  VLGGATAIW+LFE+LEY L+  VCH LI  LAVLFLWSNA++F
Sbjct  67   GKPADVFLWRNKKISASVLGGATAIWVLFELLEYFLVGLVCHLLIFTLAVLFLWSNATTF  126

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K  PHIPEV +PEEP+L+ ASAL  ++N  L++LR+IA+G+DLK FL V+ GLWI+S+
Sbjct  127  INKKRPHIPEVQLPEEPILEIASALSIEINRALSMLREIATGKDLKKFLAVVAGLWILSV  186

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG+CC+FLTLFYI  VLLHTVPVLYEKYED+VD  AEKAM E+KKQYAVFDA+VLSKIP 
Sbjct  187  VGNCCNFLTLFYILFVLLHTVPVLYEKYEDKVDPLAEKAMQEIKKQYAVFDARVLSKIPI  246

Query  202  GPLKDKKLA  176
            GPLKDKK A
Sbjct  247  GPLKDKKNA  255



>ref|XP_010053196.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW77460.1| hypothetical protein EUGRSUZ_D01798 [Eucalyptus grandis]
Length=256

 Score =   261 bits (666),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 157/189 (83%), Gaps = 0/189 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKK+S G LG  T IW LFE+ EYHLLT   H LIL LAVLFLWSNA +F
Sbjct  67   GKPADVFLWRNKKVSAGALGVVTVIWALFELAEYHLLTLAAHCLILTLAVLFLWSNAHAF  126

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV IPEEPVLQFASALR ++N   AVLRDIASG+DLK FL+VI GLW++SI
Sbjct  127  IHKSPPRIPEVSIPEEPVLQFASALRLEINQAFAVLRDIASGKDLKKFLLVIAGLWLLSI  186

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
             G+ C+FLTLFYI  VLLHTVPVLYEK+ED++D FAE+AM ELKKQYAVFDAKVLSKIP 
Sbjct  187  AGNWCNFLTLFYIVFVLLHTVPVLYEKFEDKIDPFAERAMGELKKQYAVFDAKVLSKIPL  246

Query  202  GPLKDKKLA  176
            GPLKDKK A
Sbjct  247  GPLKDKKKA  255



>ref|XP_010676393.1| PREDICTED: reticulon-like protein B2 [Beta vulgaris subsp. vulgaris]
Length=248

 Score =   260 bits (665),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+ LWR+KKIS  VLG  TA+W LFE+ EYHLL+ +CH L+L + VLFLWSNAS+F
Sbjct  60   GKPADILLWRDKKISATVLGTVTAVWALFEIFEYHLLSLICHLLMLTITVLFLWSNASTF  119

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IP+V IPE PVL+ ASAL+ ++N  LA LR+IASG+DLK FL VI GLWI SI
Sbjct  120  INKAPPKIPDVRIPEGPVLEIASALKYEINRGLASLREIASGKDLKKFLAVIAGLWIFSI  179

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTLFYI  V+LHT+PVLYEKYED+VDAFAEKAM E+KKQY VFDAKVLSKIPR
Sbjct  180  LGSCCNFLTLFYICFVMLHTLPVLYEKYEDQVDAFAEKAMIEIKKQYIVFDAKVLSKIPR  239

Query  202  GPLKDKKLA  176
            GPLKDKK A
Sbjct  240  GPLKDKKAA  248



>gb|KHG04885.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=255

 Score =   260 bits (665),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CH  IL LA+LFLWSNA +F
Sbjct  68   GKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLICHISILCLALLFLWSNAHTF  127

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPE+H+PEEP LQ ASAL  ++N  L +LRDIASGR+LK FLMVI   W++SI
Sbjct  128  IHKSPPRIPEIHLPEEPFLQVASALAIELNQGLKLLRDIASGRNLKEFLMVIAAFWVLSI  187

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKA  E+KKQYAVFDAKVLSKIP 
Sbjct  188  VGSWCNFLTLFYICFVLLHTVPVLYEKYEDKVDPFAEKAAIEVKKQYAVFDAKVLSKIPM  247

Query  202  GPLKDKKL  179
            GPLK KK+
Sbjct  248  GPLKAKKV  255



>ref|XP_004234204.1| PREDICTED: reticulon-like protein B2 [Solanum lycopersicum]
Length=255

 Score =   260 bits (664),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 162/188 (86%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWR+KKI+ GVLG AT++W+LFE+L+YHLLT VCH LILALAVLFLWSNAS+F
Sbjct  67   GKPADIFLWRDKKITAGVLGFATSLWVLFELLQYHLLTLVCHILILALAVLFLWSNASTF  126

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IP+V +PE+ VL  A+ALR ++N  L V RDIASG++LK FL VI GLW++SI
Sbjct  127  INKSPPQIPDVILPEDIVLGVAAALRIEINRALEVFRDIASGKELKKFLGVIAGLWVLSI  186

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G+C +FLTLFYI  VLLHTVPVLYEK+ED+VDAFAEKA  E+KKQYAVF+ KVLSKIPR
Sbjct  187  LGNCWNFLTLFYICFVLLHTVPVLYEKFEDQVDAFAEKAEAEIKKQYAVFNVKVLSKIPR  246

Query  202  GPLKDKKL  179
            GPLKDKKL
Sbjct  247  GPLKDKKL  254



>ref|XP_004248066.1| PREDICTED: reticulon-like protein B1 [Solanum lycopersicum]
Length=263

 Score =   259 bits (663),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS  VLGGATAIW+LFE+LEY L+  VCH LI  LAVLFLWSNA++F
Sbjct  75   GKPADVFLWRNKKISASVLGGATAIWVLFELLEYFLVGLVCHLLIFTLAVLFLWSNATTF  134

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K  PHIPEV +PEEP+L+ ASAL  ++N  L++LR+IA+G+D K FL V+TGLWI+S+
Sbjct  135  INKKRPHIPEVQLPEEPILEIASALSIEINRALSMLREIATGKDPKKFLAVVTGLWILSV  194

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG+CC+FLTLFYI  VLLHTVPVLYEKYED+VD  AEKA+ E+KKQYA+FDAKVLSKIP 
Sbjct  195  VGNCCNFLTLFYILFVLLHTVPVLYEKYEDKVDPLAEKAVQEIKKQYAIFDAKVLSKIPI  254

Query  202  GPLKDKKLA  176
            GPLKDKK A
Sbjct  255  GPLKDKKNA  263



>gb|EYU19605.1| hypothetical protein MIMGU_mgv1a012182mg [Erythranthe guttata]
Length=259

 Score =   259 bits (662),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWR+KK+S GVLG ATAIW+LFE++EYHLL+ VCH LIL LA++FLWSNASSF
Sbjct  71   GKPADIFLWRDKKVSAGVLGFATAIWVLFELIEYHLLSLVCHILILGLAIIFLWSNASSF  130

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV + E+ V+  A+ALR + N   A+LRDI SG+DLK FL VI GLW++S+
Sbjct  131  INKSPPKIPEVVVREDIVIGVANALRIEFNRAFAILRDIVSGKDLKKFLAVIAGLWVLSM  190

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSC +FLTLFYI  VLLHTVP+LYEKY+D++DAFAEKA  ELKKQYAVFDAKVLSKIP+
Sbjct  191  LGSCFNFLTLFYICFVLLHTVPLLYEKYDDQIDAFAEKAEAELKKQYAVFDAKVLSKIPK  250

Query  202  GPLKDKKL  179
            GPLKDKK 
Sbjct  251  GPLKDKKF  258



>gb|KJB24634.1| hypothetical protein B456_004G154600 [Gossypium raimondii]
Length=255

 Score =   259 bits (661),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 158/188 (84%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLL  +CH  IL LA+LFLWSNA +F
Sbjct  68   GKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLALICHISILCLALLFLWSNAHTF  127

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPE+H+PEEP LQ ASAL  ++N  L +LRDIASGR+LK FLMVI   W++SI
Sbjct  128  IHKSPPRIPEIHLPEEPFLQVASALAIELNQGLKLLRDIASGRNLKEFLMVIAAFWVLSI  187

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKA  E+KKQYAVFDAKVLSKIP 
Sbjct  188  VGSWCNFLTLFYICFVLLHTVPVLYEKYEDKVDPFAEKAAIEIKKQYAVFDAKVLSKIPM  247

Query  202  GPLKDKKL  179
            GPLK KK+
Sbjct  248  GPLKAKKV  255



>ref|XP_010916969.1| PREDICTED: reticulon-like protein B3 [Elaeis guineensis]
Length=310

 Score =   261 bits (666),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/224 (63%), Positives = 170/224 (76%), Gaps = 5/224 (2%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKKIS GVLGGATAIW+LFE++EYHLL+ VCH LIL+LA+LFLWSNA++F
Sbjct  65   GKPADIFLWRNKKISAGVLGGATAIWVLFELMEYHLLSLVCHCLILSLAILFLWSNATTF  124

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS PHIPEV IPE+  +  A +LR D+N   AVLRDIASGRDLK FL+VI GLW++SI
Sbjct  125  INKSPPHIPEVSIPEDVAVSVALSLRYDINRAFAVLRDIASGRDLKKFLLVIAGLWVLSI  184

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTLFYI  V LHTVPVLYEKYED+VD+F EKAM E+KK YA   AK LSKIP+
Sbjct  185  IGSCCNFLTLFYIVFVTLHTVPVLYEKYEDKVDSFGEKAMAEIKKHYATVHAKCLSKIPK  244

Query  202  GPLKDKKLA*DCNSVWCHYVRMCN*SLKNLCFSVIYQQTCWICH  71
            G LK +     C   +C +V  C      +  S++ + + W  H
Sbjct  245  GALKRRS---SCR--FCQFVASCGFLCVVVTLSILLRTSTWCMH  283



>gb|ABC01908.1| putative 24 kDa seed maturation protein-like protein [Solanum 
tuberosum]
Length=255

 Score =   258 bits (660),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWR+KKI+ GVLG AT++W+LFE+L+YHLLT VCH LILALAVLFLWSNAS+F
Sbjct  67   GKPADIFLWRDKKITAGVLGFATSLWVLFELLQYHLLTLVCHILILALAVLFLWSNASTF  126

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IP+V +PE+ VL  A+ALR ++N  L + RDIASG++LK FL VI GLW++SI
Sbjct  127  INKSPPQIPDVILPEDIVLGVAAALRIEINKALEIFRDIASGKELKKFLAVIAGLWVLSI  186

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G+C +FLTLFYI  VLLHTVPVLYEK+ED+VDAFAEKA  E+KKQYAVF+ KVLSKIPR
Sbjct  187  LGNCWNFLTLFYICFVLLHTVPVLYEKFEDQVDAFAEKAEAEIKKQYAVFNVKVLSKIPR  246

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  247  GPLKDKK  253



>gb|KJB06451.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=257

 Score =   258 bits (660),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CH  IL+LAVLFLWSN  +F
Sbjct  70   GKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILSLAVLFLWSNVHTF  129

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IP+VH+PEEP LQ ASAL  ++N  L +LRDIASGR+LK FL+V+   W++S+
Sbjct  130  IHKTPPRIPQVHLPEEPFLQIASALTIELNQALELLRDIASGRNLKKFLVVVAAFWVLSV  189

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFY + VLLHTVPVLYEKYED+VD FAEKA+ E+KKQYAVFDA VLSKIP 
Sbjct  190  VGSWCNFLTLFYTSFVLLHTVPVLYEKYEDKVDPFAEKAVIEIKKQYAVFDANVLSKIPT  249

Query  202  GPLKDKKL  179
            GPLK KK+
Sbjct  250  GPLKSKKV  257



>ref|XP_010545343.1| PREDICTED: reticulon-like protein B3 [Tarenaya hassleriana]
Length=259

 Score =   258 bits (660),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 156/191 (82%), Gaps = 4/191 (2%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+ LWRNKK+S GVLG ATA W+LFE+LEYHLL+ VCH  ILALAVLFLWSNAS+F
Sbjct  68   GKPADIVLWRNKKVSGGVLGAATAAWVLFELLEYHLLSLVCHSSILALAVLFLWSNASTF  127

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IPEVHIPEE VLQ AS LR ++N   A LRDIASGRDLK FLMVI GLW++SI
Sbjct  128  IHKTPPRIPEVHIPEEHVLQLASGLRTEINRGFAALRDIASGRDLKKFLMVIAGLWVLSI  187

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL----S  215
            +GSCC+F+TLFYIA VLL T+PVLYEKYED+VDAF EKAM E+KKQY V D KVL    S
Sbjct  188  LGSCCNFVTLFYIATVLLFTIPVLYEKYEDKVDAFGEKAMKEIKKQYEVLDEKVLSKIMS  247

Query  214  KIPRGPLKDKK  182
            KIPRG L  KK
Sbjct  248  KIPRGALSKKK  258



>ref|XP_003528823.2| PREDICTED: reticulon-like protein B1-like [Glycine max]
Length=314

 Score =   260 bits (664),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 157/189 (83%), Gaps = 0/189 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LWRNKKIS GVLG ATAIWI FE+LEYHLLT VCH  IL LAVLFLWSNA +F
Sbjct  126  GKPADVLLWRNKKISAGVLGVATAIWIFFELLEYHLLTLVCHISILLLAVLFLWSNAHTF  185

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IP VHIPEEP+LQFASAL  ++N   A LR I SGRDLK FL+VI G WIISI
Sbjct  186  IHKAPPRIPVVHIPEEPILQFASALTIEINRGFAALRAIGSGRDLKTFLIVIVGTWIISI  245

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFYIA VLLHTVPVLY+KYED++D  AEKA+ E KKQYAVFD KVLSKIP+
Sbjct  246  VGSWCNFLTLFYIAFVLLHTVPVLYDKYEDKIDPLAEKALVEFKKQYAVFDEKVLSKIPK  305

Query  202  GPLKDKKLA  176
            GPLK+KKLA
Sbjct  306  GPLKEKKLA  314



>ref|XP_006645662.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=249

 Score =   257 bits (657),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VCHGLI +L +LFLWSNASSF
Sbjct  62   GKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHGLIFSLGLLFLWSNASSF  121

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS+P IPEV IPE+ V+  A + R ++N   A LR IA GRD+K FL+VI GLW++S+
Sbjct  122  INKSSPRIPEVVIPEDLVVNIALSTRYEINRAFANLRQIALGRDIKKFLIVIAGLWLLSV  181

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTL YI  V+LHTVP+LYEKYED++D++ EK   E+KKQYAVFDAKVLSK+PR
Sbjct  182  LGSCCNFLTLLYIVFVVLHTVPILYEKYEDQIDSYGEKGWVEIKKQYAVFDAKVLSKVPR  241

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  242  GPLKDKK  248



>gb|KJB19087.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
 gb|KJB19090.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
Length=252

 Score =   257 bits (657),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+ LWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLWSNA+ F
Sbjct  64   GKPADILLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWSNATQF  123

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS PHIPEV IP+EPVL+F  ALR ++N   AVLRDIA GRDLKMFL VI GLW++SI
Sbjct  124  INKSTPHIPEVQIPKEPVLEFVMALRFEINRAFAVLRDIALGRDLKMFLSVIAGLWVLSI  183

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKAMHE+KKQYAVFDAKVLSKIPR
Sbjct  184  VGSWCNFLTLFYIVFVLLHTVPVLYEKYEDKVDPFAEKAMHEIKKQYAVFDAKVLSKIPR  243

Query  202  GPLKDKK  182
            GPLK KK
Sbjct  244  GPLKQKK  250



>gb|KDO56851.1| hypothetical protein CISIN_1g023137mg [Citrus sinensis]
Length=255

 Score =   257 bits (656),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 160/190 (84%), Gaps = 4/190 (2%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLWSNAS+F
Sbjct  65   GKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNASTF  124

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IP V +PE+ VL+FASALR ++N  LAVLR+IASGRDLK FL VI GLW++SI
Sbjct  125  INKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLWLLSI  184

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA----KVLS  215
            VG+ C+F+TLFYI  VLLHTVPV+YEKYED++D+F EKA  E+KKQYAVFD     KVLS
Sbjct  185  VGNWCNFVTLFYIVFVLLHTVPVIYEKYEDKIDSFGEKATIEIKKQYAVFDEKVLKKVLS  244

Query  214  KIPRGPLKDK  185
            +IP+G LK K
Sbjct  245  RIPKGALKKK  254



>ref|XP_006422079.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
 ref|XP_006490603.1| PREDICTED: reticulon-like protein B3-like [Citrus sinensis]
 gb|ESR35319.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
Length=255

 Score =   257 bits (656),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 160/190 (84%), Gaps = 4/190 (2%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLWSNAS+F
Sbjct  65   GKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNASTF  124

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IP V +PE+ VL+FASALR ++N  LAVLR+IASGRDLK FL VI GLW++SI
Sbjct  125  INKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLWLLSI  184

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA----KVLS  215
            VG+ C+F+TLFYI  VLLHTVPV+YEKYED++D+F EKA  E+KKQYAVFD     KVLS
Sbjct  185  VGNWCNFVTLFYIVFVLLHTVPVIYEKYEDKIDSFGEKATIEIKKQYAVFDEKVLKKVLS  244

Query  214  KIPRGPLKDK  185
            +IP+G LK K
Sbjct  245  RIPKGALKKK  254



>ref|NP_001149653.1| LOC100283279 [Zea mays]
 gb|ACG36248.1| seed maturation protein [Zea mays]
 gb|ACN31840.1| unknown [Zea mays]
 tpg|DAA57749.1| TPA: Seed maturation protein isoform 1 [Zea mays]
 tpg|DAA57750.1| TPA: Seed maturation protein isoform 2 [Zea mays]
Length=257

 Score =   256 bits (655),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+ LWRN+KIS GVL GATAIW+LFEV+EYHLLT VCH LIL+LA+LFLWSNAS+F
Sbjct  70   GKPADLILWRNRKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLILSLAILFLWSNASTF  129

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P+IPEV IPE+  +  A +LR ++N   A LR+I  GRDLK FL+VI GLW++S+
Sbjct  130  INKSPPNIPEVKIPEDVAVNVALSLRYEINRGFATLREIGHGRDLKKFLIVIAGLWLLSV  189

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTLFYI  V L+TVPVLYEKYED+VDAF EKAM ELKK YA+FD K LSKIP+
Sbjct  190  LGSCCNFLTLFYIVFVALYTVPVLYEKYEDKVDAFGEKAMTELKKYYAIFDEKCLSKIPK  249

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  250  GPLKDKK  256



>ref|XP_007051689.1| Reticulon family protein [Theobroma cacao]
 gb|EOX95846.1| Reticulon family protein [Theobroma cacao]
Length=255

 Score =   256 bits (655),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 161/188 (86%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS GVLGGATAIW+LFE++EY+LLT VCH  IL+LA++FLWSNA +F
Sbjct  68   GKPADVFLWRNKKISAGVLGGATAIWVLFELIEYNLLTLVCHISILSLALMFLWSNAHTF  127

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVH+PEEP LQ A+AL  ++N  L +LRDIASGR+LK FLMVI   W++SI
Sbjct  128  IHKSPPRIPEVHLPEEPFLQVAAALTFELNQALKLLRDIASGRNLKKFLMVIAAFWVLSI  187

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFYI+ VLLHTV VLYEKYED+VD  AEKAM E+KKQYAVFDAKVLSKIP+
Sbjct  188  VGSWCNFLTLFYISFVLLHTVLVLYEKYEDKVDPCAEKAMIEIKKQYAVFDAKVLSKIPK  247

Query  202  GPLKDKKL  179
            GPLK KK+
Sbjct  248  GPLKTKKV  255



>gb|KHG29253.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=251

 Score =   256 bits (654),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 158/188 (84%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CH  IL LAVLFLWSN  +F
Sbjct  64   GKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILCLAVLFLWSNVHTF  123

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IP+VH+PEEP LQ ASAL  ++N  L +LRDIASGR+LK FL+V+   W++S+
Sbjct  124  IHKTPPRIPQVHLPEEPFLQIASALTIELNQALKLLRDIASGRNLKKFLVVVAAFWVLSV  183

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFY + VLLHTVPVLYEKYED+VD FAEKA+ E+KKQYAVFDAKVL KIP 
Sbjct  184  VGSWCNFLTLFYTSFVLLHTVPVLYEKYEDKVDPFAEKAVIEIKKQYAVFDAKVLGKIPT  243

Query  202  GPLKDKKL  179
            GPLK KK+
Sbjct  244  GPLKTKKV  251



>gb|KHG15548.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=248

 Score =   256 bits (653),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD FLWRNKKIS GVLG AT IW+LFE+LEYHLLT VCH LI AL +LFLWSNA +F
Sbjct  60   GKSADTFLWRNKKISAGVLGVATVIWVLFELLEYHLLTLVCHVLIFALVILFLWSNAYAF  119

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS   IPEVHIP++PV++FA ALR + N    VLRDIA GRDLK FL VI GLWI+SI
Sbjct  120  INKSPLCIPEVHIPKDPVIEFAEALRFESNLAFTVLRDIAPGRDLKKFLYVIAGLWILSI  179

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+F+TLFY+  VLLH+VPVLYEKYED+VD FAEKAMHE+KKQ AVF+AKVLSKIPR
Sbjct  180  VGSWCNFVTLFYLVFVLLHSVPVLYEKYEDKVDPFAEKAMHEIKKQCAVFNAKVLSKIPR  239

Query  202  GPLKDK  185
            GP K+K
Sbjct  240  GPSKEK  245



>gb|EAY73097.1| hypothetical protein OsI_00974 [Oryza sativa Indica Group]
Length=279

 Score =   257 bits (656),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VCHGLI +L +LFLWSNASSF
Sbjct  92   GKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHGLIFSLGLLFLWSNASSF  151

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV IPE+ V+  A + R ++N   A LR IA GRD+K FL+VI GLW++S+
Sbjct  152  INKSPPRIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGRDIKKFLIVIAGLWLLSV  211

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTL YI  V+LHTVP+LYEKYED++D++ EK   E+KKQYAVFDAKVLSK+PR
Sbjct  212  LGSCCNFLTLVYIVFVVLHTVPILYEKYEDQIDSYGEKGWVEIKKQYAVFDAKVLSKVPR  271

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  272  GPLKDKK  278



>ref|NP_001150474.1| seed maturation protein [Zea mays]
 gb|ACG39226.1| seed maturation protein [Zea mays]
Length=283

 Score =   257 bits (656),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNK IS G+LGGATAIWILFE+L YHLLT VCHGLI AL VLFLWSNASSF
Sbjct  96   GKPADVFLWRNKNISAGILGGATAIWILFELLGYHLLTFVCHGLIFALGVLFLWSNASSF  155

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IPEV IPE+ V+  A + R ++N   A LR IA GRDLK FLMVI G W++S+
Sbjct  156  IHKAPPKIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGRDLKKFLMVIAGFWLLSV  215

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTL YI  V+LHTVPVLYEKYED++D++ EK   E+KKQYAVFD KVLSK+PR
Sbjct  216  LGSCCNFLTLVYIVFVVLHTVPVLYEKYEDQIDSYGEKGWAEIKKQYAVFDEKVLSKVPR  275

Query  202  GPLKDKK  182
            GP KDKK
Sbjct  276  GPAKDKK  282



>ref|XP_010533622.1| PREDICTED: reticulon-like protein B4 [Tarenaya hassleriana]
Length=259

 Score =   256 bits (653),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 157/191 (82%), Gaps = 4/191 (2%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKK+S G LG ATA W+LFE+LEYHLLT VCH  I ALAVLFLWSNAS+F
Sbjct  68   GKPADIFLWRNKKVSGGALGVATAAWVLFELLEYHLLTLVCHSSIFALAVLFLWSNASTF  127

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IP VHIPEEPV+Q AS LR +VN     LRDIASGRDLK FL+VI+GLW++SI
Sbjct  128  IHKTPPRIPHVHIPEEPVIQLASGLRFEVNRGFTALRDIASGRDLKKFLVVISGLWVLSI  187

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLS  215
            +GSCC+F+TLFYIA VLL TVPVLYEKYED+VDAF EKAM E+KKQYAV D    +KV+S
Sbjct  188  LGSCCNFVTLFYIATVLLFTVPVLYEKYEDQVDAFGEKAMKEIKKQYAVLDEKVLSKVMS  247

Query  214  KIPRGPLKDKK  182
            KIPRG L  KK
Sbjct  248  KIPRGALTKKK  258



>tpg|DAA52789.1| TPA: seed maturation protein [Zea mays]
Length=283

 Score =   256 bits (655),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNK IS GVLGGATAIWILFE+L YHLLT VCHGLI AL VLFLWSNASSF
Sbjct  96   GKPADVFLWRNKNISAGVLGGATAIWILFELLGYHLLTFVCHGLIFALGVLFLWSNASSF  155

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IPEV IPE+ V+  A + R ++N   A LR IA GRDLK FLMVI G W++S+
Sbjct  156  IHKAPPKIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGRDLKKFLMVIAGFWLLSV  215

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTL YI  V+LHTVPVLYEKYED++D++ EK   E+KKQYAVFD KVLSK+PR
Sbjct  216  LGSCCNFLTLVYIVFVVLHTVPVLYEKYEDQIDSYGEKGWVEIKKQYAVFDEKVLSKVPR  275

Query  202  GPLKDKK  182
            GP KDKK
Sbjct  276  GPAKDKK  282



>ref|XP_003565836.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=286

 Score =   256 bits (654),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVF+WRNK IS GVLGGATAIWILFE+L YHLL  +CHGLI +L VLFLWSNASSF
Sbjct  99   GKPADVFMWRNKNISAGVLGGATAIWILFELLGYHLLAFLCHGLIFSLGVLFLWSNASSF  158

