BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF011N15

Length=690
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009624871.1|  PREDICTED: putative glycosyltransferase 7          279   4e-88   Nicotiana tomentosiformis
ref|XP_006363813.1|  PREDICTED: putative glycosyltransferase 7-li...    278   8e-88   Solanum tuberosum [potatoes]
ref|XP_006363812.1|  PREDICTED: putative glycosyltransferase 7-li...    278   9e-88   Solanum tuberosum [potatoes]
ref|XP_009761597.1|  PREDICTED: putative glycosyltransferase 7          278   2e-87   Nicotiana sylvestris
ref|XP_004231937.1|  PREDICTED: putative glycosyltransferase 7          277   4e-87   Solanum lycopersicum
ref|XP_011099399.1|  PREDICTED: glycosyltransferase 6-like              268   1e-83   Sesamum indicum [beniseed]
gb|EYU44510.1|  hypothetical protein MIMGU_mgv1a018855mg                264   2e-82   Erythranthe guttata [common monkey flower]
ref|XP_011073681.1|  PREDICTED: glycosyltransferase 6                   260   1e-80   Sesamum indicum [beniseed]
gb|EYU41378.1|  hypothetical protein MIMGU_mgv1a006348mg                259   1e-80   Erythranthe guttata [common monkey flower]
ref|XP_010646814.1|  PREDICTED: LOW QUALITY PROTEIN: putative gly...    257   5e-80   
emb|CAN80825.1|  hypothetical protein VITISV_015452                     256   3e-79   Vitis vinifera
ref|XP_009777954.1|  PREDICTED: putative glycosyltransferase 7 is...    249   4e-77   Nicotiana sylvestris
ref|XP_009777953.1|  PREDICTED: putative glycosyltransferase 7 is...    249   1e-76   Nicotiana sylvestris
emb|CDP02616.1|  unnamed protein product                                249   2e-76   Coffea canephora [robusta coffee]
gb|ACE60602.1|  putative galactomannan galactosyl transferase           248   7e-76   Coffea arabica [arabica coffee]
ref|XP_009618872.1|  PREDICTED: putative glycosyltransferase 7          246   2e-75   Nicotiana tomentosiformis
gb|EPS69883.1|  hypothetical protein M569_04879                         243   2e-74   Genlisea aurea
ref|XP_010273069.1|  PREDICTED: putative glycosyltransferase 7          244   2e-74   Nelumbo nucifera [Indian lotus]
ref|XP_004141854.1|  PREDICTED: galactomannan galactosyltransfera...    237   6e-72   Cucumis sativus [cucumbers]
ref|XP_010274411.1|  PREDICTED: galactomannan galactosyltransfera...    236   3e-71   Nelumbo nucifera [Indian lotus]
ref|XP_010106924.1|  Galactomannan galactosyltransferase 1              233   3e-70   Morus notabilis
ref|XP_008440417.1|  PREDICTED: galactomannan galactosyltransfera...    233   4e-70   Cucumis melo [Oriental melon]
gb|KHG22205.1|  Putative glycosyltransferase 7 -like protein            230   5e-69   Gossypium arboreum [tree cotton]
gb|KJB18050.1|  hypothetical protein B456_003G031400                    229   1e-68   Gossypium raimondii
gb|ADL36661.1|  CAMTA domain class transcription factor                 228   3e-68   Malus domestica [apple tree]
ref|XP_009362595.1|  PREDICTED: LOW QUALITY PROTEIN: galactomanna...    229   4e-68   Pyrus x bretschneideri [bai li]
ref|XP_007205195.1|  hypothetical protein PRUPE_ppa005681mg             228   4e-68   Prunus persica
gb|KHG22229.1|  Putative glycosyltransferase 7 -like protein            228   4e-68   Gossypium arboreum [tree cotton]
gb|KJB46680.1|  hypothetical protein B456_008G0841002                   227   5e-68   Gossypium raimondii
gb|ADL36663.1|  CAMTA domain class transcription factor                 226   8e-68   Malus domestica [apple tree]
gb|KJB46678.1|  hypothetical protein B456_008G0841002                   226   1e-67   Gossypium raimondii
ref|XP_007047569.1|  Galactosyl transferase GMA12/MNN10 family pr...    226   2e-67   
ref|XP_008347885.1|  PREDICTED: galactomannan galactosyltransfera...    226   2e-67   
ref|XP_008362135.1|  PREDICTED: galactomannan galactosyltransfera...    227   2e-67   
ref|XP_008237711.1|  PREDICTED: galactomannan galactosyltransfera...    225   3e-67   Prunus mume [ume]
ref|XP_004288265.1|  PREDICTED: galactomannan galactosyltransfera...    225   6e-67   Fragaria vesca subsp. vesca
ref|XP_006426098.1|  hypothetical protein CICLE_v10025585mg             224   1e-66   Citrus clementina [clementine]
ref|XP_006466460.1|  PREDICTED: putative glycosyltransferase 7-like     224   1e-66   Citrus sinensis [apfelsine]
ref|XP_003539263.1|  PREDICTED: galactomannan galactosyltransfera...    222   6e-66   Glycine max [soybeans]
gb|KDP32091.1|  hypothetical protein JCGZ_12552                         221   8e-66   Jatropha curcas
ref|XP_006350640.1|  PREDICTED: putative glycosyltransferase 7-like     220   1e-65   Solanum tuberosum [potatoes]
ref|XP_006857127.1|  hypothetical protein AMTR_s00065p00144450          222   1e-65   Amborella trichopoda
emb|CDP02619.1|  unnamed protein product                                221   2e-65   Coffea canephora [robusta coffee]
gb|KJB43940.1|  hypothetical protein B456_007G224800                    219   6e-65   Gossypium raimondii
ref|XP_007156700.1|  hypothetical protein PHAVU_002G009900g             219   7e-65   Phaseolus vulgaris [French bean]
ref|XP_002310890.2|  alpha galactosyltransferase family protein         219   8e-65   
ref|XP_011007841.1|  PREDICTED: putative glycosyltransferase 7          219   1e-64   Populus euphratica
ref|XP_002320005.2|  alpha galactosyltransferase family protein         219   1e-64   Populus trichocarpa [western balsam poplar]
ref|XP_004234713.2|  PREDICTED: glycosyltransferase 6-like              217   4e-64   
ref|XP_011031309.1|  PREDICTED: putative glycosyltransferase 7          217   4e-64   Populus euphratica
gb|KDO78929.1|  hypothetical protein CISIN_1g045999mg                   217   4e-64   Citrus sinensis [apfelsine]
ref|XP_002525290.1|  transferase, putative                              216   1e-63   Ricinus communis
emb|CAI79403.1|  galactomannan galactosyltransferase                    216   1e-63   Senna occidentalis [antbush]
gb|KHN36310.1|  Galactomannan galactosyltransferase 1                   215   1e-63   Glycine soja [wild soybean]
ref|XP_003611556.1|  Galactomannan galactosyltransferase                215   2e-63   Medicago truncatula
ref|XP_009394361.1|  PREDICTED: galactomannan galactosyltransfera...    215   2e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011099400.1|  PREDICTED: glycosyltransferase 6-like              213   6e-63   Sesamum indicum [beniseed]
ref|XP_003517354.1|  PREDICTED: galactomannan galactosyltransfera...    214   8e-63   Glycine max [soybeans]
ref|XP_004511818.1|  PREDICTED: galactomannan galactosyltransfera...    211   7e-62   
ref|XP_010109205.1|  Galactomannan galactosyltransferase 1              210   1e-61   Morus notabilis
ref|XP_006404757.1|  hypothetical protein EUTSA_v10000162mg             209   6e-61   Eutrema salsugineum [saltwater cress]
emb|CDY49440.1|  BnaA09g42270D                                          208   8e-61   Brassica napus [oilseed rape]
ref|XP_009117319.1|  PREDICTED: putative glycosyltransferase 7          208   9e-61   Brassica rapa
ref|XP_010531308.1|  PREDICTED: putative glycosyltransferase 7          208   9e-61   Tarenaya hassleriana [spider flower]
emb|CDX76887.1|  BnaC08g34730D                                          208   1e-60   
ref|XP_002880469.1|  galactosyl transferase GMA12/MNN10 family pr...    206   4e-60   
ref|XP_010417049.1|  PREDICTED: putative glycosyltransferase 7          206   6e-60   Camelina sativa [gold-of-pleasure]
ref|XP_004231939.1|  PREDICTED: glycosyltransferase 6-like              205   1e-59   Solanum lycopersicum
ref|XP_010472288.1|  PREDICTED: putative glycosyltransferase 7          205   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010429224.1|  PREDICTED: putative glycosyltransferase 7          205   2e-59   Camelina sativa [gold-of-pleasure]
ref|NP_565544.1|  putative glycosyltransferase 7                        205   2e-59   Arabidopsis thaliana [mouse-ear cress]
emb|CAI11452.1|  alpha-6-galactosyltransferase                          204   3e-59   Solanum tuberosum [potatoes]
ref|XP_006294199.1|  hypothetical protein CARUB_v10023195mg             204   3e-59   Capsella rubella
emb|CDP02617.1|  unnamed protein product                                203   7e-59   Coffea canephora [robusta coffee]
ref|XP_006363811.1|  PREDICTED: putative glycosyltransferase 7-like     203   7e-59   
ref|XP_009607432.1|  PREDICTED: glycosyltransferase 6-like              202   2e-58   Nicotiana tomentosiformis
gb|ACH58908.1|  galactosyl transferase                                  201   6e-58   Coffea canephora [robusta coffee]
ref|XP_009345079.1|  PREDICTED: putative glycosyltransferase 7          200   1e-57   Pyrus x bretschneideri [bai li]
ref|XP_008392336.1|  PREDICTED: putative glycosyltransferase 7          199   4e-57   
ref|XP_008363062.1|  PREDICTED: glycosyltransferase 6-like              198   4e-57   
ref|XP_002513422.1|  transferase, putative                              198   5e-57   
emb|CAI11453.1|  alpha-6-galactosyltransferase                          198   7e-57   Nicotiana benthamiana
ref|XP_010432039.1|  PREDICTED: glycosyltransferase 6                   197   7e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010437192.1|  PREDICTED: glycosyltransferase 6-like              197   7e-57   Camelina sativa [gold-of-pleasure]
ref|NP_001105164.1|  alpha-6-galactosyltransferase                      197   1e-56   Zea mays [maize]
ref|NP_001281283.1|  putative glycosyltransferase 7                     197   2e-56   Malus domestica [apple tree]
ref|XP_010446636.1|  PREDICTED: LOW QUALITY PROTEIN: glycosyltran...    196   2e-56   Camelina sativa [gold-of-pleasure]
ref|XP_009761596.1|  PREDICTED: glycosyltransferase 6-like              197   2e-56   Nicotiana sylvestris
ref|XP_004294205.1|  PREDICTED: galactomannan galactosyltransfera...    196   2e-56   Fragaria vesca subsp. vesca
ref|XP_008806204.1|  PREDICTED: galactomannan galactosyltransfera...    197   3e-56   Phoenix dactylifera
emb|CAD98924.1|  galactomannan galactosyltransferase                    196   3e-56   Lotus japonicus
ref|XP_009361779.1|  PREDICTED: glycosyltransferase 6-like              196   4e-56   
ref|XP_006411860.1|  hypothetical protein EUTSA_v10027092mg             196   4e-56   
ref|XP_008226081.1|  PREDICTED: putative glycosyltransferase 7          195   1e-55   Prunus mume [ume]
gb|KHN20359.1|  Galactomannan galactosyltransferase 1                   190   1e-55   Glycine soja [wild soybean]
ref|XP_007211970.1|  hypothetical protein PRUPE_ppa006622mg             193   2e-55   
ref|NP_680773.1|  glycosyltransferase 6                                 193   4e-55   Arabidopsis thaliana [mouse-ear cress]
gb|KDP25125.1|  hypothetical protein JCGZ_22660                         192   9e-55   Jatropha curcas
ref|XP_009138524.1|  PREDICTED: glycosyltransferase 6                   191   2e-54   Brassica rapa
emb|CDY29577.1|  BnaA03g54220D                                          191   2e-54   Brassica napus [oilseed rape]
ref|XP_010939020.1|  PREDICTED: LOW QUALITY PROTEIN: galactomanna...    192   2e-54   Elaeis guineensis
ref|XP_003525869.1|  PREDICTED: galactomannan galactosyltransfera...    189   8e-54   Glycine max [soybeans]
gb|KFK30380.1|  hypothetical protein AALP_AA7G253700                    189   1e-53   Arabis alpina [alpine rockcress]
ref|XP_010028081.1|  PREDICTED: putative glycosyltransferase 7          190   1e-53   Eucalyptus grandis [rose gum]
emb|CDX72649.1|  BnaC07g46710D                                          189   2e-53   
ref|XP_002868971.1|  galactosyl transferase GMA12/MNN10 family pr...    188   5e-53   Arabidopsis lyrata subsp. lyrata
emb|CAI11454.1|  alpha-6-galactosyltransferase                          187   6e-53   Medicago truncatula
ref|XP_003608541.1|  Alpha-6-galactosyltransferase                      187   1e-52   
ref|XP_009362594.1|  PREDICTED: glycosyltransferase 6-like              185   3e-52   Pyrus x bretschneideri [bai li]
ref|XP_009394626.1|  PREDICTED: galactomannan galactosyltransfera...    185   4e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY87343.1|  hypothetical protein OsI_08746                          184   8e-52   Oryza sativa Indica Group [Indian rice]
gb|ACF33173.1|  putative galactomannan galactosyl transferase           184   9e-52   Coffea canephora [robusta coffee]
ref|NP_001047970.1|  Os02g0723200                                       184   1e-51   
emb|CDP02618.1|  unnamed protein product                                184   1e-51   Coffea canephora [robusta coffee]
ref|NP_001068066.1|  Os11g0546500                                       184   2e-51   
gb|EAY81250.1|  hypothetical protein OsI_36429                          184   2e-51   Oryza sativa Indica Group [Indian rice]
emb|CAB52246.1|  alpha galactosyltransferase                            183   3e-51   Trigonella foenum-graecum [fenugreek]
ref|XP_002454367.1|  hypothetical protein SORBIDRAFT_04g029500          183   4e-51   Sorghum bicolor [broomcorn]
tpg|DAA64594.1|  TPA: putative galacto(gluco)mannan alpha-1,6-gal...    174   9e-51   Pinus taeda
ref|XP_006663513.1|  PREDICTED: putative glycosyltransferase 7-like     178   3e-50   Oryza brachyantha
ref|XP_010679659.1|  PREDICTED: putative glycosyltransferase 7          180   4e-50   Beta vulgaris subsp. vulgaris [field beet]
sp|Q564G7.1|GMGT1_CYATE  RecName: Full=Galactomannan galactosyltr...    178   2e-49   Cyamopsis tetragonoloba [cluster bean]
ref|XP_008363070.1|  PREDICTED: LOW QUALITY PROTEIN: galactomanna...    175   2e-48   
dbj|BAK05879.1|  predicted protein                                      174   7e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003608540.1|  Galactomannan galactosyltransferase                173   2e-47   Medicago truncatula
ref|XP_007208181.1|  hypothetical protein PRUPE_ppa017391mg             171   2e-47   
ref|XP_008238162.1|  PREDICTED: glycosyltransferase 6-like              172   4e-47   Prunus mume [ume]
gb|ADE76992.1|  unknown                                                 168   2e-45   Picea sitchensis
ref|XP_004953741.1|  PREDICTED: galactomannan galactosyltransfera...    167   3e-45   Setaria italica
ref|XP_003570475.1|  PREDICTED: galactomannan galactosyltransfera...    165   1e-44   Brachypodium distachyon [annual false brome]
gb|AFW64907.1|  glycosyltransferase 6                                   166   1e-44   
ref|XP_003575986.2|  PREDICTED: galactomannan galactosyltransfera...    166   2e-44   
gb|ABK25085.1|  unknown                                                 165   3e-44   Picea sitchensis
ref|XP_008795673.1|  PREDICTED: glycosyltransferase 6-like              166   3e-44   
ref|NP_001152534.1|  glycosyltransferase 6                              164   5e-44   
ref|XP_002449648.1|  hypothetical protein SORBIDRAFT_05g020910          163   1e-43   Sorghum bicolor [broomcorn]
ref|XP_004980586.1|  PREDICTED: galactomannan galactosyltransfera...    162   2e-43   Setaria italica
ref|XP_004980585.1|  PREDICTED: galactomannan galactosyltransfera...    157   1e-42   Setaria italica
gb|AHC98115.1|  putative galacto(gluco)mannan alpha-1,6-galactosy...    160   3e-42   Pinus radiata
tpg|DAA64590.1|  TPA: putative galacto(gluco)mannan alpha-1,6-gal...    160   3e-42   Pinus taeda
gb|EMS46901.1|  Galactomannan galactosyltransferase 1                   154   2e-41   Triticum urartu
ref|XP_008679453.1|  PREDICTED: galactomannan galactosyltransfera...    156   4e-41   Zea mays [maize]
ref|XP_009406736.1|  PREDICTED: galactomannan galactosyltransfera...    155   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008679454.1|  PREDICTED: galactomannan galactosyltransfera...    154   3e-40   Zea mays [maize]
ref|XP_004980587.1|  PREDICTED: galactomannan galactosyltransfera...    153   5e-40   Setaria italica
ref|XP_004980588.1|  PREDICTED: galactomannan galactosyltransfera...    151   7e-40   Setaria italica
dbj|BAJ96459.1|  predicted protein                                      152   2e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010943187.1|  PREDICTED: galactomannan galactosyltransfera...    152   2e-39   Elaeis guineensis
ref|XP_008784727.1|  PREDICTED: putative glycosyltransferase 7          147   9e-38   Phoenix dactylifera
gb|EMT11268.1|  Putative glycosyltransferase 7                          143   2e-37   
ref|XP_002450906.1|  hypothetical protein SORBIDRAFT_05g020930          144   1e-36   
ref|XP_010919073.1|  PREDICTED: galactomannan galactosyltransfera...    132   1e-32   Elaeis guineensis
emb|CBI25835.3|  unnamed protein product                                129   2e-32   Vitis vinifera
ref|XP_009379786.1|  PREDICTED: putative glycosyltransferase 5          107   1e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010907157.1|  PREDICTED: putative glycosyltransferase 5          107   2e-23   Elaeis guineensis
ref|XP_001761988.1|  predicted protein                                  106   2e-23   
ref|XP_010678459.1|  PREDICTED: putative glycosyltransferase 5          105   4e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009385087.1|  PREDICTED: putative glycosyltransferase 5          105   5e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009420521.1|  PREDICTED: putative glycosyltransferase 5          105   6e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010912249.1|  PREDICTED: putative glycosyltransferase 5          105   7e-23   Elaeis guineensis
ref|XP_002990216.1|  glycosyltransferase CAZy family GT34-like pr...    105   9e-23   Selaginella moellendorffii
ref|XP_001765298.1|  predicted protein                                  103   9e-23   
ref|XP_006399253.1|  hypothetical protein EUTSA_v10013509mg             105   1e-22   Eutrema salsugineum [saltwater cress]
ref|XP_008783986.1|  PREDICTED: LOW QUALITY PROTEIN: putative gly...    105   1e-22   
ref|XP_004987031.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like    104   1e-22   Setaria italica
ref|XP_008453679.1|  PREDICTED: putative glycosyltransferase 3          101   2e-22   Cucumis melo [Oriental melon]
ref|XP_008788330.1|  PREDICTED: putative glycosyltransferase 5          103   2e-22   Phoenix dactylifera
gb|EMT32015.1|  Xyloglucan 6-xylosyltransferase                         100   3e-22   
ref|XP_009393375.1|  PREDICTED: putative glycosyltransferase 5          103   3e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011075649.1|  PREDICTED: putative glycosyltransferase 5          103   3e-22   Sesamum indicum [beniseed]
dbj|BAK00169.1|  predicted protein                                      103   4e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN48702.1|  Putative glycosyltransferase 3                          101   4e-22   Glycine soja [wild soybean]
ref|XP_008453680.1|  PREDICTED: putative glycosyltransferase 3          100   4e-22   Cucumis melo [Oriental melon]
ref|NP_001047014.1|  Os02g0529600                                       103   5e-22   
gb|KFK25153.1|  hypothetical protein AALP_AA8G072800                    102   6e-22   Arabis alpina [alpine rockcress]
ref|XP_010943718.1|  PREDICTED: putative glycosyltransferase 5          102   7e-22   Elaeis guineensis
gb|KEH31956.1|  xyloglucan xylosyltransferase                           102   8e-22   Medicago truncatula
gb|EMT32465.1|  Putative glycosyltransferase 3                          102   8e-22   
gb|ACN27080.1|  unknown                                                 100   1e-21   Zea mays [maize]
ref|XP_006494985.1|  PREDICTED: putative glycosyltransferase 3-like     102   1e-21   Citrus sinensis [apfelsine]
ref|XP_001767750.1|  predicted protein                                  101   1e-21   
ref|XP_006440652.1|  hypothetical protein CICLE_v10020086mg             102   1e-21   Citrus clementina [clementine]
ref|XP_011047184.1|  PREDICTED: putative glycosyltransferase 5          102   1e-21   Populus euphratica
dbj|BAK03947.1|  predicted protein                                      102   1e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFK30382.1|  galactosyltransferase A                                 102   1e-21   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002514720.1|  Xyloglucan 6-xylosyltransferase, putative          102   1e-21   Ricinus communis
ref|XP_004508717.1|  PREDICTED: putative glycosyltransferase 5-like     101   1e-21   Cicer arietinum [garbanzo]
ref|XP_008239899.1|  PREDICTED: putative glycosyltransferase 5          102   1e-21   Prunus mume [ume]
ref|XP_009338860.1|  PREDICTED: putative glycosyltransferase 5          101   2e-21   Pyrus x bretschneideri [bai li]
ref|XP_007209124.1|  hypothetical protein PRUPE_ppa005479mg             101   2e-21   Prunus persica
ref|XP_009339134.1|  PREDICTED: putative glycosyltransferase 5          101   2e-21   Pyrus x bretschneideri [bai li]
ref|XP_010258549.1|  PREDICTED: putative glycosyltransferase 5 is...    101   2e-21   
ref|XP_010498276.1|  PREDICTED: putative glycosyltransferase 5          101   2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010258542.1|  PREDICTED: putative glycosyltransferase 5 is...    101   2e-21   
ref|XP_008374566.1|  PREDICTED: putative glycosyltransferase 5          101   2e-21   Malus domestica [apple tree]
ref|XP_006647332.1|  PREDICTED: putative glycosyltransferase 5-like     102   2e-21   Oryza brachyantha
ref|XP_010683109.1|  PREDICTED: putative glycosyltransferase 5          101   2e-21   Beta vulgaris subsp. vulgaris [field beet]
gb|AHC98117.1|  putative xyloglucan alpha-1,6-xylosyltransferase        101   2e-21   Pinus radiata
ref|XP_006374450.1|  hypothetical protein POPTR_0015s07290g             101   2e-21   Populus trichocarpa [western balsam poplar]
emb|CDX85826.1|  BnaC06g23080D                                        99.0    2e-21   
ref|XP_010030248.1|  PREDICTED: putative glycosyltransferase 5          101   2e-21   Eucalyptus grandis [rose gum]
gb|KJB50959.1|  hypothetical protein B456_008G195000                    101   2e-21   Gossypium raimondii
ref|XP_010230173.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...    101   2e-21   
ref|XP_004952632.1|  PREDICTED: putative glycosyltransferase 5-like     101   2e-21   Setaria italica
ref|XP_010238722.1|  PREDICTED: putative glycosyltransferase 5          101   2e-21   Brachypodium distachyon [annual false brome]
gb|KDP31286.1|  hypothetical protein JCGZ_11662                         100   3e-21   Jatropha curcas
gb|KHN18571.1|  Putative glycosyltransferase 3                        99.0    3e-21   Glycine soja [wild soybean]
ref|XP_003524717.1|  PREDICTED: putative glycosyltransferase 5-like     100   3e-21   Glycine max [soybeans]
ref|XP_008393187.1|  PREDICTED: putative glycosyltransferase 5          100   3e-21   
ref|XP_006838788.1|  hypothetical protein AMTR_s00002p00259350          100   3e-21   
ref|XP_010497538.1|  PREDICTED: putative glycosyltransferase 5        97.4    3e-21   
ref|XP_004500012.1|  PREDICTED: putative glycosyltransferase 5-like     100   3e-21   Cicer arietinum [garbanzo]
ref|XP_010477058.1|  PREDICTED: putative glycosyltransferase 4          100   3e-21   
ref|XP_002318600.2|  hypothetical protein POPTR_0012s07020g             100   4e-21   Populus trichocarpa [western balsam poplar]
emb|CDX96540.1|  BnaA07g31510D                                        98.2    4e-21   
ref|XP_010459505.1|  PREDICTED: putative glycosyltransferase 4          100   4e-21   
ref|NP_001049886.1|  Os03g0305800                                       100   5e-21   
ref|XP_007155288.1|  hypothetical protein PHAVU_003G188200g             100   5e-21   Phaseolus vulgaris [French bean]
gb|EAY82266.1|  hypothetical protein OsI_37474                          100   6e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_004154960.1|  PREDICTED: putative glycosyltransferase 5-like     100   6e-21   
ref|XP_004138178.1|  PREDICTED: putative glycosyltransferase 5-like     100   6e-21   Cucumis sativus [cucumbers]
ref|XP_004154959.1|  PREDICTED: putative glycosyltransferase 3-like     100   6e-21   
ref|XP_010108713.1|  Putative glycosyltransferase 3                     100   6e-21   Morus notabilis
gb|AFK30383.1|  galactosyltransferase B1                                100   6e-21   Triticum aestivum [Canadian hard winter wheat]
ref|NP_196389.1|  xyloglucan 6-xylosyltransferase                       100   6e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004138179.1|  PREDICTED: putative glycosyltransferase 3-like     100   6e-21   Cucumis sativus [cucumbers]
gb|KJB19373.1|  hypothetical protein B456_003G098400                    100   7e-21   Gossypium raimondii
gb|AFW56047.1|  hypothetical protein ZEAMMB73_697365                    102   7e-21   
ref|XP_009149356.1|  PREDICTED: putative glycosyltransferase 4          100   8e-21   Brassica rapa
ref|XP_001781241.1|  predicted protein                                98.6    8e-21   
ref|XP_002453927.1|  hypothetical protein SORBIDRAFT_04g021570          100   8e-21   Sorghum bicolor [broomcorn]
gb|AFW71661.1|  putative glycosyltransferase                            100   8e-21   
ref|NP_001105849.1|  putative glycosyltransferase                       100   8e-21   
gb|KCW44805.1|  hypothetical protein EUGRSUZ_L01630                   95.9    9e-21   Eucalyptus grandis [rose gum]
dbj|BAK06850.1|  predicted protein                                    99.4    9e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CBX24469.1|  hypothetical_protein                                 99.4    9e-21   Oryza glaberrima
dbj|BAD43079.1|  hypothetical protein                                   100   9e-21   Arabidopsis thaliana [mouse-ear cress]
gb|EAY89696.1|  hypothetical protein OsI_11232                        99.4    9e-21   Oryza sativa Indica Group [Indian rice]
ref|NP_001066160.1|  Os12g0149300                                     99.8    1e-20   
ref|XP_002465379.1|  hypothetical protein SORBIDRAFT_01g037540        99.4    1e-20   Sorghum bicolor [broomcorn]
ref|XP_003549688.1|  PREDICTED: putative glycosyltransferase 5-like   99.4    1e-20   Glycine max [soybeans]
gb|ADE59448.1|  galactosyltransferase                                 99.8    1e-20   Triticum aestivum [Canadian hard winter wheat]
ref|NP_173304.2|  putative glycosyltransferase 4                        100   1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007037433.1|  Galactosyl transferase GMA12/MNN10 family pr...  99.8    1e-20   
gb|ABF95527.1|  Glycosyltransferase 3, putative                       99.4    1e-20   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001173389.1|  Os03g0306100                                     99.4    1e-20   
ref|XP_003558113.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  99.4    1e-20   Brachypodium distachyon [annual false brome]
ref|XP_009764347.1|  PREDICTED: putative glycosyltransferase 5        99.4    1e-20   Nicotiana sylvestris
ref|XP_001759108.1|  predicted protein                                99.0    1e-20   
ref|XP_006307492.1|  hypothetical protein CARUB_v10009116mg           99.4    1e-20   Capsella rubella
gb|KEH33442.1|  xyloglucan xylosyltransferase                         99.4    1e-20   Medicago truncatula
emb|CDX69995.1|  BnaA10g23440D                                        99.4    1e-20   
ref|XP_010040898.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     95.9    1e-20   Eucalyptus grandis [rose gum]
ref|XP_009122397.1|  PREDICTED: putative glycosyltransferase 3        99.4    1e-20   Brassica rapa
ref|XP_002871288.1|  galactosyl transferase GMA12/MNN10 family pr...  99.4    1e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_004301136.1|  PREDICTED: putative glycosyltransferase 5        99.4    1e-20   Fragaria vesca subsp. vesca
emb|CDY26738.1|  BnaA06g12840D                                        99.4    1e-20   Brassica napus [oilseed rape]
gb|EPS66800.1|  hypothetical protein M569_07974                       99.0    1e-20   Genlisea aurea
emb|CDX99024.1|  BnaC09g48110D                                        99.0    1e-20   
ref|XP_006287623.1|  hypothetical protein CARUB_v10000835mg           99.4    1e-20   
gb|EMS58373.1|  Putative glycosyltransferase 2                        98.2    2e-20   Triticum urartu
emb|CAI11456.1|  putative glycosyltransferase                         99.0    2e-20   Lotus japonicus
ref|XP_010537379.1|  PREDICTED: putative glycosyltransferase 5        99.0    2e-20   Tarenaya hassleriana [spider flower]
dbj|BAO02547.1|  (1-6)-alpha-D-xylosyltransferase ortholog            97.4    2e-20   Nicotiana alata [flowering tobacco]
ref|XP_010235491.1|  PREDICTED: putative glycosyltransferase 3        99.0    2e-20   
ref|XP_002972516.1|  glycosyltransferase CAZy family GT34-like pr...  98.2    2e-20   
ref|XP_002980080.1|  glycosyltransferase CAZy family GT34-like pr...  97.8    2e-20   
gb|EYU45549.1|  hypothetical protein MIMGU_mgv1a027105mg              99.0    2e-20   Erythranthe guttata [common monkey flower]
ref|XP_009606203.1|  PREDICTED: putative glycosyltransferase 3        99.0    2e-20   Nicotiana tomentosiformis
dbj|BAK06777.1|  predicted protein                                    98.6    2e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002465378.1|  hypothetical protein SORBIDRAFT_01g037530        98.6    2e-20   Sorghum bicolor [broomcorn]
gb|EMT04084.1|  Xyloglucan 6-xylosyltransferase                       98.6    2e-20   
gb|EYU28806.1|  hypothetical protein MIMGU_mgv1a003740mg              99.4    2e-20   Erythranthe guttata [common monkey flower]
gb|KJB28609.1|  hypothetical protein B456_005G060400                  98.2    2e-20   Gossypium raimondii
ref|XP_010098280.1|  Xyloglucan 6-xylosyltransferase                  98.6    2e-20   Morus notabilis
ref|XP_006841140.1|  hypothetical protein AMTR_s00086p00128700        98.2    3e-20   Amborella trichopoda
ref|XP_008660215.1|  PREDICTED: xyloglucan 6-xylosyltransferase-l...  98.2    3e-20   
gb|AFW88602.1|  hypothetical protein ZEAMMB73_854435                  97.8    3e-20   
ref|XP_010523024.1|  PREDICTED: putative glycosyltransferase 3        98.2    3e-20   Tarenaya hassleriana [spider flower]
ref|XP_002992573.1|  glycosyltransferase CAZy family GT34-like pr...  97.8    3e-20   
ref|XP_010522780.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     98.2    3e-20   
ref|XP_010491391.1|  PREDICTED: putative glycosyltransferase 3        98.2    3e-20   
emb|CBX25402.1|  hypothetical_protein                                 97.8    3e-20   
gb|EYU35800.1|  hypothetical protein MIMGU_mgv1a006038mg              98.2    4e-20   
ref|XP_006663818.1|  PREDICTED: putative glycosyltransferase 3-like   97.8    4e-20   
ref|XP_002284667.1|  PREDICTED: putative glycosyltransferase 5        97.8    5e-20   
gb|KHN43518.1|  Xyloglucan 6-xylosyltransferase                       97.4    5e-20   
emb|CAN80739.1|  hypothetical protein VITISV_027037                   97.4    5e-20   
ref|NP_001049853.1|  Os03g0300000                                     96.7    5e-20   
ref|XP_010452740.1|  PREDICTED: putative glycosyltransferase 3        97.8    5e-20   
emb|CDP21247.1|  unnamed protein product                              97.4    5e-20   
ref|XP_004494368.1|  PREDICTED: putative glycosyltransferase 2-like   97.4    6e-20   
ref|XP_002887538.1|  galactosyl transferase GMA12/MNN10 family pr...  97.4    6e-20   
ref|XP_009780568.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  97.4    6e-20   
gb|EMT05890.1|  Putative glycosyltransferase 3                        99.0    6e-20   
ref|XP_008663804.1|  PREDICTED: putative glycosyltransferase 3        97.8    6e-20   
dbj|BAK08324.1|  predicted protein                                    97.4    6e-20   
ref|NP_177578.1|  xyloglucan xylosyltransferase 5                     97.4    6e-20   
ref|XP_009600562.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     97.4    6e-20   
gb|KFK41883.1|  hypothetical protein AALP_AA2G184600                  97.4    6e-20   
ref|XP_006365321.1|  PREDICTED: putative glycosyltransferase 5-li...  97.4    6e-20   
gb|ACF06190.1|  xylosyl transferase                                   93.2    6e-20   
ref|XP_007035584.1|  CAMTA domain class transcription factor          97.1    7e-20   
ref|XP_010423175.1|  PREDICTED: putative glycosyltransferase 3        97.4    7e-20   
gb|ACF82576.1|  unknown                                               95.5    7e-20   
ref|XP_006651308.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  96.3    7e-20   
ref|XP_002890293.1|  hypothetical protein ARALYDRAFT_312817           98.2    7e-20   
ref|XP_006390433.1|  hypothetical protein EUTSA_v10018522mg           97.1    7e-20   
gb|EAY89653.1|  hypothetical protein OsI_11184                        97.1    7e-20   
gb|KFK30846.1|  hypothetical protein AALP_AA6G033100                  99.4    7e-20   
ref|XP_003554517.1|  PREDICTED: putative glycosyltransferase 2-like   97.1    7e-20   
ref|XP_006649941.1|  PREDICTED: putative glycosyltransferase 2-like   97.1    8e-20   
gb|ABF95475.1|  Glycosyltransferase 5, putative, expressed            97.1    8e-20   
ref|XP_007050873.1|  Alpha-1,6-xylosyltransferase isoform 1           97.1    8e-20   
emb|CDY19235.1|  BnaC05g14360D                                        97.1    8e-20   
emb|CDX93965.1|  BnaC04g21240D                                        97.1    8e-20   
ref|XP_010428421.1|  PREDICTED: putative glycosyltransferase 5 is...  97.1    8e-20   
ref|XP_010468926.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1     97.1    8e-20   
ref|XP_006300466.1|  hypothetical protein CARUB_v10020269mg           97.1    8e-20   
ref|XP_010259619.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     97.1    8e-20   
ref|XP_010416293.1|  PREDICTED: putative glycosyltransferase 5        97.1    8e-20   
ref|XP_010471529.1|  PREDICTED: putative glycosyltransferase 5        97.1    8e-20   
ref|XP_011071657.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  97.1    9e-20   
ref|XP_007050874.1|  Alpha-1,6-xylosyltransferase isoform 2           97.1    9e-20   
ref|XP_009342118.1|  PREDICTED: putative glycosyltransferase 2        96.7    9e-20   
ref|XP_009106103.1|  PREDICTED: putative glycosyltransferase 5        96.7    1e-19   
ref|XP_009761185.1|  PREDICTED: putative glycosyltransferase 5        96.7    1e-19   
ref|XP_006416577.1|  hypothetical protein EUTSA_v10007657mg           96.7    1e-19   
ref|XP_009414141.1|  PREDICTED: putative glycosyltransferase 2        96.7    1e-19   
ref|NP_191831.1|  xyloglucan 6-xylosyltransferase                     96.7    1e-19   
ref|XP_009138722.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  96.7    1e-19   
ref|XP_006651307.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  96.3    1e-19   
ref|XP_002876686.1|  hypothetical protein ARALYDRAFT_907847           96.7    1e-19   
ref|XP_001772519.1|  predicted protein                                96.3    1e-19   
emb|CAI11451.1|  alpha-1,6-xylosyltransferase                         95.9    1e-19   
ref|XP_002967572.1|  glycosyltransferase, CAZy family GT34-like p...  96.3    1e-19   
ref|XP_002442801.1|  hypothetical protein SORBIDRAFT_08g003090        96.7    1e-19   
ref|XP_010922270.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  96.3    1e-19   
emb|CDY70418.1|  BnaA04g27220D                                        96.3    1e-19   
gb|KDP27794.1|  hypothetical protein JCGZ_18874                       96.3    1e-19   
ref|XP_008368989.1|  PREDICTED: putative glycosyltransferase 2        96.3    2e-19   
ref|XP_004984900.1|  PREDICTED: putative glycosyltransferase 2-like   96.3    2e-19   
ref|XP_010089891.1|  Putative glycosyltransferase 5                   96.3    2e-19   
ref|XP_001755467.1|  predicted protein                                95.9    2e-19   
ref|XP_007163097.1|  hypothetical protein PHAVU_001G206000g           95.9    2e-19   
ref|XP_006402349.1|  hypothetical protein EUTSA_v10005949mg           96.3    2e-19   
ref|XP_001776727.1|  predicted protein                                95.9    2e-19   
ref|XP_002516919.1|  Xyloglucan 6-xylosyltransferase, putative        96.3    2e-19   
emb|CAJ57380.1|  alpha-1,6-xylosyltransferase                         95.9    2e-19   
gb|ACN29046.1|  unknown                                               95.9    2e-19   
gb|AFW88652.1|  glycosyltransferase 5                                 95.9    2e-19   
gb|KEH24376.1|  xyloglucan xylosyltransferase                         96.3    2e-19   
gb|ABK24302.1|  unknown                                               95.9    2e-19   
ref|NP_001150077.1|  glycosyltransferase 5                            95.9    2e-19   
ref|NP_001151451.1|  glycosyltransferase 5                            95.9    2e-19   
emb|CDO98874.1|  unnamed protein product                              95.9    2e-19   
ref|XP_010258249.1|  PREDICTED: putative glycosyltransferase 5        95.9    2e-19   
ref|XP_010318819.1|  PREDICTED: putative glycosyltransferase 5        95.9    2e-19   
gb|KJB84424.1|  hypothetical protein B456_N024600                     95.9    2e-19   
gb|KHG26935.1|  Putative glycosyltransferase 2 -like protein          95.9    2e-19   
gb|KJB22531.1|  hypothetical protein B456_004G052700                  95.9    2e-19   
ref|XP_009790055.1|  PREDICTED: putative glycosyltransferase 5        95.9    2e-19   
ref|XP_006356974.1|  PREDICTED: putative glycosyltransferase 2-like   95.9    2e-19   
ref|XP_002465400.1|  hypothetical protein SORBIDRAFT_01g038000        95.5    2e-19   
gb|ACE95677.1|  putative xylosyl transferase                          95.9    2e-19   
ref|XP_001777149.1|  predicted protein                                95.5    2e-19   
ref|XP_006291070.1|  hypothetical protein CARUB_v10017185mg           95.9    2e-19   
ref|XP_001767288.1|  predicted protein                                94.4    2e-19   
ref|XP_009116931.1|  PREDICTED: xyloglucan 6-xylosyltransferase       95.5    3e-19   
ref|XP_010269507.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     95.5    3e-19   
ref|XP_004229187.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     95.9    3e-19   
gb|EYU23497.1|  hypothetical protein MIMGU_mgv1a006132mg              95.5    3e-19   
ref|XP_006396461.1|  hypothetical protein EUTSA_v10028641mg           95.5    3e-19   
ref|NP_567241.1|  UDP-xylosyltransferase 2                            95.5    3e-19   
ref|XP_010413252.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...  95.5    3e-19   
ref|XP_010523942.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  95.5    3e-19   
emb|CAI11450.1|  alpha-1,6-xylosyltransferase                         95.1    3e-19   
ref|XP_010512668.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...  95.5    3e-19   
ref|XP_006287708.1|  hypothetical protein CARUB_v10000915mg           95.5    3e-19   
gb|AAC78266.1|  putative glycosyltransferase                          95.5    3e-19   
ref|XP_004239475.1|  PREDICTED: putative glycosyltransferase 3        95.1    3e-19   
ref|XP_010429788.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  95.5    3e-19   
ref|XP_010422579.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  95.5    3e-19   
ref|XP_010456020.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     95.5    3e-19   
emb|CAJ57381.1|  alpha-1,6-xylosyltransferase                         94.7    3e-19   
ref|XP_008663454.1|  PREDICTED: putative glycosyltransferase 2        93.6    3e-19   
gb|KDO71643.1|  hypothetical protein CISIN_1g047753mg                 95.1    4e-19   
ref|XP_006348817.1|  PREDICTED: putative glycosyltransferase 3-like   95.5    4e-19   
ref|XP_010037455.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  95.1    4e-19   
emb|CBI26079.3|  unnamed protein product                              94.7    4e-19   
ref|XP_008235042.1|  PREDICTED: putative glycosyltransferase 2        94.7    4e-19   
ref|XP_009617169.1|  PREDICTED: putative glycosyltransferase 5        94.7    4e-19   
ref|XP_006419581.1|  hypothetical protein CICLE_v10004948mg           94.7    5e-19   
ref|XP_008790864.1|  PREDICTED: putative glycosyltransferase 2        94.7    5e-19   
ref|XP_002455150.1|  hypothetical protein SORBIDRAFT_03g005110        94.7    5e-19   
ref|XP_006489090.1|  PREDICTED: putative glycosyltransferase 2-like   94.7    5e-19   
gb|EMT25995.1|  hypothetical protein F775_42861                       92.8    6e-19   
ref|XP_011072798.1|  PREDICTED: putative glycosyltransferase 5        94.7    6e-19   
gb|KHN20409.1|  Putative glycosyltransferase 2                        91.3    6e-19   
ref|XP_010938345.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  94.4    7e-19   
emb|CAI11457.1|  putative glycosyltransferase                         94.7    7e-19   
ref|XP_011087267.1|  PREDICTED: putative glycosyltransferase 5        94.4    7e-19   
ref|XP_003558085.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...  94.4    7e-19   
ref|XP_004987030.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  94.4    7e-19   
ref|XP_008795804.1|  PREDICTED: putative glycosyltransferase 2        94.4    7e-19   
ref|XP_004136173.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  93.6    7e-19   
ref|XP_011000518.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  94.4    8e-19   
ref|XP_008654833.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  94.4    8e-19   
ref|XP_002315554.2|  glycosyltransferase 2 family protein             94.4    8e-19   
ref|XP_011006778.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  94.4    8e-19   
ref|XP_003628458.1|  Alpha-1 6-xylosyltransferase                     95.5    8e-19   
ref|XP_009416128.1|  PREDICTED: putative glycosyltransferase 2        94.0    8e-19   
ref|XP_006389383.1|  glycosyltransferase 2 family protein             94.4    8e-19   
gb|AFW59084.1|  hypothetical protein ZEAMMB73_119802                  94.7    9e-19   
ref|XP_010652172.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     94.0    1e-18   
emb|CAN77730.1|  hypothetical protein VITISV_027412                   94.0    1e-18   
gb|EYU43946.1|  hypothetical protein MIMGU_mgv1a027073mg              94.0    1e-18   
emb|CAI11458.1|  putative glycosyltransferase                         94.0    1e-18   
ref|NP_001268156.1|  alpha-1,6-xylosyltransferase                     93.6    1e-18   
ref|XP_004977544.1|  PREDICTED: putative glycosyltransferase 5-like   93.6    1e-18   
gb|EPS71488.1|  hypothetical protein M569_03267                       93.6    1e-18   
ref|XP_008386651.1|  PREDICTED: putative glycosyltransferase 2        93.6    1e-18   
ref|XP_007201035.1|  hypothetical protein PRUPE_ppa005690mg           93.6    1e-18   
ref|XP_001771886.1|  predicted protein                                92.8    1e-18   
ref|XP_002874911.1|  hypothetical protein ARALYDRAFT_490316           93.6    1e-18   
ref|XP_009104763.1|  PREDICTED: putative glycosyltransferase 5        93.2    2e-18   
ref|XP_004980166.1|  PREDICTED: putative glycosyltransferase 5-like   93.6    2e-18   
gb|AFU82535.1|  alpha-1,6-xylosyltransferase                          90.9    2e-18   
emb|CDX90935.1|  BnaA03g26150D                                        93.2    2e-18   
emb|CDY50378.1|  BnaCnng19100D                                        93.2    2e-18   
emb|CDY18017.1|  BnaC03g30890D                                        91.7    2e-18   
gb|KHN14624.1|  Putative glycosyltransferase 2                        91.7    2e-18   
gb|KHN26556.1|  Putative glycosyltransferase 2                        91.7    2e-18   
ref|XP_004978367.1|  PREDICTED: putative glycosyltransferase 5-like   93.2    2e-18   
ref|XP_010666578.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     92.8    3e-18   
ref|XP_011090963.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  92.8    3e-18   
ref|XP_008438884.1|  PREDICTED: putative glycosyltransferase 2        92.4    3e-18   
ref|XP_004134208.1|  PREDICTED: putative glycosyltransferase 2-like   92.4    3e-18   
ref|XP_009144556.1|  PREDICTED: putative glycosyltransferase 2        92.0    4e-18   
ref|XP_007224307.1|  hypothetical protein PRUPE_ppa019851mg           92.0    5e-18   
ref|XP_004980167.1|  PREDICTED: putative glycosyltransferase 5-like   92.0    5e-18   
ref|XP_003533377.1|  PREDICTED: putative glycosyltransferase 2-li...  92.0    5e-18   
emb|CDY22055.1|  BnaA09g00840D                                        91.7    5e-18   
ref|XP_009111280.1|  PREDICTED: putative glycosyltransferase 2        92.0    6e-18   
ref|XP_002990826.1|  xyloglucan xylosyltransferase-like protein       91.7    6e-18   
ref|XP_008235045.1|  PREDICTED: putative glycosyltransferase 2        91.7    7e-18   
ref|XP_009134428.1|  PREDICTED: putative glycosyltransferase 2        91.7    7e-18   
ref|XP_004290777.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     91.3    8e-18   
ref|XP_002441834.1|  hypothetical protein SORBIDRAFT_08g003080        90.9    2e-17   
ref|XP_002974473.1|  xyloglucan xylosyltransferase-like protein       90.1    2e-17   
ref|XP_008662460.1|  PREDICTED: putative glycosyltransferase 3        90.1    2e-17   
ref|XP_002314448.2|  glycosyltransferase 2 family protein             90.1    2e-17   
ref|XP_008662468.1|  PREDICTED: putative glycosyltransferase 3        90.1    2e-17   
ref|XP_007138911.1|  hypothetical protein PHAVU_009G248100g           89.7    3e-17   
gb|ABC87290.1|  putative galactosyl transferase                       89.0    3e-17   
gb|KJB41948.1|  hypothetical protein B456_007G128800                  89.7    3e-17   
ref|XP_002987473.1|  glycosyltransferase-like protein                 87.8    3e-17   
gb|AFW63176.1|  hypothetical protein ZEAMMB73_999507                  88.6    4e-17   
ref|XP_004508217.1|  PREDICTED: putative glycosyltransferase 2-like   89.4    4e-17   
ref|XP_003609672.1|  Xyloglucan 6-xylosyltransferase                  89.4    4e-17   
ref|XP_001769838.1|  predicted protein                                88.6    5e-17   
ref|XP_008451599.1|  PREDICTED: xyloglucan 6-xylosyltransferase       88.6    5e-17   
emb|CDX76657.1|  BnaC08g32430D                                        85.9    6e-17   
ref|NP_001288054.1|  calmodulin binding transcription activator 1     89.0    6e-17   
ref|XP_006444290.1|  hypothetical protein CICLE_v10020012mg           89.0    6e-17   
ref|XP_006479923.1|  PREDICTED: putative glycosyltransferase 2-li...  89.0    6e-17   
ref|XP_006479922.1|  PREDICTED: putative glycosyltransferase 2-li...  89.0    6e-17   
ref|XP_004987032.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  88.6    7e-17   
ref|XP_008678871.1|  PREDICTED: LOW QUALITY PROTEIN: putative gly...  88.2    7e-17   
ref|XP_006479921.1|  PREDICTED: putative glycosyltransferase 2-li...  89.0    7e-17   
ref|XP_002980077.1|  glycosyltransferase-like protein                 87.0    8e-17   
ref|XP_004296837.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  88.2    1e-16   
ref|XP_009352257.1|  PREDICTED: putative glycosyltransferase 2        87.8    1e-16   
ref|XP_008367147.1|  PREDICTED: putative glycosyltransferase 2        87.8    2e-16   
ref|XP_008360279.1|  PREDICTED: putative glycosyltransferase 2        87.8    2e-16   
ref|XP_011000519.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  87.4    2e-16   
gb|EPS64541.1|  hypothetical protein M569_10236                       85.9    4e-16   
ref|XP_001764909.1|  predicted protein                                82.0    2e-14   
ref|XP_001755939.1|  predicted protein                                81.3    2e-14   
ref|XP_001756042.1|  predicted protein                                81.3    2e-14   
ref|XP_001775066.1|  predicted protein                                80.5    4e-14   
ref|XP_001768129.1|  predicted protein                                79.7    9e-14   
gb|AEW08173.1|  hypothetical protein 2_1874_01                        75.1    1e-13   
gb|EMS48021.1|  Putative glycosyltransferase 3                        77.8    2e-13   
ref|XP_001755245.1|  predicted protein                                78.2    3e-13   
gb|KEH19400.1|  xyloglucan xylosyltransferase                         77.4    6e-13   
ref|XP_001773763.1|  predicted protein                                77.0    7e-13   
emb|CAJ91142.1|  glycosyltransferase                                  65.1    2e-10   
emb|CBI15187.3|  unnamed protein product                              67.8    4e-10   
ref|XP_002966412.1|  glycosyltransferase CAZy family GT34-like pr...  67.0    1e-09   
ref|XP_002978152.1|  glycosyltransferase CAZy family GT34-like pr...  67.0    1e-09   
gb|KEH31957.1|  galactosyl transferase GMA12/MNN10 family protein     61.6    4e-09   
ref|XP_008352151.1|  PREDICTED: putative uncharacterized protein ...  64.3    9e-09   
emb|CBI36830.3|  unnamed protein product                              60.8    1e-07   
gb|AEW08650.1|  hypothetical protein CL1035Contig1_03                 55.8    3e-07   
gb|AIA92435.1|  Glyco_transf_34                                       55.5    1e-06   
gb|AFG70961.1|  hypothetical protein CL1035Contig1_04                 52.0    1e-05   
ref|XP_006840585.1|  hypothetical protein AMTR_s00045p00232030        55.1    2e-05   
ref|XP_009609259.1|  PREDICTED: putative glycosyltransferase 3        53.1    3e-05   
emb|CDY65940.1|  BnaUnng01300D                                        53.5    3e-05   