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV IPE+ V+  A + R+++N   A LR+IA GRD+K FL+VI GLW++SI
Sbjct  159  INKSPPRIPEVIIPEDLVVNVALSTRHEINRAFANLREIALGRDIKKFLIVIAGLWLLSI  218

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTL YI  V+LHTVPVLYEKYED++D++ EK   E+KKQY+VFDAKVLSK+PR
Sbjct  219  LGSCCNFLTLVYIVFVVLHTVPVLYEKYEDQIDSYGEKGWVEVKKQYSVFDAKVLSKVPR  278

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  279  GPLKDKK  285



>gb|KHG09260.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=252

 Score =   255 bits (651),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+ LWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLWSNA+ F
Sbjct  64   GKPADILLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWSNATQF  123

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS PHIPEV IP+EPVL+FA ALR ++N   AVLRDIA GRDLKMFL VI GLW++SI
Sbjct  124  INKSTPHIPEVQIPKEPVLEFAMALRFEINRAFAVLRDIALGRDLKMFLSVIAGLWVLSI  183

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFYI  V+LHTVPVLYEKYED+VD FAEKAMHE+KKQYAVFDAKVLSKIP 
Sbjct  184  VGSWCNFLTLFYIVFVVLHTVPVLYEKYEDKVDPFAEKAMHEIKKQYAVFDAKVLSKIPM  243

Query  202  GPLKDKK  182
            GPLK KK
Sbjct  244  GPLKQKK  250



>ref|XP_009388111.1| PREDICTED: reticulon-like protein B1 [Musa acuminata subsp. malaccensis]
Length=258

 Score =   255 bits (651),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 151/188 (80%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKK+S   LGGATAIW+LFE++EYHLLT VCH LIL+LA++FLWSNAS+F
Sbjct  70   GKPADVFLWRNKKVSAATLGGATAIWVLFELMEYHLLTFVCHSLILSLAIMFLWSNASTF  129

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV IPE+  +  A +LR ++N   A LRDIA GRDLK FL VI GLW+ SI
Sbjct  130  INKSPPRIPEVSIPEDMAVNIALSLRYEINWAFAALRDIALGRDLKKFLSVIAGLWVFSI  189

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G+ C+FLTLFYIA V LHTVP LYEKYED+VDAFAEKA  E KK Y+V  AK LSKIP+
Sbjct  190  IGNFCNFLTLFYIAFVTLHTVPPLYEKYEDKVDAFAEKAQTEFKKHYSVIHAKYLSKIPK  249

Query  202  GPLKDKKL  179
            GPLKDKK 
Sbjct  250  GPLKDKKF  257



>ref|XP_011022600.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=250

 Score =   254 bits (650),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKKIS G+LGGATAIW+LFE+LE HLLT VC+ LILAL +LFLWSNAS+F
Sbjct  62   GKPADIFLWRNKKISAGLLGGATAIWVLFELLECHLLTLVCYFLILALVLLFLWSNASTF  121

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS PHIPEV IPEEPVLQ A+AL  ++N   +VLRDIASGRDLK FL VI GLW++SI
Sbjct  122  INKSPPHIPEVRIPEEPVLQIAAALTTEINWAFSVLRDIASGRDLKKFLSVIAGLWVLSI  181

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFYIA VLLHTVPV YEKYED+VDAFAEKAM E+KKQYAVFDAKVLSKIPR
Sbjct  182  VGSWCNFLTLFYIAFVLLHTVPVFYEKYEDQVDAFAEKAMIEIKKQYAVFDAKVLSKIPR  241

Query  202  GPLKDKK  182
            GPLK KK
Sbjct  242  GPLKGKK  248



>ref|XP_006288443.1| hypothetical protein CARUB_v10001704mg [Capsella rubella]
 gb|EOA21341.1| hypothetical protein CARUB_v10001704mg [Capsella rubella]
Length=271

 Score =   255 bits (651),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA+ F
Sbjct  83   GKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMF  142

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGRDLK FL  I GLW++SI
Sbjct  143  IHKSPPKIPEVHIPEEPLLQLASGLRIEINRGFSSLREIASGRDLKKFLSAIAGLWVLSI  202

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G CC FLTL YIA+VLL TVP+LY+KYED+VD++ EKAM ELKKQYAV DAKVLSKIPR
Sbjct  203  LGGCCSFLTLSYIALVLLFTVPLLYDKYEDKVDSYGEKAMAELKKQYAVLDAKVLSKIPR  262

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  263  GPLKDKK  269



>ref|XP_010541290.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   255 bits (651),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+WRNKK+S GVLGG TA+W+LFE+++YHLLT  CH LI+ LAVLFLWSNAS F
Sbjct  79   GKPADIFMWRNKKMSGGVLGGITAVWVLFELMQYHLLTLFCHILIVVLAVLFLWSNASIF  138

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPEE +LQ AS LR ++N     LRDIASGRDLK FL  I GLW++S+
Sbjct  139  INKSPPKIPEVHIPEEHILQLASGLRIEINRAFTCLRDIASGRDLKKFLSAIAGLWVLSV  198

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GS C+FLTL YIA+V+L TVPV+YEKYED+VDAF EKAM E+KKQYAV D KV SKIPR
Sbjct  199  IGSWCNFLTLSYIAMVMLFTVPVMYEKYEDKVDAFGEKAMVEIKKQYAVLDEKVFSKIPR  258

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  259  GPLKDKK  265



>emb|CDP08746.1| unnamed protein product [Coffea canephora]
Length=263

 Score =   254 bits (650),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNK+IS  VLGGATA+W+LFE+LEYHLLT VCH LILALA+LFLWSNA++F
Sbjct  75   GKPADVFLWRNKRISAAVLGGATAVWVLFELLEYHLLTLVCHILILALAILFLWSNATTF  134

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV + EEP LQ A+A+R ++N  LAVLR+IASGRDLK FL V++GLW  SI
Sbjct  135  INKSPPRIPEVRLSEEPFLQVAAAVRFEINRALAVLREIASGRDLKKFLAVVSGLWFFSI  194

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GS C+FLTLFYI  VLLHT+PVLYEKYED+VD+FAEKAM E++K+YAVFD KVLSKIPR
Sbjct  195  LGSYCNFLTLFYITFVLLHTLPVLYEKYEDKVDSFAEKAMIEIRKKYAVFDEKVLSKIPR  254

Query  202  GPLKDKKLA  176
            GP KDKK A
Sbjct  255  GPSKDKKRA  263



>ref|XP_008437352.1| PREDICTED: reticulon-like protein B2 [Cucumis melo]
Length=257

 Score =   254 bits (649),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWR+KK+S GVLGGAT  WILFE+LEYH LT +CH  + ALAV+FLWSNAS F
Sbjct  69   GKPADIFLWRDKKLSGGVLGGATIAWILFELLEYHFLTLICHIFMAALAVVFLWSNASFF  128

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS PHIP+VHIPE+PV++ ASALR ++N  +AVLRDIASGRDLK FL  I GLW++SI
Sbjct  129  INKSLPHIPQVHIPEDPVIEIASALRVEINRAIAVLRDIASGRDLKSFLYAIAGLWVLSI  188

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GS  +FLTL YI V++L TVPV YEKY+D+VDAFAEKAM E+KKQY VFDAKVLSKIPR
Sbjct  189  LGSWFNFLTLLYIGVIVLFTVPVFYEKYDDKVDAFAEKAMAEIKKQYVVFDAKVLSKIPR  248

Query  202  GPLKDKKLA  176
            GPLKDKK+A
Sbjct  249  GPLKDKKIA  257



>ref|XP_002511930.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50599.1| conserved hypothetical protein [Ricinus communis]
Length=253

 Score =   254 bits (648),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 156/188 (83%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS  VLG ATAIWILFE++EYHLLT VCH  IL LA+LFLWSNA +F
Sbjct  66   GKPADVFLWRNKKISASVLGTATAIWILFELIEYHLLTLVCHISILTLAILFLWSNAHTF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IP+VHIPEEPVLQ ASAL  ++NH  AVLR IASG+DLK FL+VI   W +SI
Sbjct  126  INKTPPRIPQVHIPEEPVLQVASALTMEINHGFAVLRSIASGKDLKKFLVVIAAFWALSI  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG  C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKAM E+KKQYA+FDAKVLSKIP 
Sbjct  186  VGCWCNFLTLFYITFVLLHTVPVLYEKYEDKVDPFAEKAMIEIKKQYAMFDAKVLSKIPV  245

Query  202  GPLKDKKL  179
            G LK K++
Sbjct  246  GALKAKRV  253



>ref|XP_002303615.1| reticulon family protein [Populus trichocarpa]
 gb|EEE78594.1| reticulon family protein [Populus trichocarpa]
Length=250

 Score =   254 bits (648),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKKIS GVLGGATAIW+LFE+LE HLLT VC+ LILALA+LFLWSNAS+F
Sbjct  62   GKPADIFLWRNKKISAGVLGGATAIWVLFELLECHLLTLVCYFLILALALLFLWSNASTF  121

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS PHIPEV IPEEPVLQ A+ALR ++N   +VLRDIASGRDLK FL VI GLW++SI
Sbjct  122  INKSPPHIPEVRIPEEPVLQIAAALRIEINWAFSVLRDIASGRDLKKFLTVIAGLWVLSI  181

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFYIA VLL+TVPV YEKYED+VDAFAEKAM E+KKQYAVFDAKVLSKIP 
Sbjct  182  VGSWCNFLTLFYIAFVLLYTVPVFYEKYEDQVDAFAEKAMIEIKKQYAVFDAKVLSKIPM  241

Query  202  GPLKDKK  182
            GPLK KK
Sbjct  242  GPLKGKK  248



>ref|XP_009415169.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   254 bits (648),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLW+NKK S  VLGGATAIW+LFE++EYHLLT VCH LIL+LA+LFLWSNA++F
Sbjct  63   GKPADVFLWKNKKASAIVLGGATAIWVLFELMEYHLLTLVCHCLILSLAILFLWSNATTF  122

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS PHIPEV IPE+  +  A +LR ++N   AVLR+IA+GRD+K FL VI GLW++S+
Sbjct  123  INKSPPHIPEVIIPEDLSVNIALSLRYEINRGFAVLREIAAGRDVKKFLAVIVGLWVLSV  182

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G+CC+FLTLFYIA V LHTVP LY+KYED+VD+FAEKA  E KK YAV  AK LSKIPR
Sbjct  183  IGNCCNFLTLFYIAFVTLHTVPFLYDKYEDQVDSFAEKATVEFKKHYAVIHAKYLSKIPR  242

Query  202  GPLKDKKL  179
            GPLKDKK+
Sbjct  243  GPLKDKKV  250



>dbj|BAB32723.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAB92114.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ11106.1| hypothetical protein OsJ_00954 [Oryza sativa Japonica Group]
Length=279

 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VCHGLI +L +LFLWSNASSF
Sbjct  92   GKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHGLIFSLGLLFLWSNASSF  151

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV IPE+ V+  A + R ++N   A LR IA GRD+K FL+VI GLW++S+
Sbjct  152  INKSPPRIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGRDIKKFLIVIAGLWLLSV  211

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTL YI  V+LHTVP+LYEKYED++D++ EK   E+KKQYAV DAKVLSK+PR
Sbjct  212  LGSCCNFLTLVYIVFVVLHTVPILYEKYEDQIDSYGEKGWVEIKKQYAVLDAKVLSKVPR  271

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  272  GPLKDKK  278



>ref|XP_010529625.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   254 bits (649),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+WRNKK+S  VLGG TA+W+LFE+ EYHLLT +CH LI  +AVLFLWSNAS F
Sbjct  79   GKPADIFMWRNKKMSASVLGGITAVWVLFELAEYHLLTLLCHVLIAVIAVLFLWSNASMF  138

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPEEP+LQ AS LR ++N     LRDIASGRDLK FL  I GLW++SI
Sbjct  139  IHKSPPKIPEVHIPEEPILQLASGLRIEINRAFTCLRDIASGRDLKKFLSAIAGLWVLSI  198

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G CC+FLTL YIA+V+L T+PVLYEKYED+VDA+ EKAM E+KKQYAV D KVLSKIPR
Sbjct  199  LGGCCNFLTLSYIAMVMLFTIPVLYEKYEDKVDAYGEKAMVEIKKQYAVLDEKVLSKIPR  258

Query  202  GPLKDKK  182
            GPLK KK
Sbjct  259  GPLKGKK  265



>gb|KHG20258.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=251

 Score =   253 bits (646),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GKQAD+FLWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLWSNA++F
Sbjct  63   GKQADIFLWRNKKISAGTLGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWSNAATF  122

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV IP++PVL+FA ALR ++N   AVLRDIASGRDLK FL VI GLW+ SI
Sbjct  123  IHKSPPRIPEVQIPKDPVLEFAQALRFEINRGFAVLRDIASGRDLKKFLSVIVGLWVSSI  182

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFYI  VLLHTVPVLYEKYED+VD  AEKA HE+KKQYAVFDAKVLSKIP+
Sbjct  183  VGSWCNFLTLFYIVFVLLHTVPVLYEKYEDKVDPLAEKAWHEIKKQYAVFDAKVLSKIPK  242

Query  202  GPLKDKK  182
             PLK+KK
Sbjct  243  RPLKEKK  249



>ref|XP_006366650.1| PREDICTED: putative 24 kDa seed maturation protein-like protein 
[Solanum tuberosum]
Length=403

 Score =   258 bits (659),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWR+KKI+ GVLG AT++W+LFE+L+YHLLT VCH LILALAVLFLWSNAS+F
Sbjct  215  GKPADIFLWRDKKITAGVLGFATSLWVLFELLQYHLLTLVCHILILALAVLFLWSNASTF  274

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IP+V +PE+ VL  A+ALR ++N  L + RDIASG++LK FL VI GLW++SI
Sbjct  275  INKSPPQIPDVILPEDIVLGVAAALRIEINKALEIFRDIASGKELKKFLAVIAGLWVLSI  334

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G+C +FLTLFYI  VLLHTVPVLYEK+ED+VDAFAE A  E+KKQYAVF+ KVLSKIPR
Sbjct  335  LGNCWNFLTLFYICFVLLHTVPVLYEKFEDQVDAFAENAEAEIKKQYAVFNVKVLSKIPR  394

Query  202  GPLKDKKL  179
            GPLKDKK 
Sbjct  395  GPLKDKKF  402



>ref|XP_008655792.1| PREDICTED: reticulon-like protein B1 [Zea mays]
 gb|AFW80459.1| hypothetical protein ZEAMMB73_353444 [Zea mays]
Length=279

 Score =   254 bits (648),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 151/187 (81%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VCHGLI +L VLFLWSNASSF
Sbjct  92   GKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHGLIFSLGVLFLWSNASSF  151

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV IPE+ V+  A + R ++N   A LR IA GRD+K FLMVI GLW++S+
Sbjct  152  IHKSPPKIPEVVIPEDLVVNIAVSTRYEINRAFANLRRIALGRDIKKFLMVIAGLWLLSV  211

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+ LTL YI  V+LHTVPVLYEKYED++D + EK   E+KKQYAVFD KVLSK+PR
Sbjct  212  LGSCCNLLTLVYIVFVVLHTVPVLYEKYEDQIDTYGEKGWVEIKKQYAVFDEKVLSKVPR  271

Query  202  GPLKDKK  182
            GP KDKK
Sbjct  272  GPAKDKK  278



>gb|KDP28552.1| hypothetical protein JCGZ_14323 [Jatropha curcas]
Length=254

 Score =   253 bits (646),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 158/188 (84%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LWRNKKIS  VLG ATAIW+LFE++EYHLLT  CH LIL+LAVLFLWSNA +F
Sbjct  67   GKPADVLLWRNKKISASVLGVATAIWVLFELIEYHLLTLACHILILSLAVLFLWSNAHTF  126

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IP++H+PEEP L  ASAL  ++N  LAVLRDIASG+DLK FL+VI  LW++SI
Sbjct  127  INKTPPRIPQIHLPEEPFLLVASALTLEINRGLAVLRDIASGKDLKKFLIVIAALWVVSI  186

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFYI+ VLLHTVPVLYEKYED+VD FAEKA  E+KKQYAVFDAKVLSKIP 
Sbjct  187  VGSWCNFLTLFYISFVLLHTVPVLYEKYEDKVDPFAEKATIEIKKQYAVFDAKVLSKIPV  246

Query  202  GPLKDKKL  179
            G LK K++
Sbjct  247  GALKAKRV  254



>ref|XP_008792378.1| PREDICTED: reticulon-like protein B3 isoform X1 [Phoenix dactylifera]
 ref|XP_008792379.1| PREDICTED: reticulon-like protein B3 isoform X1 [Phoenix dactylifera]
Length=280

 Score =   253 bits (647),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 160/215 (74%), Gaps = 29/215 (13%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKKIS GVLGGATAIW+LF+++EYHLL  VCH LIL+LA+LFLWSNA++F
Sbjct  64   GKPADIFLWRNKKISAGVLGGATAIWVLFDLMEYHLLALVCHCLILSLAILFLWSNATTF  123

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLM----------  413
            I KS P IPEV IPE+  + FA +LR ++N   AVLRDIASGRDLK FLM          
Sbjct  124  INKSPPRIPEVSIPEDVAVSFALSLRYEINRGFAVLRDIASGRDLKKFLMVCCSVFLSNV  183

Query  412  -------------------VITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDE  290
                               VI GLW++SIVGSCC+FLTLFYIA V LHT+PVLYEKYED+
Sbjct  184  SGSWSISMGVILFGILVFQVIAGLWVLSIVGSCCNFLTLFYIAFVTLHTLPVLYEKYEDK  243

Query  289  VDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDK  185
            VD+FAEKAM ++KK YA F+AK LSKIPRGPLK K
Sbjct  244  VDSFAEKAMTKVKKNYATFNAKCLSKIPRGPLKKK  278



>ref|NP_001056102.1| Os05g0526400 [Oryza sativa Japonica Group]
 gb|AAU44062.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18016.1| Os05g0526400 [Oryza sativa Japonica Group]
 dbj|BAG96540.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00639.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64429.1| hypothetical protein OsJ_19273 [Oryza sativa Japonica Group]
Length=251

 Score =   253 bits (645),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKKISVGVL GATAIW+LFEV++YHLLT +CH +IL LA+LFLWSNAS+F
Sbjct  64   GKPADLFLWRNKKISVGVLAGATAIWLLFEVMDYHLLTLLCHCIILTLAMLFLWSNASTF  123

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P+IPEV IPE+  +  A +LR ++N   A LR+I  G DLK FL+V+ GLW++S+
Sbjct  124  INKSPPNIPEVKIPEDLAVNVARSLRFEINRGFATLREIGQGHDLKKFLIVVVGLWVLSV  183

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTLFYI  ++L+TVPVLYEKYED++DAF EKAM ELKK YA+FD K LSKIP+
Sbjct  184  LGSCCNFLTLFYIVFMVLYTVPVLYEKYEDQIDAFGEKAMIELKKYYAIFDEKCLSKIPK  243

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  244  GPLKNKK  250



>ref|XP_004143883.1| PREDICTED: reticulon-like protein B2-like [Cucumis sativus]
 ref|XP_004170740.1| PREDICTED: reticulon-like protein B2-like [Cucumis sativus]
 gb|KGN50045.1| hypothetical protein Csa_5G151610 [Cucumis sativus]
Length=257

 Score =   252 bits (644),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWR+KK+S GVLGGAT  WILFE+LEYH LT +CH  + ALAV+FLWSNAS F
Sbjct  69   GKPADIFLWRDKKLSGGVLGGATIAWILFELLEYHFLTLICHIFMAALAVVFLWSNASFF  128

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS PHIP+VHIPE PV++ ASALR ++N  +AVLR+IASGRDLK FL  I GLW++SI
Sbjct  129  INKSLPHIPQVHIPEGPVVEIASALRVEINRAIAVLREIASGRDLKSFLYAIAGLWVLSI  188

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS  +FLTL YI V++L TVP+ YEKY+D+VDAFAEKAM E+KKQY VFDAKVLSKIPR
Sbjct  189  VGSWFNFLTLLYIGVIVLFTVPLFYEKYDDKVDAFAEKAMAEIKKQYVVFDAKVLSKIPR  248

Query  202  GPLKDKKLA  176
            GPLKDKK+A
Sbjct  249  GPLKDKKIA  257



>ref|XP_004969875.1| PREDICTED: reticulon-like protein B1-like [Setaria italica]
Length=257

 Score =   252 bits (644),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+ LWRNKKIS GVL  ATAIW+LFEV+EYHLLT VCH LIL+LA+LFLWSNAS+F
Sbjct  70   GKTADLVLWRNKKISGGVLASATAIWLLFEVMEYHLLTLVCHCLILSLAILFLWSNASTF  129

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P+IPEV I E+  +  A +LR ++N   A LR+I  GRDLK FL+VI G W++S+
Sbjct  130  INKSPPNIPEVKISEDVAVNVALSLRYEINRGFATLREIGHGRDLKKFLIVIAGFWLLSV  189

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTLFYI  V+L+TVPVLYEKYED+VDAF EKAM ELKK YA+FD K LSKIP+
Sbjct  190  LGSCCNFLTLFYIVFVVLYTVPVLYEKYEDKVDAFGEKAMIELKKYYAIFDEKCLSKIPK  249

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  250  GPLKDKK  256



>ref|XP_009416410.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 152/188 (81%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLW+NKK S  VLGGATAIWILFE++EYHLLT VCH LIL+LA+LFLWSNA++ 
Sbjct  63   GKPADVFLWKNKKASAVVLGGATAIWILFELMEYHLLTLVCHCLILSLAILFLWSNATTL  122

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS PHIP V IPE+  +  + +L  ++N   +VLR+IA+GR+LK FL VI GLWI+SI
Sbjct  123  INKSPPHIPVVSIPEDLAVNISRSLTYEINRGFSVLREIATGRELKKFLAVIAGLWILSI  182

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTLFYIA V LHTVP LY+KYED VD FAEKA  E KK YAVF AK LSKIPR
Sbjct  183  IGSCCNFLTLFYIAFVTLHTVPFLYDKYEDRVDTFAEKATVEFKKHYAVFHAKCLSKIPR  242

Query  202  GPLKDKKL  179
            GPLKDKK 
Sbjct  243  GPLKDKKF  250



>ref|XP_002874678.1| VIRB2-interacting protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50937.1| VIRB2-interacting protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=271

 Score =   253 bits (645),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+W+NKK+S GV GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA+ F
Sbjct  83   GKPADIFMWKNKKMSGGVFGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMF  142

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPEEP+LQ  S LR ++N   + LR+IASGRDLK FL  I GLW++SI
Sbjct  143  IHKSPPKIPEVHIPEEPLLQLVSGLRIEINCGFSSLREIASGRDLKKFLSAIAGLWVLSI  202

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G CC FLTL YIA+VLL TVP+ Y+KYED+VDA+ EKAM ELKKQYAVFDAKVLSKIPR
Sbjct  203  LGGCCSFLTLAYIALVLLFTVPLFYDKYEDKVDAYGEKAMAELKKQYAVFDAKVLSKIPR  262

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  263  GPLKDKK  269



>ref|XP_008234814.1| PREDICTED: reticulon-like protein B1 [Prunus mume]
Length=259

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T VCH LIL+LAV FLWSNAS+F
Sbjct  71   GKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVCHLLILSLAVFFLWSNASTF  130

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IP+V + E  VL  ASALR ++N    +LRDIASGRDLKMFL VI  LWI+S+
Sbjct  131  INKSPPQIPKVQLSERTVLDLASALRIELNRAFHILRDIASGRDLKMFLGVIAVLWIVSL  190

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG   +FLTLFYI  VLLHT+PV+YEKY+ ++DAF+EKA+ E KKQYAVFDAKVLSKIP+
Sbjct  191  VGKWFNFLTLFYITFVLLHTLPVIYEKYDVQIDAFSEKALIEFKKQYAVFDAKVLSKIPK  250

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  251  GPLKEKK  257



>ref|XP_010261408.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
 ref|XP_010261409.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
Length=255

 Score =   251 bits (642),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 160/191 (84%), Gaps = 2/191 (1%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS  VLGGATA W+LFE+LEYH LT VCH LIL+L++LFLWSNA++F
Sbjct  65   GKPADVFLWRNKKISASVLGGATAAWVLFELLEYHFLTLVCHCLILSLSLLFLWSNATTF  124

Query  562  IKKSAphipevhi--peepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWII  389
            I KS        +  PE+PVLQFASALR ++N   +VLRDIASGRDLK FL+VI GLW++
Sbjct  125  INKSQSPPRIPEVYIPEDPVLQFASALRIEINSGFSVLRDIASGRDLKKFLVVIAGLWVL  184

Query  388  SIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKI  209
            SIVGS C+FLTLFYI  VLLHTVPV YEKYED+VD+FAEKAM E+KKQY VFDAKVLSKI
Sbjct  185  SIVGSWCNFLTLFYIVFVLLHTVPVFYEKYEDKVDSFAEKAMAEIKKQYVVFDAKVLSKI  244

Query  208  PRGPLKDKKLA  176
            PRGPLKDKK A
Sbjct  245  PRGPLKDKKRA  255



>ref|XP_004967455.1| PREDICTED: reticulon-like protein B1-like [Setaria italica]
Length=278

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 150/187 (80%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRN+ IS GVLGG TAIWILFE L YHLLT VCHGLI +L VLFLWSNASSF
Sbjct  91   GKPADVFLWRNRNISAGVLGGVTAIWILFECLGYHLLTFVCHGLIFSLGVLFLWSNASSF  150

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV IPE+ V+  A + R ++N     LR IA GRD+K FLMVI GLW++S+
Sbjct  151  INKSPPRIPEVIIPEDLVVNIALSTRYEINRAFVNLRQIALGRDIKKFLMVIAGLWLLSV  210