>ref|XP_009624871.1| PREDICTED: putative glycosyltransferase 7 [Nicotiana tomentosiformis]
Length=456

 Score =   279 bits (714),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 143/165 (87%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDKIF ESDDQSGL YL+LKE+EKWG+KIYVE  YYFEGYWVEIVG LDNITD YLGIE
Sbjct  293  FKDKIFQESDDQSGLAYLLLKEKEKWGDKIYVEGQYYFEGYWVEIVGTLDNITDKYLGIE  352

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K      LRRRH EKVSESY + W+EHL++AG GR  WRRPFITHFTGCQPCSGDHN+MY
Sbjct  353  KVVPS--LRRRHGEKVSESYGKVWEEHLKDAGYGRYSWRRPFITHFTGCQPCSGDHNQMY  410

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            SGETC DAM KALNFADNQVLR YG+MH+DLLD++SV P+P+DFP
Sbjct  411  SGETCFDAMQKALNFADNQVLRKYGYMHKDLLDSSSVFPVPFDFP  455



>ref|XP_006363813.1| PREDICTED: putative glycosyltransferase 7-like isoform X2 [Solanum 
tuberosum]
Length=423

 Score =   278 bits (710),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 144/165 (87%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDKIF ESDDQSGL YL+LKE+EKWGNKIYVE  YYFEGYWVEIVG  DNITD YL IE
Sbjct  260  FKDKIFQESDDQSGLAYLLLKEKEKWGNKIYVEGGYYFEGYWVEIVGTYDNITDRYLAIE  319

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K+ A  +LRRRHAE+VSESYA  W+EHL+ AG GR  WRRPFITHFTGCQPCSGDHN+MY
Sbjct  320  KSEA--RLRRRHAERVSESYASVWEEHLKEAGYGRYSWRRPFITHFTGCQPCSGDHNQMY  377

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            SGETC DAM KALNFADNQVLR YG+MH+DLLD++SV P+P++FP
Sbjct  378  SGETCFDAMQKALNFADNQVLRKYGYMHKDLLDSSSVFPVPFNFP  422



>ref|XP_006363812.1| PREDICTED: putative glycosyltransferase 7-like isoform X1 [Solanum 
tuberosum]
Length=455

 Score =   278 bits (712),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 144/165 (87%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDKIF ESDDQSGL YL+LKE+EKWGNKIYVE  YYFEGYWVEIVG  DNITD YL IE
Sbjct  292  FKDKIFQESDDQSGLAYLLLKEKEKWGNKIYVEGGYYFEGYWVEIVGTYDNITDRYLAIE  351

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K+ A  +LRRRHAE+VSESYA  W+EHL+ AG GR  WRRPFITHFTGCQPCSGDHN+MY
Sbjct  352  KSEA--RLRRRHAERVSESYASVWEEHLKEAGYGRYSWRRPFITHFTGCQPCSGDHNQMY  409

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            SGETC DAM KALNFADNQVLR YG+MH+DLLD++SV P+P++FP
Sbjct  410  SGETCFDAMQKALNFADNQVLRKYGYMHKDLLDSSSVFPVPFNFP  454



>ref|XP_009761597.1| PREDICTED: putative glycosyltransferase 7 [Nicotiana sylvestris]
Length=456

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 143/165 (87%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDKIF ESDDQSGL YL+LKE+EKWG+KIYVE  YYFEGYWVEIVG LDNITD YLGIE
Sbjct  293  FKDKIFQESDDQSGLAYLLLKEKEKWGDKIYVEGQYYFEGYWVEIVGTLDNITDKYLGIE  352

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K      LRRRH EKVSESY + W+EHL++AG GR  WRRPFITHFTGCQPCSGDHN+MY
Sbjct  353  KGVPS--LRRRHGEKVSESYGKVWEEHLKDAGYGRYSWRRPFITHFTGCQPCSGDHNQMY  410

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            SGETC DAM KALNFADNQVLR YG+MH+DLLD++SV P+P+DFP
Sbjct  411  SGETCFDAMQKALNFADNQVLRKYGYMHKDLLDSSSVFPVPFDFP  455



>ref|XP_004231937.1| PREDICTED: putative glycosyltransferase 7 [Solanum lycopersicum]
Length=455

 Score =   277 bits (708),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 143/165 (87%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDKIF ESDDQSGL YL+LKE+EKWGNKIYVE  YYFEGYWVEIVG  DNITD YL IE
Sbjct  292  FKDKIFQESDDQSGLAYLLLKEKEKWGNKIYVEGGYYFEGYWVEIVGTYDNITDRYLAIE  351

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K+    +LRRRHAE+VSESYA  W+EHL+ AG GR  WRRPFITHFTGCQPCSGDHN+MY
Sbjct  352  KSEG--RLRRRHAERVSESYASVWEEHLKEAGYGRYSWRRPFITHFTGCQPCSGDHNQMY  409

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            SGETC DAM KALNFADNQVLR YG+MH+DLLD++SV P+P++FP
Sbjct  410  SGETCFDAMQKALNFADNQVLRKYGYMHKDLLDSSSVFPVPFNFP  454



>ref|XP_011099399.1| PREDICTED: glycosyltransferase 6-like [Sesamum indicum]
Length=462

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 141/165 (85%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDKIFPESDDQSGL+YLILKE+EKWGNKIYVE +YYFEGYW+EIVG  DNIT+ Y  IE
Sbjct  299  FKDKIFPESDDQSGLVYLILKEKEKWGNKIYVEGEYYFEGYWMEIVGTFDNITERYTQIE  358

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K      LRRRHAEKVSESYA  W+E+L++AG GR  WRRPFITHFTGCQPCSGDHN+MY
Sbjct  359  KEVPA--LRRRHAEKVSESYARVWEEYLKDAGYGRGSWRRPFITHFTGCQPCSGDHNQMY  416

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            SG+TC DAM KAL FADNQVLRNYGF+H DLLD ++V  LP+D+P
Sbjct  417  SGQTCFDAMQKALIFADNQVLRNYGFVHPDLLDPSTVNLLPFDYP  461



>gb|EYU44510.1| hypothetical protein MIMGU_mgv1a018855mg [Erythranthe guttata]
Length=438

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDKIFPESDDQSGL+YL+LKE+EKWGNKIYVES+YYFEGYW+EI+G  DNIT+ Y   E
Sbjct  271  FKDKIFPESDDQSGLVYLLLKEKEKWGNKIYVESEYYFEGYWMEIIGTFDNITERYTETE  330

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K AA   LRRRH EKVSE YA  W+++L+ AGQGR  WRRPFITHFTGCQPCSG HN+MY
Sbjct  331  KPAAAAALRRRHGEKVSEGYATVWEDYLKEAGQGRGSWRRPFITHFTGCQPCSGAHNQMY  390

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            SG+TC DAM +AL FADNQVLRNYGF+H D+ D  +V P+P+D+P
Sbjct  391  SGQTCVDAMQRALTFADNQVLRNYGFVHPDIGDPTTVNPIPFDYP  435



>ref|XP_011073681.1| PREDICTED: glycosyltransferase 6 [Sesamum indicum]
Length=466

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 139/165 (84%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDKIFPESDDQSGL+YL+LKE+EKWG KIYVES+YYFEGYW+EIVGK DNIT  Y+ +E
Sbjct  303  FKDKIFPESDDQSGLVYLLLKEKEKWGEKIYVESEYYFEGYWMEIVGKFDNITRKYMEME  362

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K      LRRRHAEKVS SY    +E+L++ G GR  WRRPFITHFTGCQPCSGDHN+MY
Sbjct  363  KEVGA--LRRRHAEKVSGSYGRLREEYLKDVGYGRESWRRPFITHFTGCQPCSGDHNQMY  420

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            SG+TC DAM KAL FADNQVLRNYGF+H DLLD ++V PLP+D+P
Sbjct  421  SGQTCFDAMQKALTFADNQVLRNYGFVHPDLLDPSTVDPLPFDYP  465



>gb|EYU41378.1| hypothetical protein MIMGU_mgv1a006348mg [Erythranthe guttata]
Length=447

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 142/165 (86%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDKIFPESDDQSGL+YL+LK+++KWG+KIY+ES YYFEGYW+EIVG  +NIT+ Y  +E
Sbjct  283  FKDKIFPESDDQSGLVYLLLKDKDKWGDKIYLESGYYFEGYWMEIVGNFENITERYKQVE  342

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
              AA  +LRRRHAEKVSE Y   W+EHL+ AG GR  WRRPFITHFTGCQPCSGDHN+MY
Sbjct  343  --AAEGRLRRRHAEKVSEGYVPVWEEHLKEAGYGRGSWRRPFITHFTGCQPCSGDHNQMY  400

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            SG+TC DAM KAL FADNQVLR+YG++H DLLD ++V+PLP+D+P
Sbjct  401  SGQTCFDAMQKALIFADNQVLRSYGYVHPDLLDPSTVLPLPFDYP  445



>ref|XP_010646814.1| PREDICTED: LOW QUALITY PROTEIN: putative glycosyltransferase 
7 [Vitis vinifera]
Length=403

 Score =   257 bits (656),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 140/165 (85%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQSGL+YL++KE++KW  KIY+ES YYFEGYW EIVG LDNIT  YL IE
Sbjct  240  FKDKMFPESDDQSGLVYLLVKEKDKWAEKIYLESQYYFEGYWEEIVGTLDNITSKYLEIE  299

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K      LRRRHAEKVSESYAE+ + +L+ AG GR  WRRPFITHFTGCQPCSG HN+MY
Sbjct  300  KGV--NTLRRRHAEKVSESYAEQREPYLKKAGNGRYSWRRPFITHFTGCQPCSGKHNQMY  357

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            +GE+C ++M KALNFADNQVLRN+GF+H DLLD+++V PLP+D+P
Sbjct  358  AGESCWNSMQKALNFADNQVLRNFGFVHPDLLDSSTVTPLPFDYP  402



>emb|CAN80825.1| hypothetical protein VITISV_015452 [Vitis vinifera]
Length=446

 Score =   256 bits (655),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 140/165 (85%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQSGL+YL++KE++KW  KIY+ES YYFEGYW EIVG LDNIT  YL IE
Sbjct  283  FKDKMFPESDDQSGLVYLLVKEKDKWAEKIYLESQYYFEGYWEEIVGTLDNITSKYLEIE  342

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K      LRRRHAEKVSESYAE+ + +L+ AG GR  WRRPFITHFTGCQPCSG HN+MY
Sbjct  343  KGV--NTLRRRHAEKVSESYAEQREPYLKKAGNGRYSWRRPFITHFTGCQPCSGKHNQMY  400

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            +GE+C ++M KALNFADNQVLRN+GF+H DLLD+++V PLP+D+P
Sbjct  401  AGESCWNSMQKALNFADNQVLRNFGFVHPDLLDSSTVTPLPFDYP  445



>ref|XP_009777954.1| PREDICTED: putative glycosyltransferase 7 isoform X2 [Nicotiana 
sylvestris]
Length=412

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 142/169 (84%), Gaps = 7/169 (4%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FP+SDDQSGL YL+LKE++KWG+KIY+ES+YYF+GYWV+IVG+L+NITD YLGIE
Sbjct  250  FKDKNFPQSDDQSGLSYLLLKEKDKWGDKIYLESEYYFQGYWVDIVGQLNNITDKYLGIE  309

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K      LRRRHAEKVSE Y + W+E+L      +  WRRPFITHFTGC+PCSGDHN +Y
Sbjct  310  KKMPS--LRRRHAEKVSERYGKLWEEYLI-----KDKWRRPFITHFTGCEPCSGDHNPIY  362

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*TS  182
            S ETC +AM KALNFADNQVLR YGF+H+DLLD++SV PLP+DFP+ +S
Sbjct  363  SWETCYNAMQKALNFADNQVLRKYGFVHKDLLDSSSVSPLPFDFPSNSS  411



>ref|XP_009777953.1| PREDICTED: putative glycosyltransferase 7 isoform X1 [Nicotiana 
sylvestris]
Length=431

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 142/169 (84%), Gaps = 7/169 (4%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FP+SDDQSGL YL+LKE++KWG+KIY+ES+YYF+GYWV+IVG+L+NITD YLGIE
Sbjct  269  FKDKNFPQSDDQSGLSYLLLKEKDKWGDKIYLESEYYFQGYWVDIVGQLNNITDKYLGIE  328

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K      LRRRHAEKVSE Y + W+E+L      +  WRRPFITHFTGC+PCSGDHN +Y
Sbjct  329  KKMPS--LRRRHAEKVSERYGKLWEEYLI-----KDKWRRPFITHFTGCEPCSGDHNPIY  381

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*TS  182
            S ETC +AM KALNFADNQVLR YGF+H+DLLD++SV PLP+DFP+ +S
Sbjct  382  SWETCYNAMQKALNFADNQVLRKYGFVHKDLLDSSSVSPLPFDFPSNSS  430



>emb|CDP02616.1| unnamed protein product [Coffea canephora]
Length=448

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 144/165 (87%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FPESDDQ+GL YLILKE+EKWGNKIY+E +YYFEGYW+EIVG L+NITD Y GIE
Sbjct  277  FKDKTFPESDDQTGLAYLILKEREKWGNKIYMEDEYYFEGYWMEIVGTLENITDAYTGIE  336

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K     +LRRRHAE+V ESY + W+EHL++AG GR  WRRPF+THFTGCQPCSGDHN+MY
Sbjct  337  KRER--RLRRRHAERVGESYGKVWEEHLKDAGYGRGSWRRPFMTHFTGCQPCSGDHNQMY  394

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            SG++C DAM  ALNFADNQVLR YGF+HRDLLDT++V+PLP+D+P
Sbjct  395  SGQSCWDAMQIALNFADNQVLRRYGFVHRDLLDTSTVLPLPFDYP  439



>gb|ACE60602.1| putative galactomannan galactosyl transferase [Coffea arabica]
Length=448

 Score =   248 bits (632),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 143/165 (87%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FPESDDQ+GL YLILKE+EKWGNKIY+E +YYFEGYW+EIVG L+NITD Y GIE
Sbjct  277  FKDKTFPESDDQTGLAYLILKEREKWGNKIYMEDEYYFEGYWMEIVGTLENITDAYTGIE  336

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K     +LRRRHAE+V ESY + W+EHL++AG GR  WRRPF+THFTGCQPCSGDHN+MY
Sbjct  337  KRER--RLRRRHAERVGESYGKVWEEHLKDAGYGRGSWRRPFMTHFTGCQPCSGDHNQMY  394

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            SG++C DAM  ALNFADNQVLR YGF+HRDLLDT++V PLP+D+P
Sbjct  395  SGQSCWDAMQIALNFADNQVLRRYGFVHRDLLDTSTVPPLPFDYP  439



>ref|XP_009618872.1| PREDICTED: putative glycosyltransferase 7 [Nicotiana tomentosiformis]
Length=443

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 138/166 (83%), Gaps = 7/166 (4%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            F DK FP+SDDQSGL YL+LKE++KWG+KIY+ES+YYF+GYWV+I+G+LDNITD YLGIE
Sbjct  281  FNDKNFPQSDDQSGLSYLLLKEKDKWGDKIYLESEYYFQGYWVDIIGQLDNITDKYLGIE  340

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K      LRRRHAEKVSE Y + WKE+L      +  WRRPFITHFTGC+PCSGDHN +Y
Sbjct  341  KKMPS--LRRRHAEKVSERYGKLWKEYLI-----KDKWRRPFITHFTGCEPCSGDHNPIY  393

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            S ETC +AM K LNFADNQVLRNYGF+H+DLLD++SV PL +DFP+
Sbjct  394  SWETCYNAMQKTLNFADNQVLRNYGFVHKDLLDSSSVSPLSFDFPS  439



>gb|EPS69883.1| hypothetical protein M569_04879, partial [Genlisea aurea]
Length=420

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 135/165 (82%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            F DK FPESDDQ+GLIYL+LKE +KWG KIYVES+YYFEGYW+EIVG+LD I   YL I+
Sbjct  258  FADKAFPESDDQAGLIYLLLKENKKWGPKIYVESEYYFEGYWLEIVGELDRIAAEYLKIQ  317

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +      LRRRHAEK+S+SYA  W++HL++ G GR   RRPF+THFTGCQPCSG+HN MY
Sbjct  318  RAVPA--LRRRHAEKLSKSYAAAWEKHLKDKGYGRGSLRRPFVTHFTGCQPCSGEHNPMY  375

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
              ++CAD + KAL FAD+QVLRNYG++HRD LD ++VVPLP+D+P
Sbjct  376  PEKSCADGLQKALTFADDQVLRNYGYLHRDPLDPSTVVPLPFDYP  420



>ref|XP_010273069.1| PREDICTED: putative glycosyltransferase 7 [Nelumbo nucifera]
Length=460

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 137/165 (83%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
              DK+FPE+DDQSGL+YL+L+E+EKW +KIY+E +YYFEGYW+EIVG L+NITD Y+G+E
Sbjct  297  LSDKLFPEADDQSGLVYLLLEEKEKWADKIYLEGEYYFEGYWLEIVGTLNNITDKYVGME  356

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K   G  LRRRHAEKV E Y+   +  L+ AG GR  WRRPFITHFTGCQPCSG++N+MY
Sbjct  357  KEIRG--LRRRHAEKVMEHYSLVREPFLKAAGNGRGSWRRPFITHFTGCQPCSGEYNQMY  414

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            SG++C   M KALNFADNQVLR++GFMHRDL D++SV PLP+D+P
Sbjct  415  SGDSCWQGMEKALNFADNQVLRSFGFMHRDLQDSSSVSPLPFDYP  459



>ref|XP_004141854.1| PREDICTED: galactomannan galactosyltransferase 1-like [Cucumis 
sativus]
 ref|XP_004167675.1| PREDICTED: galactomannan galactosyltransferase 1-like [Cucumis 
sativus]
 gb|KGN48624.1| hypothetical protein Csa_6G495780 [Cucumis sativus]
Length=444

 Score =   237 bits (605),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 133/163 (82%), Gaps = 3/163 (2%)
 Frame = -3

Query  682  DKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKT  503
            DK+FPESDDQ+GL+YL+ KE+EKWGNKIY+E +YYFEGYW EIV   DNIT+ Y+ +E+ 
Sbjct  284  DKLFPESDDQTGLVYLLYKEKEKWGNKIYLEGEYYFEGYWEEIVTTFDNITERYMEMER-  342

Query  502  AAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSG  323
              G++LRRRHAEKVSE Y E  +++L+ AG G+  WRRPFITHFTGCQPCSGDHN+MYSG
Sbjct  343  -GGQELRRRHAEKVSEQYGEFREKYLKEAGNGKGSWRRPFITHFTGCQPCSGDHNQMYSG  401

Query  322  ETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
             +C D M KALNFADNQVLR YGFMH D  D+ SV  +PYD+P
Sbjct  402  GSCWDGMRKALNFADNQVLRKYGFMHPDAFDS-SVSEVPYDYP  443



>ref|XP_010274411.1| PREDICTED: galactomannan galactosyltransferase 1-like [Nelumbo 
nucifera]
Length=467

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 140/166 (84%), Gaps = 2/166 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
             KDK++ ESDDQSGL+YL+L+++EKW +KIYVES YYFEGYW+EIV +L+NI+D Y+GIE
Sbjct  302  LKDKVYAESDDQSGLVYLLLEQKEKWADKIYVESQYYFEGYWLEIVERLENISDRYVGIE  361

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
             T+AGE LRRRHAEKV+  YA+  + +L+ AG G   WRRPF+THFTGCQPC+G+HN +Y
Sbjct  362  -TSAGE-LRRRHAEKVNGYYAQLREPYLKEAGFGWGSWRRPFVTHFTGCQPCNGNHNRIY  419

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            SGE+C   M KALNFADNQVLR +GF+H D+LD++SV PLP+D+P+
Sbjct  420  SGESCWKGMEKALNFADNQVLRTFGFVHGDMLDSSSVSPLPFDYPS  465



>ref|XP_010106924.1| Galactomannan galactosyltransferase 1 [Morus notabilis]
 gb|EXC12640.1| Galactomannan galactosyltransferase 1 [Morus notabilis]
Length=459

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 129/165 (78%), Gaps = 3/165 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            F DK FPESDDQ+GL YLI KE+EKW ++IY+ES+YYFEGYW EIV  LDNIT+ YL IE
Sbjct  297  FADKAFPESDDQTGLAYLIYKEKEKWADRIYLESEYYFEGYWEEIVRTLDNITERYLEIE  356

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K    EKLRRRHAEKVSE Y    +EHL  AG G   WRRPFITHFTGCQPCSG+HN+MY
Sbjct  357  KK--DEKLRRRHAEKVSEQYGAFREEHLGAAGYGLGSWRRPFITHFTGCQPCSGNHNQMY  414