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTL YI  V+LHTVPVLYEKYED++D++ EK   E+KKQYAVFD KVLSK+PR
Sbjct  211  LGSCCNFLTLVYIVFVVLHTVPVLYEKYEDQIDSYGEKGWVEIKKQYAVFDEKVLSKVPR  270

Query  202  GPLKDKK  182
            GP KDKK
Sbjct  271  GPAKDKK  277



>gb|EYU23406.1| hypothetical protein MIMGU_mgv1a012325mg [Erythranthe guttata]
Length=254

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            G+ AD+ LW++KK+S GVLGG TAIW+LF++LEYHLL  VCHGLIL L  LFL+SNAS+F
Sbjct  66   GQPADLLLWKDKKVSGGVLGGVTAIWVLFDLLEYHLLALVCHGLILGLVGLFLYSNASTF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            IKKS P IP V IPEEPVL FASALR  +N   A LRDIASG+DLK FL VI GLW++S 
Sbjct  126  IKKSPPKIPVVSIPEEPVLNFASALRIGINEGFATLRDIASGKDLKKFLSVIAGLWVLSF  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
             GSCCDFLTL Y   VLL TVP++Y+KYED+VD FAEKAM E+KKQYAVF+ KVLSKIPR
Sbjct  186  FGSCCDFLTLLYSITVLLFTVPLVYDKYEDQVDCFAEKAMVEIKKQYAVFNTKVLSKIPR  245

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  246  GPLKEKK  252



>gb|EMS62606.1| Reticulon-like protein B1 [Triticum urartu]
Length=248

 Score =   251 bits (640),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKKIS GVL GATAIW+LFEVLEYHLLT +CHG IL L +LFLWSNAS+F
Sbjct  60   GKPADLFLWRNKKISGGVLAGATAIWLLFEVLEYHLLTLLCHGFILTLGILFLWSNASAF  119

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            + K  P+IPEV IPE+  +  A +LR ++N   A LR I  GRDLK FL+V+ GLWI+S 
Sbjct  120  VNKCPPNIPEVKIPEDLAVNVARSLRYEINRGFASLRAIGQGRDLKKFLIVVAGLWILSF  179

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTLFYI  ++L+TVPVLYEKYED++DAF EKAM ELKK YA+FD K LSKIP+
Sbjct  180  LGSCCNFLTLFYIVFMVLYTVPVLYEKYEDKIDAFGEKAMVELKKYYAIFDEKCLSKIPK  239

Query  202  GPLKDKK  182
            GP KDKK
Sbjct  240  GPSKDKK  246



>ref|XP_011073407.1| PREDICTED: reticulon-like protein B2 isoform X1 [Sesamum indicum]
Length=248

 Score =   251 bits (640),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 152/187 (81%), Gaps = 6/187 (3%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLW          GGATAIW+LF+VLEYHLLT VCHGLI+ LA+LFLWS+  +F
Sbjct  66   GKPADIFLWXX------XXGGATAIWVLFDVLEYHLLTLVCHGLIVGLALLFLWSSIMTF  119

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV IPEEP L+FASALR ++NH  AVLRDIASGRDLK FL V+ GLWI+S+
Sbjct  120  INKSPPRIPEVSIPEEPALKFASALRVEINHGFAVLRDIASGRDLKKFLSVVAGLWILSV  179

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG CCDFLTL Y   VLL TVP+ YEKYED+VD+FAEKAM E+KKQY VFDA+VLSKIPR
Sbjct  180  VGGCCDFLTLLYTITVLLFTVPLFYEKYEDQVDSFAEKAMAEVKKQYVVFDARVLSKIPR  239

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  240  GPLKDKK  246



>ref|XP_006360189.1| PREDICTED: reticulon-like protein B2-like [Solanum tuberosum]
Length=253

 Score =   251 bits (640),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWR+KK++ GVLG AT IW LFE+LEYHLLT VCH LI+A+AVLFLWSNAS+F
Sbjct  66   GKPADIFLWRDKKVTAGVLGFATVIWALFELLEYHLLTLVCHILIVAVAVLFLWSNASAF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I  + P IPEV +P++ VL  ASALR ++N  L +LRDIASG+DLK FL+VI GLW++S+
Sbjct  126  INTAPPQIPEVVLPKDIVLGVASALRIEINRALEILRDIASGKDLKKFLVVIVGLWVVSV  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G+  +FLTLFYI  VLLHTVP+LYEKYED+VDAFAEKA  E+KK YAVFDA VLSKIPR
Sbjct  186  LGNIWNFLTLFYIVFVLLHTVPLLYEKYEDKVDAFAEKAEAEIKKHYAVFDANVLSKIPR  245

Query  202  GPLKDKK  182
            GPLK KK
Sbjct  246  GPLKGKK  252



>ref|XP_008232963.1| PREDICTED: reticulon-like protein B6 [Prunus mume]
Length=257

 Score =   250 bits (639),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 157/187 (84%), Gaps = 1/187 (1%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKK+S GVLGGATA+W+LFE+LEYHLLT V H LI  LAVLFLWSNA SF
Sbjct  71   GKPADVFLWRNKKVSAGVLGGATAVWVLFELLEYHLLTLVGHILIGTLAVLFLWSNAHSF  130

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IPEVH+PEEP LQ AS LR  +N   AVL DIASGR+LK FL+VI GLW++SI
Sbjct  131  IHKTPPRIPEVHLPEEPFLQVASELRLQINWAFAVLHDIASGRELKKFLIVIAGLWVLSI  190

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG+ C+FLTLFYI+ VLLHTVPV+YEKYED++D FAEKA  E KK YAVFDAKVLSKIP+
Sbjct  191  VGTWCNFLTLFYISFVLLHTVPVIYEKYEDKIDPFAEKATIEFKKHYAVFDAKVLSKIPQ  250

Query  202  GPLKDKK  182
            G LK+K+
Sbjct  251  G-LKNKR  256



>gb|EMT19773.1| Reticulon-like protein B1 [Aegilops tauschii]
Length=286

 Score =   251 bits (642),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVF+WRNK IS GVLGGATAIWILFE+L YHLL  + H LI +L VLFLWSNASSF
Sbjct  99   GKPADVFMWRNKHISAGVLGGATAIWILFELLGYHLLAFLGHALIFSLGVLFLWSNASSF  158

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV IPE+ V+  A + R+++N   A LR IA GRD+K FL+VI GLW++SI
Sbjct  159  INKSPPKIPEVIIPEDLVVNIALSTRHEINRAFANLRQIALGRDIKKFLIVIAGLWLLSI  218

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTLFYI  V+LHTVPV+YEKYED++D + EK   E+KKQYAVFDAKVLSK+PR
Sbjct  219  LGSCCNFLTLFYIVFVVLHTVPVIYEKYEDQIDTYGEKGWIEVKKQYAVFDAKVLSKVPR  278

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  279  GPLKDKK  285



>ref|XP_009772131.1| PREDICTED: reticulon-like protein B2 [Nicotiana sylvestris]
Length=260

 Score =   250 bits (639),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK A++FLWR+KK+S GVLG AT IW LFE+L+YHLLT VCH LI+A+ VLFLWSNAS+F
Sbjct  72   GKPAEIFLWRDKKVSAGVLGFATVIWALFELLQYHLLTLVCHILIVAITVLFLWSNASAF  131

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I  + P IPEV +P + VL  ASALR ++N  L +LRDIASG+DLK FL+VI GLW++SI
Sbjct  132  INTAPPQIPEVVLPRDIVLGVASALRIEMNRILEILRDIASGKDLKKFLVVILGLWVVSI  191

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G+C +FLTLFYI  VLLHTVPVLY+KYED+VDAFAEKA  E+KK YAVF+ +VLSKIPR
Sbjct  192  LGNCWNFLTLFYIVFVLLHTVPVLYDKYEDKVDAFAEKAEAEIKKHYAVFNDQVLSKIPR  251

Query  202  GPLKDKKLA  176
            GPL+DK+LA
Sbjct  252  GPLRDKRLA  260



>ref|XP_006847055.1| hypothetical protein AMTR_s00017p00194840 [Amborella trichopoda]
 gb|ERN08636.1| hypothetical protein AMTR_s00017p00194840 [Amborella trichopoda]
Length=291

 Score =   251 bits (641),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS  VLGGAT IWILFE LEYH +T +CH LIL LA+LFLWSN ++F
Sbjct  104  GKPADVFLWRNKKISASVLGGATLIWILFECLEYHFVTLLCHCLILTLALLFLWSNGTAF  163

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS PHIPEV IPE+     A +LR ++N   +VLRDIASGRDLKMFL V+ GLW++SI
Sbjct  164  INKSPPHIPEVKIPEDVATNIALSLRYEINRAFSVLRDIASGRDLKMFLTVVAGLWVLSI  223

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTLFYI  V+LHTVPVLYEKYED+VD+F+EKAM E+KKQYAVFDAKVLSKIPR
Sbjct  224  LGSCCNFLTLFYITFVVLHTVPVLYEKYEDQVDSFSEKAMIEIKKQYAVFDAKVLSKIPR  283

Query  202  GPLKDKK  182
            GPLK KK
Sbjct  284  GPLKSKK  290



>ref|XP_006374289.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52086.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=254

 Score =   249 bits (637),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS GVLGGATA+W+ FE+LEYHL+T VCH  I +LAVLFLWSNAS+F
Sbjct  66   GKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVLFLWSNASNF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            + KS P IPEV +PE+ V + AS LR ++N   AVL DIASGRDLK FL VI GL ++S+
Sbjct  126  LNKSPPKIPEVLLPEKWVREVASGLRIEINRGFAVLHDIASGRDLKKFLAVIAGLLVLSL  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGSCC+FLTL YI+ VLLHTVPVLYEKYED+VD  +EKA  ++KKQYAV D K +SKIPR
Sbjct  186  VGSCCNFLTLLYISFVLLHTVPVLYEKYEDQVDGNSEKAWTQIKKQYAVLDEKYISKIPR  245

Query  202  GPLKDKK  182
            GP K+KK
Sbjct  246  GPFKEKK  252



>ref|XP_006374290.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52087.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=263

 Score =   250 bits (638),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS GVLGGATA+W+ FE+LEYHL+T VCH  I +LAVLFLWSNAS+F
Sbjct  75   GKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVLFLWSNASNF  134

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            + KS P IPEV +PE+ V + AS LR ++N   AVL DIASGRDLK FL VI GL ++S+
Sbjct  135  LNKSPPKIPEVLLPEKWVREVASGLRIEINRGFAVLHDIASGRDLKKFLAVIAGLLVLSL  194

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGSCC+FLTL YI+ VLLHTVPVLYEKYED+VD  +EKA  ++KKQYAV D K +SKIPR
Sbjct  195  VGSCCNFLTLLYISFVLLHTVPVLYEKYEDQVDGNSEKAWTQIKKQYAVLDEKYISKIPR  254

Query  202  GPLKDKK  182
            GP K+KK
Sbjct  255  GPFKEKK  261



>emb|CDJ26559.1| unnamed protein product, partial [Triticum aestivum]
Length=290

 Score =   251 bits (640),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVF+WRNK +S GVLGGATAIWILFE+L YHLL  + H LI +L VLFLWSNASSF
Sbjct  103  GKPADVFMWRNKHVSAGVLGGATAIWILFELLGYHLLAFLGHALIFSLGVLFLWSNASSF  162

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV IPE+ V+  A + R+++N   A LR IA GRD+K FL+VI GLW++SI
Sbjct  163  INKSPPRIPEVIIPEDLVVNIALSTRHEINRAFANLRQIALGRDIKKFLIVIAGLWLLSI  222

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTLFYI  V+LHTVPV+YEKYED++D + EK   E+KKQYAVFDAKVLSK+PR
Sbjct  223  LGSCCNFLTLFYIVFVVLHTVPVIYEKYEDQIDTYGEKGWIEVKKQYAVFDAKVLSKVPR  282

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  283  GPLKDKK  289



>emb|CDP05124.1| unnamed protein product [Coffea canephora]
Length=256

 Score =   249 bits (637),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 161/188 (86%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWR+KKIS  VLG  TAIW+LFE+LEY+LLT VCH LILALAVLFLWSNAS+F
Sbjct  68   GKPADVFLWRDKKISASVLGVVTAIWVLFELLEYYLLTLVCHILILALAVLFLWSNASTF  127

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P  PEV +PE+ VL  ASALR +VN  LA LR+IASGRDLK FL VI GLW+ SI
Sbjct  128  INKSPPQFPEVILPEDIVLGVASALRIEVNRALAALREIASGRDLKKFLAVIAGLWVFSI  187

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTLFYI+ +LLHTVPVLYEKYED+VD+FAEKA  E+KKQYAVF+AKVLSKIPR
Sbjct  188  LGSCCNFLTLFYISFILLHTVPVLYEKYEDQVDSFAEKAEAEIKKQYAVFNAKVLSKIPR  247

Query  202  GPLKDKKL  179
            GPLKDKK 
Sbjct  248  GPLKDKKF  255



>ref|XP_010092876.1| Reticulon-like protein [Morus notabilis]
 gb|EXB52694.1| Reticulon-like protein [Morus notabilis]
Length=255

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 153/189 (81%), Gaps = 0/189 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LWRNKKIS   LGG T  W+ FE+LEYHLLT VC+ LI++LA+LFLWSNA +F
Sbjct  67   GKPADVLLWRNKKISASFLGGVTGAWVFFELLEYHLLTLVCYTLIVSLAILFLWSNAHTF  126

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPE+P LQ  SAL  ++N   A LR IASGRDLK FL+VI GLW++SI
Sbjct  127  IHKSPPRIPEVHIPEDPFLQVVSALTIEINQGFAALRSIASGRDLKKFLIVIAGLWVLSI  186

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS  +FLTLFYI+VVLLHTVPVLYEKYED++D  AEKA+ ELKKQY VFD KVLSKIP+
Sbjct  187  VGSWANFLTLFYISVVLLHTVPVLYEKYEDKIDPLAEKALIELKKQYTVFDEKVLSKIPK  246

Query  202  GPLKDKKLA  176
            GPLK KK A
Sbjct  247  GPLKGKKRA  255



>ref|XP_009134231.1| PREDICTED: reticulon-like protein B2 [Brassica rapa]
Length=267

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+W+NKK+S GVLGGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA+ F
Sbjct  79   GKPADIFMWKNKKMSGGVLGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMF  138

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPE+P+LQ AS LR ++N   + L +IASGRDLK FL  + GLWI+SI
Sbjct  139  IHKSPPKIPEVHIPEDPLLQLASGLRIEINRGFSSLHEIASGRDLKKFLSALFGLWILSI  198

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G CC FLTL YIA+VLL TVP++Y+KYED+VD++ EKAM ELKKQYAV DAKVLSKIPR
Sbjct  199  LGGCCSFLTLAYIALVLLFTVPLVYDKYEDKVDSYGEKAMAELKKQYAVLDAKVLSKIPR  258

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  259  GPLKDKK  265



>ref|XP_004240710.1| PREDICTED: reticulon-like protein B6 [Solanum lycopersicum]
Length=253

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWR+KK++ GVLG AT IW LFE+LEYHLLT VCH LI+A+AVLFLWSNAS+F
Sbjct  66   GKPADVFLWRDKKVTAGVLGFATVIWALFELLEYHLLTLVCHILIVAVAVLFLWSNASAF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I  + PHIPEV +P++ VL  ASALR ++N  L +LRDIASG+DLK FL+VI GLWI+SI
Sbjct  126  INTAPPHIPEVVLPKDIVLSVASALRIEINRALEILRDIASGKDLKKFLVVIVGLWIVSI  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G+  +FLTLFYI  VLLHTVPVLYEK+ED+VDA AEKA  E+KK YAVFDA VLSKIPR
Sbjct  186  LGNIWNFLTLFYIVFVLLHTVPVLYEKHEDKVDAVAEKAEAEIKKHYAVFDANVLSKIPR  245

Query  202  GPLKDKK  182
            GPLK KK
Sbjct  246  GPLKGKK  252



>ref|XP_008376662.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=261

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T VCH LIL+LAV FLWS AS+F
Sbjct  73   GKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVCHLLILSLAVFFLWSYASTF  132

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IP+V IPE+ VL+ ASALR ++N    VLRDIASGRDLK FL VI  LWI+S+
Sbjct  133  INKSPPQIPKVQIPEKTVLELASALRIEINKGFYVLRDIASGRDLKTFLGVIAVLWILSV  192

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG   +FLTLFYI  VLLHT+PV+YEKY+D++DAF EKA  E+KKQYAVFDAKVLSKIPR
Sbjct  193  VGKWFNFLTLFYIIFVLLHTLPVIYEKYDDQIDAFGEKAWIEIKKQYAVFDAKVLSKIPR  252

Query  202  GPLKDKK  182
            GP+K+KK
Sbjct  253  GPVKEKK  259



>ref|XP_010422067.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=265

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA+ F
Sbjct  77   GKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMF  136

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPEEP+LQ AS LR ++N   + L +IASGRD+K FL  I GLW++SI
Sbjct  137  IHKSPPKIPEVHIPEEPLLQLASGLRIEINRGFSSLHEIASGRDIKKFLSAIFGLWVLSI  196

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G CC FLTL YIA+VLL TVP++Y+KYED++D + EKAM ELKKQYAVFDAKVLSKIPR
Sbjct  197  LGGCCSFLTLAYIALVLLFTVPLIYDKYEDKIDPYGEKAMAELKKQYAVFDAKVLSKIPR  256

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  257  GPLKNKK  263



>ref|XP_009406786.1| PREDICTED: reticulon-like protein B1 isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406787.1| PREDICTED: reticulon-like protein B1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=252

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 150/188 (80%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLW+NKK S  VLGGATAIWI FE++EYHLLT  CH LIL+LA++FLWSNA+  
Sbjct  64   GKPADVFLWKNKKASAAVLGGATAIWIFFELMEYHLLTLFCHCLILSLAIIFLWSNATFL  123

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS PHIP V IPE  V+  A +LR ++N   AVLR+IA+GRDLK FL+VI GLW++S 
Sbjct  124  INKSPPHIPVVSIPENLVVDIALSLRYEINRGFAVLREIATGRDLKKFLIVIAGLWVLST  183

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG CC+FLTLFYI  V LHT+P LY+KYED+VDAFAEKA  E KK YAVF AK LSKIPR
Sbjct  184  VGRCCNFLTLFYIVFVTLHTLPFLYDKYEDKVDAFAEKASVEFKKHYAVFQAKYLSKIPR  243

Query  202  GPLKDKKL  179
            GPLKDKK 
Sbjct  244  GPLKDKKF  251



>ref|XP_007218819.1| hypothetical protein PRUPE_ppa010065mg [Prunus persica]
 gb|EMJ20018.1| hypothetical protein PRUPE_ppa010065mg [Prunus persica]
Length=265

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T VCH LIL+LAV FLWSNAS+F
Sbjct  77   GKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVCHLLILSLAVFFLWSNASTF  136

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IP+V + E  VL  ASALR ++N    +LRDIASGRDLK FL VI  LWI+S+
Sbjct  137  INKSPPQIPKVQLSERTVLDLASALRIELNRAFHILRDIASGRDLKTFLGVIAILWILSV  196

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG   +FLTLFYI  VLLHT+PV+YEKY+ ++DAF+EKA+ E KKQYAVFDAKVLSKIP+
Sbjct  197  VGKWFNFLTLFYITFVLLHTLPVIYEKYDVQIDAFSEKALIEFKKQYAVFDAKVLSKIPK  256

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  257  GPLKEKK  263



>ref|XP_010455527.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=268

 Score =   248 bits (634),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA+ F
Sbjct  80   GKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMF  139

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPE+HIPE+P+LQ AS LR ++N   + L +IASGRD+K FL  I GLW++SI
Sbjct  140  IHKSPPKIPEIHIPEDPLLQLASGLRIEINRGFSSLHEIASGRDIKKFLSAIFGLWVLSI  199

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G CC FLTL YIA+VLL TVP++Y+KYED++D + EKAM ELKKQYAVFDAKVLSKIPR
Sbjct  200  LGGCCSFLTLAYIALVLLFTVPLIYDKYEDKIDPYGEKAMAELKKQYAVFDAKVLSKIPR  259

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  260  GPLKNKK  266



>ref|XP_010544774.1| PREDICTED: reticulon-like protein B6 [Tarenaya hassleriana]
Length=253

 Score =   248 bits (633),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 134/186 (72%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LWR+KK+S  VLG ATAIW+LFE++EYHLL+ VCH LILAL+VLFLWSNA SF
Sbjct  66   GKPADVLLWRDKKLSAAVLGTATAIWVLFELVEYHLLSLVCHILILALSVLFLWSNAHSF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPE+H+ EE  L  ASALRN+VN    VLRDIA GRDLK FLMV+ GLW+IS+
Sbjct  126  INKSPPQIPEIHLHEEHFLLVASALRNEVNQAFTVLRDIALGRDLKKFLMVVAGLWVISV  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C FLTL YI  VLLHTVPVLYEK+ED+VD  AEKA  ELKKQY V D KVLSKIP 
Sbjct  186  VGSWCHFLTLIYICFVLLHTVPVLYEKHEDKVDPMAEKAFVELKKQYGVLDEKVLSKIPI  245

Query  202  GPLKDK  185
            GPLK K
Sbjct  246  GPLKAK  251



>ref|XP_010669728.1| PREDICTED: reticulon-like protein B4 [Beta vulgaris subsp. vulgaris]
Length=285

 Score =   249 bits (636),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS  VL  ATAIWILFE+LEYHLLT +CH LI +LAVLFLW+NAS+F
Sbjct  97   GKPADVFLWRNKKISGSVLASATAIWILFELLEYHLLTLICHSLIFSLAVLFLWANASTF  156

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS PHIPEV +PE+P+L+  + LR+++N  LA+L DIA G+DLK FL VI GLWI+SI
Sbjct  157  INKSPPHIPEVILPEKPILEAVAGLRHELNRGLAMLHDIAMGKDLKKFLAVIAGLWILSI  216

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG  C F+TLFYI  VLLHT+P+LYEKYED+VDAFAEKAM E KK Y V + K +SKIPR
Sbjct  217  VGKSCGFITLFYINFVLLHTIPILYEKYEDKVDAFAEKAMAEAKKHYGVINEKYISKIPR  276

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  277  GPLKNKK  283



>ref|XP_009368711.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=250

 Score =   248 bits (632),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T VCH LIL+LAV FLWS AS+F
Sbjct  62   GKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVCHLLILSLAVFFLWSYASTF  121

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IP+V IPE+ VL+ ASALR ++N    VLRDIASGRDLK FL VI  LWI+S+
Sbjct  122  INKSPPQIPKVQIPEKTVLELASALRIEINKGFYVLRDIASGRDLKTFLGVIAVLWILSV  181

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG   +FLTLFYI  VLLHT+PV+YEKY+D++DAF EKA  E+KKQYAVFDAKVLSKIP+
Sbjct  182  VGKWFNFLTLFYIIFVLLHTLPVIYEKYDDQIDAFGEKAWIEIKKQYAVFDAKVLSKIPK  241

Query  202  GPLKDKK  182
            GP+K+KK
Sbjct  242  GPVKEKK  248



>gb|EAY75742.1| hypothetical protein OsI_03655 [Oryza sativa Indica Group]
Length=253

 Score =   248 bits (632),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+ LWRNKKIS GVL GATAIW+LFE++EYHLLT VCH LIL+LAVLFLWSNAS+F
Sbjct  66   GKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAVLFLWSNASTF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P+IPEV IPE+  +  A +LR ++N   A LR+I  GRDLK FL+VI GLWI+S+
Sbjct  126  IHKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGRDLKKFLIVIAGLWILSV  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GS C+FLTLFYI  V L+TVPVLYEKYED++DAF EKA  ELKK YA+F+ K LSKIP+
Sbjct  186  LGSSCNFLTLFYIVFVALYTVPVLYEKYEDKIDAFGEKAEIELKKYYALFEEKCLSKIPK  245

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  246  GPLKDKK  252



>gb|KHN15986.1| Reticulon-like protein B5, partial [Glycine soja]
Length=242

 Score =   247 bits (630),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 152/189 (80%), Gaps = 0/189 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LWRNKKIS  VLG ATA+WI FE+LEYHLLT VCH  IL LAVLFLWSNA +F
Sbjct  54   GKPADVLLWRNKKISASVLGVATAVWIFFELLEYHLLTLVCHISILVLAVLFLWSNAHTF  113

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IP VH+PEEP+ QFASAL  ++N   A L  I SGRDLK FL++I G WIISI
Sbjct  114  IHKAPPCIPTVHLPEEPIRQFASALTIEINRGFAALHAIGSGRDLKTFLIIIVGTWIISI  173

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFYI  VLLHTVPV+Y+KYED++D  AEKA+ E KKQYAVFD KVL+KIP+
Sbjct  174  VGSWCNFLTLFYIVFVLLHTVPVIYDKYEDKIDPLAEKALIEFKKQYAVFDEKVLNKIPK  233

Query  202  GPLKDKKLA  176
            GPLK KKLA
Sbjct  234  GPLKGKKLA  242



>ref|NP_001241367.1| uncharacterized protein LOC100796111 [Glycine max]
 gb|ACU22605.1| unknown [Glycine max]
Length=256

 Score =   247 bits (630),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 152/189 (80%), Gaps = 0/189 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LWRNKKIS  VLG ATA+WI FE+LEYHLLT VCH  IL LAVLFLWSNA +F
Sbjct  68   GKPADVLLWRNKKISASVLGVATAVWIFFELLEYHLLTLVCHISILVLAVLFLWSNAHTF  127

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IP VH+PEEP+ QFASAL  ++N   A L  I SGRDLK FL++I G WIISI
Sbjct  128  IHKAPPCIPTVHLPEEPIRQFASALTIEINRGFAALHAIGSGRDLKTFLIIIVGTWIISI  187

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFYI  VLLHTVPV+Y+KYED++D  AEKA+ E KKQYAVFD KVL+KIP+
Sbjct  188  VGSWCNFLTLFYIVFVLLHTVPVIYDKYEDKIDPLAEKALIEFKKQYAVFDEKVLNKIPK  247

Query  202  GPLKDKKLA  176
            GPLK KKLA
Sbjct  248  GPLKGKKLA  256



>gb|EAZ13460.1| hypothetical protein OsJ_03377 [Oryza sativa Japonica Group]
Length=253

 Score =   246 bits (629),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+ LWRNKKIS GVL GATAIW+LFE++EYHLLT VCH LIL+LAVLFLWSNAS+F
Sbjct  66   GKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAVLFLWSNASTF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P+IPEV IPE+  +  A +LR ++N   A LR+I  GRDLK FL+VI GLWI+S+
Sbjct  126  IHKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGRDLKKFLIVIAGLWILSV  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GS C+FLTLFYI  V L+TVPVLYEKYED+VDAF EKA  E KK YA+F+ K LSKIP+
Sbjct  186  LGSSCNFLTLFYIVFVALYTVPVLYEKYEDKVDAFGEKAEIEFKKYYALFEEKCLSKIPK  245

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  246  GPLKDKK  252



>ref|XP_010435260.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=273

 Score =   247 bits (631),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLL  +CH +I+ALAVLFLWSNA+ F
Sbjct  85   GKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLAVLCHVMIVALAVLFLWSNATMF  144

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPEEP+LQ AS LR ++N   + L +IASGRD+K FL  I GLW++SI
Sbjct  145  IHKSPPKIPEVHIPEEPLLQLASGLRIEINRGFSSLHEIASGRDIKKFLSAIFGLWVLSI  204

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G CC FLTL YIA+VLL TVP++Y+KYED++D + EKAM ELKKQYAVFDAKVLSKIPR
Sbjct  205  LGGCCSFLTLAYIALVLLFTVPLVYDKYEDKIDPYGEKAMAELKKQYAVFDAKVLSKIPR  264

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  265  GPLKNKK  271



>ref|XP_009380544.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=252

 Score =   246 bits (629),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 150/187 (80%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LWR+KKIS G L  ATAIW++FE++ YHLLT VCHGLIL+L +LFLWS A +F
Sbjct  65   GKSADVMLWRDKKISAGALSAATAIWVMFELVGYHLLTFVCHGLILSLVILFLWSKACTF  124

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV IPE+  +Q A  LR ++N  LAVLR++A GRD+K FL VI GLW++S+
Sbjct  125  INKSPPRIPEVSIPEDQAVQVARTLRYEMNRALAVLREVALGRDVKKFLTVIAGLWLLSM  184

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS  +FLTL YI  V LHTVPVLYEKYED+VDA AEKAM E+KKQYAV D KVLSKIPR
Sbjct  185  VGSSVNFLTLVYILFVTLHTVPVLYEKYEDKVDAAAEKAMAEIKKQYAVLDDKVLSKIPR  244

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  245  GPLKDKK  251



>ref|XP_003568063.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=244

 Score =   246 bits (628),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 151/187 (81%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKKIS GVL GATAIW+LFEV+EYHLLT +CH  IL L +LFLWSNAS+F
Sbjct  57   GKPADLFLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLLCHCFILTLGILFLWSNASAF  116

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P+IPEV IPE+  +  A +LR ++N   A LRDI  GRDLK FL+VI GLW +S 
Sbjct  117  INKSPPNIPEVRIPEDLAVNVARSLRYEINRGFASLRDIGQGRDLKKFLIVIAGLWTLSA  176

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GS C+FLTLFYI  ++L+TVPVLYEKYED++DA+ EKAM ELKK YA+FD K LSKIP+
Sbjct  177  LGSSCNFLTLFYIVFMVLYTVPVLYEKYEDKIDAYGEKAMIELKKYYAIFDEKCLSKIPK  236

Query  202  GPLKDKK  182
            GP KDKK
Sbjct  237  GPSKDKK  243



>ref|NP_001044177.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAB89453.1| putative 24 kDa seed maturation protein [Oryza sativa Japonica 
Group]
 dbj|BAF06091.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAG89426.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00393.1| unnamed protein product [Oryza sativa Japonica Group]
Length=253

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+ LWRNKKIS GVL GATAIW+LFE++EYHLLT VCH LIL+LAVLFLWSNAS+F
Sbjct  66   GKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAVLFLWSNASTF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P+IPEV IPE+  +  A +LR ++N   A LR+I  GRDLK FL+VI GLWI+S+
Sbjct  126  IHKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGRDLKKFLIVIAGLWILSV  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GS C+FLTLFYI  V L+TVPVLYEKYED+VDAF EKA  E KK YA+F+ K LSKIP+
Sbjct  186  LGSSCNFLTLFYIVFVALYTVPVLYEKYEDKVDAFGEKAEIEFKKYYALFEEKCLSKIPK  245

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  246  GPLKDKK  252



>ref|XP_011080892.1| PREDICTED: reticulon-like protein B2 [Sesamum indicum]
Length=257

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            G+ ADV LWR+KK+S GVLGGA A+W LF+VLEYH LT +CHGLIL L  +FL SNAS+F
Sbjct  69   GQGADVLLWRDKKVSAGVLGGAAALWFLFDVLEYHFLTLICHGLILGLVAMFLLSNASTF  128

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            +KK+ P IPEV +PEEPVL+FASALR ++N   A LRDIASG+DLK FL VI GLW++S+
Sbjct  129  VKKAPPRIPEVVLPEEPVLKFASALRIEINRVFADLRDIASGKDLKKFLYVIGGLWVLSV  188

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG  CDF+TL +   +LL TVP LYEK ED+VD +AEKA+ ELKKQYAVFDAKVLSKIPR
Sbjct  189  VGGICDFMTLIFSITLLLFTVPFLYEKNEDQVDCYAEKAIAELKKQYAVFDAKVLSKIPR  248

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  249  GPLKDKK  255



>gb|EMT18983.1| Reticulon-like protein B1 [Aegilops tauschii]
Length=225

 Score =   245 bits (625),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 150/185 (81%), Gaps = 0/185 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             AD+FLWRNKKIS GVL GATAIW+LFEVLEYHLLT +CHG IL L +LFLWSNAS+F+ 
Sbjct  39   SADLFLWRNKKISGGVLAGATAIWLLFEVLEYHLLTLLCHGFILTLGILFLWSNASAFVN  98

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            K  P+IPEV IPE+  +  A +LR ++N   A LR I  GRDLK FL+V+ GLWI+S +G
Sbjct  99   KCPPNIPEVKIPEDLAVNVARSLRYEINRGFASLRAIGQGRDLKKFLIVVAGLWILSFLG  158

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            SCC+FLTLFYI  ++L+TVPVLYEKYED++DAF EKAM ELKK YA+FD K LSKIP+GP
Sbjct  159  SCCNFLTLFYIVFMVLYTVPVLYEKYEDKIDAFGEKAMVELKKYYAIFDEKCLSKIPKGP  218

Query  196  LKDKK  182
             KDKK
Sbjct  219  SKDKK  223



>ref|XP_008354289.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=251

 Score =   246 bits (627),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LWRNKKIS  VL GAT +W+ FE+LEYHL+T VCH LIL+LAV +LWSNAS+F
Sbjct  63   GKPADVLLWRNKKISASVLAGATVLWVFFELLEYHLITLVCHLLILSLAVFYLWSNASNF  122

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IP V IPE+ VL+ ASALR ++N    VLR+IASGRDLK FL VI  LWI+S+
Sbjct  123  INKSQPQIPXVQIPEKTVLELASALRIELNKGFYVLRBIASGRDLKAFLGVIAVLWILSV  182

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG   +FLTLFYI  VLLHT+PV+YEKY+D++DAF EKA  E+KKQYAVFDAKVLSKIP+
Sbjct  183  VGKWFNFLTLFYIIFVLLHTLPVIYEKYDDQIDAFGEKAWIEIKKQYAVFDAKVLSKIPK  242

Query  202  GPLKDKK  182
            GP+K+KK
Sbjct  243  GPVKEKK  249



>ref|XP_007218268.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
 gb|EMJ19467.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
Length=339

 Score =   248 bits (634),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 157/187 (84%), Gaps = 1/187 (1%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKK+S GVLGGATA+W+LFE+LEYHLLT V H LI  LAVLFLWSNA SF
Sbjct  153  GKPADVFLWRNKKVSAGVLGGATAVWVLFELLEYHLLTLVGHILIGTLAVLFLWSNAHSF  212

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IPEVH+PEEP LQ AS LR  +N   AVL DIASGR+LK FL+VI GLW++SI
Sbjct  213  IHKTPPRIPEVHLPEEPFLQVASELRLQINWAFAVLHDIASGRELKKFLIVIAGLWVLSI  272

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG+ C+FLTLFYI+ VLLHTVPV+YEKYED++D FAEKA  E KK YAVFDAKVLSKIP+
Sbjct  273  VGTWCNFLTLFYISFVLLHTVPVIYEKYEDKIDPFAEKATIEFKKHYAVFDAKVLSKIPQ  332

Query  202  GPLKDKK  182
            G LK+K+
Sbjct  333  G-LKNKR  338



>gb|EAY98759.1| hypothetical protein OsI_20691 [Oryza sativa Indica Group]
Length=251

 Score =   245 bits (626),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKKISVGVL GATAIW+LFEV++YHLLT +CH +IL LA+LFLWSNAS+F
Sbjct  64   GKPADLFLWRNKKISVGVLTGATAIWLLFEVMDYHLLTLLCHCIILTLAMLFLWSNASTF  123

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P+IPEV IPE+  +  A ++R ++N   A LR+I  G DLK FL+V+ GLW++S+
Sbjct  124  INKSPPNIPEVKIPEDLAVNVARSVRFEINRGFATLREIGLGHDLKKFLIVVAGLWVLSV  183

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTLFYI  ++L+TVPVLYEKYED++DAF EKA+ ELKK YA+FD K LSKIP+
Sbjct  184  LGSCCNFLTLFYIVFMVLYTVPVLYEKYEDQIDAFGEKAVIELKKYYAIFDEKCLSKIPK  243

Query  202  GPLKDKK  182
            GP K+KK
Sbjct  244  GPSKNKK  250



>ref|XP_006644671.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=253

 Score =   245 bits (626),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT VCH LIL+LAVLFLWSNAS+F
Sbjct  66   GKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLILSLAVLFLWSNASTF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P+IPEV IPE+  +  A +LR ++N   A LR+I  GR+LK FL+VI GLWI+S+
Sbjct  126  INKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGRELKKFLIVIAGLWILSV  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GS C+FLTLFYI  V L+TVPVLYEKYED+VDA  EKA  ELKK YA+F+ K LSKIP+
Sbjct  186  LGSSCNFLTLFYIVFVALYTVPVLYEKYEDKVDALGEKAEIELKKYYALFEEKCLSKIPK  245

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  246  GPLKDKK  252



>ref|XP_011047748.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=254

 Score =   245 bits (626),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS GVLGGATA+W+ FE+LEYHL+T VC+  I +LAVLFLWSNAS+F
Sbjct  66   GKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCYLSIFSLAVLFLWSNASNF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            + KS P IPEV +PE+ V + AS LR ++N  +AVL DIASGRDLK FL VI GL ++S+
Sbjct  126  LNKSPPKIPEVLLPEKCVREVASGLRIEINRGVAVLHDIASGRDLKKFLAVIAGLLVLSL  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGSCC+FLTL YI+ VLLHTVPVLYEKYED+VD  +EK+  ++KKQYA+ D K LSKIPR
Sbjct  186  VGSCCNFLTLLYISFVLLHTVPVLYEKYEDQVDGCSEKSWIQIKKQYALLDEKYLSKIPR  245

Query  202  GPLKDKK  182
            GP K+KK
Sbjct  246  GPFKEKK  252



>ref|XP_011084470.1| PREDICTED: reticulon-like protein B2 [Sesamum indicum]
Length=258

 Score =   245 bits (626),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWR+KKI+ GVLG ATAIW+LFE+LEYHLLT VCH LILALA++FLWSNAS+F
Sbjct  70   GKPADIFLWRDKKITAGVLGVATAIWVLFELLEYHLLTLVCHILILALALIFLWSNASTF  129

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPE+ +PE+ VL  A+A R + N  LA+LRDIASGR+LK FL VI GLW++SI
Sbjct  130  INKSPPKIPEIIVPEDIVLGIAAAFRIEFNRALAILRDIASGRELKKFLAVIAGLWVLSI  189

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G+  +FLTLFY   VLLHTVPVLYEKYED+VDAFAEKA  ELKKQYAVF+ KVLSKIPR
Sbjct  190  LGNYFNFLTLFYTCFVLLHTVPVLYEKYEDQVDAFAEKAEAELKKQYAVFNTKVLSKIPR  249

Query  202  GPLKDKKL  179
            GPLKDKKL
Sbjct  250  GPLKDKKL  257



>gb|ACF87936.1| unknown [Zea mays]
Length=208

 Score =   243 bits (620),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 152/187 (81%), Gaps = 1/187 (1%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT VCH LI++LA+LFLWSNASSF
Sbjct  22   GKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLIVSLAILFLWSNASSF  81

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P+IPEV IPE+  +  A  LR ++N   A LR+I  G DLK FL+VI GLW+ S+
Sbjct  82   INKSPPNIPEVKIPEDVSVNVALTLRYEINRGFATLREIGHGHDLKKFLIVIAGLWLFSV  141

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTLFYI  V L+T+PVLYEKYED+VDAF EKAM ELKK YA+FD K LSKIP+
Sbjct  142  LGSCCNFLTLFYIVFVALYTIPVLYEKYEDKVDAFGEKAMIELKKYYAIFDEKCLSKIPK  201

Query  202  GPLKDKK  182
            G LKDKK
Sbjct  202  G-LKDKK  207



>ref|XP_009375555.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
 ref|XP_009375556.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=264

 Score =   245 bits (625),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS  VL GAT +W+ FE+LEYHL+T VCH LI  LAV +LWSNAS+F
Sbjct  76   GKPADVFLWRNKKISASVLAGATVLWVFFELLEYHLITLVCHLLITFLAVFYLWSNASNF  135

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IP+V IPE+ VL+ ASALR ++N    VLRDIASGRDLK FL V+  LWI+S+
Sbjct  136  INKSQPQIPKVQIPEKTVLELASALRIELNKGFYVLRDIASGRDLKAFLGVVAVLWILSV  195

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG   +FLTLFYI  VLLHT+PV+YEKY+D++DAF EKA  E+KKQYAVFDAKVLSKIP+
Sbjct  196  VGKWFNFLTLFYILFVLLHTLPVIYEKYDDQIDAFGEKAWIEIKKQYAVFDAKVLSKIPK  255

Query  202  GPLKDKK  182
            GP+K+KK
Sbjct  256  GPVKEKK  262



>ref|XP_008343772.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=251

 Score =   244 bits (623),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LWRNKKIS  VL GAT +W+ FE+LEYHL+T VCH LIL+LAV +LWSNAS+F
Sbjct  63   GKPADVLLWRNKKISASVLAGATVLWVFFELLEYHLITLVCHLLILSLAVFYLWSNASNF  122

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IP+V IPE+ VL+ ASALR ++N    VLR+IASGRDLK FL VI  LWI+S+
Sbjct  123  INKSQPQIPKVQIPEKTVLELASALRIELNKGFYVLRNIASGRDLKAFLGVIAVLWILSV  182

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG   +FLTLFYI  VLLHT+PV+YEKY+D++DAF EKA  E+KKQYAVFDAKVLSKIP+
Sbjct  183  VGKWFNFLTLFYIIFVLLHTLPVIYEKYDDQIDAFGEKAWIEIKKQYAVFDAKVLSKIPK  242

Query  202  GPLKDKK  182
            GP+K+KK
Sbjct  243  GPVKEKK  249



>dbj|BAJ89699.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=257

 Score =   244 bits (624),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 150/187 (80%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+ LWRNKKIS GVL GATAIW+LFEVLEYHLLT +CHG IL L +LFLWSNAS+F
Sbjct  69   GKPADLLLWRNKKISGGVLAGATAIWLLFEVLEYHLLTLLCHGFILTLGILFLWSNASAF  128

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            + K  P+IPEV IPE+  +  A +LR ++N   A LR I  GRDLK FL+V+ GLWI+S 
Sbjct  129  VNKCPPNIPEVKIPEDLAVNVARSLRYEINRGFASLRAIGQGRDLKKFLIVVAGLWILSA  188

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GS C+FLTLFYI  ++L+TVPVLYEKYED++DAF EKAM ELKK YA+FD K LSKIP+
Sbjct  189  LGSSCNFLTLFYIVFMVLYTVPVLYEKYEDKIDAFGEKAMVELKKYYAIFDEKCLSKIPK  248

Query  202  GPLKDKK  182
            GP KDKK
Sbjct  249  GPSKDKK  255



>ref|NP_192861.1| reticulon-like protein B2 [Arabidopsis thaliana]
 sp|Q9SUT9.1|RTNLB_ARATH RecName: Full=Reticulon-like protein B2; Short=AtRTNLB2; AltName: 
Full=VirB2-interacting protein 2 [Arabidopsis thaliana]
 emb|CAB51406.1| putative protein [Arabidopsis thaliana]
 emb|CAB81223.1| putative protein [Arabidopsis thaliana]
 gb|AAK59408.1| unknown protein [Arabidopsis thaliana]
 gb|AAK82535.1| AT4g11220/F8L21_10 [Arabidopsis thaliana]
 gb|AAL14401.1| AT4g11220/F8L21_10 [Arabidopsis thaliana]
 gb|AAM64366.1| unknown [Arabidopsis thaliana]
 gb|AAN86201.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82986.1| reticulon-like protein B2 [Arabidopsis thaliana]
Length=271

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+W++KK+S GV GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA+ F
Sbjct  83   GKPADIFMWKDKKMSGGVFGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMF  142

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPEEP+LQ AS LR ++N  ++ LR+IASGRD+K FL  I GLW++SI
Sbjct  143  IHKSPPKIPEVHIPEEPLLQLASGLRIEINRGISSLREIASGRDIKKFLSAIAGLWVLSI  202

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G C  FLTL YIA+VLL TVP+ Y+KYED+VD++ EKAM ELKKQYAV DAKV SKIPR
Sbjct  203  LGGCYSFLTLAYIALVLLFTVPLFYDKYEDKVDSYGEKAMAELKKQYAVLDAKVFSKIPR  262

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  263  GPLKDKK  269



>gb|EYU25170.1| hypothetical protein MIMGU_mgv1a012274mg [Erythranthe guttata]
Length=255

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 151/188 (80%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWR+KK +  VLG ATAIW+LFE+LEYHLL+ VCH LIL LA+LFLWSNAS+F
Sbjct  68   GKPADIFLWRDKKTTGYVLGVATAIWVLFELLEYHLLSLVCHFLILGLAILFLWSNASTF  127

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P  PEV I E  V+  ASAL  + N   A+LR++ASG+DLK FL VI GLW++S+
Sbjct  128  ISKSRPKFPEVIISENVVVSVASALTIEFNRAFAILREVASGKDLKKFLAVIAGLWVLSV  187

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSC +FLTLFY   VLLHTVPVLYEKYED+VDAFAEKA HE+KKQYAVFD KVLSK+P+
Sbjct  188  LGSCFNFLTLFYTCFVLLHTVPVLYEKYEDQVDAFAEKAEHEIKKQYAVFDVKVLSKLPK  247

Query  202  GPLKDKKL  179
              LK KK 
Sbjct  248  AILKYKKF  255



>ref|XP_002320163.1| reticulon family protein [Populus trichocarpa]
 gb|ABK92738.1| unknown [Populus trichocarpa]
 gb|EEE98478.1| reticulon family protein [Populus trichocarpa]
Length=251

 Score =   244 bits (622),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKK+S GVLG ATAIW+LFE++EY+LLT VCH LIL+LA+ FLWSNA SF
Sbjct  64   GKPADVFLWRNKKVSAGVLGFATAIWVLFELVEYNLLTLVCHILILSLALSFLWSNAHSF  123

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IP+VH+PEEPVLQ ASAL  ++N    VLR IA+G+DLK FL+VI GLW++SI
Sbjct  124  INKSPPRIPQVHLPEEPVLQVASALCVEINGAFVVLRSIAAGKDLKKFLIVIAGLWVMSI  183

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C FLTLFYI  VLLHTVPVLYEK+ED++D  AEKAM E+K+QYAVFDAKVLSKIP 
Sbjct  184  VGSWCHFLTLFYICFVLLHTVPVLYEKFEDKIDPLAEKAMIEIKRQYAVFDAKVLSKIPV  243

Query  202  GPLKDKKL  179
              LK KK+
Sbjct  244  AALKAKKV  251



>gb|ABK94480.1| unknown [Populus trichocarpa]
Length=251

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKK+S GVLG ATAIW+LFE++EY+LLT VCH LIL+LA+ FLWSNA SF
Sbjct  64   GKPADVFLWRNKKVSAGVLGFATAIWVLFELVEYNLLTLVCHILILSLALSFLWSNAHSF  123

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IP+VH+PEEPVLQ ASAL  ++N    VLR IA+G+DLK FL+VI GLW++SI
Sbjct  124  INKSPPRIPQVHLPEEPVLQVASALCVEINGAFVVLRSIAAGKDLKKFLIVIAGLWVMSI  183

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C FLTLFYI  VLLHTVPVLYEK+ED++D  AEKAM E+K+QYAVFDAKVLSKIP 
Sbjct  184  VGSWCHFLTLFYICFVLLHTVPVLYEKFEDKIDPLAEKAMIEIKRQYAVFDAKVLSKIPV  243

Query  202  GPLKDKKL  179
              LK KK+
Sbjct  244  AALKAKKV  251



>gb|EYU32181.1| hypothetical protein MIMGU_mgv1a012219mg [Erythranthe guttata]
Length=258

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 150/189 (79%), Gaps = 1/189 (1%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWR+KKIS GVLGG TA+W+LFE+LEYHLLT VCH +I  L++LFLWSN + F
Sbjct  71   GKPADIFLWRDKKISGGVLGGVTAVWVLFELLEYHLLTLVCHIVIFTLSMLFLWSNVTIF  130

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K  P IP V + EEP +  A ALRN++N   AVLR+IASGRDLK FL+V+  LW  SI
Sbjct  131  INKRPPPIPVVSLSEEPFVGVALALRNEINRTCAVLREIASGRDLKKFLVVVAVLWFFSI  190

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGSCC+FLTLFY+  VLLHTVPVLYEKY +++DAF EKA  E+KKQYAVFDAK L KIP+
Sbjct  191  VGSCCNFLTLFYLVFVLLHTVPVLYEKYNEKIDAFTEKATVEIKKQYAVFDAKFLCKIPK  250

Query  202  GPLKDKKLA  176
            GP  DKK A
Sbjct  251  GPF-DKKRA  258



>gb|KJB24285.1| hypothetical protein B456_004G137000 [Gossypium raimondii]
Length=255

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 157/183 (86%), Gaps = 0/183 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GKQAD+FLWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLWSNA++F
Sbjct  63   GKQADIFLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWSNAATF  122

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV IP++PVL+FA ALR ++N   AVLRDIASGRDLK FL VI GLW++SI
Sbjct  123  IHKSPPRIPEVQIPKDPVLEFAQALRFEINRGFAVLRDIASGRDLKKFLSVIAGLWVLSI  182

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG+ C+FLTLFYI  VLLHT+PVLYEKYED+VD   EKA HE+KKQYAVFDAKVLSKIP+
Sbjct  183  VGNWCNFLTLFYIVFVLLHTLPVLYEKYEDKVDQLTEKAWHEIKKQYAVFDAKVLSKIPK  242

Query  202  GPL  194
             PL
Sbjct  243  RPL  245



>ref|XP_006654676.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=247

 Score =   243 bits (620),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKKISVGVL GATAIW+LFEV++YHLLT +CH +IL LA+LFLWSNAS+F
Sbjct  60   GKPADLFLWRNKKISVGVLAGATAIWLLFEVMDYHLLTLLCHCVILTLAILFLWSNASTF  119

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P+IPEV IPE+  +  A +LR ++N   A LR+I  G DLK FL+V+ GLWI+S+
Sbjct  120  INKSPPNIPEVRIPEDLAVNVARSLRFEINRGFATLREIGQGHDLKKFLIVVAGLWILSV  179

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTLFYI  + L+TVPVLYEKY+D++DAF EKAM ELKK  A+FD K L+KIP+
Sbjct  180  LGSCCNFLTLFYIVFMALYTVPVLYEKYDDKIDAFGEKAMIELKKYCAIFDEKCLAKIPK  239

Query  202  GPLKDKK  182
            GP K+KK
Sbjct  240  GPSKNKK  246



>ref|NP_001130478.1| Seed maturation protein [Zea mays]
 ref|XP_008654247.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 ref|XP_008654248.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 gb|ACF78704.1| unknown [Zea mays]
 gb|ACF84299.1| unknown [Zea mays]
 gb|ACG48055.1| seed maturation protein [Zea mays]
 gb|ACR34851.1| unknown [Zea mays]
 gb|AFW85129.1| Seed maturation protein [Zea mays]
Length=253

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 152/187 (81%), Gaps = 1/187 (1%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT VCH LI++LA+LFLWSNASSF
Sbjct  67   GKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLIVSLAILFLWSNASSF  126