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            SGE+C D M KALNFADNQVLR YGFMH  LLD  SV  +P+D P
Sbjct  415  SGESCWDGMTKALNFADNQVLRTYGFMHPHLLD-PSVNAVPFDHP  458



>ref|XP_008440417.1| PREDICTED: galactomannan galactosyltransferase 1-like [Cucumis 
melo]
Length=445

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 131/163 (80%), Gaps = 3/163 (2%)
 Frame = -3

Query  682  DKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKT  503
            DK+FPESDDQ+GL+YL+ KE+EKWGNKIY+E +YYFEGYW EIV   DNITD Y  +E+ 
Sbjct  285  DKLFPESDDQTGLVYLLYKEKEKWGNKIYLEGEYYFEGYWEEIVTTFDNITDKYREMER-  343

Query  502  AAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSG  323
              G++LRRRHAEKVSE Y    +++L+ AG G+  WRRPFITHFTGCQPCSGDHN+MYSG
Sbjct  344  -GGQELRRRHAEKVSEQYGVFREKYLKEAGNGKGSWRRPFITHFTGCQPCSGDHNQMYSG  402

Query  322  ETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
             +C D M KALNFADNQVLR YGF+H D +D  SV  +PYD+P
Sbjct  403  GSCWDGMRKALNFADNQVLRKYGFVHPDAMD-PSVSEVPYDYP  444



>gb|KHG22205.1| Putative glycosyltransferase 7 -like protein [Gossypium arboreum]
Length=452

 Score =   230 bits (586),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 134/165 (81%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQ+ LIYL+ K +EK+ + IY+E ++YFEGYWVEI G+ +N T+MYL IE
Sbjct  282  FKDKLFPESDDQTALIYLLYKHKEKYYDHIYLEGEFYFEGYWVEIFGRYENTTEMYLEIE  341

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            + AA  +LRRRHAEKVSE Y    +E+L+ AG G+  WRRP ITHFTGCQPC+GDHN+MY
Sbjct  342  RGAA--ELRRRHAEKVSEHYGAFREEYLKGAGNGKGSWRRPLITHFTGCQPCNGDHNKMY  399

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
             GE+C + M KALNFADNQVLR YGF+H DLLD+++V  LP+D+P
Sbjct  400  DGESCWNGMVKALNFADNQVLRKYGFIHPDLLDSSTVSELPFDYP  444



>gb|KJB18050.1| hypothetical protein B456_003G031400 [Gossypium raimondii]
Length=450

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 134/165 (81%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQ+ LIYL+ K +EK+ + IY+E ++YFEGYWVEI G+ +N T+MYL IE
Sbjct  282  FKDKLFPESDDQTALIYLLYKHKEKYYDHIYLEGEFYFEGYWVEIFGRYENTTEMYLAIE  341

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            + AA  +LRRRHAEKVSE Y    +E+L++AG G+  WRRP ITHFTGCQPC+GDHN+MY
Sbjct  342  RGAA--ELRRRHAEKVSEQYGAFREEYLKSAGNGKGSWRRPLITHFTGCQPCNGDHNKMY  399

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
             GE+C + M KALNFADNQVLR YGF+H DLLD++ V  +P+D+P
Sbjct  400  DGESCWNGMVKALNFADNQVLRKYGFIHPDLLDSSIVSEVPFDYP  444



>gb|ADL36661.1| CAMTA domain class transcription factor [Malus domestica]
Length=449

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 130/167 (78%), Gaps = 3/167 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FPESDDQ+GL YLI +E+EKWG+KIY+ES+YYFEGYW EIVG LD I   Y  IE
Sbjct  281  FKDKAFPESDDQTGLAYLIYREKEKWGDKIYLESEYYFEGYWAEIVGTLDKIEARYDEIE  340

Query  508  K--TAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNE  335
            +   A   +LRRRHAEKVSE Y    +E+LR AG G+  WRRPF+THFTGCQPCSG HNE
Sbjct  341  RGEEANAVRLRRRHAEKVSEQYGAYREEYLREAGYGKGSWRRPFVTHFTGCQPCSGMHNE  400

Query  334  MYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            MYSGE+C D M KALNFADNQVLR YG++H    ++A+  P+P+D+P
Sbjct  401  MYSGESCWDGMRKALNFADNQVLRKYGYVHPSAGESAA-TPVPFDYP  446



>ref|XP_009362595.1| PREDICTED: LOW QUALITY PROTEIN: galactomannan galactosyltransferase 
1-like [Pyrus x bretschneideri]
Length=495

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 129/167 (77%), Gaps = 3/167 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FPESDDQ+GL YLI KE+EKWG+KIY+ES+YYFEGYW EIVG LD I   Y  IE
Sbjct  327  FKDKAFPESDDQTGLAYLIYKEKEKWGDKIYLESEYYFEGYWAEIVGTLDKIEARYDEIE  386

Query  508  KTAA--GEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNE  335
            +       +LRRRHAEKVSE Y    +E+LR AG G+  WRRPF+THFTGCQPCSG HNE
Sbjct  387  RGEEDNAVRLRRRHAEKVSEQYGAYREEYLREAGYGKGSWRRPFVTHFTGCQPCSGMHNE  446

Query  334  MYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            MYSGE+C D M KALNFADNQVLR YG++H    D+A+  P+P+D+P
Sbjct  447  MYSGESCWDGMRKALNFADNQVLRKYGYVHASTGDSAA-TPVPFDYP  492



>ref|XP_007205195.1| hypothetical protein PRUPE_ppa005681mg [Prunus persica]
 gb|EMJ06394.1| hypothetical protein PRUPE_ppa005681mg [Prunus persica]
Length=448

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 126/168 (75%), Gaps = 3/168 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FPESDDQ+GL YLI KE+EKWG KIY+ES+YYFEGYW EIVG LD I D Y  IE
Sbjct  281  FKDKAFPESDDQTGLAYLIYKEKEKWGKKIYMESEYYFEGYWAEIVGTLDKIEDRYAEIE  340

Query  508  KTAA--GEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNE  335
            +       +LRRRHAEKVSE Y E  +E+L  AG GR  WRRPFITHFTGCQPCSG HNE
Sbjct  341  RGEEDNAVRLRRRHAEKVSEQYGEFREEYLSEAGNGRGSWRRPFITHFTGCQPCSGRHNE  400

Query  334  MYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            MY   +C D M KALNFADNQVLR YG++H   +D A V  +P+D+P+
Sbjct  401  MYKANSCWDGMEKALNFADNQVLRKYGYVHPSTMDRA-VSTVPFDYPS  447



>gb|KHG22229.1| Putative glycosyltransferase 7 -like protein [Gossypium arboreum]
Length=456

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 132/165 (80%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQS ++YL+  E+EK+ + IY+E ++YFEGYWVEIVG  +N T+ YL IE
Sbjct  288  FKDKLFPESDDQSAMVYLLYTEKEKYYDHIYLEGEFYFEGYWVEIVGGYENTTERYLEIE  347

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            + A   KLRRRHAEKVSE YA   +E L+ AG G+  WRRP ITHFTGCQPCSGDHN+MY
Sbjct  348  RGAP--KLRRRHAEKVSEQYAAFREEFLKEAGNGKGSWRRPLITHFTGCQPCSGDHNQMY  405

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            +GE+C + M KALNFADNQVLR YGF+H DL D+++V  +P+D+P
Sbjct  406  AGESCWNGMVKALNFADNQVLRKYGFVHSDLHDSSTVTEIPFDYP  450



>gb|KJB46680.1| hypothetical protein B456_008G0841002 [Gossypium raimondii]
Length=424

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQS L+YL+  E+EK+ + IY+E ++YFEGYWVEIVG  +N T+ YL IE
Sbjct  256  FKDKLFPESDDQSALVYLLYTEKEKYYDHIYLEGEFYFEGYWVEIVGGYENTTERYLEIE  315

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            + A   KLRRRHAEKVSE YA   +E L+ AG G+  WRRP ITHFTGCQPCSGDHN MY
Sbjct  316  RGAP--KLRRRHAEKVSEQYAAFREEFLKEAGNGKGSWRRPLITHFTGCQPCSGDHNLMY  373

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            +GE+C + M KALNFADNQVLR YGF+H DL D+++V  +P+D+P
Sbjct  374  AGESCWNGMVKALNFADNQVLRKYGFVHSDLHDSSTVTEIPFDYP  418



>gb|ADL36663.1| CAMTA domain class transcription factor [Malus domestica]
Length=441

 Score =   226 bits (577),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 128/167 (77%), Gaps = 3/167 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FPESDDQ+GL YLI KE++KW +KIY+ES+YYFEGYW EIVG LD I   Y  IE
Sbjct  273  FKDKAFPESDDQTGLAYLIYKERDKWADKIYLESEYYFEGYWAEIVGTLDKIEARYAEIE  332

Query  508  KTA--AGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNE  335
            +    +  +LRRRHAEKVSE Y    +E+LR AG G+  WRRPF+THFTGCQPCSG HNE
Sbjct  333  RGEEDSAMRLRRRHAEKVSEQYGVFREEYLREAGYGKGSWRRPFVTHFTGCQPCSGAHNE  392

Query  334  MYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            MYSGE+C D M KALNFADNQVLR YG++H    D A+  P+P+D+P
Sbjct  393  MYSGESCWDGMRKALNFADNQVLRKYGYVHPSTEDRAA-TPVPFDYP  438



>gb|KJB46678.1| hypothetical protein B456_008G0841002 [Gossypium raimondii]
 gb|KJB46679.1| hypothetical protein B456_008G0841002 [Gossypium raimondii]
 gb|KJB46681.1| hypothetical protein B456_008G0841002 [Gossypium raimondii]
 gb|KJB46682.1| hypothetical protein B456_008G0841002 [Gossypium raimondii]
Length=456

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQS L+YL+  E+EK+ + IY+E ++YFEGYWVEIVG  +N T+ YL IE
Sbjct  288  FKDKLFPESDDQSALVYLLYTEKEKYYDHIYLEGEFYFEGYWVEIVGGYENTTERYLEIE  347

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            + A   KLRRRHAEKVSE YA   +E L+ AG G+  WRRP ITHFTGCQPCSGDHN MY
Sbjct  348  RGAP--KLRRRHAEKVSEQYAAFREEFLKEAGNGKGSWRRPLITHFTGCQPCSGDHNLMY  405

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            +GE+C + M KALNFADNQVLR YGF+H DL D+++V  +P+D+P
Sbjct  406  AGESCWNGMVKALNFADNQVLRKYGFVHSDLHDSSTVTEIPFDYP  450



>ref|XP_007047569.1| Galactosyl transferase GMA12/MNN10 family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007047570.1| Galactosyl transferase GMA12/MNN10 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91726.1| Galactosyl transferase GMA12/MNN10 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91727.1| Galactosyl transferase GMA12/MNN10 family protein isoform 1 [Theobroma 
cacao]
Length=455

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQS LIYL+ KE+EK+ + IY+E ++Y EGYWVEIVG  +N T+ YL IE
Sbjct  287  FKDKLFPESDDQSALIYLLYKEKEKYYDHIYLEGEFYLEGYWVEIVGGYENTTERYLEIE  346

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +     KLRRRHAEKVSE YA   +E L+ AG G+  WRRP ITHFTGCQPCSGDHN+MY
Sbjct  347  RGVP--KLRRRHAEKVSEQYAAFREEFLKEAGNGKGSWRRPLITHFTGCQPCSGDHNQMY  404

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            +GETC + M KALNFADNQVLR YGF+  DL D+++V  +PYD+P
Sbjct  405  AGETCWNGMVKALNFADNQVLRKYGFVRPDLRDSSTVTEVPYDYP  449



>ref|XP_008347885.1| PREDICTED: galactomannan galactosyltransferase 1-like [Malus 
domestica]
Length=449

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 129/167 (77%), Gaps = 3/167 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FPESDDQ+GL YLI +E+EKWG+KIY+ES+YYFEGYW EIVG LD I   Y  IE
Sbjct  281  FKDKAFPESDDQTGLAYLIYREKEKWGDKIYLESEYYFEGYWAEIVGTLDKIEARYDEIE  340

Query  508  KTAA--GEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNE  335
            +       +LRRRHAEKVSE Y    +E+LR AG G+  WRRPF+THFTGCQPCSG HNE
Sbjct  341  RGEEDNAVRLRRRHAEKVSEQYGAYREEYLREAGYGKGSWRRPFVTHFTGCQPCSGMHNE  400

Query  334  MYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            MYSGE+C D M KALNFADNQVLR YG++H    ++A+  P+P+D+P
Sbjct  401  MYSGESCWDGMRKALNFADNQVLRKYGYVHPSAGESAA-TPVPFDYP  446



>ref|XP_008362135.1| PREDICTED: galactomannan galactosyltransferase 1-like [Malus 
domestica]
Length=504

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 128/167 (77%), Gaps = 3/167 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FPESDDQ+GL YLI KE++KW +KIY+ES+YYFEGYW EIVG LD I   Y  IE
Sbjct  336  FKDKAFPESDDQTGLAYLIYKERDKWADKIYLESEYYFEGYWAEIVGTLDKIEARYAEIE  395

Query  508  KTA--AGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNE  335
            +    +  +LRRRHAEKVSE Y    +E+LR AG G+  WRRPF+THFTGCQPCSG HNE
Sbjct  396  RGEEDSAMRLRRRHAEKVSEQYGVFREEYLREAGYGKGSWRRPFVTHFTGCQPCSGAHNE  455

Query  334  MYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            MYSGE+C D M KALNFADNQVLR YG++H    D A+  P+P+D+P
Sbjct  456  MYSGESCWDGMRKALNFADNQVLRKYGYVHPSTEDRAA-TPVPFDYP  501



>ref|XP_008237711.1| PREDICTED: galactomannan galactosyltransferase 1-like [Prunus 
mume]
 ref|XP_008237720.1| PREDICTED: galactomannan galactosyltransferase 1-like [Prunus 
mume]
Length=448

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 125/168 (74%), Gaps = 3/168 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FPESDDQ+GL YLI KE+EKWG KIY+ES+YYFEGYW EIVG LD I D Y  IE
Sbjct  281  FKDKAFPESDDQTGLAYLIYKEKEKWGKKIYLESEYYFEGYWAEIVGTLDKIEDRYAEIE  340

Query  508  KTAA--GEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNE  335
            +       +LRRRHAEKVSE Y    +E+L  AG GR  WRRPFITHFTGCQPCSG HNE
Sbjct  341  RGEEDNAVRLRRRHAEKVSEQYGAFREEYLSEAGYGRGSWRRPFITHFTGCQPCSGRHNE  400

Query  334  MYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            MY   +C D M KALNFADNQVLR YG++H   +D A V  +P+D+P+
Sbjct  401  MYKANSCWDGMEKALNFADNQVLRKYGYVHPSTMDRA-VSTVPFDYPS  447



>ref|XP_004288265.1| PREDICTED: galactomannan galactosyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=457

 Score =   225 bits (573),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 129/170 (76%), Gaps = 6/170 (4%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FPESDDQ+GL YLI KE EKW ++IY+ESDYYFEGYW EIVG L+NIT+ Y  IE
Sbjct  286  FKDKAFPESDDQTGLAYLIYKENEKWADRIYLESDYYFEGYWAEIVGNLENITEKYTEIE  345

Query  508  KTAAGE---KLRRRHAEKVSESYAEKWKEHLRNAGQGR--SGWRRPFITHFTGCQPCSGD  344
            K    E   +LRRRHAEKVSE Y    ++ L++AG G     WRRPF+THFTGCQPCSG 
Sbjct  346  KRRGDEDVARLRRRHAEKVSEQYGAFREKFLKDAGSGYGVGSWRRPFVTHFTGCQPCSGA  405

Query  343  HNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            HN MYSG +C D M KALNFADNQVLR YGF+H   +D+ S+ PLP+++P
Sbjct  406  HNLMYSGTSCWDGMQKALNFADNQVLRKYGFVHASAVDS-SIQPLPFNYP  454



>ref|XP_006426098.1| hypothetical protein CICLE_v10025585mg [Citrus clementina]
 gb|ESR39338.1| hypothetical protein CICLE_v10025585mg [Citrus clementina]
Length=452

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 132/166 (80%), Gaps = 2/166 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDKIFPESDDQ+ LIYL+  E++K+ + IY+E ++YFEGYW+EIV   DNIT  Y+ IE
Sbjct  284  FKDKIFPESDDQAALIYLLYTEKDKYYDNIYLEGEFYFEGYWLEIVPTYDNITGRYMEIE  343

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +     +  RRHAEKVSESYA + +++L+ AG GR  WRRPFITHFTGCQPCSGDHN+MY
Sbjct  344  RRVRTLR--RRHAEKVSESYAAQREQYLKEAGNGRGSWRRPFITHFTGCQPCSGDHNQMY  401

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            SGETC   M KALNFADNQVLR YGF+H DL D++ V P+P+DFP+
Sbjct  402  SGETCWSGMVKALNFADNQVLRKYGFVHPDLRDSSLVSPVPFDFPD  447



>ref|XP_006466460.1| PREDICTED: putative glycosyltransferase 7-like [Citrus sinensis]
Length=452

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 132/166 (80%), Gaps = 2/166 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDKIFPESDDQ+ LIYL+  E++K+ + IY+E ++YFEGYW+EIV   DNIT  Y+ IE
Sbjct  284  FKDKIFPESDDQAALIYLLYTEKDKYYDNIYLEGEFYFEGYWLEIVPTYDNITGRYMEIE  343

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +     +  RRHAEKVSESYA + +++L+ AG GR  WRRPFITHFTGCQPCSGDHN+MY
Sbjct  344  RRVRTLR--RRHAEKVSESYAAQREQYLKEAGNGRGSWRRPFITHFTGCQPCSGDHNQMY  401

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            SGETC   M KALNFADNQVLR YGF+H DL D++ V P+P+DFP+
Sbjct  402  SGETCWSGMVKALNFADNQVLRKYGFVHPDLRDSSLVSPVPFDFPD  447



>ref|XP_003539263.1| PREDICTED: galactomannan galactosyltransferase 1-like isoformX1 
[Glycine max]
 ref|XP_006590622.1| PREDICTED: galactomannan galactosyltransferase 1-like isoform 
X2 [Glycine max]
Length=452

 Score =   222 bits (565),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 130/165 (79%), Gaps = 3/165 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FPESDDQ+GL YLI  E++KW ++IY+ES+YYFEGYW EI+G   NIT+ Y  +E
Sbjct  286  FKDKFFPESDDQTGLAYLIAIEKDKWADRIYLESEYYFEGYWEEILGTFQNITEKYNEME  345

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K  +  +LRRRHAEKVSE+Y E  +E+L++AG G+  WRRPFITHFTGCQPCSG +N MY
Sbjct  346  KGVS--RLRRRHAEKVSETYGEMREEYLKDAGNGKGSWRRPFITHFTGCQPCSGKYNAMY  403

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            S + C + M KALNFADNQV+R +G+M  DLLD A + P+P+D+P
Sbjct  404  SADDCWNGMQKALNFADNQVMRKFGYMRPDLLDNA-ISPVPFDYP  447



>gb|KDP32091.1| hypothetical protein JCGZ_12552 [Jatropha curcas]
Length=453

 Score =   221 bits (564),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 126/165 (76%), Gaps = 3/165 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FP SDDQS LIYL+ K++    +KIY+E +YYFEGYW EI+   DNITD Y  IE
Sbjct  287  FKDKLFPGSDDQSALIYLLYKDKSL-MDKIYLEGEYYFEGYWSEILPTYDNITDKYTEIE  345

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K     KLRRRHAEKVSE YA   + HLR AG G+  WRRPFITHFTGCQPCSGDHN+MY
Sbjct  346  K--EDPKLRRRHAEKVSEQYAAFREPHLREAGNGKGSWRRPFITHFTGCQPCSGDHNKMY  403

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
             G++C   M KALNFADNQVLR YGF+H DLLD+ +VV  P+D+P
Sbjct  404  EGDSCWKGMVKALNFADNQVLRKYGFVHPDLLDSKTVVETPFDYP  448



>ref|XP_006350640.1| PREDICTED: putative glycosyltransferase 7-like [Solanum tuberosum]
Length=411

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 130/166 (78%), Gaps = 6/166 (4%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FP+SDDQSGL YL+LKE++KWG KIY+ES+YYF+GYWV+I+  LDNIT+ Y  IE
Sbjct  250  FKDKKFPQSDDQSGLSYLLLKEKDKWGEKIYIESEYYFQGYWVDIIETLDNITNKYFEIE  309

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K      LRRRHAEKV  S  + W+E+L          RRPF+THFTGC+PCSGD+N +Y
Sbjct  310  KKIP--ILRRRHAEKVV-SEIKVWEEYLIKDNYSI---RRPFVTHFTGCEPCSGDYNPIY  363

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            S ETC DAM KALNFADNQVLR YGF+H +LLD+++V PLP+DFP+
Sbjct  364  SWETCYDAMQKALNFADNQVLRKYGFLHNNLLDSSTVFPLPFDFPS  409



>ref|XP_006857127.1| hypothetical protein AMTR_s00065p00144450 [Amborella trichopoda]
 gb|ERN18594.1| hypothetical protein AMTR_s00065p00144450 [Amborella trichopoda]
Length=478

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 127/165 (77%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
              D++F  SDDQS L+YL+L E++KWG+KI++E+ YYFEGYWVEI+G  +NIT  Y  +E
Sbjct  312  LSDRLFSASDDQSALVYLLLTERDKWGDKIFLENSYYFEGYWVEIIGTYENITRRYEDME  371

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K  A   LRRR  EK++  + E  + +L+ AG GR  WRRPF+THFTGCQPCSGDHN++Y
Sbjct  372  K--AQPILRRRKPEKLAMKFGELREPYLKEAGNGRFSWRRPFVTHFTGCQPCSGDHNKIY  429

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            SGE C   M +ALNFADNQVLRN+GF+H DL D+ASV PLP+DFP
Sbjct  430  SGENCWKGMERALNFADNQVLRNFGFVHEDLSDSASVKPLPFDFP  474



>emb|CDP02619.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 125/165 (76%), Gaps = 3/165 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQS L+YL+LKE+ KWG+ +YVE++Y   GYW  +VG++DNIT  Y  IE
Sbjct  298  FKDKMFPESDDQSALVYLLLKEKRKWGDMMYVENEYSLHGYWAAVVGRIDNITGRYEKIE  357

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +     KLRRRHAE V E Y + W+EHL +AG  + GWRRPFITHFTGCQPCSGDHN  Y
Sbjct  358  RQEV--KLRRRHAEAVGERYGKLWEEHLEDAGDRKGGWRRPFITHFTGCQPCSGDHNPSY  415

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
             G+ C   M +ALNFADNQVLRN+GF+H DL +  SV PL +DFP
Sbjct  416  VGKDCWVGMERALNFADNQVLRNFGFVHPDLRN-GSVSPLAFDFP  459



>gb|KJB43940.1| hypothetical protein B456_007G224800 [Gossypium raimondii]
Length=456

 Score =   219 bits (559),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 134/168 (80%), Gaps = 6/168 (4%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK++PESDDQS LIYL+ KE+EK+ + IY+E ++YF+GYWV+++G  DN T+ YL +E
Sbjct  284  FKDKLYPESDDQSALIYLLYKEKEKYYDHIYLEKEFYFQGYWVDLIGVYDNTTERYLQME  343

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +  A  +LRRRHAEKVSE YA   +E L+  G+    W+RPFITHFTGC+PCSG+HN+ Y
Sbjct  344  RKVA--RLRRRHAEKVSEQYAAFREEFLKETGK----WKRPFITHFTGCEPCSGNHNQKY  397

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*T  185
             GETC + M KALNFADNQ+LRNYGF+H DLLD+++V  +P+D+PN T
Sbjct  398  DGETCWEGMVKALNFADNQILRNYGFLHSDLLDSSTVTEVPFDYPNPT  445



>ref|XP_007156700.1| hypothetical protein PHAVU_002G009900g [Phaseolus vulgaris]
 gb|ESW28694.1| hypothetical protein PHAVU_002G009900g [Phaseolus vulgaris]
Length=450

 Score =   219 bits (558),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 128/166 (77%), Gaps = 6/166 (4%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FPESDDQ+GL YLI  E+EKW +KIY+ESDYYFEGYW EIVG L NI+D Y  +E
Sbjct  290  FKDKFFPESDDQTGLAYLIAIEKEKWADKIYLESDYYFEGYWKEIVGTLQNISDKYKKME  349

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +     +LRRRHAEKVSESY    +E L++AG    GWRRPFITHFTGCQPCSG +N MY
Sbjct  350  EGV--HRLRRRHAEKVSESYGGIREEDLKDAG---FGWRRPFITHFTGCQPCSGKYNAMY  404

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            S + C + MHKALNFADNQVLRNYGF+  DLL   SV  LP+D+P+
Sbjct  405  SADDCWNGMHKALNFADNQVLRNYGFLRPDLL-LNSVSTLPFDYPH  449



>ref|XP_002310890.2| alpha galactosyltransferase family protein [Populus trichocarpa]
 gb|EEE91340.2| alpha galactosyltransferase family protein [Populus trichocarpa]
Length=457

 Score =   219 bits (558),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 126/166 (76%), Gaps = 3/166 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQSGL YL+ K++   G KIY+E +YYFEGYW +I+   DNIT+ Y  +E
Sbjct  291  FKDKLFPESDDQSGLTYLLYKDKSLTG-KIYLEGEYYFEGYWADILPTYDNITEKYTELE  349

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K     KLRRRHAEKVSE Y    + HLR AG G+  WRRPFITHFTGCQPCSGDHN+MY
Sbjct  350  KEDG--KLRRRHAEKVSEQYGVFREPHLREAGNGKGSWRRPFITHFTGCQPCSGDHNQMY  407

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
             GETC + M KALNFADNQVLR YGF+H DLLD+ +V    +D+P+
Sbjct  408  EGETCWNGMVKALNFADNQVLRKYGFVHPDLLDSNTVTETSFDYPD  453



>ref|XP_011007841.1| PREDICTED: putative glycosyltransferase 7 [Populus euphratica]
 ref|XP_011007842.1| PREDICTED: putative glycosyltransferase 7 [Populus euphratica]
Length=458

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 128/166 (77%), Gaps = 3/166 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQSGLIY++ +++    +KIY+E +YYFEGYW +IV   DNIT+ Y  +E
Sbjct  292  FKDKLFPESDDQSGLIYMLYQDKGL-MDKIYLEGEYYFEGYWADIVPTYDNITEKYTELE  350

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K     KLRRRHAEKVSE Y    + HL+ AG G+  WRRPFITHFTGCQPCSGDHN++Y
Sbjct  351  KEDG--KLRRRHAEKVSEQYGVFREPHLKEAGNGKGSWRRPFITHFTGCQPCSGDHNQIY  408

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
             GETC + M KALNFADNQVLR YGF+H DLLD+ +V   P+D+P+
Sbjct  409  HGETCWNGMVKALNFADNQVLRKYGFVHPDLLDSGTVTETPFDYPD  454



>ref|XP_002320005.2| alpha galactosyltransferase family protein [Populus trichocarpa]
 gb|EEE98320.2| alpha galactosyltransferase family protein [Populus trichocarpa]
Length=458

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 128/166 (77%), Gaps = 3/166 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQSGLIY++ +++    +KIY+E +YYFEGYW +IV   DNIT+ Y  +E
Sbjct  292  FKDKLFPESDDQSGLIYMLYQDKGL-MDKIYLEGEYYFEGYWADIVPTYDNITEKYTELE  350

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K     KLRRRHAEKVSE Y    + HL+ AG G+  WRRPFITHFTGCQPCSGDHN++Y
Sbjct  351  KEDG--KLRRRHAEKVSEQYGVFREPHLKEAGNGKGSWRRPFITHFTGCQPCSGDHNQIY  408

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
             GETC + M KALNFADNQVLR YGF+H DLLD+ +V   P+D+P+
Sbjct  409  HGETCWNGMVKALNFADNQVLRKYGFVHPDLLDSGTVTETPFDYPD  454



>ref|XP_004234713.2| PREDICTED: glycosyltransferase 6-like [Solanum lycopersicum]
Length=446

 Score =   217 bits (553),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 131/166 (79%), Gaps = 6/166 (4%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FP+SDDQSGL YL+LKE++KWG+KIY+ES+YYF+GYWV+I+  LDNIT+ Y  IE
Sbjct  285  FKDKNFPQSDDQSGLSYLLLKEKDKWGDKIYIESEYYFQGYWVDIIDTLDNITNKYFEIE  344

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K      LRRRHAEKV  S  + W+E+L          RRPF+THFTGC+PCSGD+N +Y
Sbjct  345  KKIP--ILRRRHAEKVV-SEIKVWEEYLIKDSYSI---RRPFVTHFTGCEPCSGDYNPIY  398

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            S ETC +AM KALNFADNQVLR YGF+H +LLD++SV PLP+D+P+
Sbjct  399  SWETCYNAMQKALNFADNQVLRKYGFVHNNLLDSSSVRPLPFDYPS  444



>ref|XP_011031309.1| PREDICTED: putative glycosyltransferase 7 [Populus euphratica]
 ref|XP_011016265.1| PREDICTED: putative glycosyltransferase 7 [Populus euphratica]
Length=457

 Score =   217 bits (553),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 124/166 (75%), Gaps = 3/166 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQSGL YL+ K++     KIY+E +YYFEGYW +I+   DNIT+ Y  +E
Sbjct  291  FKDKLFPESDDQSGLTYLLYKDKSL-TEKIYLEGEYYFEGYWADILPTYDNITEKYTELE  349

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K     KLRRRHAEKVSE Y    + HLR AG G+  WRRPFITHFTGCQPCSGDHN+MY
Sbjct  350  KEDG--KLRRRHAEKVSEQYGVFREPHLREAGNGKGSWRRPFITHFTGCQPCSGDHNQMY  407

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
             GETC   M KALNFADNQVLR YGF+H DLLD+ +V    +D+P+
Sbjct  408  EGETCWTGMVKALNFADNQVLRKYGFVHPDLLDSNTVTETSFDYPD  453



>gb|KDO78929.1| hypothetical protein CISIN_1g045999mg [Citrus sinensis]
Length=438

 Score =   217 bits (552),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 125/166 (75%), Gaps = 16/166 (10%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDKIFPESDDQ+ LIYL+  E++K+ + IY+E ++YFEGYW+EIV  +           
Sbjct  284  FKDKIFPESDDQAALIYLLYTEKDKYYDNIYLEGEFYFEGYWLEIVPTV-----------  332

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
                   LRRRHAEKVSESYA + +++L+ AG GR  WRRPFITHFTGCQPCSGDHN+MY
Sbjct  333  -----RTLRRRHAEKVSESYAAQREQYLKEAGNGRGSWRRPFITHFTGCQPCSGDHNQMY  387

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            SGETC   M KALNFADNQVLR YGF+H DL D++ V P+P+DFP+
Sbjct  388  SGETCWSGMVKALNFADNQVLRKYGFVHPDLRDSSLVSPVPFDFPD  433



>ref|XP_002525290.1| transferase, putative [Ricinus communis]
 gb|EEF37118.1| transferase, putative [Ricinus communis]
Length=446

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 128/166 (77%), Gaps = 3/166 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FP+SDDQ+ LIY++ K++    +KIY+E +YYFEGYW+EIV   DNIT+ Y  IE
Sbjct  280  FKDKLFPDSDDQTALIYMLYKDKSL-TDKIYLEGEYYFEGYWLEIVPTYDNITEKYTEIE  338

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +     KLRRRHAEKVSE Y    + HL+ AG G+  WRRPFITHFTGCQPCSG+HN+MY
Sbjct  339  RQDV--KLRRRHAEKVSEQYGAFREPHLKAAGNGKGSWRRPFITHFTGCQPCSGEHNKMY  396

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
             G+ C D M +ALNFADNQVLR YGF+H DLL++ +VV  P+D+P+
Sbjct  397  EGDACWDGMVRALNFADNQVLRKYGFVHPDLLNSNTVVETPFDYPD  442



>emb|CAI79403.1| galactomannan galactosyltransferase [Senna occidentalis]
Length=449

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 125/165 (76%), Gaps = 3/165 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FPESDDQ+GL YLI  E+EKW ++IY+ES+YYFEGYW EIV   +NITD Y  +E
Sbjct  287  FKDKAFPESDDQTGLAYLIAVEKEKWADRIYLESEYYFEGYWKEIVETYENITDKYHEVE  346

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +      LRRRHAEKVSESY    + ++  AG GR  WRRPFITHFTGCQPCSG+HN MY
Sbjct  347  RKV--RSLRRRHAEKVSESYGAVREPYVMVAGSGRGSWRRPFITHFTGCQPCSGNHNAMY  404

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            S + C + M+KAL FADNQVLR +G++H DL D  SV P+P+D+P
Sbjct  405  SPDACWNGMNKALIFADNQVLRKFGYVHPDLQDN-SVSPIPFDYP  448



>gb|KHN36310.1| Galactomannan galactosyltransferase 1 [Glycine soja]
Length=417

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 126/165 (76%), Gaps = 6/165 (4%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FPESDDQ+GL YLI  E++KW  +IY+ES+YYFEGYW EI G   NIT+ Y  +E
Sbjct  257  FKDKFFPESDDQTGLAYLIAMEKDKWAERIYLESEYYFEGYWEEIQGTFKNITEKYKEME  316

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K    ++LRRRHAEKVSE+Y E  +E+L++AG  +  WRRPFITHFTGCQPCSG +N MY
Sbjct  317  KGV--QRLRRRHAEKVSETYGEMREEYLKDAGNAKGSWRRPFITHFTGCQPCSGKYNAMY  374

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            S   C++AMH ALNFADNQV+R +G+    LLD A V PLP+D+P
Sbjct  375  SPHDCSNAMHNALNFADNQVMRKFGY---SLLDNA-VSPLPFDYP  415



>ref|XP_003611556.1| Galactomannan galactosyltransferase [Medicago truncatula]
 gb|AES94514.1| galactosyl transferase GMA12/MNN10 family protein [Medicago truncatula]
Length=446

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 126/165 (76%), Gaps = 3/165 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FPESDDQ+GL YLI  E+EKWG+KIY+E +YYFEGYW EIV    NI+  Y  IE
Sbjct  283  FKDKFFPESDDQTGLAYLIAIEKEKWGDKIYLEGEYYFEGYWEEIVETFSNISKKYEDIE  342

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K     KLRRR+AEKVSE+Y    +E+L++AG G+  WRRPF+THFTGCQPCSG +NEMY
Sbjct  343  KVEP--KLRRRYAEKVSEAYGVIREEYLKDAGYGKGSWRRPFVTHFTGCQPCSGKYNEMY  400

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            + + C + M KALNFADNQV+R +GF+H+DL D   V  LP+D+P
Sbjct  401  TADACWNGMKKALNFADNQVMRKFGFVHKDLGDNG-VSSLPFDYP  444



>ref|XP_009394361.1| PREDICTED: galactomannan galactosyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=451

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 130/169 (77%), Gaps = 6/169 (4%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+F ESDDQS L+YL+LK +++WG+KI++ESDYYFEGYWVEIVG+L+N+T  Y  +E
Sbjct  284  FKDKLFNESDDQSALVYLLLKHKDQWGDKIFLESDYYFEGYWVEIVGRLENMTAKYAAVE  343

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRN---AGQGRSGWRRPFITHFTGCQPCSGDHN  338
            +   G  LRRRHAE  + +Y      HL     A  G +GWRRPF+THFTGCQPCSGDHN
Sbjct  344  RQVQG--LRRRHAEVANGAYGRLRDRHLSGEDGAVSGPNGWRRPFMTHFTGCQPCSGDHN  401

Query  337  EMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            +MYSGE+C + M +AL+FAD+QVLR+YGF H D L +  V PLP+D+P+
Sbjct  402  KMYSGESCWEGMQRALHFADDQVLRDYGFRHADPL-SGDVEPLPFDYPS  449



>ref|XP_011099400.1| PREDICTED: glycosyltransferase 6-like [Sesamum indicum]
Length=430

 Score =   213 bits (543),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 125/166 (75%), Gaps = 3/166 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQS LIYL+LKE+ KWG+ IYVE++Y   GYW+EIV K   I   Y+ IE
Sbjct  262  FKDKLFPESDDQSALIYLLLKERRKWGDMIYVENEYSLHGYWLEIVKKFARIAKKYVEIE  321

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGR-SGWRRPFITHFTGCQPCSGDHNEM  332
            K     +LRRRHAE V ESYA + + HL   G+ + SGWRRPFITHFTGCQPCSG+HN  
Sbjct  322  KRVP--RLRRRHAEAVRESYAAELERHLAGGGERQDSGWRRPFITHFTGCQPCSGEHNPA  379

Query  331  YSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            Y G++C   M +ALNFADNQVLR+YGF+H D+ + + V PLP+D+P
Sbjct  380  YEGDSCWVGMERALNFADNQVLRSYGFVHPDIANGSYVRPLPFDYP  425



>ref|XP_003517354.1| PREDICTED: galactomannan galactosyltransferase 1-like [Glycine 
max]
Length=449

 Score =   214 bits (544),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 125/165 (76%), Gaps = 6/165 (4%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FPESDDQ+GL YLI  E++KW  +IY+ES+YYFEGYW EI G   NIT+ Y  +E
Sbjct  289  FKDKFFPESDDQTGLAYLIAMEKDKWAERIYLESEYYFEGYWEEIQGTFKNITEKYKEME  348

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K    ++LRRRHAEKVSE+Y E  +E+L++AG  +  WRRPFITHFTGCQPCSG +N MY
Sbjct  349  KGV--QRLRRRHAEKVSETYGEMREEYLKDAGNAKGSWRRPFITHFTGCQPCSGKYNAMY  406

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            S   C +AMH ALNFADNQV+R +G+    LLD A V PLP+D+P
Sbjct  407  SAHDCWNAMHNALNFADNQVMRKFGY---SLLDNA-VSPLPFDYP  447



>ref|XP_004511818.1| PREDICTED: galactomannan galactosyltransferase 1-like [Cicer 
arietinum]
Length=458

 Score =   211 bits (538),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 125/165 (76%), Gaps = 3/165 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FPESDDQ+GL YLI  E+EKW ++IY+E +YYFEGYW EIVG  +NI+  Y  IE
Sbjct  295  FKDKFFPESDDQTGLAYLIAIEKEKWADRIYLEGEYYFEGYWEEIVGTFENISKKYDEIE  354

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K     +LRRRHAEKVSESY    +E+LR AG G+  WRRPF+THFTGCQPCSG +NEMY
Sbjct  355  KGV--RRLRRRHAEKVSESYGAVREEYLREAGYGKGSWRRPFVTHFTGCQPCSGKYNEMY  412

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            + + C + M +AL+FADNQV+R YG++H DL +   V  +P+D+P
Sbjct  413  TADACWNGMRRALHFADNQVIRKYGYVHPDLGNNL-VTSIPFDYP  456



>ref|XP_010109205.1| Galactomannan galactosyltransferase 1 [Morus notabilis]
 gb|EXC21327.1| Galactomannan galactosyltransferase 1 [Morus notabilis]
Length=433

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 127/165 (77%), Gaps = 8/165 (5%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK++PESDDQSGLIYL+LKE EKWG+KIY+ES+Y FEGYW+ +VG LDNIT  Y  IE
Sbjct  274  FKDKLYPESDDQSGLIYLLLKENEKWGDKIYLESEYNFEGYWLGMVGGLDNITKGYTEIE  333

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K      LRRRHAEK+SE Y+E       N  +G    +RPF+ HFTGC+PC+GDHN +Y
Sbjct  334  KKVG--VLRRRHAEKMSEYYSEI----RENYSKGVE--KRPFVIHFTGCEPCTGDHNPVY  385

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            + E C + M KALNFADNQVLR++GF+H DLL+++ V PLP+DFP
Sbjct  386  TWEACWNGMQKALNFADNQVLRSFGFVHPDLLNSSLVSPLPFDFP  430



>ref|XP_006404757.1| hypothetical protein EUTSA_v10000162mg [Eutrema salsugineum]
 gb|ESQ46210.1| hypothetical protein EUTSA_v10000162mg [Eutrema salsugineum]
Length=449

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 128/167 (77%), Gaps = 3/167 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQ+ LIYL+ K +E++  KIY+E +YYFEGYW+EIV  L N+TD YL +E
Sbjct  282  FKDKLFPESDDQTALIYLLFKHREEYYPKIYLEGEYYFEGYWLEIVPGLANVTDRYLEME  341

Query  508  KTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEM  332
            +  A   LRRRHAEKVSE Y A + +  LR    G+   RRPF+THFTGCQPCSGDHN+M
Sbjct  342  REDA--TLRRRHAEKVSERYGAFREERFLRGERGGKGSLRRPFVTHFTGCQPCSGDHNKM  399

Query  331  YSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            Y G+TC + M KA+NFADNQV+R YGF+H DL  T+ + P+P+D+P+
Sbjct  400  YDGDTCWNGMIKAINFADNQVMRRYGFVHSDLGKTSPLQPVPFDYPD  446



>emb|CDY49440.1| BnaA09g42270D [Brassica napus]
Length=448

 Score =   208 bits (530),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 127/167 (76%), Gaps = 3/167 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E +YYFEGYW+EIV  L NIT+ YL +E
Sbjct  281  FKDKLFPESDDQTALIYLLFKHKEVYYPKIYLEGEYYFEGYWLEIVPGLANITERYLEME  340

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEH-LRNAGQGRSGWRRPFITHFTGCQPCSGDHNEM  332
            +  A   LRRRHAEKVSE YA   +E  LR    G+   RRPF+THFTGCQPCSGDHN M
Sbjct  341  REDA--TLRRRHAEKVSERYAAFREERFLRGESGGKGSKRRPFVTHFTGCQPCSGDHNTM  398

Query  331  YSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            Y+G+TC + M KA+NFADNQV+R YGF+H DL  T+ + P+P+D+P+
Sbjct  399  YNGDTCWNGMIKAINFADNQVMRRYGFVHSDLGKTSPLQPVPFDYPD  445



>ref|XP_009117319.1| PREDICTED: putative glycosyltransferase 7 [Brassica rapa]
Length=448

 Score =   208 bits (530),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 127/167 (76%), Gaps = 3/167 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E +YYFEGYW+EIV  L NIT+ YL +E
Sbjct  281  FKDKLFPESDDQTALIYLLFKHKEVYYPKIYLEGEYYFEGYWLEIVPGLANITERYLEME  340

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEH-LRNAGQGRSGWRRPFITHFTGCQPCSGDHNEM  332
            +  A   LRRRHAEKVSE YA   +E  LR    G+   RRPF+THFTGCQPCSGDHN M
Sbjct  341  REDA--TLRRRHAEKVSERYAAFREERFLRGESGGKGSKRRPFVTHFTGCQPCSGDHNTM  398

Query  331  YSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            Y+G+TC + M KA+NFADNQV+R YGF+H DL  T+ + P+P+D+P+
Sbjct  399  YNGDTCWNGMIKAINFADNQVMRRYGFVHSDLGKTSPLQPVPFDYPD  445



>ref|XP_010531308.1| PREDICTED: putative glycosyltransferase 7 [Tarenaya hassleriana]
Length=449

 Score =   208 bits (530),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 128/167 (77%), Gaps = 3/167 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQ+ LIYL+ K +E + +KIY+E  YYFEGYW+EIV  LDN+T+ YL +E
Sbjct  282  FKDKLFPESDDQTALIYLLYKHREVYYDKIYLEGAYYFEGYWLEIVSGLDNVTERYLEME  341

Query  508  KTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEM  332
            +  A    RRRHAEKVSE Y A + +  L+    G+   RRPFITHFTGCQPCSGDHN M
Sbjct  342  RQDA--TCRRRHAEKVSERYGAFREERFLKGVAGGKGSVRRPFITHFTGCQPCSGDHNRM  399

Query  331  YSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            Y+G+TC + M +ALNFADNQV+R+YGF+H DL  T+ + P+P+D+P+
Sbjct  400  YNGDTCWNGMIRALNFADNQVMRSYGFVHSDLRKTSPLQPVPFDYPD  446



>emb|CDX76887.1| BnaC08g34730D [Brassica napus]
Length=448

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 126/167 (75%), Gaps = 3/167 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E +YYFEGYW+EIV  L NIT+ YL +E
Sbjct  281  FKDKLFPESDDQTALIYLLFKHKEVYYPKIYLEGEYYFEGYWLEIVPGLANITERYLEME  340

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEH-LRNAGQGRSGWRRPFITHFTGCQPCSGDHNEM  332
            +  A   LRRRHAEKVSE YA   +E  LR    G+   RRPF+THFTGCQPCSGDHN M
Sbjct  341  REDA--TLRRRHAEKVSERYAAFREERFLRGESGGKGSKRRPFVTHFTGCQPCSGDHNTM  398

Query  331  YSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            Y G+TC + M KA+NFADNQV+R YGF+H DL  T+ + P+P+D+P+
Sbjct  399  YDGDTCWNGMIKAINFADNQVMRRYGFVHSDLGKTSPLQPVPFDYPD  445



>ref|XP_002880469.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH56728.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=434

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 127/167 (76%), Gaps = 3/167 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E D+YFEGYW+EIV  L N+T+ YL +E
Sbjct  267  FKDKLFPESDDQTALIYLLYKHREVYYPKIYLEGDFYFEGYWLEIVPGLTNVTERYLEME  326

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEH-LRNAGQGRSGWRRPFITHFTGCQPCSGDHNEM  332
            +  A   LRRRHAEKVSE YA   +E  L+    G+   RRPF+THFTGCQPCSGDHN+M
Sbjct  327  REDA--TLRRRHAEKVSERYAAFREERFLKGERGGKGSKRRPFVTHFTGCQPCSGDHNKM  384

Query  331  YSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            Y G+TC + M KA+NFADNQV+R YGF+H DL  T+ + PLP+D+P+
Sbjct  385  YDGDTCWNGMIKAINFADNQVMRKYGFVHSDLGKTSPLQPLPFDYPD  431



>ref|XP_010417049.1| PREDICTED: putative glycosyltransferase 7 [Camelina sativa]
Length=466

 Score =   206 bits (525),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 126/167 (75%), Gaps = 3/167 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E DYYFEGYW+EIV    N+T+ YL +E
Sbjct  299  FKDKLFPESDDQTALIYLLYKHREVYYPKIYLEGDYYFEGYWLEIVPGFANVTERYLEME  358

Query  508  KTAAGEKLRRRHAEKVSESYAE-KWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEM  332
            +  A   LRRRHAEKVSE YA  + K  L+    G+   RRPF+THFTGCQPCSGDHN+M
Sbjct  359  REDAA--LRRRHAEKVSEGYAAFREKRFLKGERGGKGSKRRPFVTHFTGCQPCSGDHNKM  416

Query  331  YSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            Y G+TC + M KA+NFADNQV+R YGF+H DL  T+ + P+P+D+P+
Sbjct  417  YDGDTCWNGMIKAINFADNQVMRKYGFVHSDLGKTSPLQPVPFDYPD  463



>ref|XP_004231939.1| PREDICTED: glycosyltransferase 6-like [Solanum lycopersicum]
Length=443

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 116/165 (70%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FPESDDQS L YLILK ++KW +KI+  +DY   GYW+ IV + +NIT  Y+ IE
Sbjct  273  FKDKTFPESDDQSALSYLILKGEQKWRSKIHAITDYSLHGYWLGIVNRFENITANYMKIE  332

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +     KLRRRHAE VS SYA  W+  L      + GWRRPFITHFTGCQPCSGDH   Y
Sbjct  333  RDVP--KLRRRHAEAVSHSYAAAWEPLLAEGADEKGGWRRPFITHFTGCQPCSGDHATEY  390

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
             G++C   M +ALNFADNQVLRN+GFMH D+   + V PL +DFP
Sbjct  391  VGDSCWVGMERALNFADNQVLRNFGFMHDDIKSNSPVSPLNFDFP  435