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P+IPEV IPE+  +  A  LR ++N   A LR+I  G DLK FL+VI GLW+ S+
Sbjct  127  INKSPPNIPEVKIPEDVSVNVALTLRYEINRGFATLREIGHGHDLKKFLIVIAGLWLFSV  186

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTLFYI  V L+T+PVLYEKYED+VDAF EKAM ELKK YA+FD K LSKIP+
Sbjct  187  LGSCCNFLTLFYIVFVALYTIPVLYEKYEDKVDAFGEKAMIELKKYYAIFDEKCLSKIPK  246

Query  202  GPLKDKK  182
            G LKDKK
Sbjct  247  G-LKDKK  252



>gb|KDO86331.1| hypothetical protein CISIN_1g025719mg [Citrus sinensis]
Length=249

 Score =   243 bits (620),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS GVLGGATAIW+LFE+ EYHLLT VCH LILALA+LFLW+NA +F
Sbjct  65   GKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTLVCHTLILALAILFLWANAHTF  124

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            IKK+ P IPEVH+PEEP LQ ASA R ++NH  AVLR IASGRDLK FLM I  LW++S+
Sbjct  125  IKKAPPCIPEVHLPEEPFLQVASAFRIELNHAFAVLRSIASGRDLKSFLMAIAALWVLSV  184

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIP  206
            VGS C+FLTLFYIA+VLLH VPVLYEKYED++D  AEKAM E+KKQYAVFDAKVLSKIP
Sbjct  185  VGSWCNFLTLFYIALVLLHIVPVLYEKYEDKIDPLAEKAMIEIKKQYAVFDAKVLSKIP  243



>ref|XP_009406784.1| PREDICTED: reticulon-like protein B1 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406785.1| PREDICTED: reticulon-like protein B1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=253

 Score =   243 bits (620),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 150/189 (79%), Gaps = 1/189 (1%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLW+NKK S  VLGGATAIWI FE++EYHLLT  CH LIL+LA++FLWSNA+  
Sbjct  64   GKPADVFLWKNKKASAAVLGGATAIWIFFELMEYHLLTLFCHCLILSLAIIFLWSNATFL  123

Query  562  IK-KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIIS  386
            I  +S PHIP V IPE  V+  A +LR ++N   AVLR+IA+GRDLK FL+VI GLW++S
Sbjct  124  INNRSPPHIPVVSIPENLVVDIALSLRYEINRGFAVLREIATGRDLKKFLIVIAGLWVLS  183

Query  385  IVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIP  206
             VG CC+FLTLFYI  V LHT+P LY+KYED+VDAFAEKA  E KK YAVF AK LSKIP
Sbjct  184  TVGRCCNFLTLFYIVFVTLHTLPFLYDKYEDKVDAFAEKASVEFKKHYAVFQAKYLSKIP  243

Query  205  RGPLKDKKL  179
            RGPLKDKK 
Sbjct  244  RGPLKDKKF  252



>ref|XP_010035177.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW46473.1| hypothetical protein EUGRSUZ_K00300 [Eucalyptus grandis]
Length=255

 Score =   243 bits (619),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWR+KK+S GVLG ATAIWILFE++EYHL+T VCH LI  LA++FLW++AS+ 
Sbjct  67   GKPADIFLWRDKKVSAGVLGVATAIWILFELMEYHLITLVCHILIATLAIIFLWASASTH  126

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P+IPEV +PE+ VL+ AS LR + N  LA+LR+IASGR+LK FL  I GLW++S+
Sbjct  127  ITKSPPNIPEVQLPEKCVLEVASVLRFEANRGLALLREIASGRELKKFLAFIAGLWVLSM  186

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS  + +TLFYI  VLLHTVPV YEKYED+VD FAEKAM E+KKQ+AVF+ KVLSK+PR
Sbjct  187  VGSWFNSVTLFYITFVLLHTVPVFYEKYEDQVDPFAEKAMVEIKKQFAVFNEKVLSKVPR  246

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  247  GPLKDKK  253



>gb|KFK31901.1| hypothetical protein AALP_AA6G173800 [Arabis alpina]
Length=259

 Score =   242 bits (618),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+W+ KK+S GV GGAT  W+LFE++EYHLLT + H +IL LAVLFLWSNA+ F
Sbjct  71   GKPADIFMWKKKKMSGGVFGGATVAWVLFELMEYHLLTLLSHVMILLLAVLFLWSNATMF  130

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IP++HIPEEP+LQ AS LR ++N   + L +IASGRDLK FL VI GLW++SI
Sbjct  131  IHKSPPKIPQLHIPEEPLLQLASGLRIEINRGFSSLHEIASGRDLKKFLSVIAGLWVLSI  190

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G CC FLTL YIA+VLL TVP+LY+KYED+VD + EKAM ELKKQYAVFDAKVLSKIP 
Sbjct  191  LGGCCSFLTLAYIALVLLFTVPLLYDKYEDKVDPYGEKAMLELKKQYAVFDAKVLSKIPM  250

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  251  GPLKNKK  257



>ref|XP_006444935.1| hypothetical protein CICLE_v10021860mg [Citrus clementina]
 ref|XP_006491199.1| PREDICTED: reticulon-like protein B5-like [Citrus sinensis]
 gb|ESR58175.1| hypothetical protein CICLE_v10021860mg [Citrus clementina]
Length=249

 Score =   242 bits (617),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS GVLGGATAIW+LFE+ EYHLLT VCH LILALA+LFLW+NA +F
Sbjct  65   GKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTLVCHTLILALAILFLWANAHTF  124

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            IKK+ P IPEVH+PEEP LQ ASA R ++NH  AVLR IASGRDLK FLM I  LW++S+
Sbjct  125  IKKAPPCIPEVHLPEEPFLQVASAFRIELNHAFAVLRSIASGRDLKSFLMAIAALWVLSV  184

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIP  206
            VGS C+FLTLFYIA+VLLH +PVLYEKYED++D  AEKAM E+KKQYAVFDAKVLSKIP
Sbjct  185  VGSWCNFLTLFYIALVLLHILPVLYEKYEDKIDPLAEKAMIEIKKQYAVFDAKVLSKIP  243



>ref|XP_004149448.1| PREDICTED: reticulon-like protein B1-like [Cucumis sativus]
 ref|XP_004167648.1| PREDICTED: reticulon-like protein B1-like [Cucumis sativus]
 gb|KGN57883.1| hypothetical protein Csa_3G363160 [Cucumis sativus]
Length=250

 Score =   242 bits (617),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLW+NKK S GVLGGATA+WILFE+LEY L+T VCH LI+ LA+ FLWS A++F
Sbjct  62   GKPADVFLWKNKKNSAGVLGGATALWILFELLEYQLITLVCHILIILLAIPFLWSYANTF  121

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IP+V +PE+ +LQ  ++LR ++N  ++ LRD+ASGRDL+ FL    GLWI+SI
Sbjct  122  INKTPPQIPDVRLPEDCLLQVVTSLRIEINRIISTLRDVASGRDLRKFLSAFLGLWILSI  181

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
             GS C+FLTL Y+  +LLHTVPVLYEKYED+VD FAEKA+ ELKKQYA FDAKVLSKIP 
Sbjct  182  AGSWCNFLTLLYMCFILLHTVPVLYEKYEDQVDPFAEKALIELKKQYAEFDAKVLSKIPL  241

Query  202  GPLKDKK  182
            GPL++KK
Sbjct  242  GPLQEKK  248



>gb|KJB06453.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=288

 Score =   243 bits (619),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 159/219 (73%), Gaps = 31/219 (14%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CH  IL+LAVLFLWSN  +F
Sbjct  70   GKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILSLAVLFLWSNVHTF  129

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IP+VH+PEEP LQ ASAL  ++N  L +LRDIASGR+LK FL+V+   W++S+
Sbjct  130  IHKTPPRIPQVHLPEEPFLQIASALTIELNQALELLRDIASGRNLKKFLVVVAAFWVLSV  189

Query  382  VGSCCDFLTLFYI-------------------------------AVVLLHTVPVLYEKYE  296
            VGS C+FLTLFY                                A VLLHTVPVLYEKYE
Sbjct  190  VGSWCNFLTLFYTCNDTGLLFLVPSSFIYTNFILNFDPSSLWKSAFVLLHTVPVLYEKYE  249

Query  295  DEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  179
            D+VD FAEKA+ E+KKQYAVFDA VLSKIP GPLK KK+
Sbjct  250  DKVDPFAEKAVIEIKKQYAVFDANVLSKIPTGPLKSKKV  288



>ref|NP_194094.1| VIRB2-interacting protein 1 [Arabidopsis thaliana]
 sp|Q9SUR3.1|RTNLA_ARATH RecName: Full=Reticulon-like protein B1; Short=AtRTNLB1; AltName: 
Full=VirB2-interacting protein 1 [Arabidopsis thaliana]
 emb|CAA23029.1| putative protein [Arabidopsis thaliana]
 emb|CAB79318.1| putative protein [Arabidopsis thaliana]
 gb|AAK91338.1| AT4g23630/F9D16_100 [Arabidopsis thaliana]
 gb|AAM65433.1| unknown [Arabidopsis thaliana]
 gb|AAM91465.1| AT4g23630/F9D16_100 [Arabidopsis thaliana]
 gb|AEE84787.1| VIRB2-interacting protein 1 [Arabidopsis thaliana]
Length=275

 Score =   241 bits (616),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+W+NKK+S GVLGGATA W++FE++EYHLLT +CH +I+ LAVLFLWSNA+ F
Sbjct  87   GKPADIFMWKNKKMSGGVLGGATAAWVVFELMEYHLLTLLCHVMIVVLAVLFLWSNATMF  146

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGRDLK FL+ I GLW++SI
Sbjct  147  INKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGRDLKKFLIAIAGLWVLSI  206

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKAM ELKKQYAV D KVLSKIP 
Sbjct  207  LGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAMIELKKQYAVLDEKVLSKIPL  266

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  267  GPLKNKK  273



>gb|ABR17571.1| unknown [Picea sitchensis]
 gb|ACN40850.1| unknown [Picea sitchensis]
Length=259

 Score =   240 bits (613),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 142/188 (76%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LWRNK+ S GVL GAT +W+LFE L Y+LLT +CH LIL + +LF+WSNAS+F
Sbjct  72   GKSADVILWRNKQTSAGVLAGATVMWLLFEWLGYYLLTLICHVLILGITILFVWSNASAF  131

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K    IP++   E+     ASALR ++N    V+ D+ASGRDLK FLMV+ GLWI+S+
Sbjct  132  INKQPVRIPQISFSEQLFQDVASALRFEINRLFTVIHDVASGRDLKKFLMVVAGLWILSV  191

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GS  +FLTLFY+A V  HTVPVLYEKYED+VDAF  KAM E KK Y  FDAKVLSKIPR
Sbjct  192  IGSWANFLTLFYVAFVFAHTVPVLYEKYEDQVDAFTFKAMDEAKKHYGTFDAKVLSKIPR  251

Query  202  GPLKDKKL  179
            GPLKDKK 
Sbjct  252  GPLKDKKF  259



>ref|XP_010433883.1| PREDICTED: reticulon-like protein B1 [Camelina sativa]
Length=276

 Score =   241 bits (614),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ F
Sbjct  88   GKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLICHVMIVVLAVLFLWSNATMF  147

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGR+LK FL+ I GLWI+SI
Sbjct  148  INKSPPKIPEVHIPEEPILQLASGLRIEINRGFSTLREIASGRELKKFLIAIFGLWILSI  207

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKA+ ELKKQYAV D KVLSKIP 
Sbjct  208  LGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAVIELKKQYAVLDEKVLSKIPL  267

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  268  GPLKNKK  274



>ref|XP_002869770.1| VIRB2-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46029.1| VIRB2-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=272

 Score =   240 bits (613),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+W+NKK+S GVLGGATA W++FE++EYHLLT +CH +I+ LAVLFLWSNA+ F
Sbjct  84   GKPADIFMWKNKKMSGGVLGGATAAWVVFELMEYHLLTLLCHVMIVVLAVLFLWSNATMF  143

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGRDLK FL+ I GLW++SI
Sbjct  144  INKSPPKIPEVHIPEEPILQLASGLRIEINRGFSTLREIASGRDLKKFLIAIAGLWVLSI  203

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKA+ ELKKQYAV D KVLSKIP 
Sbjct  204  LGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAVIELKKQYAVLDEKVLSKIPL  263

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  264  GPLKNKK  270



>gb|KDO56850.1| hypothetical protein CISIN_1g023137mg [Citrus sinensis]
Length=287

 Score =   240 bits (613),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 160/222 (72%), Gaps = 36/222 (16%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLWSNAS+F
Sbjct  65   GKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNASTF  124

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IP V +PE+ VL+FASALR ++N  LAVLR+IASGRDLK FL VI GLW++SI
Sbjct  125  INKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLWLLSI  184

Query  382  VGSCCDFLTLFYIA--------------------------------VVLLHTVPVLYEKY  299
            VG+ C+F+TLFYI                                  VLLHTVPV+YEKY
Sbjct  185  VGNWCNFVTLFYIGKKHSLVLMAYFLKWIVFLLKCLDLLYGSFETVFVLLHTVPVIYEKY  244

Query  298  EDEVDAFAEKAMHELKKQYAVFDA----KVLSKIPRGPLKDK  185
            ED++D+F EKA  E+KKQYAVFD     KVLS+IP+G LK K
Sbjct  245  EDKIDSFGEKATIEIKKQYAVFDEKVLKKVLSRIPKGALKKK  286



>ref|XP_006422078.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
 gb|ESR35318.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
Length=287

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 160/222 (72%), Gaps = 36/222 (16%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLWSNAS+F
Sbjct  65   GKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNASTF  124

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IP V +PE+ VL+FASALR ++N  LAVLR+IASGRDLK FL VI GLW++SI
Sbjct  125  INKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLWLLSI  184

Query  382  VGSCCDFLTLFYIA--------------------------------VVLLHTVPVLYEKY  299
            VG+ C+F+TLFYI                                  VLLHTVPV+YEKY
Sbjct  185  VGNWCNFVTLFYIGKKHSLVLMAYFLKWIVFLLKCLDLLYGSFETVFVLLHTVPVIYEKY  244

Query  298  EDEVDAFAEKAMHELKKQYAVFDA----KVLSKIPRGPLKDK  185
            ED++D+F EKA  E+KKQYAVFD     KVLS+IP+G LK K
Sbjct  245  EDKIDSFGEKATIEIKKQYAVFDEKVLKKVLSRIPKGALKKK  286



>ref|XP_010439152.1| PREDICTED: reticulon-like protein B1 isoform X1 [Camelina sativa]
Length=276

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ F
Sbjct  88   GKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLICHVMIVVLAVLFLWSNATMF  147

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGR+LK FL+ I GLWI+SI
Sbjct  148  INKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGRELKKFLIAIFGLWILSI  207

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKA+ ELKKQYAV D KVLSKIP 
Sbjct  208  LGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAVIELKKQYAVLDEKVLSKIPL  267

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  268  GPLKNKK  274



>ref|XP_010509305.1| PREDICTED: reticulon-like protein B1 [Camelina sativa]
Length=275

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ F
Sbjct  87   GKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLICHVMIVVLAVLFLWSNATMF  146

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPE+HIPEEP+LQ AS LR ++N   + LR+IASGR+LK FL+ I GLWI+SI
Sbjct  147  INKSPPKIPEIHIPEEPILQLASGLRIEINRGFSSLREIASGRELKKFLIAIFGLWILSI  206

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKA+ ELKKQYAV D KVLSKIP 
Sbjct  207  LGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAVIELKKQYAVLDEKVLSKIPL  266

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  267  GPLKNKK  273



>gb|ACN40158.1| unknown [Picea sitchensis]
Length=259

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 142/188 (76%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LWRNK+ S GVL GAT +W+LFE L Y+LLT +CH LIL + +LF+WSNAS+F
Sbjct  72   GKSADVILWRNKQTSAGVLAGATVMWLLFEWLGYYLLTLICHVLILGITILFVWSNASAF  131

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K    IP++   E+     ASALR ++N    V+ ++ASGRDLK FLMV+ GLWI+S+
Sbjct  132  INKQPVRIPQISFSEQLFQDVASALRFEINRLFTVIHNVASGRDLKKFLMVVAGLWILSV  191

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GS  +FLTLFY+A V  HTVPVLYEKYED+VDAF  KAM E KK Y  FDAKVLSKIPR
Sbjct  192  IGSWANFLTLFYVAFVFAHTVPVLYEKYEDQVDAFTFKAMDEAKKHYGTFDAKVLSKIPR  251

Query  202  GPLKDKKL  179
            GPLKDKK 
Sbjct  252  GPLKDKKF  259



>gb|KJB24288.1| hypothetical protein B456_004G137000 [Gossypium raimondii]
Length=233

 Score =   238 bits (607),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
            +AD+FLWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLWSNA++FI 
Sbjct  43   KADIFLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWSNAATFIH  102

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            KS P IPEV IP++PVL+FA ALR ++N   AVLRDIASGRDLK FL VI GLW++SIVG
Sbjct  103  KSPPRIPEVQIPKDPVLEFAQALRFEINRGFAVLRDIASGRDLKKFLSVIAGLWVLSIVG  162

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            + C+FLTLFYI  VLLHT+PVLYEKYED+VD   EKA HE+KKQYAVFDAKVLSKIP+ P
Sbjct  163  NWCNFLTLFYIVFVLLHTLPVLYEKYEDKVDQLTEKAWHEIKKQYAVFDAKVLSKIPKRP  222

Query  196  L  194
            L
Sbjct  223  L  223



>gb|KHN29299.1| Reticulon-like protein B5 [Glycine soja]
Length=250

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LWRNKKIS GVLGGATA+W+LFE+LEYHLLT VCH LIL LAVLFLWSNA +F
Sbjct  63   GKPADVLLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVCHILILLLAVLFLWSNAHTF  122

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVH+PEEP  Q ASALR ++N   A+L  I SGRDLK FL++I G+WI+SI
Sbjct  123  IHKSPPRIPEVHLPEEPFQQVASALRIEINRGFAILHSIGSGRDLKKFLVIIAGVWILSI  182

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG+ C+FLTLFYI  VLLHTVPVLYEKYED++D  AEKA+ E+KKQY VFDAKVLSKIP 
Sbjct  183  VGNWCNFLTLFYITFVLLHTVPVLYEKYEDKIDPLAEKAVIEIKKQYVVFDAKVLSKIPL  242

Query  202  GPLKDK  185
            GPLK K
Sbjct  243  GPLKAK  248



>ref|XP_006284300.1| hypothetical protein CARUB_v10005469mg [Capsella rubella]
 gb|ACC91263.1| reticulon family protein [Capsella rubella]
 gb|EOA17198.1| hypothetical protein CARUB_v10005469mg [Capsella rubella]
Length=274

 Score =   238 bits (608),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+W+NKK+S GVLG ATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ F
Sbjct  86   GKPADIFMWKNKKMSGGVLGAATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMF  145

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGRDLK FL+ I GLW++SI
Sbjct  146  INKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGRDLKKFLIAIAGLWVLSI  205

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKA+ ELKKQYAV D KVLSKIP 
Sbjct  206  LGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAVIELKKQYAVLDEKVLSKIPL  265

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  266  GPLKNKK  272



>ref|XP_010112604.1| Reticulon-like protein [Morus notabilis]
 gb|EXC34329.1| Reticulon-like protein [Morus notabilis]
Length=254

 Score =   237 bits (605),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKK+S GVLG AT IWILFE++EYHLLT VCH LILALA+LFLWSNAS+F
Sbjct  69   GKPADIFLWRNKKVSAGVLGVATVIWILFELVEYHLLTLVCHLLILALALLFLWSNASTF  128

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P +P+V+IPE+PVLQ A+ALR ++N  LA+LR+IASGRDLK FL VI GLW++S+
Sbjct  129  INKSPPRLPDVYIPEDPVLQVAAALRIEINRGLAILREIASGRDLKKFLSVIAGLWVLSV  188

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
             G+  +FLTLFY A VLL TVPV+YEKYED+VD FAEKA+ E+KKQY VFDAKVLSK+PR
Sbjct  189  AGNLFNFLTLFYTAFVLLFTVPVIYEKYEDKVDPFAEKAIIEIKKQYKVFDAKVLSKLPR  248

Query  202  GPLK  191
            GPLK
Sbjct  249  GPLK  252



>ref|XP_008375931.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=255

 Score =   237 bits (605),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 152/187 (81%), Gaps = 1/187 (1%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKK+S GVLGGAT +WILFE+LEY+LLT V H LI  LA+LFLWSNA +F
Sbjct  69   GKTADVFLWRNKKVSGGVLGGATVVWILFELLEYNLLTLVAHILIATLAILFLWSNAHTF  128

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IPEV +PEEP LQ AS LR  +N   A+L +IASG+DLK FL VI GLW++S+
Sbjct  129  IHKTPPRIPEVRLPEEPFLQVASELRVVINCAFALLHNIASGKDLKKFLAVIAGLWVLSV  188

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG  C+FLTLFYI+ VLLHTVPV+YEKYED++D  AEK   E KKQYAVFDAKVL+KIPR
Sbjct  189  VGKWCNFLTLFYISFVLLHTVPVIYEKYEDKIDPLAEKVTIEFKKQYAVFDAKVLNKIPR  248

Query  202  GPLKDKK  182
            G LK+K+
Sbjct  249  G-LKNKR  254



>emb|CDY57657.1| BnaC01g15350D [Brassica napus]
Length=275

 Score =   238 bits (606),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+W++KKIS GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ F
Sbjct  87   GKPADIFMWKDKKISGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMF  146

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPEEP+LQ AS LR ++N  L+ LR+IASGRDLK FL  I GLW++SI
Sbjct  147  INKSPPKIPEVHIPEEPILQLASGLRIEINRGLSSLREIASGRDLKKFLCAIVGLWVLSI  206

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G   +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+KKQYAV D KVLSKIP 
Sbjct  207  MGGWFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPM  266

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  267  GPLKNKK  273



>ref|XP_002870630.1| VIRB2-interacting protein 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46889.1| VIRB2-interacting protein 3 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   237 bits (604),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 154/191 (81%), Gaps = 4/191 (2%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKK+S GV G  TA W+LFE+ EYHLL  +CH  I ALA LFLWSNA +F
Sbjct  66   GKPADIFLWRNKKVSGGVFGAVTASWVLFELFEYHLLAFLCHFAIFALAALFLWSNACTF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K++PHIPEV+IPE+PVLQ  S LR ++N  L VLR+IASG+D+K F++VI GLW++SI
Sbjct  126  IHKASPHIPEVNIPEDPVLQLVSGLRIEINRGLTVLRNIASGKDVKKFILVIAGLWVLSI  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLS  215
            +GSC +FLTLFYIA VLL T+PVLYEKYED+VDAF EKAM E+KKQYAV D    +KVLS
Sbjct  186  IGSCYNFLTLFYIATVLLFTIPVLYEKYEDKVDAFGEKAMKEIKKQYAVLDEKVLSKVLS  245

Query  214  KIPRGPLKDKK  182
            KIPRG L  KK
Sbjct  246  KIPRGALNKKK  256



>ref|NP_001042463.1| Os01g0226300 [Oryza sativa Japonica Group]
 dbj|BAF04377.1| Os01g0226300, partial [Oryza sativa Japonica Group]
Length=178

 Score =   234 bits (597),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 145/177 (82%), Gaps = 0/177 (0%)
 Frame = -1

Query  712  NKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipe  533
            N+ IS GVLGGATAIWILFE+L YHLLT VCHGLI +L +LFLWSNASSFI KS P IPE
Sbjct  1    NRNISAGVLGGATAIWILFELLGYHLLTFVCHGLIFSLGLLFLWSNASSFINKSPPRIPE  60

Query  532  vhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTL  353
            V IPE+ V+  A + R ++N   A LR IA GRD+K FL+VI GLW++S++GSCC+FLTL
Sbjct  61   VIIPEDLVVNIALSTRYEINRAFANLRQIALGRDIKKFLIVIAGLWLLSVLGSCCNFLTL  120

Query  352  FYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  182
             YI  V+LHTVP+LYEKYED++D++ EK   E+KKQYAV DAKVLSK+PRGPLKDKK
Sbjct  121  VYIVFVVLHTVPILYEKYEDQIDSYGEKGWVEIKKQYAVLDAKVLSKVPRGPLKDKK  177



>gb|EMS62854.1| Reticulon-like protein B1 [Triticum urartu]
Length=237

 Score =   236 bits (602),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 153/219 (70%), Gaps = 32/219 (15%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVF+WRNK IS GVLGGATAIWILFE+L YHLL  + H LI +L VLFLWSNASSF
Sbjct  18   GKPADVFMWRNKHISAGVLGGATAIWILFELLGYHLLAFLGHALIFSLGVLFLWSNASSF  77

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV IPE+ V+  A + R+++N   A LR IA GRD+K FL+VI GLW++SI
Sbjct  78   INKSPPRIPEVIIPEDLVVNIALSTRHEINRAFANLRQIALGRDIKKFLIVIAGLWLLSI  137

Query  382  VGSCCDFLTLFYIA--------------------------------VVLLHTVPVLYEKY  299
            +GSCC+FLTLFYI                                  V+LHTVPV+YEKY
Sbjct  138  LGSCCNFLTLFYIGEGSQLSIPFLAPLLPNVDLVFTVDLSLLCQTVFVVLHTVPVIYEKY  197

Query  298  EDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  182
            ED++D + EK   E+KKQYAVFDAKVLSK+PRGPLKDKK
Sbjct  198  EDQIDTYGEKGWIEVKKQYAVFDAKVLSKVPRGPLKDKK  236