>ref|XP_010472288.1| PREDICTED: putative glycosyltransferase 7 [Camelina sativa]
Length=455

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 126/167 (75%), Gaps = 3/167 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E D+YFEGYW+EIV    N+T+ YL +E
Sbjct  288  FKDKLFPESDDQTALIYLLYKHREVYYPKIYLEGDFYFEGYWLEIVPGFANVTERYLEME  347

Query  508  KTAAGEKLRRRHAEKVSESYAE-KWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEM  332
            +  A   LRRRHAEKVSE YA  + K  L+    G+   RRPF+THFTGCQPCSGDHN+M
Sbjct  348  REDA--TLRRRHAEKVSEGYAAFREKRFLKGERGGKGSKRRPFVTHFTGCQPCSGDHNKM  405

Query  331  YSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            Y G+TC + M KA+NFADNQV+R YGF+H DL  T+ + P+P+D+P+
Sbjct  406  YDGDTCWNGMIKAINFADNQVMRKYGFVHSDLGKTSPLQPVPFDYPD  452



>ref|XP_010429224.1| PREDICTED: putative glycosyltransferase 7 [Camelina sativa]
Length=455

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 126/167 (75%), Gaps = 3/167 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E D+YFEGYW+EIV    N+T+ YL +E
Sbjct  288  FKDKLFPESDDQTALIYLLYKHREVYYPKIYLEGDFYFEGYWLEIVPGFANVTERYLEME  347

Query  508  KTAAGEKLRRRHAEKVSESYAE-KWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEM  332
            +  A   LRRRHAEKVSE YA  + K  L+    G+   RRPF+THFTGCQPCSGDHN+M
Sbjct  348  REDA--TLRRRHAEKVSERYAAFREKRFLKGERGGKGSKRRPFVTHFTGCQPCSGDHNKM  405

Query  331  YSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            Y G+TC + M KA+NFADNQV+R YGF+H DL  T+ + P+P+D+P+
Sbjct  406  YDGDTCWNGMIKAINFADNQVMRKYGFVHSDLGKTSPLQPVPFDYPD  452



>ref|NP_565544.1| putative glycosyltransferase 7 [Arabidopsis thaliana]
 sp|O81007.1|GT7_ARATH RecName: Full=Putative glycosyltransferase 7; Short=AtGT7 [Arabidopsis 
thaliana]
 gb|AAC32437.1| Expressed protein [Arabidopsis thaliana]
 emb|CAC01675.1| putative golgi glycosyltransferase [Arabidopsis thaliana]
 gb|AAK59529.1| unknown protein [Arabidopsis thaliana]
 gb|AAL15201.1| unknown protein [Arabidopsis thaliana]
 gb|AEC07370.1| putative glycosyltransferase 7 [Arabidopsis thaliana]
 gb|AHL38845.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=449

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 127/167 (76%), Gaps = 3/167 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQ+ L+YL+ K +E +  KIY+E D+YFEGYW+EIV  L N+T+ YL +E
Sbjct  282  FKDKLFPESDDQTALLYLLYKHREVYYPKIYLEGDFYFEGYWLEIVPGLSNVTERYLEME  341

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEH-LRNAGQGRSGWRRPFITHFTGCQPCSGDHNEM  332
            +  A   LRRRHAEKVSE YA   +E  L+    G+   RRPF+THFTGCQPCSGDHN+M
Sbjct  342  REDA--TLRRRHAEKVSERYAAFREERFLKGERGGKGSKRRPFVTHFTGCQPCSGDHNKM  399

Query  331  YSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            Y G+TC + M KA+NFADNQV+R YGF+H DL  T+ + P+P+D+P+
Sbjct  400  YDGDTCWNGMIKAINFADNQVMRKYGFVHSDLGKTSPLQPVPFDYPD  446



>emb|CAI11452.1| alpha-6-galactosyltransferase [Solanum tuberosum]
Length=443

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 116/165 (70%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FPESDDQS L YLILK + KW +KI+  +DY   GYW+ IV + D IT+ Y  IE
Sbjct  273  FKDKTFPESDDQSALSYLILKGERKWRSKIHAITDYSLHGYWLGIVNRFDKITENYTKIE  332

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +     KLRRRHAE VS+SYAE  +  L     G+ GWRRPFITHFTGCQPCSGDH   Y
Sbjct  333  RDVP--KLRRRHAEAVSDSYAEAREPLLAEGADGKGGWRRPFITHFTGCQPCSGDHAAEY  390

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
             G++C   M +ALNFADNQVLRN+GFMH D+   + V PL +DFP
Sbjct  391  VGDSCWVGMERALNFADNQVLRNFGFMHDDIKSNSPVSPLNFDFP  435



>ref|XP_006294199.1| hypothetical protein CARUB_v10023195mg [Capsella rubella]
 gb|EOA27097.1| hypothetical protein CARUB_v10023195mg [Capsella rubella]
Length=452

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 127/167 (76%), Gaps = 3/167 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQ+ LIYL+ K +E++  KIY+E DYYFEGYW+EIV  L N+T+ YL +E
Sbjct  285  FKDKLFPESDDQTALIYLLYKHREEYYPKIYLEGDYYFEGYWLEIVPGLANVTERYLEME  344

Query  508  KTAAGEKLRRRHAEKVSESYAE-KWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEM  332
            +  A   LRRRHAEKVSE YA  + K  L+    G+   RRPF+THFTGCQPCSGDHN+M
Sbjct  345  REDA--TLRRRHAEKVSERYAAFREKRFLKGERGGKGSKRRPFVTHFTGCQPCSGDHNKM  402

Query  331  YSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            Y G+TC + M KA+NFADNQV+R YGF+H DL  T+ +  +P+D+P+
Sbjct  403  YDGDTCWNGMIKAINFADNQVMRKYGFVHSDLGKTSPLQHVPFDYPD  449



>emb|CDP02617.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 121/166 (73%), Gaps = 3/166 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
              DK+ P +D+QS L+YL+L+E++KWG+ IY+E+ YY  GYWVEIVG+L++I   YL  E
Sbjct  273  LSDKVIPGADEQSSLVYLLLREKKKWGDMIYLENQYYLHGYWVEIVGRLNDIIKKYLDTE  332

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQ-GRSGWRRPFITHFTGCQPCSGDHNEM  332
              A    LRRR AE VSES    W++ LR+AG  G SGWRRPFITHFTGCQPC+G  +  
Sbjct  333  --AKVPVLRRRVAEVVSESLDGVWEKCLRDAGGFGNSGWRRPFITHFTGCQPCTGKRDPA  390

Query  331  YSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            Y G  C  AM KALNFADNQVLR YGFMH DL + +SV P+P+DFP
Sbjct  391  YKGNACWVAMEKALNFADNQVLRRYGFMHPDLGNGSSVFPVPFDFP  436



>ref|XP_006363811.1| PREDICTED: putative glycosyltransferase 7-like [Solanum tuberosum]
Length=443

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 116/165 (70%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FPESDDQS L YLILK + KW +KI+  +DY   GYW+ IV + D IT+ Y  IE
Sbjct  273  FKDKTFPESDDQSALSYLILKGERKWRSKIHAITDYSLHGYWLGIVNRFDKITENYTKIE  332

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +     KLRRRHAE VS+SYAE  +  L     G+ GWRRPFITHFTGCQPCSGDH   Y
Sbjct  333  RDVP--KLRRRHAEAVSDSYAEAREPLLAEGEDGKGGWRRPFITHFTGCQPCSGDHAAEY  390

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
             G++C   M +ALNFADNQVLRN+GFMH D+   + V PL +DFP
Sbjct  391  VGDSCWVGMERALNFADNQVLRNFGFMHDDIKSNSPVSPLNFDFP  435



>ref|XP_009607432.1| PREDICTED: glycosyltransferase 6-like [Nicotiana tomentosiformis]
Length=443

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 117/165 (71%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDKIFPESDDQS L Y+I+K +EKW +KI+  +DY   GYW+ IV + DNIT  Y+ I+
Sbjct  273  FKDKIFPESDDQSALSYIIMKGEEKWRSKIHAITDYSLHGYWLGIVDRFDNITGNYVKID  332

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +     KLRRRHAE VSESYA   +  +   G  + GWRRPFITHFTGCQPCSGDH   Y
Sbjct  333  RDVP--KLRRRHAEAVSESYAAAREPLVAEGGDWKGGWRRPFITHFTGCQPCSGDHAAEY  390

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
             G+ C   M +ALNFADNQVLRN+GFMH D+   + V P+ +DFP
Sbjct  391  VGDKCWVGMERALNFADNQVLRNFGFMHNDIKSNSPVSPVNFDFP  435



>gb|ACH58908.1| galactosyl transferase [Coffea canephora]
Length=444

 Score =   201 bits (511),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 120/166 (72%), Gaps = 3/166 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
              DK+ P +D+QS L+YL+L+E++KWG+  Y+E+ YY  GYWV IVG+L++I   YL  E
Sbjct  273  LSDKVIPGADEQSSLVYLLLREKKKWGDMTYLENQYYLHGYWVAIVGRLNDIIKKYLDTE  332

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQ-GRSGWRRPFITHFTGCQPCSGDHNEM  332
              A    LRRR AE VSES    W+++LR+AG  G SGWRRPFITHFTGCQPC+G  +  
Sbjct  333  --AKVPVLRRRVAEVVSESLDGVWEKYLRDAGGFGNSGWRRPFITHFTGCQPCTGKRDPA  390

Query  331  YSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            Y G  C  AM KALNFADNQVLR YGFMH DL + +SV P+P+DFP
Sbjct  391  YKGNACWVAMEKALNFADNQVLRRYGFMHPDLGNGSSVSPVPFDFP  436



>ref|XP_009345079.1| PREDICTED: putative glycosyltransferase 7 [Pyrus x bretschneideri]
Length=442

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 123/166 (74%), Gaps = 2/166 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
             KDK +P SDDQS L+YL++KE+ +W  KIY+ES+YY  GYW+ IV  LD I+  Y+ I+
Sbjct  278  IKDKAYPGSDDQSALVYLLIKEKSRWAAKIYLESEYYLHGYWLGIVDGLDGISKGYMEID  337

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +    + LRRRHAEKVS  Y +  ++++R  G  R   RRPF+THFTGC+PCSG+HN MY
Sbjct  338  REV--DLLRRRHAEKVSLFYGQMREKYMRERGIWRENKRRPFVTHFTGCEPCSGEHNGMY  395

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            + E C + M KALNFADNQVLR +GF+H DLL+++ V PLP+DFP+
Sbjct  396  TWEACWNGMQKALNFADNQVLRRFGFVHPDLLNSSLVSPLPFDFPD  441



>ref|XP_008392336.1| PREDICTED: putative glycosyltransferase 7 [Malus domestica]
Length=442

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 122/166 (73%), Gaps = 2/166 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
             KDK +P SDDQS LIYL++KE+ KW +KIY+ES Y   GYW+ IV  LD I+  YL I+
Sbjct  278  IKDKAYPGSDDQSALIYLLIKEKSKWADKIYLESXYNLHGYWLGIVDGLDGISKGYLEID  337

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +    + LRRRHAEKVS  Y +  ++++R  G  R   RRPF+THFTGC+PCSG+HN MY
Sbjct  338  REV--DLLRRRHAEKVSLFYGQMREKYMRXRGIWRENKRRPFVTHFTGCEPCSGEHNGMY  395

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            + E C + M KALNFADNQVLR +GF+H DLL+++ V PLP+DFP+
Sbjct  396  TWEACWNGMQKALNFADNQVLRRFGFVHPDLLNSSWVSPLPFDFPD  441



>ref|XP_008363062.1| PREDICTED: glycosyltransferase 6-like [Malus domestica]
Length=442

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 122/166 (73%), Gaps = 2/166 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
             KDK +P SDDQS LIYL++KE+ KW +KIY+ES Y   GYW+ IV  LD I+  YL I+
Sbjct  278  IKDKAYPGSDDQSALIYLLIKEKSKWADKIYLESXYNLHGYWLGIVDGLDGISKGYLEID  337

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +    + LRRRHAEKVS  Y +  ++++R  G  R   RRPF+THFTGC+PCSG+HN MY
Sbjct  338  REV--DLLRRRHAEKVSLFYGQMREKYMRXRGIWRENKRRPFVTHFTGCEPCSGEHNGMY  395

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            + E C + M KALNFADNQVLR +GF+H DLL+++ V PLP+DFP+
Sbjct  396  TWEACWNGMQKALNFADNQVLRRFGFVHPDLLNSSWVSPLPFDFPD  441



>ref|XP_002513422.1| transferase, putative [Ricinus communis]
 gb|EEF48825.1| transferase, putative [Ricinus communis]
Length=424

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 121/160 (76%), Gaps = 5/160 (3%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+ PE+DDQ+ LIYL+LKE+EKWG+KIY+E +Y  + YW+++V   DNIT  YL I+
Sbjct  268  FKDKMIPEADDQAALIYLLLKEKEKWGDKIYIEEEYDLQKYWLDVVDAYDNITRGYLEIK  327

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +      LRRRHAEKVSE Y   W+++L+     +   RRP ITHFTGC+PCSG+HN  Y
Sbjct  328  REVPS--LRRRHAEKVSEKYGASWEQYLKAKSSFQ---RRPLITHFTGCEPCSGNHNPAY  382

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPL  209
            S ++C + M KALNFADNQVL NYGF+H++L+D++SV PL
Sbjct  383  SWDSCFNGMRKALNFADNQVLLNYGFLHQNLVDSSSVSPL  422



>emb|CAI11453.1| alpha-6-galactosyltransferase [Nicotiana benthamiana]
Length=443

 Score =   198 bits (503),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 115/165 (70%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FPESDDQS L Y+I+K +EKW +KI+  +DY   GYW+ IV + DNIT  Y  I+
Sbjct  273  FKDKTFPESDDQSALSYVIMKGEEKWRSKIHAITDYSLHGYWLGIVDRFDNITGNYEKID  332

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +     KLRRRHAE VSESYA   +  +   G  + GWRRPFITHFTGCQPCSGDH   Y
Sbjct  333  RDVP--KLRRRHAESVSESYAAAREPLVAEGGDWKGGWRRPFITHFTGCQPCSGDHVSEY  390

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
             G+ C   M +ALNFADNQVLRN+GFMH D+   + V P+ +DFP
Sbjct  391  VGDKCWVGMERALNFADNQVLRNFGFMHVDIKSNSPVTPVNFDFP  435



>ref|XP_010432039.1| PREDICTED: glycosyltransferase 6 [Camelina sativa]
Length=429

 Score =   197 bits (502),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 125/167 (75%), Gaps = 3/167 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E++YYF+GYW+ +VG   N+T+ YL +E
Sbjct  262  FKDKLFPESDDQTALIYLLYKHKELYYPKIYLEAEYYFQGYWIGVVGGFANVTERYLEME  321

Query  508  KTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEM  332
            +    + LRRRHAEKVSE Y A + +  L+    GR   RR F+THFTGCQPCSGDHN +
Sbjct  322  R--QDDTLRRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFVTHFTGCQPCSGDHNPI  379

Query  331  YSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            Y G+TC + M +ALNFADNQV+R YG++H DL  T+ + PLP+D+PN
Sbjct  380  YHGDTCWNEMIRALNFADNQVMRVYGYVHSDLSKTSPLQPLPFDYPN  426



>ref|XP_010437192.1| PREDICTED: glycosyltransferase 6-like [Camelina sativa]
Length=429

 Score =   197 bits (502),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 125/167 (75%), Gaps = 3/167 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E++YYF+GYW+ +VG   N+T+ YL +E
Sbjct  262  FKDKLFPESDDQTALIYLLYKHKELYYPKIYLEAEYYFQGYWIGVVGGFANVTERYLEME  321

Query  508  KTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEM  332
            +    + LRRRHAEKVSE Y A + +  L+    GR   RR F+THFTGCQPCSGDHN +
Sbjct  322  RQ--DDTLRRRHAEKVSERYGAFREERFLKGEFGGRDSRRRAFVTHFTGCQPCSGDHNPI  379

Query  331  YSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            Y G+TC + M +ALNFADNQV+R YG++H DL  T+ + PLP+D+PN
Sbjct  380  YHGDTCWNEMIRALNFADNQVMRVYGYVHSDLSKTSPLQPLPFDYPN  426



>ref|NP_001105164.1| alpha-6-galactosyltransferase [Zea mays]
 emb|CAI11455.1| alpha-6-galactosyltransferase [Zea mays]
 gb|ACF82483.1| unknown [Zea mays]
 gb|AFW63649.1| hypothetical protein ZEAMMB73_992521 [Zea mays]
Length=444

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 118/168 (70%), Gaps = 4/168 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+F ESDDQS L+Y++L+E  +W +K+++ES YYFEGYW+EIVG+L N+T+ Y  +E
Sbjct  272  FKDKVFDESDDQSALVYMLLQEGSRWRDKVFLESGYYFEGYWMEIVGRLANMTERYEAME  331

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAG---QGRSGWRRPFITHFTGCQPCSGDHN  338
            +      LRRRHAE+    YA      L  AG    G  GWRRPF+THFTGCQPCSG  N
Sbjct  332  RRPGAAALRRRHAEREHAEYAVARNAALGGAGLAETGVHGWRRPFVTHFTGCQPCSGQRN  391

Query  337  EMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            E YSG++C   M +ALNFAD+QVLR YGF H   L +  V PLP+D+P
Sbjct  392  EHYSGDSCDQGMRRALNFADDQVLRAYGFRHASSL-SDDVQPLPFDYP  438



>ref|NP_001281283.1| putative glycosyltransferase 7 [Malus domestica]
 gb|ADL36662.1| CAMTA domain class transcription factor [Malus domestica]
Length=442

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 122/166 (73%), Gaps = 2/166 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
             KDK +P SDDQS LIYL++KE+ +W  KIY+ES+Y   GYW+ IV  LD I+  Y+ ++
Sbjct  278  IKDKAYPGSDDQSALIYLLIKEKSRWAAKIYLESEYNLHGYWLGIVDGLDGISKGYMEVD  337

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +    + LRRRHAEKVS  Y +  ++++R  G  R   RRPF+THFTGC+PCSG+HN MY
Sbjct  338  REV--DLLRRRHAEKVSLFYGQMREKYMRERGIWRENKRRPFVTHFTGCEPCSGEHNGMY  395

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            + E C + M KALNFADNQVLR +GF+H DLL+++ V PLP+DFP+
Sbjct  396  TWEACWNGMQKALNFADNQVLRRFGFVHPDLLNSSLVSPLPFDFPD  441



>ref|XP_010446636.1| PREDICTED: LOW QUALITY PROTEIN: glycosyltransferase 6 [Camelina 
sativa]
Length=428

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 124/166 (75%), Gaps = 3/166 (2%)
 Frame = -3

Query  685  KDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEK  506
            KDK+FPESDDQ+ LIYL+ K +E +  KIY+E++YYF+GYW+ +VG   N+T+ YL +E+
Sbjct  262  KDKLFPESDDQTALIYLLYKHKELYYPKIYLEAEYYFQGYWIGVVGGFANVTERYLEMER  321

Query  505  TAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
                + LRRRHAEKVSE Y A + +  L+    GR   RR F+THFTGCQPCSGDHN +Y
Sbjct  322  --QDDTLRRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFVTHFTGCQPCSGDHNPIY  379

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
             G+TC D M +ALNFADNQV+R YG++H DL  T+ + PLP+D+PN
Sbjct  380  RGDTCWDEMIRALNFADNQVMRVYGYVHSDLSMTSPLQPLPFDYPN  425



>ref|XP_009761596.1| PREDICTED: glycosyltransferase 6-like [Nicotiana sylvestris]
Length=443

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 114/165 (69%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FPESDDQS L Y+I+K +EKW  KI+  +DY   GYW+ IV + DNIT  Y+ I+
Sbjct  273  FKDKTFPESDDQSALSYIIMKGEEKWRRKIHAITDYSLHGYWLGIVDRFDNITGNYVKID  332

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +     KLRRRHAE VSESYA   +  +      + GWRRPFITHFTGCQPCSGDH   Y
Sbjct  333  RDVP--KLRRRHAEAVSESYAAAREPLVAEGSDWKGGWRRPFITHFTGCQPCSGDHAAEY  390

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
             G+ C   M +ALNFADNQVLRN+GFMH D+   + V P+ +DFP
Sbjct  391  VGDKCWVGMERALNFADNQVLRNFGFMHDDIKSNSPVSPVNFDFP  435



>ref|XP_004294205.1| PREDICTED: galactomannan galactosyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=434

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 123/165 (75%), Gaps = 3/165 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
             KDK++P SDDQS LIYL+LK+++KWG+K+Y+ESD  F+ YW+ +V  LDNIT  Y  ++
Sbjct  272  LKDKLYPGSDDQSALIYLLLKQKQKWGDKVYLESDN-FQSYWLGVVDGLDNITKGYTEVD  330

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +     KLRRRH EKVSE Y E  ++++++ G  R   RRPF+THFTGC+PCSGD N  Y
Sbjct  331  REMG--KLRRRHGEKVSELYGEMREQYMKDKGMWRENVRRPFVTHFTGCEPCSGDCNPDY  388

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            + E C   M KALN+ADNQVLR YGF+H DLL+++ V PLP+D+P
Sbjct  389  TWEDCWKGMQKALNYADNQVLRKYGFVHPDLLNSSLVTPLPFDYP  433



>ref|XP_008806204.1| PREDICTED: galactomannan galactosyltransferase 1-like [Phoenix 
dactylifera]
Length=469

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 123/167 (74%), Gaps = 5/167 (3%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FK K+F ESDDQS L++++++E++ W +KI++E  +YFEGYW+EI+G+L+ +++MYL +E
Sbjct  304  FKGKVFAESDDQSALVHILIRERDLWADKIFLEDSFYFEGYWLEIIGRLEKMSEMYLALE  363

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAG--QGRSGWRRPFITHFTGCQPCSGDHNE  335
            +      LRRRHAEKV+  Y       L   G   G +GWRRPF+THFTGCQPCSGDHN+
Sbjct  364  RNVP--PLRRRHAEKVAAVYGRMRDGELERQGAETGPAGWRRPFMTHFTGCQPCSGDHNK  421

Query  334  MYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
             YSGE C   M +ALNFAD+QV+R YGF H + L++  V PLP+D+P
Sbjct  422  KYSGENCYQGMLRALNFADDQVMRVYGFKHTE-LESYGVTPLPFDYP  467



>emb|CAD98924.1| galactomannan galactosyltransferase [Lotus japonicus]
Length=437

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 118/165 (72%), Gaps = 7/165 (4%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+ P+SDDQ+ L YLI   ++KW  KIY+E DYYFEGYWVE+    +N++  Y  +E
Sbjct  278  FKDKVIPDSDDQTALAYLIAMGEDKWTEKIYLEKDYYFEGYWVELAKMYENVSVRYDEVE  337

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +   G  LRRRHAEKVSE Y E  +EH++  GQ    WRRPFITHFTGCQPC+G HN  Y
Sbjct  338  RRVGG--LRRRHAEKVSERYGEMREEHVKYFGQ----WRRPFITHFTGCQPCNGHHNPAY  391

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            + + C + M +ALNFADNQVLR YG++ R L D A V P+PYD+P
Sbjct  392  AADDCWNGMDRALNFADNQVLRTYGYVRRSLNDKA-VTPIPYDYP  435



>ref|XP_009361779.1| PREDICTED: glycosyltransferase 6-like [Pyrus x bretschneideri]
Length=442

 Score =   196 bits (498),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 122/166 (73%), Gaps = 2/166 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
             KDK +P SDDQS LIYL++KE+ KW +KIY+ES+Y   GYW+ IV  LD I+  Y+ I+
Sbjct  278  IKDKAYPGSDDQSALIYLLIKEKAKWADKIYLESEYNLHGYWLGIVDGLDGISKGYMEID  337

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +    + LRRRHAEKVS  Y +  ++++R  G  R   RRPF+THFTGC+PCSG+HN MY
Sbjct  338  REV--DLLRRRHAEKVSLFYGQMREKYMREKGIWRENKRRPFVTHFTGCEPCSGEHNGMY  395

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            + E C + M KALNFADNQVL  +GF+H DLL+++ V PLP+DFP+
Sbjct  396  TWEACWNGMQKALNFADNQVLIRFGFLHPDLLNSSWVSPLPFDFPD  441



>ref|XP_006411860.1| hypothetical protein EUTSA_v10027092mg, partial [Eutrema salsugineum]
 gb|ESQ53313.1| hypothetical protein EUTSA_v10027092mg, partial [Eutrema salsugineum]
Length=440

 Score =   196 bits (498),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 123/167 (74%), Gaps = 3/167 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E +YY +GYW+ +VG L N+T+ YL +E
Sbjct  273  FKDKLFPESDDQTALIYLLYKHKEVYYPKIYLEGEYYLQGYWIGVVGGLANVTERYLEME  332

Query  508  KTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEM  332
            +  A   LRRRHAEKVSE Y A + +  LR    GR   RR F+THFTGCQPCSGDHN +
Sbjct  333  RDDA--TLRRRHAEKVSERYGAFREERFLRGEFGGRGSRRRAFVTHFTGCQPCSGDHNPI  390

Query  331  YSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            Y G+TC   M +ALNFADNQV+R YG++H DL  T+ + P+P+D+P+
Sbjct  391  YDGDTCWKEMIRALNFADNQVMRTYGYVHSDLSKTSPLQPVPFDYPD  437



>ref|XP_008226081.1| PREDICTED: putative glycosyltransferase 7 [Prunus mume]
Length=439

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 122/165 (74%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
             KDK +P SDDQS LIYL++KE+++W +KIY+ES+Y   GYW+ IV  LD I+  Y+ I+
Sbjct  276  IKDKAYPGSDDQSALIYLLIKEKDRWADKIYLESEYNLHGYWLGIVDGLDKISKGYMEID  335

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +    + LRRRHAEK+S  Y    ++H+++ G  +   RRPF+THFTGC+PCSG+HN MY
Sbjct  336  REV--DLLRRRHAEKMSLFYGAMREKHMKDRGFWKENVRRPFVTHFTGCEPCSGEHNSMY  393

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            + E C + M KALNFADNQVL  +GF+H DLL+++ V PLP+DFP
Sbjct  394  TWEACWNGMQKALNFADNQVLSRFGFVHPDLLNSSLVSPLPFDFP  438



>gb|KHN20359.1| Galactomannan galactosyltransferase 1 [Glycine soja]
Length=268

 Score =   190 bits (482),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 122/166 (73%), Gaps = 8/166 (5%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+ P+SDDQ+ L YLI  E+ KW +KI++ES+YYF+GYW+EI     N+++ Y  +E
Sbjct  109  FKDKVLPDSDDQTALAYLIAVEK-KWADKIFLESEYYFQGYWLEISKTYYNVSERYDEVE  167

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +   G  LRRRHAEKVSESY    +E+L + G+    W+RPFITHFTGCQPC+G HN  Y
Sbjct  168  RKVKG--LRRRHAEKVSESYGLMREEYLNDVGE----WKRPFITHFTGCQPCNGHHNPAY  221

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
                C ++M +ALNFADNQVLR YG+M +DLL+ A + P+P+D+PN
Sbjct  222  DAMDCWNSMERALNFADNQVLRVYGYMRKDLLNKA-ISPIPFDYPN  266



>ref|XP_007211970.1| hypothetical protein PRUPE_ppa006622mg [Prunus persica]
 gb|EMJ13169.1| hypothetical protein PRUPE_ppa006622mg [Prunus persica]
Length=402

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 122/165 (74%), Gaps = 2/165 (1%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
             KDK +P SDDQS LIYL++KE+++W ++IY+ES+Y   GYW+ IV  LD I+  Y+ I+
Sbjct  239  IKDKAYPGSDDQSALIYLLIKEKDRWADRIYLESEYNLHGYWLGIVDGLDKISKGYMEID  298

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +    + LRRRHAEK+S  Y    ++H+++ G  +   RRPF+THFTGC+PCSG+HN MY
Sbjct  299  REV--DLLRRRHAEKMSLFYGAMREKHMKDRGFWKENVRRPFVTHFTGCEPCSGEHNSMY  356

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            + E C + M KALNFADNQVL  +GF+H DLL+++ V PLP+DFP
Sbjct  357  TWEACWNGMQKALNFADNQVLSRFGFVHPDLLNSSLVSPLPFDFP  401



>ref|NP_680773.1| glycosyltransferase 6 [Arabidopsis thaliana]
 sp|Q9SZG1.1|GT6_ARATH RecName: Full=Glycosyltransferase 6; Short=AtGT6 [Arabidopsis 
thaliana]
 emb|CAB38308.1| putative protein [Arabidopsis thaliana]
 emb|CAB80434.1| putative protein [Arabidopsis thaliana]
 gb|ABH04623.1| At4g37690 [Arabidopsis thaliana]
 gb|AEE86828.1| glycosyltransferase 6 [Arabidopsis thaliana]
 gb|AHL38658.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=432

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 122/167 (73%), Gaps = 3/167 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E++YY +GYW+ + G   N+T+ YL +E
Sbjct  265  FKDKLFPESDDQTALIYLLYKHKELYYPKIYLEAEYYLQGYWIGVFGDFANVTERYLEME  324

Query  508  KTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEM  332
            +    + LRRRHAEKVSE Y A + +  L+    GR   RR FITHFTGCQPCSGDHN  
Sbjct  325  R--EDDTLRRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFITHFTGCQPCSGDHNPS  382

Query  331  YSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            Y G+TC + M +ALNFADNQV+R YG++H DL  T+ + PLP+D+PN
Sbjct  383  YDGDTCWNEMIRALNFADNQVMRVYGYVHSDLSKTSPLQPLPFDYPN  429



>gb|KDP25125.1| hypothetical protein JCGZ_22660 [Jatropha curcas]
Length=432

 Score =   192 bits (488),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 120/160 (75%), Gaps = 5/160 (3%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+ PE+DDQ+ L+YL+LKE+EKWG+KIY+E DY  + YW+E V   D IT  Y+ IE
Sbjct  276  FKDKMIPEADDQAALVYLLLKEKEKWGDKIYIEEDYDLQTYWLEAVQDYDKITQDYMEIE  335

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +  +   LRR+HAEKVSESY    +++++     R   +RP ITHFTGC+PC+G+HN +Y
Sbjct  336  RKVSS--LRRKHAEKVSESYGASREQYIKVKNNFR---KRPLITHFTGCEPCTGNHNPVY  390

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPL  209
            S E C + + +ALNFADNQVL+NYGF+H++LLD +SV PL
Sbjct  391  SWEDCLNGIQRALNFADNQVLQNYGFLHQNLLDFSSVSPL  430



>ref|XP_009138524.1| PREDICTED: glycosyltransferase 6 [Brassica rapa]
Length=438

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 125/170 (74%), Gaps = 4/170 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKL-DNITDMYLGI  512
            FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E++YYF+GYW+ +VG    N+T+ YL +
Sbjct  270  FKDKLFPESDDQTALIYLLYKHKEVYYPKIYLEAEYYFQGYWIGVVGGFFANVTERYLEM  329

Query  511  EKTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNE  335
            E+  A   LRRRHAEKVSE Y A + +  L+    GR   RR F+THFTGCQPCSGDHN 
Sbjct  330  EREDA--TLRRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFVTHFTGCQPCSGDHNP  387

Query  334  MYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*T  185
             Y G+TC + M +ALNFADNQV+R YG++H DL  T+ + PLP+D+P+ T
Sbjct  388  SYDGDTCWNEMIRALNFADNQVMRAYGYVHTDLSKTSPLQPLPFDYPDET  437



>emb|CDY29577.1| BnaA03g54220D [Brassica napus]
Length=438

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 125/170 (74%), Gaps = 4/170 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKL-DNITDMYLGI  512
            FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E++YYF+GYW+ +VG    N+T+ YL +
Sbjct  270  FKDKLFPESDDQTALIYLLYKHKEVYYPKIYLEAEYYFQGYWIGVVGGFFANVTERYLEM  329

Query  511  EKTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNE  335
            E+  A   LRRRHAEKVSE Y A + +  L+    GR   RR F+THFTGCQPCSGDHN 
Sbjct  330  EREDA--TLRRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFVTHFTGCQPCSGDHNP  387

Query  334  MYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*T  185
             Y G+TC + M +ALNFADNQV+R YG++H DL  T+ + PLP+D+P+ T
Sbjct  388  SYDGDTCWNEMIRALNFADNQVMRAYGYVHTDLSKTSPLQPLPFDYPDET  437



>ref|XP_010939020.1| PREDICTED: LOW QUALITY PROTEIN: galactomannan galactosyltransferase 
1-like [Elaeis guineensis]
Length=470

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 120/167 (72%), Gaps = 5/167 (3%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+F ESDDQS L++L+  E+++W +K+++E  +YFEGYW+EIVG+  N+T+ YL +E
Sbjct  304  FKDKLFVESDDQSALVHLLNAERDRWADKVFLEDAFYFEGYWIEIVGRFGNMTEKYLAME  363

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAG--QGRSGWRRPFITHFTGCQPCSGDHNE  335
            +      LRRRHAEKV+  Y       L   G   G +GWRRPF+THFTGCQPCSGDHN+
Sbjct  364  RKVP--PLRRRHAEKVAGVYGRMRDGELEREGAETGPTGWRRPFMTHFTGCQPCSGDHNK  421

Query  334  MYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
             YSGE C + M +ALNFAD+QV R+YGF H + L    V PLP+D+P
Sbjct  422  KYSGENCYEGMLRALNFADDQVSRDYGFRHTE-LGGYDVKPLPFDYP  467



>ref|XP_003525869.1| PREDICTED: galactomannan galactosyltransferase 1-like [Glycine 
max]
Length=428

 Score =   189 bits (481),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 121/166 (73%), Gaps = 8/166 (5%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+ P+SDDQ+ L YLI  E  KW +KI++ES+YYF+GYW+EI     N+++ Y  +E
Sbjct  269  FKDKVLPDSDDQTALAYLIAVEN-KWADKIFLESEYYFQGYWLEISKTYYNVSERYDEVE  327

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +   G  LRRRHAEKVSESY    +E+L + G+    W+RPFITHFTGCQPC+G HN  Y
Sbjct  328  RKVKG--LRRRHAEKVSESYGLMREEYLNDVGE----WKRPFITHFTGCQPCNGHHNPAY  381

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
                C ++M +ALNFADNQVLR YG+M +DLL+ A + P+P+D+PN
Sbjct  382  DAMDCWNSMERALNFADNQVLRVYGYMRKDLLNKA-ISPIPFDYPN  426



>gb|KFK30380.1| hypothetical protein AALP_AA7G253700 [Arabis alpina]
Length=439

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 122/167 (73%), Gaps = 3/167 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQ+ LIYL+ K ++ + +KIY+E +YY +GYW+ +V    N+T+ YL +E
Sbjct  272  FKDKLFPESDDQTALIYLLYKHKDVYYDKIYLEGEYYLQGYWIGVVDGFGNVTERYLEME  331

Query  508  KTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEM  332
            +     +LRRRHAEKVSE Y A + +  L+    GR   RR F+THFTGCQPCSGDHN +
Sbjct  332  REDV--RLRRRHAEKVSEGYGAFREERFLKGEFGGRGSRRRAFVTHFTGCQPCSGDHNPI  389

Query  331  YSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            Y G+ C + M +ALNF DNQV+R YG++H DL  T+ +VPLP+D+P+
Sbjct  390  YDGDKCWNEMIRALNFGDNQVMRVYGYVHSDLSKTSPLVPLPFDYPD  436



>ref|XP_010028081.1| PREDICTED: putative glycosyltransferase 7 [Eucalyptus grandis]
 gb|KCW54740.1| hypothetical protein EUGRSUZ_I00693 [Eucalyptus grandis]
Length=460

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 121/165 (73%), Gaps = 8/165 (5%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            F DK+FP+SDDQS LIYL+L +++++G+KIYVE++YYFEGYW  IVG L NIT  Y  ++
Sbjct  286  FADKLFPDSDDQSALIYLLLTQKDRYGDKIYVENEYYFEGYWEGIVGTLPNITREYEDMD  345

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +      LRRRHAEK S  YA +  E      +       PF+THFTGCQPCSG+HN+MY
Sbjct  346  RQGP-PALRRRHAEKASRHYAARRAEAGAARKR-------PFVTHFTGCQPCSGNHNQMY  397

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            SGE+C + M KALNFADNQVLR YG++  DL+D+A V P+P+D+P
Sbjct  398  SGESCWNGMVKALNFADNQVLRRYGYVRPDLMDSAVVKPIPFDYP  442



>emb|CDX72649.1| BnaC07g46710D [Brassica napus]
Length=438

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 124/170 (73%), Gaps = 4/170 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKL-DNITDMYLGI  512
            FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E++YYF+GYW+ +VG    N+T+ YL +
Sbjct  270  FKDKLFPESDDQTALIYLLYKHKEVYYPKIYLEAEYYFQGYWIGVVGGFFANVTERYLEM  329

Query  511  EKTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNE  335
            E+  A   LRRRHAEKVSE Y A + +  L+    GR   RR F+THFTGCQPCSGDHN 
Sbjct  330  EREDA--TLRRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFVTHFTGCQPCSGDHNP  387

Query  334  MYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*T  185
             Y G+TC + M +ALNFADNQV+R YG++H DL  T+ + PLP+ +P+ T
Sbjct  388  SYDGDTCWNEMIRALNFADNQVMRAYGYVHSDLSKTSPLQPLPFGYPDET  437



>ref|XP_002868971.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH45230.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=436

 Score =   188 bits (477),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 120/167 (72%), Gaps = 3/167 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E +YY +GYW+ +V    N+T+ YL +E
Sbjct  269  FKDKLFPESDDQTALIYLLYKHKELYYPKIYLEGEYYLQGYWIGVVDGFANVTERYLEME  328

Query  508  KTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEM  332
            +    + LRRRHAEKVSE Y A + +  L+    GR   RR F+THFTGCQPCSGDHN  
Sbjct  329  R--EDDTLRRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFVTHFTGCQPCSGDHNPS  386

Query  331  YSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            Y G+TC + + +ALNFADNQV+R YG +H DL  T+ + PLP+D+PN
Sbjct  387  YDGDTCWNEIIRALNFADNQVMRVYGHVHSDLSKTSPLQPLPFDYPN  433



>emb|CAI11454.1| alpha-6-galactosyltransferase [Medicago truncatula]
 gb|AES90738.2| galactosyl transferase GMA12/MNN10 family protein [Medicago truncatula]
Length=438

 Score =   187 bits (476),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 117/165 (71%), Gaps = 7/165 (4%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FK K+ P+SDDQ+ L YLI   ++KW  KIY+E++YYFEGYW+EI    D +   Y  IE
Sbjct  277  FKTKVVPDSDDQTALAYLIAMGEDKWTKKIYMENEYYFEGYWMEISKMYDKMGKKYDEIE  336

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K   G  LRRRHAEKVSE Y E  +E+++N G  R    RPFITHFTGCQPC+G HN MY
Sbjct  337  KRVEG--LRRRHAEKVSERYGEMREEYVKNLGDMR----RPFITHFTGCQPCNGHHNPMY  390

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            + + C + M +ALNFADNQVLR +GF+H +LLD  SV PLP+ +P
Sbjct  391  AADDCWNGMERALNFADNQVLRKFGFIHPNLLD-KSVSPLPFGYP  434



>ref|XP_003608541.1| Alpha-6-galactosyltransferase [Medicago truncatula]
Length=462

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 117/165 (71%), Gaps = 7/165 (4%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FK K+ P+SDDQ+ L YLI   ++KW  KIY+E++YYFEGYW+EI    D +   Y  IE
Sbjct  277  FKTKVVPDSDDQTALAYLIAMGEDKWTKKIYMENEYYFEGYWMEISKMYDKMGKKYDEIE  336

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K   G  LRRRHAEKVSE Y E  +E+++N G  R    RPFITHFTGCQPC+G HN MY
Sbjct  337  KRVEG--LRRRHAEKVSERYGEMREEYVKNLGDMR----RPFITHFTGCQPCNGHHNPMY  390

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            + + C + M +ALNFADNQVLR +GF+H +LLD  SV PLP+ +P
Sbjct  391  AADDCWNGMERALNFADNQVLRKFGFIHPNLLD-KSVSPLPFGYP  434



>ref|XP_009362594.1| PREDICTED: glycosyltransferase 6-like [Pyrus x bretschneideri]
Length=422

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 115/160 (72%), Gaps = 8/160 (5%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FP  DDQS LIYL+  ++E+WG K Y+E +YY E YW+ +VGK DN T+ Y   E
Sbjct  271  FKDKPFPLPDDQSALIYLLFTDEERWGKKTYLEWEYYLEAYWIGVVGKYDNFTESYAETE  330

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +  +G  LRRRHAEKV+E Y  K + +++    GR   RRPF+THFTGCQPCSG+HN  Y
Sbjct  331  RNDSG--LRRRHAEKVNEWYGAKRETYIK----GRV--RRPFVTHFTGCQPCSGEHNPQY  382

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPL  209
            +G++C D M++ALNFADNQVLRNYGF+H DL  +   V L
Sbjct  383  TGDSCWDEMNRALNFADNQVLRNYGFVHPDLSSSTVSVLL  422



>ref|XP_009394626.1| PREDICTED: galactomannan galactosyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=429

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 121/169 (72%), Gaps = 6/169 (4%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
             KDK+F  SDDQS L+YL+LK +++WG+K+++ESDY  E YWV IV +L+N+T  Y  +E
Sbjct  262  LKDKLFNVSDDQSALVYLLLKHRDQWGDKVFLESDYDLEAYWVAIVDRLENMTAKYAEVE  321

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRN---AGQGRSGWRRPFITHFTGCQPCSGDHN  338
            +   G  LRRRHAE VS  Y    +E L     A  G +GW RPF+THFTGCQPC+G HN
Sbjct  322  RRVDG--LRRRHAEVVSGGYGRLREEQLATEEGAVSGPNGWHRPFMTHFTGCQPCNGAHN  379

Query  337  EMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            +MY+ ++C + M +AL+FAD+QVLR+YGF H D L +  V PLP+D+P+
Sbjct  380  KMYTWKSCWEGMQRALHFADDQVLRDYGFRHADPL-SGDVEPLPFDYPS  427



>gb|EAY87343.1| hypothetical protein OsI_08746 [Oryza sativa Indica Group]
 gb|EAZ24444.1| hypothetical protein OsJ_08194 [Oryza sativa Japonica Group]
Length=422

 Score =   184 bits (467),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 118/172 (69%), Gaps = 6/172 (3%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+F ESDDQS L+Y++L+    W +K+Y+ESDYYFEGYW+EI G+L NIT+ Y  +E
Sbjct  254  FKDKVFNESDDQSALVYMLLQSGSPWRDKVYLESDYYFEGYWLEIAGRLGNITERYEAME  313

Query  508  KTAAGEKLRRRHAEK---VSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHN  338
            + AA   LRRRHAE       +  +        A  G SGWRRPF+THFTGCQPCSG  N
Sbjct  314  RGAA--PLRRRHAEAEHASYAAARDAALAGAGLAESGVSGWRRPFVTHFTGCQPCSGHRN  371

Query  337  EMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*TS  182
            E Y+G++C + + +AL+FAD+QVLR YGF H   L  A V PLP+D P  T+
Sbjct  372  EHYTGKSCDEGIRRALSFADDQVLRAYGFRHAGPLSDA-VSPLPFDHPTQTA  422



>gb|ACF33173.1| putative galactomannan galactosyl transferase [Coffea canephora]
Length=447

 Score =   184 bits (468),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 116/168 (69%), Gaps = 8/168 (5%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
              DK+FP +D+QS L+YL+L E++KWG+KIY+E+ Y    YWV +VGKLD  T      E
Sbjct  272  LSDKMFPGADEQSSLVYLLLTEKKKWGDKIYLENQYDLSSYWVGVVGKLDKFTRTEADAE  331

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRN--AGQGRSGWRRPFITHFTGCQPCSGDHNE  335
            K      LRRR AE V ES  E W+++L N  A +G+    RPFITHFTGCQPCSG+H+ 
Sbjct  332  KNLP--LLRRRRAEVVGESVGEVWEKYLENNTASEGK----RPFITHFTGCQPCSGNHDP  385

Query  334  MYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
             Y G TC DAM + LN+ADNQVLRN GF+HRD+   + V+PL +DFP+
Sbjct  386  SYVGNTCWDAMERTLNYADNQVLRNLGFVHRDISRGSYVLPLAFDFPS  433



>ref|NP_001047970.1| Os02g0723200 [Oryza sativa Japonica Group]
 dbj|BAD13026.1| putative alpha galactosyltransferase [Oryza sativa Japonica Group]
 dbj|BAF09884.1| Os02g0723200 [Oryza sativa Japonica Group]
 dbj|BAG98296.1| unnamed protein product [Oryza sativa Japonica Group]
Length=447

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 118/172 (69%), Gaps = 6/172 (3%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+F ESDDQS L+Y++L+    W +K+Y+ESDYYFEGYW+EI G+L NIT+ Y  +E
Sbjct  279  FKDKVFNESDDQSALVYMLLQSGSPWRDKVYLESDYYFEGYWLEIAGRLGNITERYEAME  338

Query  508  KTAAGEKLRRRHAEK---VSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHN  338
            + AA   LRRRHAE       +  +        A  G SGWRRPF+THFTGCQPCSG  N
Sbjct  339  RGAA--PLRRRHAEAEHASYAAARDAALAGAGLAESGVSGWRRPFVTHFTGCQPCSGHRN  396

Query  337  EMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*TS  182
            E Y+G++C + + +AL+FAD+QVLR YGF H   L  A V PLP+D P  T+
Sbjct  397  EHYTGKSCDEGIRRALSFADDQVLRAYGFRHAGPLSDA-VSPLPFDHPTQTA  447



>emb|CDP02618.1| unnamed protein product [Coffea canephora]
Length=447

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 114/168 (68%), Gaps = 8/168 (5%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
              DK+FP +D+QS L+YL+L E++KWG+KIY+E+ Y    YWV +VGKLD  T      E
Sbjct  272  LSDKMFPGADEQSSLVYLLLTEKKKWGDKIYLENQYDLSSYWVGVVGKLDKFTRTEADAE  331

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRN--AGQGRSGWRRPFITHFTGCQPCSGDHNE  335
            K      LRRR AE VSES  E W+++L N  A +G+    RPFITHFTGCQPCSG H+ 
Sbjct  332  KNLP--LLRRRRAEVVSESVGEVWEKYLENNTASEGK----RPFITHFTGCQPCSGSHDP  385

Query  334  MYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
             Y G TC DAM + LN+ADNQVLRN GF HRD+   + V PL +DFP+
Sbjct  386  SYVGNTCWDAMERTLNYADNQVLRNLGFAHRDISHGSYVSPLAFDFPS  433



>ref|NP_001068066.1| Os11g0546500 [Oryza sativa Japonica Group]
 gb|ABA94224.1| Glycosyltransferase 6, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28429.1| Os11g0546500 [Oryza sativa Japonica Group]
Length=483

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 119/165 (72%), Gaps = 8/165 (5%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEK--TAAG  494
            ESDDQS L+YL+ + +EKWG K Y+E  Y+F+GYWVE+V +LD+I   Y   E+  +AA 
Sbjct  317  ESDDQSALVYLLSEHEEKWGAKTYLEKGYFFQGYWVEVVDRLDDIAARYEAAERRPSAAA  376

Query  493  EKLRRRHAEKVSESYAEKWKEHLRNAGQG-----RSGWRRPFITHFTGCQPCSGDHNEMY  329
              LRRRHAE+  E YA      +R A  G     +SGWRRPF+THFTGCQPC G+ N++Y
Sbjct  377  AHLRRRHAEREHERYAAARNAAVRGAVPGPAGGGQSGWRRPFVTHFTGCQPCGGEPNKIY  436

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            S ++CAD M++ALNFAD+QVLRNYG+ H+D L +  V PLP+D+P
Sbjct  437  SKKSCADGMNRALNFADDQVLRNYGYRHKDPL-SDEVRPLPFDYP  480