>gb|KHN40449.1| Reticulon-like protein B5 [Glycine soja]
Length=259

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LWRNKKIS G+LGGATA+W+LFE+LEYHLLT VCH LIL LAVLFLWSNA +F
Sbjct  72   GKPADVLLWRNKKISAGMLGGATAVWVLFELLEYHLLTLVCHILILLLAVLFLWSNAHTF  131

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPE H+PEEP LQ ASALR +VN   AVL  I SGRDLK FL+VI  +WI+SI
Sbjct  132  IHKSPPRIPEFHLPEEPFLQVASALRIEVNRGFAVLHSIGSGRDLKKFLVVIASVWILSI  191

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG+ C+FLTLFYI  +LLHTVPVLYEKY+D++D  AEKA+ E+KKQYAVFDAKVLSKIP 
Sbjct  192  VGNWCNFLTLFYITFILLHTVPVLYEKYDDKIDPLAEKAVIEIKKQYAVFDAKVLSKIPL  251

Query  202  GPLKDK  185
            GPLK K
Sbjct  252  GPLKAK  257



>ref|NP_001240231.1| uncharacterized protein LOC100778096 [Glycine max]
 gb|ACU20901.1| unknown [Glycine max]
Length=259

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LWRNKKIS G+LGGATA+W+LFE+LEYHLLT VCH LIL LAVLFLWSNA +F
Sbjct  72   GKPADVLLWRNKKISAGMLGGATAVWVLFELLEYHLLTLVCHILILLLAVLFLWSNAHTF  131

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPE H+PEEP LQ ASALR +VN   AVL  I SGRDLK FL+VI  +WI+SI
Sbjct  132  IHKSPPRIPEFHLPEEPFLQVASALRIEVNRGFAVLHSIGSGRDLKKFLVVIASVWILSI  191

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG+ C+FLTLFYI  +LLHTVPVLYEKY+D++D  AEKA+ E+KKQYAVFDAKVLSKIP 
Sbjct  192  VGNWCNFLTLFYITFILLHTVPVLYEKYDDKIDPLAEKAVIEIKKQYAVFDAKVLSKIPL  251

Query  202  GPLKDK  185
            GPLK K
Sbjct  252  GPLKAK  257



>ref|XP_006396933.1| hypothetical protein EUTSA_v10028886mg [Eutrema salsugineum]
 dbj|BAJ34499.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ38386.1| hypothetical protein EUTSA_v10028886mg [Eutrema salsugineum]
Length=265

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+W+NKK+S GV GGAT  W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ F
Sbjct  77   GKPADIFMWKNKKMSGGVFGGATVAWVLFELIEYHLLTLLCHVMIVLLAVLFLWSNATMF  136

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPEEP+LQ AS LR ++N   + LR IASGRDLK FL  I GLW++S+
Sbjct  137  IHKSPPKIPEVHIPEEPLLQLASGLRIEINRGFSSLRQIASGRDLKKFLSAIVGLWVLSV  196

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G CC FLTL YIA+VLL T+P+LY+KYED+VD++ EKAM ELKKQYAVFDAKVLSKIPR
Sbjct  197  LGGCCSFLTLAYIALVLLFTLPLLYDKYEDKVDSYGEKAMAELKKQYAVFDAKVLSKIPR  256

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  257  GPLKDKK  263



>ref|XP_009341126.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=260

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 152/187 (81%), Gaps = 1/187 (1%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKK+S GVL G TAIW+LFE+LEYHLLT V + LI ALA+LFLWSNA +F
Sbjct  74   GKPADVFLWRNKKVSAGVLIGTTAIWVLFELLEYHLLTLVGYILICALAILFLWSNAHAF  133

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ PHIP+VH+PEEP LQ AS LR  +N   A+L DIASGRDLK FL VI GLW++S+
Sbjct  134  IHKTPPHIPKVHLPEEPFLQVASELRVQINCGFALLHDIASGRDLKKFLAVIAGLWVLSV  193

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG  C+FLTLFYI  VLLHTVPV+YEKYED++D  AEKA  E KKQYAVFDAKVLSKIP 
Sbjct  194  VGKWCNFLTLFYICFVLLHTVPVIYEKYEDKIDPLAEKATIEFKKQYAVFDAKVLSKIPH  253

Query  202  GPLKDKK  182
            G LK K+
Sbjct  254  G-LKSKR  259



>ref|XP_008344578.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=260

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 150/187 (80%), Gaps = 1/187 (1%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKK+S GVL GAT IW+LFE+L+YHLLT V H LI ALA+LFLWSNA +F
Sbjct  74   GKXADVFLWRNKKVSAGVLSGATVIWVLFELLQYHLLTLVGHILIGALAILFLWSNAHAF  133

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IPEV +PEEP LQ AS LR  +N   A+L DIASGRDLK FL VI GLW++S+
Sbjct  134  IHKTPPRIPEVRLPEEPFLQVASELRVQINCAFALLHDIASGRDLKKFLAVIAGLWVLSV  193

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG  C+FLTLFYI  V+LHTVPV+YEKYED++D  AE+A  E KKQYA FDAKVLSKIP 
Sbjct  194  VGKWCNFLTLFYICFVVLHTVPVIYEKYEDKIDPLAERATIEFKKQYAXFDAKVLSKIPH  253

Query  202  GPLKDKK  182
            G LK+K+
Sbjct  254  G-LKNKR  259



>emb|CDY10954.1| BnaA03g46130D [Brassica napus]
Length=270

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ F
Sbjct  82   GKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMF  141

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGRDLK FL  I GLW++SI
Sbjct  142  INKSPPKIPEVHIPEEPILQLASGLRVEINRGFSSLREIASGRDLKKFLTAIAGLWVMSI  201

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G   +FLTL YIA+VLL TVP+ Y+KYED+VD   EKAM E+KKQYAV D KVLSKIP 
Sbjct  202  LGGWFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPL  261

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  262  GPLKNKK  268



>ref|XP_009338786.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=259

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 151/187 (81%), Gaps = 1/187 (1%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKK+S GVLGGAT +W+LFE+L+YHLLT V H LI  LA+LFLWSNA +F
Sbjct  73   GKSADVFLWRNKKVSGGVLGGATVVWVLFELLQYHLLTLVAHILIATLAILFLWSNAHTF  132

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IPEV +PEEP LQ AS LR  +N   A+L  IASG+DLK FL VI GLW++S+
Sbjct  133  IHKTPPRIPEVRLPEEPFLQVASELRVVINCAFALLHSIASGKDLKKFLAVIAGLWVLSV  192

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG  C+FLTLFYI+ VLLHTVP +YEKYED++D  AEK + E KKQYAVFDAKVLSKIPR
Sbjct  193  VGKWCNFLTLFYISFVLLHTVPFIYEKYEDKIDPLAEKVIIEFKKQYAVFDAKVLSKIPR  252

Query  202  GPLKDKK  182
            G LK+K+
Sbjct  253  G-LKNKR  258



>gb|KDP22201.1| hypothetical protein JCGZ_26032 [Jatropha curcas]
Length=248

 Score =   235 bits (600),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 149/187 (80%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LWRNK++S  VLGGAT +W+LFE+LEYHL+T VCH  IL LA+LFLWSNAS+F
Sbjct  60   GKPADVLLWRNKQVSASVLGGATVVWVLFELLEYHLITLVCHISILTLAILFLWSNASTF  119

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            + KS P IP++ +PE+ VL+ ASALR ++N  LAVL DIA+GRD+K FL VI  LW++SI
Sbjct  120  VNKSPPEIPQIVLPEKYVLEIASALRIEINRALAVLHDIAAGRDVKTFLTVIASLWVLSI  179

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GS  +FLTL YI  VLLHTVP+ YEKYED++D  AEKA  E+KKQY VFD KVLSKIP 
Sbjct  180  IGSWFNFLTLLYIVFVLLHTVPLAYEKYEDQIDPIAEKAWIEIKKQYVVFDEKVLSKIPV  239

Query  202  GPLKDKK  182
            G LK+ K
Sbjct  240  GLLKELK  246



>dbj|BAJ98297.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97542.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=255

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT V H LIL+LA LFLWSN   F
Sbjct  68   GKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVGHCLILSLATLFLWSNVCIF  127

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P+IPEV IPE+  +  A +LR+++N  L  LR+I  GRDLK FL+VI GLW++S+
Sbjct  128  IHKSPPNIPEVKIPEDLTVNIALSLRHEINRGLFTLREIGHGRDLKKFLIVIGGLWVLSV  187

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTL YI  V+L+TVPVLYEKY+D+VDAF EKAM ELKK YA+F+ KVLSKIP+
Sbjct  188  LGSCCNFLTLSYIVFVVLYTVPVLYEKYDDKVDAFGEKAMIELKKYYAIFEEKVLSKIPK  247

Query  202  GPLKDKK  182
            G LK+KK
Sbjct  248  GALKNKK  254



>ref|XP_004298843.1| PREDICTED: reticulon-like protein B2 [Fragaria vesca subsp. vesca]
Length=246

 Score =   235 bits (600),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 150/188 (80%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWR+KK+S G+LGGAT +W+LFE+LEYHLLT V H LI A+ + FLWSN   F
Sbjct  59   GKLADIFLWRDKKLSGGILGGATVMWLLFELLEYHLLTLVAHVLIAAITLFFLWSNGLGF  118

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPE+ IPE+ +LQ  S++  ++N  L V+RDIASG+DLK FL VI GLW++SI
Sbjct  119  INKSPPKIPEIQIPEKTLLQIVSSITFEINRALVVIRDIASGKDLKQFLSVIAGLWVVSI  178

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G  C+FLTL YIA+VLL +VPV YEKY+ ++D  AEKAM E+KKQYAVFDAKVLSKIPR
Sbjct  179  LGKSCNFLTLLYIAIVLLFSVPVFYEKYDHKIDPLAEKAMFEIKKQYAVFDAKVLSKIPR  238

Query  202  GPLKDKKL  179
            G LK KK+
Sbjct  239  GALKAKKI  246



>emb|CDY44123.1| BnaA01g13310D [Brassica napus]
Length=276

 Score =   236 bits (602),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ F
Sbjct  88   GKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMF  147

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPEEP+LQ AS LR ++N  L+ LR+IASGRDLK FL  I GLW++SI
Sbjct  148  INKSPPKIPEVHIPEEPILQLASGLRIEINRGLSSLREIASGRDLKKFLCAIFGLWVLSI  207

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G   +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+KKQYAV D KVLSKIP 
Sbjct  208  MGGWFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPM  267

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  268  GPLKNKK  274



>ref|NP_001239653.1| uncharacterized protein LOC100793862 [Glycine max]
 gb|ACU21118.1| unknown [Glycine max]
Length=257

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 154/186 (83%), Gaps = 0/186 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LWRNKKIS GVLGGATA+W+LFE+LEYHLLT VCH LIL LAVLFLWSNA +F
Sbjct  70   GKPADVLLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVCHILILLLAVLFLWSNAHTF  129

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVH+PEEP  Q ASALR ++N   A+L  I SGRDLK FL++I G+WI+SI
Sbjct  130  IHKSPPRIPEVHLPEEPFQQVASALRIEINRGFAILHSIGSGRDLKKFLVIIAGVWILSI  189

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG+ C+FLTLFYI  VL HTVPVLYEKYED++D  AEKA+ E+KKQY VFDAKVLSKIP 
Sbjct  190  VGNWCNFLTLFYITFVLSHTVPVLYEKYEDKIDPLAEKAVIEIKKQYVVFDAKVLSKIPL  249

Query  202  GPLKDK  185
            GPLK K
Sbjct  250  GPLKAK  255



>ref|XP_010538815.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+WR+KK+S  VLGG TA+W+LFE++EYHLL+ + H LI+ LAVLF+WSNAS F
Sbjct  79   GKPADIFMWRDKKMSASVLGGITAVWVLFELMEYHLLSLLSHVLIVVLAVLFIWSNASMF  138

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPEEP+LQ AS LR ++N     LRDIASGRDLK FL  I GLW++SI
Sbjct  139  INKSPPKIPEVHIPEEPILQLASGLRIEINRAFTCLRDIASGRDLKKFLTAIAGLWVLSI  198

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG CC+FLTL YI +V+L T+PVLYEK+ED+VDA+ EKAM E+KKQYAV D KVLSKIPR
Sbjct  199  VGGCCNFLTLSYIGMVMLFTIPVLYEKHEDKVDAYGEKAMVEMKKQYAVLDEKVLSKIPR  258

Query  202  GPLKDKK  182
            GPLK KK
Sbjct  259  GPLKGKK  265



>ref|XP_009345612.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
 ref|XP_009345624.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=260

 Score =   235 bits (600),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 152/187 (81%), Gaps = 1/187 (1%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKK+S GVL G TAIW+LFE+LEYHLLT V + LI ALA+LFLWSNA +F
Sbjct  74   GKPADVFLWRNKKVSAGVLIGTTAIWVLFELLEYHLLTLVGYILICALAILFLWSNAHAF  133

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ PHIP+VH+PEEP LQ AS LR  +N   A+L DIASGRDLK FL VI GLW++S+
Sbjct  134  IHKTPPHIPKVHLPEEPFLQVASELRVQINCGFALLHDIASGRDLKKFLAVIAGLWVLSV  193

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG  C+FLTLFYI  VLLHTVPV+YE+YED++D  AEKA  E KKQYAVFDAKVLSKIP 
Sbjct  194  VGKWCNFLTLFYICFVLLHTVPVIYERYEDKIDPLAEKATIEFKKQYAVFDAKVLSKIPH  253

Query  202  GPLKDKK  182
            G LK K+
Sbjct  254  G-LKSKR  259



>ref|XP_009137263.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=276

 Score =   236 bits (601),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ F
Sbjct  88   GKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMF  147

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPEEP+LQ AS LR ++N  L+ LR+IASGRDLK FL  I GLW++SI
Sbjct  148  INKSPPKIPEVHIPEEPILQLASGLRIEINRGLSSLREIASGRDLKKFLCAIFGLWVLSI  207

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G   +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+KKQYAV D KVLSKIP 
Sbjct  208  MGGWFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPM  267

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  268  GPLKNKK  274



>ref|XP_009137373.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=268

 Score =   236 bits (601),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ F
Sbjct  80   GKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMF  139

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGRDLK FL  I GLW +SI
Sbjct  140  INKSPPKIPEVHIPEEPILQLASGLRVEINRGFSSLREIASGRDLKKFLAAIAGLWFVSI  199

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G   +FLTL YIA+VLL TVP+ Y+KYED+VD   EKAM E+KKQYAV D KVLSKIP 
Sbjct  200  LGGWFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPL  259

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  260  GPLKNKK  266



>ref|NP_198975.1| reticulon-like protein B4 [Arabidopsis thaliana]
 sp|Q9FFS0.1|RTNLD_ARATH RecName: Full=Reticulon-like protein B4; Short=AtRTNLB4; AltName: 
Full=VirB2-interacting protein 3 [Arabidopsis thaliana]
 dbj|BAB11466.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK59673.1| unknown protein [Arabidopsis thaliana]
 gb|AAL15269.1| AT5g41600/MBK23_13 [Arabidopsis thaliana]
 gb|AAN12890.1| unknown protein [Arabidopsis thaliana]
 gb|AED94696.1| reticulon-like protein B4 [Arabidopsis thaliana]
Length=257

 Score =   234 bits (598),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 152/191 (80%), Gaps = 4/191 (2%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKK+S GVLG  TA W+LFE+ EYHLL  +CH  I ALA LFLWSNA +F
Sbjct  66   GKPADIFLWRNKKVSGGVLGAVTASWVLFELFEYHLLAFLCHFAIFALAALFLWSNACTF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS PHIPEVHIPE+P+LQ  S LR ++N  L +LR+IASG+D+K F++VI GLW++SI
Sbjct  126  IHKSTPHIPEVHIPEDPILQLVSGLRIEINRGLTLLRNIASGKDVKKFILVIAGLWVLSI  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL----S  215
            +GSC +FLTLFY A VLL T+PVLYEKYED+VDA+ EKAM E+KKQYAV D KVL    S
Sbjct  186  IGSCYNFLTLFYTATVLLFTIPVLYEKYEDKVDAYGEKAMREIKKQYAVLDEKVLRKVIS  245

Query  214  KIPRGPLKDKK  182
            KIPRG L  KK
Sbjct  246  KIPRGALNKKK  256



>ref|XP_007139767.1| hypothetical protein PHAVU_008G057300g [Phaseolus vulgaris]
 gb|ESW11761.1| hypothetical protein PHAVU_008G057300g [Phaseolus vulgaris]
Length=256

 Score =   234 bits (597),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 154/186 (83%), Gaps = 0/186 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LWRNKKIS GVLGGATA+W+LFE+LEYH LT VCH LIL LAVLFLWSNA +F
Sbjct  69   GKPADVLLWRNKKISAGVLGGATAVWVLFELLEYHFLTLVCHILILLLAVLFLWSNAHTF  128

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IP+VH+PEEP+LQ AS LR ++N   AVL  I SGRDLK FLMVI G+WI+SI
Sbjct  129  IHKSPPRIPDVHLPEEPILQVASVLRIEINRGFAVLHSIGSGRDLKKFLMVIAGVWILSI  188

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG+ C+FLTLFYI  +LLHT PVLYEKYED++D  AEKA+ E+KKQYAVFDAKVLSKIP 
Sbjct  189  VGNWCNFLTLFYITFILLHTTPVLYEKYEDKIDPLAEKAVIEIKKQYAVFDAKVLSKIPV  248

Query  202  GPLKDK  185
            G LK K
Sbjct  249  GLLKAK  254



>ref|XP_004306726.1| PREDICTED: reticulon-like protein B5 [Fragaria vesca subsp. vesca]
Length=257

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKKIS GVLGGAT +++LFE++EYHLLT +CH LI ALAV+FLWSNA + 
Sbjct  70   GKPADVFLWRNKKISAGVLGGATVVYVLFELVEYHLLTLICHILIGALAVMFLWSNAHTI  129

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
              K+APHIPEV +PEEP LQ AS LR  +N   A+L +IASGR+LK FL+VI GLW++SI
Sbjct  130  FHKTAPHIPEVSLPEEPFLQVASELRLQINWAFALLHNIASGRELKKFLIVIAGLWVLSI  189

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFYI  VLLHTVPVLYEKYE +VD  AEKA  E+KKQY VFDAKV++K+  
Sbjct  190  VGSWCNFLTLFYITFVLLHTVPVLYEKYEHKVDPLAEKATIEMKKQYGVFDAKVVTKVRE  249

Query  202  GPLKDKK  182
              LK+K+
Sbjct  250  TVLKNKR  256



>emb|CDY05135.1| BnaC03g29330D [Brassica napus]
Length=313

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+W+NKK+S GVLGGAT  W+LFE++EYHLLT +CH +I+ LA LFLWSNA+ F
Sbjct  125  GKPADIFMWKNKKVSGGVLGGATVAWVLFELMEYHLLTLLCHVMIVTLAALFLWSNATMF  184

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I+KS P IPEVHIPE+P+LQ AS LR ++N   + L +IASGRDLK FL  + GLWI+SI
Sbjct  185  IRKSPPKIPEVHIPEDPLLQLASGLRIEINRGFSSLHEIASGRDLKKFLSALFGLWILSI  244

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G CC FLTL YIA+VLL TVP++Y+KYED+VD++ EKAM ELK QYAV DAKVLSKIPR
Sbjct  245  LGGCCSFLTLAYIALVLLFTVPLVYDKYEDKVDSYGEKAMAELKNQYAVLDAKVLSKIPR  304

Query  202  GPLKDKK  182
               K+KK
Sbjct  305  WTSKNKK  311



>ref|XP_006413535.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
 gb|ESQ54988.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
Length=275

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+W+NKK+S GVLG ATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ F
Sbjct  87   GKPADIFMWKNKKMSGGVLGAATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMF  146

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGRDLK FL  + GLW++S+
Sbjct  147  INKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGRDLKKFLSAVAGLWVLSV  206

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G   +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+KKQYAV D KVLSKIP 
Sbjct  207  LGGWFNFLTLAYIALVLLFTVPIVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPL  266

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  267  GPLKNKK  273



>emb|CDY25557.1| BnaC09g11820D [Brassica napus]
Length=251

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 152/191 (80%), Gaps = 4/191 (2%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLFLWS+A++F
Sbjct  60   GKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHISILALAVLFLWSSATTF  119

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ PHIPEVHIPE+ VLQ AS LRN++N    +LR+IA GRDLK FLMV+ GLW++S 
Sbjct  120  IHKTPPHIPEVHIPEDVVLQLASGLRNEINRGFTLLRNIALGRDLKKFLMVVAGLWVLSK  179

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLS  215
            VGS C+FLTL YIA VLL TVPVLYEKYED+VD F EKAM E+KKQYAV D    +KV+S
Sbjct  180  VGSSCNFLTLIYIATVLLFTVPVLYEKYEDKVDDFGEKAMKEIKKQYAVLDEKVLSKVMS  239

Query  214  KIPRGPLKDKK  182
            KIPRG    KK
Sbjct  240  KIPRGAFNKKK  250



>ref|XP_003569752.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=257

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 149/187 (80%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+ LWRNKK S  VL GAT+IW+LFEV+EYHLL  VCH LIL+LA LFLWSNA +F
Sbjct  70   GKPADLVLWRNKKTSGVVLAGATSIWLLFEVMEYHLLNLVCHCLILSLATLFLWSNACTF  129

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P+IPEV IPE+  +  A +LR ++N   + LRDI  GRDLK FL+VI  LW++S+
Sbjct  130  INKSPPNIPEVKIPEDLTVNIALSLRYEINRGFSTLRDIGHGRDLKKFLIVIASLWVLSV  189

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G+CC+FLTL YI  V+L+TVPVLYEKYED+VDAF EKAM ELKK YA+F+ K LSKIP+
Sbjct  190  LGNCCNFLTLSYIVFVVLYTVPVLYEKYEDKVDAFGEKAMIELKKYYAIFEEKCLSKIPK  249

Query  202  GPLKDKK  182
            G LK+KK
Sbjct  250  GHLKNKK  256



>ref|XP_011003673.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=251

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 147/187 (79%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRN KIS GVLGGAT +W+LFE+L YHL+T VC+  I  LAVLFLWSN S F
Sbjct  63   GKPADVFLWRNTKISAGVLGGATTVWVLFELLGYHLITLVCYLSIFFLAVLFLWSNTSDF  122

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            + K  P IPEV +PE+ V + ASALR ++N   AVL DIASGRDLK  L VI GLW++S+
Sbjct  123  LNKPPPKIPEVVLPEQCVREVASALRIEINRGFAVLHDIASGRDLKKVLAVIAGLWVLSL  182

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSC + LTL YI+ VLLHTVPVLYEKYED+VDA++EK   E+KKQYAVFD K LSKIP+
Sbjct  183  IGSCINILTLLYISFVLLHTVPVLYEKYEDQVDAYSEKTWIEIKKQYAVFDEKYLSKIPK  242

Query  202  GPLKDKK  182
            G LK +K
Sbjct  243  GALKGEK  249



>dbj|BAH57206.1| AT1G64090 [Arabidopsis thaliana]
Length=240

 Score =   232 bits (592),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 148/185 (80%), Gaps = 4/185 (2%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  ILALAVLFLWS+AS+F
Sbjct  47   GKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWSSASTF  106

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS  HIPEVHIPE+ VLQ AS LR ++N    VLRDIASGRDLK FL+VI GLW++S 
Sbjct  107  IHKSPLHIPEVHIPEDVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSK  166

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLS  215
            VGS C+FLTL YIA VLL T+PVLYEKYED+VD F EKAM E+KKQY  FD    +KV+S
Sbjct  167  VGSSCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKAMREIKKQYVEFDVKVLSKVMS  226

Query  214  KIPRG  200
            KIP+G
Sbjct  227  KIPKG  231



>emb|CDX90792.1| BnaA03g24720D [Brassica napus]
Length=267

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+W+NKK+S GVLGGAT  W+LFE+LEYHLLT +CH +I+ALAVLFLWSNA+ F
Sbjct  79   GKPADIFMWKNKKMSGGVLGGATVAWVLFELLEYHLLTLLCHVMIVALAVLFLWSNATMF  138

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPE+P+LQ AS LR ++N   + L +IASGRDLK FL  + GLWI+SI
Sbjct  139  IHKSPPKIPEVHIPEDPLLQLASGLRIEINRGFSSLHEIASGRDLKKFLSALFGLWILSI  198

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G CC FLTL YIA+VLL TVP++Y+KYED+VD++ EKAM ELKKQYAV DAKVLSKIPR
Sbjct  199  LGGCCSFLTLAYIALVLLFTVPLVYDKYEDKVDSYGEKAMAELKKQYAVLDAKVLSKIPR  258

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  259  GPLKDKK  265



>ref|XP_006391670.1| hypothetical protein EUTSA_v10023649mg [Eutrema salsugineum]
 gb|ESQ28956.1| hypothetical protein EUTSA_v10023649mg [Eutrema salsugineum]
Length=256

 Score =   233 bits (593),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 151/191 (79%), Gaps = 4/191 (2%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKK+S GVLG AT  W+LFE+LEY+LLT   H  ILALA LFLWS+A +F
Sbjct  65   GKPADIFLWRNKKVSGGVLGVATISWVLFELLEYNLLTLFGHITILALACLFLWSSAITF  124

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ PHIPE+HIPEE VLQ AS LR ++N     LRDIASGRDLK FL+VI GLW++SI
Sbjct  125  IHKTPPHIPEIHIPEEVVLQLASGLRIEINRGFTTLRDIASGRDLKKFLLVIAGLWLLSI  184

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLS  215
            VGS C+FLTL YIA +LL TVPVLYEKYED+VD F EKAM E+KKQYAVFD    +KV+S
Sbjct  185  VGSSCNFLTLIYIATILLFTVPVLYEKYEDKVDDFGEKAMKEIKKQYAVFDEKVLSKVMS  244

Query  214  KIPRGPLKDKK  182
            KIPRG    KK
Sbjct  245  KIPRGAFNKKK  255



>gb|KFK37395.1| hypothetical protein AALP_AA4G251600 [Arabis alpina]
Length=249

 Score =   233 bits (593),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLWSNA +F
Sbjct  62   GKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTF  121

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            IKKS P IPE+H+PEE  L  AS+LRN+VN    +LR IA GRDLK FLMVI GLWIIS+
Sbjct  122  IKKSPPQIPEIHVPEEAFLVIASSLRNEVNQAFVILRSIALGRDLKKFLMVIVGLWIISV  181

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG+  +FLTL YI  V+LHTVP++YEK+ED+VD FAEKAM EL+KQY VFD KV+SKIP 
Sbjct  182  VGNWFNFLTLVYICFVVLHTVPMMYEKHEDKVDPFAEKAMKELQKQYLVFDEKVISKIPI  241

Query  202  GPLKDK  185
              LK K
Sbjct  242  ASLKAK  247



>dbj|BAJ33905.1| unnamed protein product [Thellungiella halophila]
Length=275

 Score =   233 bits (595),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK A++F+W+NKK+S GVLG ATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ F
Sbjct  87   GKPAEIFMWKNKKMSGGVLGAATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMF  146

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGRDLK FL  + GLW++S+
Sbjct  147  INKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGRDLKKFLSAVAGLWVLSV  206

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G   +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+KKQYAV D KVLSKIP 
Sbjct  207  LGGWFNFLTLAYIALVLLFTVPIVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPL  266

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  267  GPLKNKK  273



>ref|XP_010418453.1| PREDICTED: reticulon-like protein B3 [Camelina sativa]
 ref|XP_010473656.1| PREDICTED: reticulon-like protein B3 isoform X1 [Camelina sativa]
 ref|XP_010473657.1| PREDICTED: reticulon-like protein B3 isoform X2 [Camelina sativa]
Length=254

 Score =   233 bits (593),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 151/191 (79%), Gaps = 4/191 (2%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  IL LAVLFLWS+AS+F
Sbjct  63   GKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWSSASTF  122

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ PHIPEVHIPEE VLQ AS LR ++N    VLRDIASGRDLK FL+VI GLW++S 
Sbjct  123  IHKTTPHIPEVHIPEEVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSK  182

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLS  215
            VGS C+FLTL YIA VLL T+PVLYEKY+D+VD F EKAM E+KKQY VFD    +KV+S
Sbjct  183  VGSSCNFLTLIYIATVLLFTIPVLYEKYDDKVDDFGEKAMREIKKQYVVFDEKVLSKVMS  242

Query  214  KIPRGPLKDKK  182
            KIP+G    KK
Sbjct  243  KIPKGAFYKKK  253



>ref|XP_010518282.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=255

 Score =   233 bits (593),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLWSNA +F
Sbjct  66   GKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IPEVH+PE+  L  AS+LRN++N    +LR IA GRDLK FLMV+ GLWIIS+
Sbjct  126  INKTPPQIPEVHVPEDAFLVIASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISV  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG+ C+FLTL YI  V+LHTVP+LYEK+ED+VD  AEKAM EL+KQY VFD KVLSKIP 
Sbjct  186  VGNWCNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFDEKVLSKIPV  245

Query  202  GPLKDK  185
              LK K
Sbjct  246  ASLKAK  251



>ref|XP_010430525.1| PREDICTED: reticulon-like protein B3 [Camelina sativa]
Length=255

 Score =   233 bits (593),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 151/191 (79%), Gaps = 4/191 (2%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  IL LAVLFLWS+AS+F
Sbjct  64   GKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWSSASTF  123

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ PHIPEVHIPEE VLQ AS LR ++N    VLRDIASGRDLK FL+VI GLW++S 
Sbjct  124  IHKTTPHIPEVHIPEEVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSK  183

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLS  215
            VGS C+FLTL YIA VLL T+PVLYEKY+D+VD F EKAM E+KKQY VFD    +KV+S
Sbjct  184  VGSSCNFLTLIYIATVLLFTIPVLYEKYDDKVDDFGEKAMREIKKQYVVFDEKVLSKVMS  243

Query  214  KIPRGPLKDKK  182
            KIP+G    KK
Sbjct  244  KIPKGAFYKKK  254



>ref|NP_176592.1| reticulon-like protein B3 [Arabidopsis thaliana]
 sp|Q9SH59.1|RTNLC_ARATH RecName: Full=Reticulon-like protein B3; Short=AtRTNLB3 [Arabidopsis 
thaliana]
 gb|AAF24576.1|AC007764_18 F22C12.15 [Arabidopsis thaliana]
 gb|AAL36421.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51418.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99051.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE34190.1| reticulon-like protein B3 [Arabidopsis thaliana]
Length=255

 Score =   233 bits (593),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 148/185 (80%), Gaps = 4/185 (2%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  ILALAVLFLWS+AS+F
Sbjct  62   GKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWSSASTF  121

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS  HIPEVHIPE+ VLQ AS LR ++N    VLRDIASGRDLK FL+VI GLW++S 
Sbjct  122  IHKSPLHIPEVHIPEDVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSK  181

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLS  215
            VGS C+FLTL YIA VLL T+PVLYEKYED+VD F EKAM E+KKQY  FD    +KV+S
Sbjct  182  VGSSCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKAMREIKKQYVEFDVKVLSKVMS  241

Query  214  KIPRG  200
            KIP+G
Sbjct  242  KIPKG  246



>ref|XP_010473658.1| PREDICTED: reticulon-like protein B3 isoform X3 [Camelina sativa]
Length=267

 Score =   233 bits (594),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 151/191 (79%), Gaps = 4/191 (2%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  IL LAVLFLWS+AS+F
Sbjct  76   GKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWSSASTF  135

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ PHIPEVHIPEE VLQ AS LR ++N    VLRDIASGRDLK FL+VI GLW++S 
Sbjct  136  IHKTTPHIPEVHIPEEVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSK  195

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLS  215
            VGS C+FLTL YIA VLL T+PVLYEKY+D+VD F EKAM E+KKQY VFD    +KV+S
Sbjct  196  VGSSCNFLTLIYIATVLLFTIPVLYEKYDDKVDDFGEKAMREIKKQYVVFDEKVLSKVMS  255

Query  214  KIPRGPLKDKK  182
            KIP+G    KK
Sbjct  256  KIPKGAFYKKK  266



>ref|XP_010506615.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=255

 Score =   232 bits (592),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLWSNA +F
Sbjct  66   GKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IPEVH+PE+  L  AS+LRN++N    +LR IA GRDLK FLMV+ GLWIIS+
Sbjct  126  INKTPPQIPEVHVPEDAFLVIASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISV  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG+ C+FLTL YI  V+LHTVP+LYEK+ED+VD  AEKAM EL+KQY VFD KVLSKIP 
Sbjct  186  VGNWCNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFDEKVLSKIPV  245

Query  202  GPLKDK  185
              LK K
Sbjct  246  ASLKAK  251



>ref|XP_010508058.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=256

 Score =   232 bits (592),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLWSNA +F
Sbjct  67   GKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTF  126

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IPEVH+PE+  L  AS+LRN++N    +LR IA GRDLK FLMV+ GLWIIS+
Sbjct  127  INKTPPQIPEVHVPEDAFLVIASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISV  186

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG+ C+FLTL YI  V+LHTVP+LYEK+ED+VD  AEKAM EL+KQY VFD KVLSKIP 
Sbjct  187  VGNWCNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFDEKVLSKIPV  246

Query  202  GPLKDK  185
              LK K
Sbjct  247  ASLKAK  252



>emb|CDY41666.1| BnaC03g62180D [Brassica napus]
Length=276

 Score =   233 bits (593),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSN + F
Sbjct  88   GKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNVTRF  147

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IP+VHIPEEPVLQ AS LR ++N   + LR+IASGRDLK F+  I GLW++SI
Sbjct  148  IHKSPPKIPQVHIPEEPVLQLASGLRIEINRGFSSLREIASGRDLKKFISAIAGLWVLSI  207

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G   +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+KKQYAV D KVLSKIP 
Sbjct  208  LGGWFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPL  267

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  268  GPLKNKK  274



>emb|CDY24806.1| BnaA08g15040D [Brassica napus]
Length=274

 Score =   233 bits (593),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ F
Sbjct  86   GKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMF  145

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPEEPVLQ AS LR ++N     LR+IASGRDLK F+  I GLW++SI
Sbjct  146  IHKSPPKIPEVHIPEEPVLQLASGLRIEINRGFYSLREIASGRDLKKFISAIAGLWVLSI  205

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G   +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+KKQYAV D KVLSKIP 
Sbjct  206  LGGWFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPL  265

Query  202  GPLKDKK  182
            GPLK+KK
Sbjct  266  GPLKNKK  272



>ref|XP_008377768.1| PREDICTED: reticulon-like protein B2 [Malus domestica]
Length=258

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 149/188 (79%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWR+KK S GVL   T IW+ FE+ EYHLLT V H LIL +A LFLWSNAS+F
Sbjct  71   GKAADVFLWRDKKASAGVLIALTIIWVFFELFEYHLLTLVSHLLILGIASLFLWSNASTF  130

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS PHIP+V IPE+ VLQ AS +  ++N    +LR+IASG+DLK FL VI GLW++SI
Sbjct  131  INKSPPHIPQVQIPEKLVLQIASVITLEINRAFVILREIASGKDLKQFLSVIAGLWVVSI  190

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G   +FLTL YIAVVLL T+PV YEKY+D+VDA AEKA+ E+KKQYAVFDAKV+SKIPR
Sbjct  191  LGKWYNFLTLVYIAVVLLFTLPVFYEKYDDQVDAVAEKALIEIKKQYAVFDAKVMSKIPR  250

Query  202  GPLKDKKL  179
            G LKDKK 
Sbjct  251  GQLKDKKF  258



>ref|XP_006294850.1| hypothetical protein CARUB_v10023902mg [Capsella rubella]
 gb|EOA27748.1| hypothetical protein CARUB_v10023902mg [Capsella rubella]
Length=255

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWR+KK+S  VLG AT IW+LFE++EYHLL+ +CH  ILAL  LFLWSNA +F
Sbjct  66   GKPADVFLWRDKKLSAAVLGVATVIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K++P IPE+H+PEE  L  AS+LRN++N    +LR IA GRDLK FLMV+ GLWIIS+
Sbjct  126  INKTSPQIPEIHVPEEAFLVIASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISV  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG+ C+FLTL YI  V+LHTVP+LYEK+ED+VD  AEKAM EL+KQY VFD KVLSKIP 
Sbjct  186  VGNWCNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFDEKVLSKIPV  245

Query  202  GPLKDK  185
              LK K
Sbjct  246  ASLKAK  251



>ref|XP_007040378.1| Reticulan like protein B3, putative isoform 3, partial [Theobroma 
cacao]
 gb|EOY24879.1| Reticulan like protein B3, putative isoform 3, partial [Theobroma 
cacao]
Length=277

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKKIS G LG AT IW+LFE+LEY+LLT VCH LILALA+LFLWSNA++F
Sbjct  64   GKPADIFLWRNKKISAGALGVATVIWVLFELLEYYLLTLVCHLLILALAILFLWSNATTF  123

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV IP+EPVL+FA ALR ++N   AVLRDIASGRDLK FL VI GLW++SI
Sbjct  124  INKSPPRIPEVQIPKEPVLEFAQALRFEINRAFAVLRDIASGRDLKKFLSVIAGLWVLSI  183

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFYI  VLLH+VPVLYEKYED+VD+F+EKAMHE+KKQYAVFDAKVLSKIPR
Sbjct  184  VGSWCNFLTLFYIVFVLLHSVPVLYEKYEDKVDSFSEKAMHEIKKQYAVFDAKVLSKIPR  243

Query  202  GPLK  191
            GPL 
Sbjct  244  GPLN  247



>ref|XP_006397801.1| hypothetical protein EUTSA_v10001599mg [Eutrema salsugineum]
 gb|ESQ39254.1| hypothetical protein EUTSA_v10001599mg [Eutrema salsugineum]
Length=253

 Score =   231 bits (589),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLWSNA +F
Sbjct  66   GKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IPEVH+PEE  L  AS+LRN++N    +LR IA GRDLK FLMV+ GLWIIS+
Sbjct  126  INKTPPQIPEVHVPEEAFLTIASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISV  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG+ C+FLTL YI  V+LHTVP++YEK+ED+VD  AEKAM EL+KQY VFD KV+SKIP 
Sbjct  186  VGNWCNFLTLVYICFVVLHTVPMMYEKHEDKVDPLAEKAMKELQKQYLVFDEKVISKIPI  245

Query  202  GPLKDK  185
              LK K
Sbjct  246  ASLKAK  251



>emb|CDM81762.1| unnamed protein product [Triticum aestivum]
Length=253

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 151/187 (81%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+ LWRNKKIS GVL GATAIW+LFE++EYHLLT V H LIL+LA LFL+SN   F
Sbjct  66   GKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVGHCLILSLATLFLYSNVCIF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            + KS P+IPEV IPE+  +  A +LR+++N     LR+I  GRDLK FL+VI GLW++S+
Sbjct  126  VHKSPPNIPEVKIPEDMTVNIALSLRHEINRGFFTLREIGHGRDLKKFLIVIGGLWVLSV  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTL YI  V+L+TVPVLYEKY+D+VDAF EKAM ELKK YA+F+ KVLSKIP+
Sbjct  186  LGSCCNFLTLSYIVFVVLYTVPVLYEKYDDKVDAFGEKAMIELKKYYAIFEEKVLSKIPK  245

Query  202  GPLKDKK  182
            G LK+KK
Sbjct  246  GALKNKK  252



>ref|XP_008367699.1| PREDICTED: reticulon-like protein B2 [Malus domestica]
Length=258

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 150/188 (80%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWR KK+S GVL   T IW+ FE+LEYHLLT V H LI+ + +LFLWSNAS+F
Sbjct  71   GKAADIFLWRGKKVSAGVLIALTIIWVFFELLEYHLLTLVSHLLIIGIVMLFLWSNASTF  130

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS PHIP+V IPE+PVLQ ASA+ +++N    ++R+IASG+DLK FL  I GLW++SI
Sbjct  131  INKSPPHIPQVQIPEKPVLQIASAITSEINRAFVIVREIASGKDLKQFLSAIAGLWVVSI  190

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G   +FLTL YIAVVLL T+PV YEKY+D+VDA AEKA+ E+KKQYAVFDAKVLSKIPR
Sbjct  191  LGKYYNFLTLVYIAVVLLFTLPVFYEKYDDQVDAVAEKALTEMKKQYAVFDAKVLSKIPR  250

Query  202  GPLKDKKL  179
            G  K KK 
Sbjct  251  GQTKAKKF  258



>ref|XP_002887921.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64180.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
Length=254

 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 151/191 (79%), Gaps = 4/191 (2%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  ILALAVLFLWS+A++F
Sbjct  63   GKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWSSATTF  122

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS PHIPEVHIPEE VL+ AS LR ++N    VLRDIASGRDLK FL+VI GLW++S 
Sbjct  123  IHKSPPHIPEVHIPEEVVLELASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSK  182

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLS  215
            +GS C+FLTL YIA VLL T+PVLYEKYED+VD F EKAM E+KKQY  FD    +KV+S
Sbjct  183  LGSSCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKAMREIKKQYVEFDVKVLSKVMS  242

Query  214  KIPRGPLKDKK  182
            KIP+G    KK
Sbjct  243  KIPKGAFYKKK  253



>ref|XP_004965478.1| PREDICTED: reticulon-like protein B2-like [Setaria italica]
Length=257

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 146/187 (78%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LW++KK S  V+GGAT IW+LFEVL YHLLT + H LI  LA+LFL S A++F
Sbjct  69   GKTADVLLWKDKKTSAVVIGGATVIWVLFEVLGYHLLTLISHVLIGVLAILFLLSKATTF  128

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            IKKS P+IP V IPE+ V+  + ALRND+N  L + R+IA G DLK FL VI GLWI+S 
Sbjct  129  IKKSPPNIPLVEIPEDLVVNVSQALRNDINRALHLFREIAMGHDLKKFLGVIVGLWILSS  188

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGSCCDFLTL YIAV++LHTVP+LY+KY+D+VD FA +A  E +KQY V DAKVLSKIPR
Sbjct  189  VGSCCDFLTLIYIAVLMLHTVPILYDKYQDKVDHFAGRAHTEARKQYEVLDAKVLSKIPR  248

Query  202  GPLKDKK  182
            GP K KK
Sbjct  249  GPAKPKK  255



>ref|XP_007040377.1| Reticulan like protein B3, putative isoform 2 [Theobroma cacao]
 gb|EOY24878.1| Reticulan like protein B3, putative isoform 2 [Theobroma cacao]
Length=291

 Score =   231 bits (590),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKKIS G LG AT IW+LFE+LEY+LLT VCH LILALA+LFLWSNA++F
Sbjct  64   GKPADIFLWRNKKISAGALGVATVIWVLFELLEYYLLTLVCHLLILALAILFLWSNATTF  123

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEV IP+EPVL+FA ALR ++N   AVLRDIASGRDLK FL VI GLW++SI
Sbjct  124  INKSPPRIPEVQIPKEPVLEFAQALRFEINRAFAVLRDIASGRDLKKFLSVIAGLWVLSI  183

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C+FLTLFYI  VLLH+VPVLYEKYED+VD+F+EKAMHE+KKQYAVFDAKVLSKIPR
Sbjct  184  VGSWCNFLTLFYIVFVLLHSVPVLYEKYEDKVDSFSEKAMHEIKKQYAVFDAKVLSKIPR  243

Query  202  GPLK  191
            GPL 
Sbjct  244  GPLN  247



>ref|XP_009334492.1| PREDICTED: reticulon-like protein B2 [Pyrus x bretschneideri]
Length=258

 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 149/188 (79%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWR+KK S GVL   T IW+ FE+ EYHLLT V H LIL +A LFLWSNAS+F
Sbjct  71   GKAADVFLWRDKKASAGVLIALTIIWVFFELFEYHLLTLVSHLLILGIASLFLWSNASTF  130

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS PHIP+V IPE+PVLQ AS +  ++N    +LR+IASG+DLK FL VI GLW++SI
Sbjct  131  INKSPPHIPQVQIPEKPVLQIASVITMEINRAFVILREIASGKDLKQFLSVIAGLWVVSI  190

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G   +FLTL YI VVLL T+PV YEKY+D+VDA AEKA+ E+KKQYAVFDAKV+SKIPR
Sbjct  191  LGKWYNFLTLVYIVVVLLFTLPVFYEKYDDQVDAVAEKALIEIKKQYAVFDAKVMSKIPR  250

Query  202  GPLKDKKL  179
            G LKDKK 
Sbjct  251  GQLKDKKF  258



>ref|XP_007209494.1| hypothetical protein PRUPE_ppa010244mg [Prunus persica]
 gb|EMJ10693.1| hypothetical protein PRUPE_ppa010244mg [Prunus persica]
Length=257

 Score =   230 bits (586),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 150/187 (80%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWR+KK S  VL   T IW+ FE+L YHLLT + H LIL LA+LFLWSNAS+F
Sbjct  70   GKAADVFLWRDKKGSASVLIAITIIWVFFELLGYHLLTLMAHCLILVLAMLFLWSNASTF  129

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IP+V IPE+PVLQ ASA+  ++N    +LR+IASG+DLK FL VI GLW++SI
Sbjct  130  INKSPPRIPQVKIPEKPVLQIASAITIEINRAFVILREIASGKDLKQFLSVIAGLWVLSI  189

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G   +FLTL YI VVLL T+PV YEKY+D+VDAFAEKAM E+KKQYAVFDAKVLSK+P+
Sbjct  190  LGKWYNFLTLVYIVVVLLFTLPVFYEKYDDQVDAFAEKAMIEIKKQYAVFDAKVLSKVPK  249

Query  202  GPLKDKK  182
            G +KDKK
Sbjct  250  GQMKDKK  256



>emb|CDY34396.1| BnaA09g11380D [Brassica napus]
Length=251

 Score =   230 bits (586),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 150/191 (79%), Gaps = 4/191 (2%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLFLWS+A++F
Sbjct  60   GKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFLWSSATTF  119

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ PHIPEVHIPEE VLQ AS LR ++N    +LR+IA GRDLK FLMV+ GLW++S 
Sbjct  120  IHKTPPHIPEVHIPEEVVLQLASGLRIEINRGFTILRNIALGRDLKKFLMVVAGLWVLSK  179

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLS  215
            VGS C+FLTL YIA VLL TVPV YEKYED+VD F EKAM E+KKQYAV D    +KV+S
Sbjct  180  VGSSCNFLTLIYIATVLLFTVPVFYEKYEDKVDHFGEKAMKEIKKQYAVLDEKVLSKVMS  239

Query  214  KIPRGPLKDKK  182
            KIPRG    KK
Sbjct  240  KIPRGAFNKKK  250



>ref|XP_009142682.1| PREDICTED: reticulon-like protein B5 [Brassica rapa]
 emb|CDX79993.1| BnaA05g01630D [Brassica napus]
Length=251

 Score =   230 bits (586),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLWSNA +F
Sbjct  64   GKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHVSILALGGLFLWSNAHTF  123

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            IKKS P IPE+H+PEEP L  AS+LRN++N    +LR IA GRDLK FLMV+ GLWIIS+
Sbjct  124  IKKSPPQIPEIHVPEEPFLLIASSLRNELNQGFVILRSIALGRDLKKFLMVVVGLWIISV  183

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG+ C+FLTL YI  VLLHTVP++YEK+ED+VD FAEKA  EL K Y VFD KV+SKIP 
Sbjct  184  VGNWCNFLTLVYICFVLLHTVPMMYEKHEDKVDPFAEKAFKELHKHYLVFDEKVVSKIPI  243

Query  202  GPLKDK  185
              LK K
Sbjct  244  ASLKAK  249



>ref|XP_002301382.1| hypothetical protein POPTR_0002s16690g [Populus trichocarpa]
 gb|EEE80655.1| hypothetical protein POPTR_0002s16690g [Populus trichocarpa]
Length=251

 Score =   229 bits (585),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 153/188 (81%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKK+S GVLG  TA+W+LFE++EYHLLT VCH LILA A+LFLWSNA + 
Sbjct  64   GKPADVFLWRNKKVSAGVLGFVTAMWVLFELIEYHLLTLVCHILILAAALLFLWSNACTL  123

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVH+PE+ VLQ ASAL  ++N   A LR +A+G+D K FLM+I GLW++SI
Sbjct  124  INKSPPRIPEVHLPEKLVLQVASALCVEINSAFAGLRSVAAGKDFKKFLMIIAGLWVLSI  183

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS C FLTLFYI  VLLHTVPVLYEKYED+VD  AEKAM E+KKQYAVFDAKVLSKIP 
Sbjct  184  VGSSCHFLTLFYICFVLLHTVPVLYEKYEDKVDPLAEKAMVEIKKQYAVFDAKVLSKIPV  243

Query  202  GPLKDKKL  179
              LK K++
Sbjct  244  ASLKAKRV  251



>gb|AFK42059.1| unknown [Lotus japonicus]
Length=258

 Score =   230 bits (586),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 149/190 (78%), Gaps = 4/190 (2%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LW+NKK+S G LG ATA+W+ FE+LEYHLLT VCH LIL++ +LFLWSNA + 
Sbjct  67   GKPADVLLWKNKKVSAGALGVATAVWLFFELLEYHLLTLVCHILILSITLLFLWSNAHTL  126

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            + K+ P IP  H+PEEP L+ ASALR ++NH  A LRDI +G+D+K FL+ I GLWI+SI
Sbjct  127  LHKAPPRIPVFHLPEEPFLEIASALRIEINHGFAALRDIGTGKDVKKFLIAIVGLWILSI  186

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA----KVLS  215
            VGS C+FLTLFYI  VLL T+P LY+KYED++D  AEKA HE+KKQY VFDA    KVLS
Sbjct  187  VGSWCNFLTLFYINFVLLLTIPFLYDKYEDKIDPLAEKAAHEIKKQYVVFDAKVLSKVLS  246

Query  214  KIPRGPLKDK  185
            KIP+G LK K
Sbjct  247  KIPKGLLKGK  256



>ref|XP_010447719.1| PREDICTED: reticulon-like protein B4 [Camelina sativa]
Length=257

 Score =   229 bits (585),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 154/191 (81%), Gaps = 4/191 (2%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKK+S GV G  TA W+LFE++EYH LT +CH  + ALA LFLWSNA +F
Sbjct  66   GKPADIFLWRNKKVSGGVFGAITASWVLFELIEYHFLTFLCHFAMAALAALFLWSNACTF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS PHIPEVHIPE+PVLQ  S LR ++N    VLR+IASGRDLK F++VI GLW++SI
Sbjct  126  IHKSTPHIPEVHIPEDPVLQLVSGLRIEINRGFTVLRNIASGRDLKKFILVIAGLWVLSI  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLS  215
            +GSCC+FLTLFYIA VLL T+PV+YEKYED+VDAF EKAM E+KKQYAV D    +KVLS
Sbjct  186  IGSCCNFLTLFYIATVLLFTIPVVYEKYEDKVDAFGEKAMKEIKKQYAVLDEKVFSKVLS  245

Query  214  KIPRGPLKDKK  182
            KIPRG L  KK
Sbjct  246  KIPRGALNKKK  256



>ref|XP_009349323.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=259

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 148/187 (79%), Gaps = 1/187 (1%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKK+S GVLGGAT +W+LFE+L+YHLLT V H LI  LA+LFLWSNA +F
Sbjct  73   GKSADVFLWRNKKVSGGVLGGATVVWVLFELLQYHLLTLVAHILIATLAILFLWSNAHTF  132

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IPEV +PEEP LQ AS LR  +N   A+L  IASG+DLK FL VI GLW++S+
Sbjct  133  IHKTPPRIPEVRLPEEPFLQVASELRVVINCSFALLHSIASGKDLKKFLAVIAGLWVLSV  192

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG  C+FLTLFYI+ VLLHTVP +YEKYED++D  AEK   E KKQY VFDAKVLSKIP 
Sbjct  193  VGKWCNFLTLFYISFVLLHTVPFIYEKYEDKIDPLAEKVTIEFKKQYDVFDAKVLSKIPC  252

Query  202  GPLKDKK  182
            G LK+K+
Sbjct  253  G-LKNKR  258



>emb|CDY38194.1| BnaA09g11950D [Brassica napus]
Length=250

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 149/190 (78%), Gaps = 4/190 (2%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLFLWS+A++F
Sbjct  60   GKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFLWSSATTF  119

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K  PHIPEVHIPEE VLQ AS LR ++N    +LR+IA GRDLK FLMV+ GLW++S 
Sbjct  120  IHKKPPHIPEVHIPEEVVLQLASGLRIEINRGFTILRNIALGRDLKKFLMVVAGLWVLSK  179

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLS  215
            VGS C+FLTL YIA VLL T+PVLYEKYED+VD F EKAM E+KKQYAV D    +KV+S
Sbjct  180  VGSSCNFLTLIYIATVLLFTIPVLYEKYEDKVDHFGEKAMKEIKKQYAVLDEKVLSKVMS  239

Query  214  KIPRGPLKDK  185
            KIPRG    K
Sbjct  240  KIPRGAFNKK  249



>emb|CDY42012.1| BnaC04g00900D [Brassica napus]
Length=251

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 147/184 (80%), Gaps = 0/184 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLWSNA +F
Sbjct  64   GKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHVSILALGGLFLWSNAHTF  123

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            IKKS P IPE+H+PEEP L  AS+LRN++N    +LR IA GRDLK FLM++ GLWIIS+
Sbjct  124  IKKSPPQIPEIHVPEEPFLLIASSLRNELNQGFVILRSIALGRDLKKFLMIVVGLWIISV  183

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG+ C+FLTL YI  VLLHTVP++YEK+ED+VD FAEKA  EL K Y VFD KV+SKIP 
Sbjct  184  VGNWCNFLTLVYICFVLLHTVPMMYEKHEDKVDPFAEKAFKELHKHYLVFDEKVVSKIPI  243

Query  202  GPLK  191
              LK
Sbjct  244  ASLK  247



>ref|XP_009395750.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=253

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 139/188 (74%), Gaps = 0/188 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWRNKK+S    G  TAIW+ FE++EYHL+T VCHGLIL+LA++FLW NA++F
Sbjct  65   GKPADVFLWRNKKVSASTFGAVTAIWVFFELMEYHLITLVCHGLILSLAIIFLWCNATTF  124

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS PH+PEV I E+  L    +LR  +N  L  LRDIASGRDLK FL     LW++SI
Sbjct  125  ISKSRPHVPEVSISEDLALNVVLSLRYVINRGLVALRDIASGRDLKKFLAAAAALWVLSI  184

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            + +CC FL LFYIA V L+TVPVLYEKYED VDAFAEKA  E KK Y V   K LSKIP 
Sbjct  185  IANCCSFLMLFYIAFVALYTVPVLYEKYEDRVDAFAEKAEAEFKKHYVVIHVKYLSKIPM  244

Query  202  GPLKDKKL  179
            GPLKDKK 
Sbjct  245  GPLKDKKF  252



>ref|XP_006284372.1| hypothetical protein CARUB_v10005543mg [Capsella rubella]
 gb|EOA17270.1| hypothetical protein CARUB_v10005543mg [Capsella rubella]
Length=257

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 154/191 (81%), Gaps = 4/191 (2%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKK+S GV G  TA W+LFE++EYH LT +CH  + ALA LFLWSNA +F
Sbjct  66   GKPADIFLWRNKKVSGGVFGAITASWVLFELIEYHFLTFLCHFAMAALAALFLWSNACTF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ PHIPEVHIPE+PVLQ  S LR ++N    VLR+IASGRDLK F++VI GLWI+SI
Sbjct  126  IHKATPHIPEVHIPEDPVLQLVSGLRIEINRGFTVLRNIASGRDLKKFILVIAGLWILSI  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLS  215
            +GSCC+FLTLFYIA VLL T+PV+YEKYED+VDAF EKAM E+KKQYAV D    +KVLS
Sbjct  186  LGSCCNFLTLFYIATVLLFTIPVIYEKYEDKVDAFGEKAMKEIKKQYAVLDEKVLSKVLS  245

Query  214  KIPRGPLKDKK  182
            KIPRG L  KK
Sbjct  246  KIPRGALNKKK  256



>ref|NP_001185307.1| reticulon-like protein B3 [Arabidopsis thaliana]
 gb|AEE34191.1| reticulon-like protein B3 [Arabidopsis thaliana]
Length=271

 Score =   228 bits (582),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 146/182 (80%), Gaps = 4/182 (2%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  ILALAVLFLWS+AS+FI K
Sbjct  81   ADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWSSASTFIHK  140

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S  HIPEVHIPE+ VLQ AS LR ++N    VLRDIASGRDLK FL+VI GLW++S VGS
Sbjct  141  SPLHIPEVHIPEDVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSKVGS  200

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLSKIP  206
             C+FLTL YIA VLL T+PVLYEKYED+VD F EKAM E+KKQY  FD    +KV+SKIP
Sbjct  201  SCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKAMREIKKQYVEFDVKVLSKVMSKIP  260

Query  205  RG  200
            +G
Sbjct  261  KG  262



>gb|KFK40472.1| hypothetical protein AALP_AA2G000200 [Arabis alpina]
Length=254

 Score =   228 bits (580),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 151/192 (79%), Gaps = 4/192 (2%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  ILALAVLFLWS+A++F
Sbjct  63   GKPADIFLWRNKKVSGGVLGAATISWILFELLEYNLLTLFGHVSILALAVLFLWSSATTF  122

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ PHIPE+HIPE+ VL+ AS LR ++N    VLR IA GRDLK FLMV+ GLW++SI
Sbjct  123  IHKTPPHIPEIHIPEKIVLELASGLRIEINRGFTVLRHIALGRDLKKFLMVVAGLWVLSI  182

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLS  215
            +GS C FLTL YIA V+L TVPVLYEKYED+VD F EKAM E+KKQYAV D    +KV+S
Sbjct  183  LGSSCTFLTLVYIATVILFTVPVLYEKYEDKVDDFGEKAMKEIKKQYAVLDEKVLSKVMS  242

Query  214  KIPRGPLKDKKL  179
            KIP G L  KKL
Sbjct  243  KIPIGALMKKKL  254



>ref|XP_009112901.1| PREDICTED: reticulon-like protein B3 [Brassica rapa]
Length=251

 Score =   228 bits (580),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 148/191 (77%), Gaps = 4/191 (2%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLFLWS+A++F
Sbjct  60   GKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFLWSSATTF  119

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K  PHIPEVHIPEE  LQ AS LR ++N    +LR+IA GR+LK FLMV+ GLW++S 
Sbjct  120  IHKKPPHIPEVHIPEEVALQLASGLRIEINRGFTILRNIALGRELKKFLMVVAGLWVLSK  179

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLS  215
            VGS C+FLTL YIA VLL TVPV YEKYED+VD F EKAM E+KKQYAV D    +KV+S
Sbjct  180  VGSSCNFLTLIYIATVLLFTVPVFYEKYEDKVDHFGEKAMKEIKKQYAVLDEKVLSKVMS  239

Query  214  KIPRGPLKDKK  182
            KIPRG    KK
Sbjct  240  KIPRGAFNKKK  250



>ref|XP_006302727.1| hypothetical protein CARUB_v10020840mg [Capsella rubella]
 gb|EOA35625.1| hypothetical protein CARUB_v10020840mg [Capsella rubella]
Length=253

 Score =   228 bits (580),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 147/185 (79%), Gaps = 4/185 (2%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  IL LAVLFLWS+A++F
Sbjct  61   GKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWSSATTF  120

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ PHIPEVHIPEE VLQ AS LR ++N     LRDIASGRDLK FL+VI GLW++S 
Sbjct  121  IHKTPPHIPEVHIPEEVVLQLASGLRIEINRGFTALRDIASGRDLKKFLLVIAGLWVLSK  180

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLS  215
            VGS C+FLTL YIA VLL T+PVLYEKYED+VD F EKAM E+KKQY  FD    +KV+S
Sbjct  181  VGSSCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKAMREIKKQYVEFDVKVLSKVMS  240

Query  214  KIPRG  200
            KIP+G
Sbjct  241  KIPKG  245



>ref|XP_010671578.1| PREDICTED: reticulon-like protein B4 [Beta vulgaris subsp. vulgaris]
Length=286

 Score =   228 bits (582),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 151/189 (80%), Gaps = 0/189 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LWRNKKIS   LG AT IW LFE+LEYHLLT +CH LI  LAVLFLWSNAS+F
Sbjct  98   GKPADVLLWRNKKISASALGVATVIWFLFELLEYHLLTLLCHILIFTLAVLFLWSNASAF  157

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IP+VHIP+  +L+F S LR ++N  L+VLRDIASG++LK F  VI GLW++S+
Sbjct  158  IHKAPPRIPDVHIPDNALLEFISVLRFEINRALSVLRDIASGKELKKFFGVIAGLWVVSV  217

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGS  +FLTL Y+  VLLHTVPVLYEKYED VDAFAEKA  ELKKQYAV D K LSKIPR
Sbjct  218  VGSWFNFLTLVYLLFVLLHTVPVLYEKYEDHVDAFAEKAAIELKKQYAVADEKFLSKIPR  277

Query  202  GPLKDKKLA  176
            GPLKDKK A
Sbjct  278  GPLKDKKSA  286



>ref|XP_002880222.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56481.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
Length=255

 Score =   227 bits (579),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 147/186 (79%), Gaps = 0/186 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLWSN  +F
Sbjct  66   GKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNVHTF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K++P IPE+H+PEE  L  AS+LRN++N    +LR IA GRDLK FLMV+ GLWIIS+
Sbjct  126  INKASPQIPEIHVPEEAFLVIASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISV  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG+ C+FLTL Y   V+LHTVP+LYEK+ED+VD  AEKA+ EL+KQY VFD KVLSKIP 
Sbjct  186  VGNWCNFLTLVYFCFVILHTVPMLYEKHEDKVDPLAEKALKELQKQYVVFDEKVLSKIPI  245

Query  202  GPLKDK  185
              LK K
Sbjct  246  ASLKAK  251



>ref|XP_006656127.1| PREDICTED: reticulon-like protein B2-like [Oryza brachyantha]
Length=262

 Score =   228 bits (580),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LW++KK S  V+GGAT IWILFEVL+YHLLT + H +I ALA+LFLWS A++F
Sbjct  74   GKTADVLLWKDKKTSAVVIGGATVIWILFEVLDYHLLTLLSHVMIGALAILFLWSKATTF  133

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            IKKS P IP V IPE+  +  + ALRND+N  L + R+IA G DLK FL VI  LW++S 
Sbjct  134  IKKSPPDIPVVQIPEDVAVNVSRALRNDINRALHLFREIALGHDLKKFLGVIVALWVLSE  193

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGSCCDFLTL Y+AV++LHTVP+LY+KY+D+VD FA +A  E  K Y V DAKVLSKIPR
Sbjct  194  VGSCCDFLTLIYVAVLMLHTVPILYDKYQDKVDHFAGRAHSEACKHYEVLDAKVLSKIPR  253

Query  202  GPLKDKK  182
            GP K KK
Sbjct  254  GPSKPKK  260



>gb|ACG32549.1| seed maturation protein [Zea mays]
Length=254

 Score =   227 bits (579),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNK+IS GVL GATA W+LFEV++YHLLT +CH LIL LA+LFLWSNA++F
Sbjct  66   GKPADLFLWRNKRISGGVLAGATAFWLLFEVMDYHLLTLLCHCLILTLAILFLWSNATTF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P+IPEV IP++  + FA +LR ++N   A LR+I  G DLK FL+VI GLWI+S+
Sbjct  126  INKSPPNIPEVKIPDDLAVNFARSLRYEINRGFATLREIGQGHDLKKFLIVIAGLWILSV  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTL YI  ++L+TVPVLYEK+ED+VDAF EKAM ELKK YA+FD K LSKIP+
Sbjct  186  LGSCCNFLTLSYIVFMVLYTVPVLYEKHEDKVDAFGEKAMVELKKYYAIFDEKCLSKIPK  245

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  246  GPLKDKK  252



>ref|NP_001046501.1| Os02g0265900 [Oryza sativa Japonica Group]
 dbj|BAD27895.1| putative 24 kDa seed maturation protein [Oryza sativa Japonica 
Group]
 dbj|BAF08415.1| Os02g0265900 [Oryza sativa Japonica Group]
 gb|EAZ22509.1| hypothetical protein OsJ_06173 [Oryza sativa Japonica Group]
 dbj|BAG96495.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87213.1| unnamed protein product [Oryza sativa Japonica Group]
Length=230

 Score =   226 bits (575),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LW++KKIS  V+GGAT +W+LFEV++YH LT + H LI  LA+LFLWS A+ F
Sbjct  42   GKAADVLLWKDKKISAAVIGGATVLWVLFEVVDYHFLTLISHVLIGVLAILFLWSKATIF  101

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            IKKS P+IPEV I E+  +  A ALR D+N  L +LR+I+ G DL  FL VI  LWI+S 
Sbjct  102  IKKSPPNIPEVKISEDLAVNVALALRTDINQALHLLREISLGHDLMKFLGVIVALWILSE  161

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GS CDFLTLFY+AV++LHTVP+LY KY+D+VD FA KA  EL +QY+V DAKVLSKIPR
Sbjct  162  IGSLCDFLTLFYVAVLMLHTVPILYHKYQDKVDHFAGKAHVELSRQYSVLDAKVLSKIPR  221

Query  202  GPLKDKK  182
            GP KDKK
Sbjct  222  GPAKDKK  228



>ref|XP_004308034.1| PREDICTED: reticulon-like protein B2 [Fragaria vesca subsp. vesca]
Length=275

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LWR+KK S  VLG AT +WI FE LEYHL+T  CH +IL LAV FLWSN SSF
Sbjct  87   GKPADVLLWRDKKESASVLGAATVLWIFFECLEYHLITLFCHIMILFLAVFFLWSNGSSF  146

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ P IP+V IPE+ VL  ASALR ++N    VLR+IASGRDLK FL VI  LWI+S+
Sbjct  147  INKAPPEIPKVQIPEKCVLDIASALRIELNKGFHVLREIASGRDLKTFLGVIAVLWIVSV  206

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +G C  FLTLFY+  VLLH+ P++YEK+ED++DA AEKA  E KKQYAVF+ KVLSKIP+
Sbjct  207  IGKCFSFLTLFYLTFVLLHSAPLIYEKHEDQIDAVAEKAWIEFKKQYAVFNEKVLSKIPK  266

Query  202  GPLKDKK  182
            GP+K+KK
Sbjct  267  GPVKEKK  273



>ref|XP_010441324.1| PREDICTED: reticulon-like protein B4 [Camelina sativa]
Length=257

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 152/191 (80%), Gaps = 4/191 (2%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKK+S GV G  TA W+LFE++EY  LT +CH  + ALA LFLWSNA +F
Sbjct  66   GKPADIFLWRNKKVSGGVFGAITASWVLFELIEYRFLTFLCHFAMAALAALFLWSNACTF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P IPEVHIPE+PVLQ  S LR ++N    VLR+IASGRDLK F++VI GLW++SI
Sbjct  126  IHKSTPRIPEVHIPEDPVLQLVSGLRIEINRGFTVLRNIASGRDLKKFILVIAGLWVLSI  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLS  215
            +GSCC+FLTLFYIA VLL T+PV+YEKYED+VDAF EKAM E+KKQYAV D    +KVLS
Sbjct  186  IGSCCNFLTLFYIATVLLFTIPVVYEKYEDKVDAFGEKAMKEIKKQYAVLDDKVFSKVLS  245

Query  214  KIPRGPLKDKK  182
            KIPRG L  KK
Sbjct  246  KIPRGALNKKK  256



>emb|CDY52012.1| BnaC06g42920D [Brassica napus]
Length=254

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 145/186 (78%), Gaps = 0/186 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            G  ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ VCH LI +LA +FLWSNA +F
Sbjct  67   GLPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLVCHILIFSLAAMFLWSNAHAF  126

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            +KKS P IPEVH+ EE  L  ASALRN++N    +LR IA GRDLK FLMV+ GLWIIS+
Sbjct  127  MKKSPPKIPEVHVKEEHFLLIASALRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISV  186

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG+  +FLTL YI  V+LHTVP+LYEK+ED+VD  AEK + ELKK Y VFD KVLSKIP 
Sbjct  187  VGNWFNFLTLVYICFVVLHTVPMLYEKHEDKVDPVAEKTLKELKKHYMVFDEKVLSKIPL  246

Query  202  GPLKDK  185
              LK K
Sbjct  247  ASLKAK  252



>ref|XP_010436110.1| PREDICTED: reticulon-like protein B4 [Camelina sativa]
Length=257

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 153/191 (80%), Gaps = 4/191 (2%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNKK+S GV G  TA W+LFE++EYH LT +CH  + ALA LFLWSNA +F
Sbjct  66   GKPADIFLWRNKKVSGGVFGAITASWVLFELIEYHFLTFLCHFAMAALAALFLWSNACTF  125

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I K+ PH+PEVHIPE+PVLQ  S LR ++N    VLR+IASGRDLK F++VI GLW +SI
Sbjct  126  IHKATPHLPEVHIPEDPVLQLVSGLRIEINRGFTVLRNIASGRDLKKFILVIAGLWALSI  185

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLS  215
            +GSCC+FLTLFYIA VLL T+PV+YEKYED+VDAF EKAM E+KKQYAV D    +KVLS
Sbjct  186  IGSCCNFLTLFYIATVLLFTIPVVYEKYEDKVDAFGEKAMKEIKKQYAVLDEKVLSKVLS  245

Query  214  KIPRGPLKDKK  182
            KIPRG L  KK
Sbjct  246  KIPRGALNKKK  256



>ref|XP_002441411.1| hypothetical protein SORBIDRAFT_09g026210 [Sorghum bicolor]
 gb|EES19841.1| hypothetical protein SORBIDRAFT_09g026210 [Sorghum bicolor]
Length=255

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK AD+FLWRNK+IS GVL GATAIW+LFEV++YHLLT +CH LIL LA+LFLWSNA++F
Sbjct  67   GKPADLFLWRNKRISGGVLAGATAIWLLFEVMDYHLLTLLCHCLILTLAILFLWSNATTF  126

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            I KS P+IPEV IPE+  +  A +LR ++N   A LR+I  G DLK FL+VI GLWI+S+
Sbjct  127  INKSPPNIPEVKIPEDLAVNVARSLRYEINRGFATLREIGQGHDLKKFLIVIAGLWILSV  186

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GSCC+FLTL YI  ++L+TVPVLYEK+ED+VDAF EKAM ELKK YA+FD K LSKIP+
Sbjct  187  LGSCCNFLTLSYIVFMVLYTVPVLYEKHEDKVDAFGEKAMVELKKYYAIFDEKCLSKIPK  246

Query  202  GPLKDKK  182
            GPLKDKK
Sbjct  247  GPLKDKK  253



>ref|NP_001057713.1| Os06g0503400 [Oryza sativa Japonica Group]
 dbj|BAD45275.1| putative 24 kDa seed maturation protein [Oryza sativa Japonica 
Group]
 dbj|BAF19627.1| Os06g0503400 [Oryza sativa Japonica Group]
 dbj|BAG93532.1| unnamed protein product [Oryza sativa Japonica Group]
Length=265

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LW++KK S  V+GGAT IWILFEVL+YHLLT + H +I ALA+LFLWS A++F
Sbjct  78   GKTADVLLWKDKKTSAVVIGGATVIWILFEVLDYHLLTLLSHVMIGALAILFLWSKATTF  137

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            IKKS P IP V IPE+  +  + ALR+D+N  L + R+IA G DLK FL VI  LW++S 
Sbjct  138  IKKSPPDIPVVQIPEDVAVNVSRALRSDINRALHLFREIALGHDLKKFLGVIVALWVLSE  197

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGSCCDFLTL Y+AV++LHTVP+LY+KY+D+VD FA +A  E  K Y V DAKVLSKIPR
Sbjct  198  VGSCCDFLTLIYVAVLMLHTVPILYDKYQDKVDHFAGRAHSEACKHYEVLDAKVLSKIPR  257

Query  202  GPLKDKK  182
            GP+K KK
Sbjct  258  GPVKPKK  264



>ref|XP_009104316.1| PREDICTED: reticulon-like protein B6 [Brassica rapa]
 emb|CDY53913.1| BnaA07g38210D [Brassica napus]
Length=254

 Score =   225 bits (574),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 143/186 (77%), Gaps = 0/186 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            G  ADVFLWR+KK+S  VLG ATAIW+LFE++EYH L+ VCH LI +LA +FLWSNA +F
Sbjct  67   GLPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSLVCHILIFSLAAMFLWSNAHAF  126

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            +KKS P IPE+ + EE  L  ASALRN++N    +LR IA GRDLK FLMV+ GLWIIS+
Sbjct  127  MKKSPPKIPEIQVKEEHFLLIASALRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISV  186

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VG+  +FLTL YI  V+LHTVP+LYEK+ED+VD  AEK + ELKK Y VFD KVLSKIP 
Sbjct  187  VGNWFNFLTLVYICFVVLHTVPMLYEKHEDKVDPVAEKTLKELKKHYMVFDEKVLSKIPL  246

Query  202  GPLKDK  185
              LK K
Sbjct  247  ASLKAK  252



>gb|EPS71452.1| hypothetical protein M569_03311 [Genlisea aurea]
Length=242

 Score =   225 bits (573),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 146/187 (78%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LWRNK +S+GV+GGATAIWILF+VLEYH LT V H LIL L + F+WSN S+F
Sbjct  54   GKAADVLLWRNKNVSLGVIGGATAIWILFDVLEYHFLTLVSHALILGLVIFFVWSNGSTF  113

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            +KKS P IP+V IPE+PVL+F S  R ++N   + LRDIASG+DLK FL++I  LW +S+
Sbjct  114  LKKSPPRIPQVIIPEKPVLEFVSDARIEINRAFSSLRDIASGKDLKKFLLLIVVLWALSV  173

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GS  DFL+L Y+  V L T+P  YEKYEDE+D+FA  A  ELKKQYA FDAKVLSKIPR
Sbjct  174  LGSLFDFLSLVYLTTVSLLTLPSFYEKYEDEIDSFAHGAAAELKKQYAAFDAKVLSKIPR  233

Query  202  GPLKDKK  182
            G L+++K
Sbjct  234  GLLQNRK  240



>gb|ABB51093.1| reticulon [Hordeum vulgare]
Length=204

 Score =   223 bits (569),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 141/187 (75%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LW+NKK +  V+GG T IW+LFEVL+YHLLT + H +I  LA+LF+WS A +F
Sbjct  17   GKTADVLLWKNKKTTAVVIGGTTVIWVLFEVLDYHLLTLLSHVMIGVLAILFVWSKAMTF  76

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            IKKS P IP V IPE+  +  + ALRNDVN  L + R+IA G DLK FL VI GLW++S 
Sbjct  77   IKKSPPDIPVVEIPEDLAVNVSRALRNDVNRSLHLFREIAMGHDLKKFLGVIAGLWVLSE  136

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            VGSCCDFLTL YIAV+++HTVP+LY+KY+D+VD FA KA  E  K Y V D KVLSKIPR
Sbjct  137  VGSCCDFLTLIYIAVLMIHTVPILYDKYQDKVDHFAGKAHTEACKHYEVLDQKVLSKIPR  196

Query  202  GPLKDKK  182
            GP K KK
Sbjct  197  GPAKTKK  203



>gb|EAY85291.1| hypothetical protein OsI_06662 [Oryza sativa Indica Group]
Length=230

 Score =   224 bits (571),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = -1

Query  742  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  563
            GK ADV LW++KKIS  V+GGAT +W+LFEV++YH LT + H LI  LA+LFLWS A+ F
Sbjct  42   GKAADVLLWKDKKISAAVIGGATVLWVLFEVVDYHFLTLISHVLIGVLAILFLWSKATIF  101

Query  562  IKKSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISI  383
            IKKS P+IPEV I E+  +  A ALR D+N  L +LR+I+ G DL  FL VI  LWI+S 
Sbjct  102  IKKSPPNIPEVKISEDLAVNVALALRTDINQALHLLREISLGHDLMKFLGVIVALWILSE  161

Query  382  VGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPR  203
            +GS CDFLTLFY+AV++LHTVP+ Y KY+D+VD FA KA  EL +QY+V DAKVLSKIPR
Sbjct  162  IGSLCDFLTLFYVAVLMLHTVPIFYHKYQDKVDHFAGKAHVELSRQYSVLDAKVLSKIPR  221

Query  202  GPLKDKK  182
            GP KDKK
Sbjct  222  GPAKDKK  228



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1347639082210