>gb|EAY81250.1| hypothetical protein OsI_36429 [Oryza sativa Indica Group]
Length=483

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 119/165 (72%), Gaps = 8/165 (5%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEK--TAAG  494
            ESDDQS L+YL+ + +EKWG K Y+E  Y+F+GYWVE+V +LD+I   Y   E+  +AA 
Sbjct  317  ESDDQSALVYLLSEHEEKWGAKTYLEKGYFFQGYWVEVVDRLDDIAARYEAAERRPSAAA  376

Query  493  EKLRRRHAEKVSESYAEKWKEHLRNAGQG-----RSGWRRPFITHFTGCQPCSGDHNEMY  329
              LRRRHAE+  E YA      +R A  G     +SGWRRPF+THFTGCQPC G+ N++Y
Sbjct  377  AHLRRRHAEREHERYAAARNAAVRGAVPGPAGGGQSGWRRPFVTHFTGCQPCGGEPNKIY  436

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            S ++CAD M++ALNFAD+QVLRNYG+ H+D L +  V PLP+D+P
Sbjct  437  SKKSCADGMNRALNFADDQVLRNYGYRHKDPL-SDEVRPLPFDYP  480



>emb|CAB52246.1| alpha galactosyltransferase [Trigonella foenum-graecum]
Length=438

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 117/165 (71%), Gaps = 7/165 (4%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FK K+  +SDDQ+ L YLI   ++KW  KIY+E++YYFEGYW+EI    D + + Y  IE
Sbjct  277  FKTKVVRDSDDQTALAYLIAMGEDKWTKKIYMENEYYFEGYWLEISKMYDKMGERYDEIE  336

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K   G  LRRRHAEKVSE Y E  +E+++N G  R    RPFITHFTGCQPC+G HN +Y
Sbjct  337  KRVEG--LRRRHAEKVSERYGEMREEYVKNLGDMR----RPFITHFTGCQPCNGHHNPIY  390

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            + + C + M +ALNFADNQVLR +GF+H +LLD  SV PLP+ +P
Sbjct  391  AADDCWNGMERALNFADNQVLRKFGFIHPNLLD-KSVSPLPFGYP  434



>ref|XP_002454367.1| hypothetical protein SORBIDRAFT_04g029500 [Sorghum bicolor]
 gb|EES07343.1| hypothetical protein SORBIDRAFT_04g029500 [Sorghum bicolor]
Length=443

 Score =   183 bits (464),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 117/171 (68%), Gaps = 7/171 (4%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQE---KWGNKIYVESDYYFEGYWVEIVGKLDNITDMYL  518
            FKDK+F ESDDQS L+Y++L++++    W +K+++ESDYYFEGYW EIVG+L N+T+ Y 
Sbjct  268  FKDKVFDESDDQSALVYMLLQKEKGSRPWRDKVFLESDYYFEGYWAEIVGRLGNMTERYE  327

Query  517  GIEKTAAGEKLRRRHAEK---VSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSG  347
             +E+      LRRRHAE+      +  +        A  G  GWRRPF+THFTGCQPCSG
Sbjct  328  AMERRPGAAALRRRHAEREHAEYAAARDAALAGAGLAETGVHGWRRPFVTHFTGCQPCSG  387

Query  346  DHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
              NE YSG++C   M +ALNFAD+QVLR YGF H   L +  V PLP+D+P
Sbjct  388  QRNEHYSGDSCDQGMRRALNFADDQVLRAYGFRHAGPL-SDDVEPLPFDYP  437



>tpg|DAA64594.1| TPA_inf: putative galacto(gluco)mannan alpha-1,6-galactosyltransferase, 
partial [Pinus taeda]
Length=173

 Score =   174 bits (442),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 116/171 (68%), Gaps = 11/171 (6%)
 Frame = -3

Query  682  DKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKT  503
            D+ F  SDDQS L+YL+LKE++KW ++I++E  YY  GYW++IVG  +NIT+ Y  +EK 
Sbjct  5    DRAFNSSDDQSALVYLLLKEKDKWADRIFIEHKYYLNGYWLDIVGTYENITEKYEAMEK-  63

Query  502  AAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSG-------WRRPFITHFTGCQPCSGD  344
                 L +RHAEK++  YAE  + H+R+     S         RRPF+THFTGCQPCSGD
Sbjct  64   -ENPMLNKRHAEKMNRDYAEMREHHMRDNKNFYSDNDDIMVRRRRPFVTHFTGCQPCSGD  122

Query  343  HNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPL-PYDFP  194
            HN++Y GE C   M +ALNFAD+QVL+NYGF H D L ++ V P+  + FP
Sbjct  123  HNKIYKGENCWKGMERALNFADDQVLKNYGFRH-DNLQSSHVNPIQSFYFP  172



>ref|XP_006663513.1| PREDICTED: putative glycosyltransferase 7-like [Oryza brachyantha]
Length=332

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 116/165 (70%), Gaps = 8/165 (5%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKT--AAG  494
            ESDDQS L+YL+ + +EKWG+K  +E  YYF+GYWVEIV +LD I   Y   E+   AA 
Sbjct  166  ESDDQSALVYLLSEHEEKWGSKTILELGYYFQGYWVEIVDRLDGIAARYESAERRPGAAA  225

Query  493  EKLRRRHAEKVSESYAEKWKEHLRNA-----GQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            + LRRRHAE+    YAE     +R+A     G G++GWRRP +THFTG QPC G  N++Y
Sbjct  226  KALRRRHAEREHLRYAEARNAAMRSAIPGPAGGGQTGWRRPVMTHFTGGQPCGGKPNKIY  285

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            S ++CAD M++ALNFAD+QVLR YGF H+D L +  V PLP+D+P
Sbjct  286  SKKSCADGMNRALNFADDQVLRAYGFRHKDPL-SDEVRPLPFDYP  329



>ref|XP_010679659.1| PREDICTED: putative glycosyltransferase 7 [Beta vulgaris subsp. 
vulgaris]
Length=431

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 117/160 (73%), Gaps = 4/160 (3%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            F DK++PESDDQ+G+ YL++KE E W +KIY+E DYYFEGYWVEIVG  +N+T  Y  IE
Sbjct  274  FTDKLYPESDDQTGIAYLMVKEGENWKDKIYLEKDYYFEGYWVEIVGNYENVTAHYSKIE  333

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K     +LRRRHAEK  E Y  +W+ +L    +     +RPFITHFTGC+PCSG HNEMY
Sbjct  334  KKER--RLRRRHAEKAGEDYRAQWEYNLERENEKLM--KRPFITHFTGCEPCSGKHNEMY  389

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPL  209
            + E+C   M+KALNFADNQVLRN+G+   +L +++ V PL
Sbjct  390  NLESCFKGMNKALNFADNQVLRNFGYFRPNLDNSSWVQPL  429



>sp|Q564G7.1|GMGT1_CYATE RecName: Full=Galactomannan galactosyltransferase 1 [Cyamopsis 
tetragonoloba]
 emb|CAI79402.1| galactomannan galactosyltransferase [Cyamopsis tetragonoloba]
Length=435

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 117/166 (70%), Gaps = 10/166 (6%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKE-QEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGI  512
            FKDK+ P+SDDQ+ L YLI  + ++ W  KI++ES+YYFEGYW+EIV   +NI++ Y  +
Sbjct  277  FKDKVLPDSDDQTALAYLIATDNKDTWREKIFLESEYYFEGYWLEIVKTYENISERYDEV  336

Query  511  EKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEM  332
            E+   G  LRRRHAEKVSE Y    +E+L++        RRPFITHFTGCQPC+G HN  
Sbjct  337  ERKVEG--LRRRHAEKVSEKYGAMREEYLKDNK------RRPFITHFTGCQPCNGHHNPA  388

Query  331  YSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            Y+   C + M +ALNFADNQ+LR YG+  ++LLD  SV PLP+ +P
Sbjct  389  YNANDCWNGMERALNFADNQILRTYGYHRQNLLD-KSVSPLPFGYP  433



>ref|XP_008363070.1| PREDICTED: LOW QUALITY PROTEIN: galactomannan galactosyltransferase 
1-like, partial [Malus domestica]
Length=383

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 108/163 (66%), Gaps = 3/163 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
             K K    SDDQ GLIYL++ +QE W NK YVE DYY  GYW+ IV  LD IT  Y+ IE
Sbjct  219  IKGKQISNSDDQXGLIYLLITQQEGWANKTYVEGDYYQHGYWL-IVDGLDTITKRYMEIE  277

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +    + LRRRHAEKVS+ Y     +H+++ G      RRPF THFT CQPC+G H+  Y
Sbjct  278  REV--DMLRRRHAEKVSQFYGTMRDQHVKDKGYWXDDLRRPFTTHFTXCQPCNGQHSSAY  335

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYD  200
            + E C + M + LNFADNQVLR + F+H DLL+++ V PLP+D
Sbjct  336  TWEACWNGMQRGLNFADNQVLRRFAFVHPDLLNSSFVSPLPFD  378



>dbj|BAK05879.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=427

 Score =   174 bits (441),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 112/170 (66%), Gaps = 6/170 (4%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            F+DK+F ESDDQS L+Y++      W  K+++E+ YYF+GYWVEIVG+L  I   Y  IE
Sbjct  253  FRDKLFNESDDQSALVYMLQHRGSPWREKVFLENGYYFQGYWVEIVGRLGGIAARYEAIE  312

Query  508  KTA-AGEKLRRRHAEKVS-ESYAEK---WKEHLRNAGQGRSGWRRPFITHFTGCQPCSGD  344
            + A A   LRRRHA     E YA+           A  G  GWRRPF+THFTGCQPCSG+
Sbjct  313  RRAPAVALLRRRHAASWEHEGYAQAREAALAGAGLAESGVKGWRRPFVTHFTGCQPCSGN  372

Query  343  HNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
             N  YSG++C D M +ALNFAD+QVLR+YGF H   L +  V PLP+D+P
Sbjct  373  RNRDYSGDSCDDGMRRALNFADDQVLRDYGFRHAGPL-SDDVRPLPFDYP  421



>ref|XP_003608540.1| Galactomannan galactosyltransferase [Medicago truncatula]
 gb|AES90737.1| galactosyl transferase GMA12/MNN10 family protein [Medicago truncatula]
Length=422

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 113/165 (68%), Gaps = 9/165 (5%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK FP  DDQS LIYL+ +++ KWG K ++E  Y  EGYW+  +GKL+ I + Y  IE
Sbjct  265  FKDKPFPLPDDQSSLIYLLSRQRRKWGAKTFLEEGYDLEGYWIATMGKLEGIQNKYDEIE  324

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            K A    LRRRH+EKVS  Y E  + +L+ +       RRPF+ HFTGCQPCSGDHN  Y
Sbjct  325  KKA--RVLRRRHSEKVSVWYGEMREPYLKWSE------RRPFVKHFTGCQPCSGDHNPSY  376

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
             G+ C   M +ALNFADNQVLRNYGF+ ++L+ T+SV  +P+ +P
Sbjct  377  KGDVCWKEMERALNFADNQVLRNYGFVRKNLM-TSSVYEVPFGYP  420



>ref|XP_007208181.1| hypothetical protein PRUPE_ppa017391mg, partial [Prunus persica]
 gb|EMJ09380.1| hypothetical protein PRUPE_ppa017391mg, partial [Prunus persica]
Length=366

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 115/159 (72%), Gaps = 9/159 (6%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+F  SDDQS LIYL+   +EKWG+K Y+E +Y  EGYW+ +VGK D + + Y+ +E
Sbjct  215  FKDKLFSVSDDQSSLIYLLFTNKEKWGDKTYLEGEYNLEGYWLALVGKYDTLAESYIKME  274

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +      LRRRHAEKV++ YA + +++L    QG    RRPF+THFTGCQPCSG+HN  Y
Sbjct  275  RNEG--VLRRRHAEKVNDWYAAEREKYL----QGHE--RRPFVTHFTGCQPCSGEHNPQY  326

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDT-ASVV  215
            S ++C + M +ALN+ADNQVL+NYGF+H +L  +  SVV
Sbjct  327  SADSCWNEMKRALNYADNQVLKNYGFVHPELSSSEVSVV  365



>ref|XP_008238162.1| PREDICTED: glycosyltransferase 6-like [Prunus mume]
Length=417

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 115/159 (72%), Gaps = 9/159 (6%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+F  SDDQS LIYL+   +EKWG+K Y+E +Y  EGYW+ +VGK D +T  Y+ +E
Sbjct  266  FKDKLFSVSDDQSSLIYLLFTNKEKWGDKTYLEGEYNLEGYWLALVGKYDTLTASYIKME  325

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            +      LRRRHAEKV++ Y  + +++L    QGR   RRPF+THFTGCQPCSG+HN  Y
Sbjct  326  RNEG--VLRRRHAEKVNDWYDAEREKYL----QGRE--RRPFVTHFTGCQPCSGEHNPQY  377

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDT-ASVV  215
            S ++C + M +ALN+ADNQVL+NYGF+H +L  +  SVV
Sbjct  378  SADSCWNEMKRALNYADNQVLKNYGFVHPELSSSEVSVV  416



>gb|ADE76992.1| unknown [Picea sitchensis]
Length=477

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 117/174 (67%), Gaps = 11/174 (6%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
              D+ F  SDDQS L+YL++KE++KW ++IY+E  YY  GYWV+IVG  +NIT+ Y  +E
Sbjct  307  LSDRAFNASDDQSALVYLLIKEKDKWADRIYIEHSYYLNGYWVDIVGTYENITEKYEAME  366

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSG-------WRRPFITHFTGCQPCS  350
            K      L +RHAEK++  YAE  + ++R+     S         RRPF+THFTGCQPCS
Sbjct  367  KE--NPMLNKRHAEKMNRDYAEMREHYIRSDKNFYSDNDDIMVRRRRPFVTHFTGCQPCS  424

Query  349  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPL-PYDFPN  191
            GDHN++Y GE C   M +ALNFAD+QVL++YGF H D L ++ V P+  + FP+
Sbjct  425  GDHNKIYKGENCWKGMERALNFADDQVLKHYGFRH-DNLQSSHVNPIQSFYFPS  477



>ref|XP_004953741.1| PREDICTED: galactomannan galactosyltransferase 1-like [Setaria 
italica]
Length=429

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 115/168 (68%), Gaps = 4/168 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK+F ESDDQS L+Y++L+    W  K+++ESDYYFEGYW+EIVG+L N+T+ Y  +E
Sbjct  259  FKDKVFDESDDQSALVYMLLQSGSPWREKVFLESDYYFEGYWLEIVGRLGNVTERYEAME  318

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRS---GWRRPFITHFTGCQPCSGDHN  338
            +      LRRR AE    ++A      L  AG   +   GWRRPF+THFTGCQPCSG  N
Sbjct  319  RRPGSAALRRRRAEAEHVAHAAARNAALAGAGLAEAGVRGWRRPFVTHFTGCQPCSGHRN  378

Query  337  EMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            E YSG +C + M +ALNFAD+QVLR YGF H   L +  V PLP+D+P
Sbjct  379  EHYSGASCDEGMRRALNFADDQVLRAYGFRHAGPL-SDDVQPLPFDYP  425



>ref|XP_003570475.1| PREDICTED: galactomannan galactosyltransferase 1-like [Brachypodium 
distachyon]
Length=417

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 107/165 (65%), Gaps = 7/165 (4%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
            FKDK F ESDDQS L+YL+ ++   W  K+++E +YYFEGYW+EIV +L NI+     +E
Sbjct  257  FKDKAFNESDDQSALVYLLQQDGSPWRQKVFLEHEYYFEGYWLEIVPRLGNISKRCEAME  316

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
            + AA E  +RR   +      +      R A     GWRRPF+THFTGCQPCSG  NE Y
Sbjct  317  RQAAPEMRKRRAEREARRGRGD------RAAASRVEGWRRPFVTHFTGCQPCSGHRNEDY  370

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            SGE+C + M +ALNFAD+QVLR YGF H   L +  V PLP+ +P
Sbjct  371  SGESCDEGMRRALNFADDQVLRAYGFRHAGPL-SDDVTPLPFGYP  414



>gb|AFW64907.1| glycosyltransferase 6 [Zea mays]
Length=479

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 112/173 (65%), Gaps = 16/173 (9%)
 Frame = -3

Query  667  ESDDQSGLIYLILK--EQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAG  494
            ESDDQS L+YL+ +  E+E+W N  ++ES YYF+GYW EIV +LD +   Y  +E+  AG
Sbjct  305  ESDDQSALVYLLSRHLERERWANATFLESGYYFQGYWAEIVDRLDGVATRYEAVERGRAG  364

Query  493  EK--LRRRHAEKVSESYAEKWKEHLRN-----------AGQGRSGWRRPFITHFTGCQPC  353
             +  LRRRHAE+    YA   ++ +R             G G+ GWRRPF+THFTGCQPC
Sbjct  365  GRAGLRRRHAEREHLLYAAARRQAVRQQRGTGGGVPGPDGGGQKGWRRPFVTHFTGCQPC  424

Query  352  SGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
             G  N MY+   CA+ + +AL FAD+QVLR+YGF H   L + SV PLP+D+P
Sbjct  425  GGAPNRMYTRRRCAEGIRRALAFADDQVLRSYGFRHAAPL-SDSVTPLPFDYP  476



>ref|XP_003575986.2| PREDICTED: galactomannan galactosyltransferase 1-like [Brachypodium 
distachyon]
Length=479

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 108/174 (62%), Gaps = 12/174 (7%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAA---  497
            +SDDQS L+YL++K + KWG K Y++ DY+F+GYW EIV +LD +   YL  E+ AA   
Sbjct  308  DSDDQSALVYLLMKNRRKWGRKTYLDHDYFFQGYWAEIVDRLDGVAVRYLAAERRAARPG  367

Query  496  -GEKLRRRHAEKVSESYAEKWKEHLRNA-----GQGRSGWRRPFITHFTGCQPCSGDHNE  335
                LRRRHAE     YA      +  A     G G++GWRRPFITHF GCQPC G  N 
Sbjct  368  TSALLRRRHAEAEHALYAAARNAVVGRAVPGPAGGGQTGWRRPFITHFAGCQPCGGTPNV  427

Query  334  MYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*TSPIR  173
            ++   +CA+ + +ALNFAD+QVLR YGF H   L    V PLP+ +P   SP R
Sbjct  428  IFPNGSCAEGVRRALNFADDQVLRAYGFRHAGPLSDV-VQPLPFGYPR--SPAR  478



>gb|ABK25085.1| unknown [Picea sitchensis]
Length=479

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 111/163 (68%), Gaps = 4/163 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
              D+   ESDDQS LIYL++KE++KW  KIY+E++Y+F+GYW++IVG  +NIT +Y  +E
Sbjct  321  LPDRALTESDDQSALIYLMIKEKKKWAGKIYIENEYFFQGYWLDIVGSFENITKIYDAME  380

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
              A    LRRR+AEK +  YA K    L+    G    RRPF+THFTGCQPCSG+HN +Y
Sbjct  381  --AKHPDLRRRYAEKSARLYAGKRDRSLKEIWAGILQ-RRPFVTHFTGCQPCSGNHNPIY  437

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYD  200
              E C + M ++L+FAD+QVLR YGF  R  L +  V P+ ++
Sbjct  438  KAEDCWNGMARSLDFADDQVLRIYGF-RRHQLQSVVVSPIHFN  479



>ref|XP_008795673.1| PREDICTED: glycosyltransferase 6-like [Phoenix dactylifera]
Length=516

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 112/159 (70%), Gaps = 5/159 (3%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            +SDDQS L++L++K+ ++WGNK+Y+E+ Y   GYW  I+G+LDNIT+ Y  +EK    ++
Sbjct  360  DSDDQSALVHLLVKDIKRWGNKVYLENSYDLHGYWEAIIGRLDNITERYKRLEKKE--KE  417

Query  487  LRRRHAEKVSESYAEKWKEHL-RNAGQGRS--GWRRPFITHFTGCQPCSGDHNEMYSGET  317
            LRRRHAEK +  +    + +L R  G G +    RRPF+THFTGCQPCS  HN  Y+ E+
Sbjct  418  LRRRHAEKDTVGFGGTREWYLDREVGMGPAERKKRRPFVTHFTGCQPCSAGHNPAYTWES  477

Query  316  CADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYD  200
            C + MH+ALNFAD QVLR YGF   D+ + +SV PLP+D
Sbjct  478  CYEGMHRALNFADGQVLRAYGFGRPDINNISSVQPLPFD  516



>ref|NP_001152534.1| glycosyltransferase 6 [Zea mays]
 gb|ACG48084.1| glycosyltransferase 6 [Zea mays]
Length=473

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 111/173 (64%), Gaps = 16/173 (9%)
 Frame = -3

Query  667  ESDDQSGLIYLILK--EQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAG  494
            ESDDQS L+YL+ +  E+E+W N  ++ES YYF+G W EIV +LD +   Y  +E+  AG
Sbjct  299  ESDDQSALVYLLSRHLERERWANATFLESGYYFQGXWAEIVDRLDGVATRYEAVERGRAG  358

Query  493  EK--LRRRHAEKVSESYAEKWKEHLRN-----------AGQGRSGWRRPFITHFTGCQPC  353
             +  LRRRHAE+    YA   +E +R             G G+ GWRRPF+THFTGCQPC
Sbjct  359  GRAGLRRRHAEREHLLYAAARREXVRQQRGTGGGVPGPDGGGQKGWRRPFVTHFTGCQPC  418

Query  352  SGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
             G  N MY+   CA+ + +AL FAD+QVLR+YGF H   L + SV PLP+D+P
Sbjct  419  GGAPNRMYTRRRCAEGIRRALAFADDQVLRSYGFRHAAPL-SDSVTPLPFDYP  470



>ref|XP_002449648.1| hypothetical protein SORBIDRAFT_05g020910 [Sorghum bicolor]
 gb|EES08636.1| hypothetical protein SORBIDRAFT_05g020910 [Sorghum bicolor]
Length=449

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 108/174 (62%), Gaps = 29/174 (17%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            +SDDQS L YL+L  +E+WG+K Y+  DYYF+GY+ EIVGKLD I   Y+ +E+      
Sbjct  282  QSDDQSALAYLLLMNRERWGDKTYLGIDYYFQGYFAEIVGKLDAIAARYVAVERKGE-PA  340

Query  487  LRRRHAEKVSESYAEKWKEHLRNA---------------GQGRSGWRRPFITHFTGCQPC  353
            LRRRHAE+          EHLR A               G G+SGWRRPF+THFTGC PC
Sbjct  341  LRRRHAER----------EHLRYAAARNAAVRAVVPGPDGGGQSGWRRPFVTHFTGCNPC  390

Query  352  SGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL-DTASVVPLPYDFP  194
             G  N++YS E C D M +AL FAD+QVLR YGF H   L DT  V  LP+D+P
Sbjct  391  GGKRNKIYSREICEDGMRRALGFADDQVLRAYGFRHAAPLNDTVRV--LPFDYP  442



>ref|XP_004980586.1| PREDICTED: galactomannan galactosyltransferase 1-like [Setaria 
italica]
Length=450

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 107/174 (61%), Gaps = 20/174 (11%)
 Frame = -3

Query  661  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  482
            DDQS L+YL+L   E+ G K ++E++Y+F+GYW+EIV +LD +   Y  +E+ A    LR
Sbjct  287  DDQSALVYLLLHNWERLGKKAFIETEYFFQGYWLEIVDRLDGVAARYEAVERRAPA--LR  344

Query  481  RRHAEKVSESYAEKWKEHLRNAG----------QGRSGWRRPFITHFTGCQPCSGDHNEM  332
            RRHAE+    YA       RNA            G  GWRRP ITHF GCQPCSG  N M
Sbjct  345  RRHAEREHLRYAAA-----RNAAVSGAVPGPAGGGEKGWRRPLITHFVGCQPCSGGRNPM  399

Query  331  YSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*TSPIRQ  170
            YS E+C D M + L FADNQVLR YGF H   L+  SV PLP+D+P   +P R+
Sbjct  400  YSRESCEDGMRRTLGFADNQVLRAYGFRHAAPLND-SVRPLPFDYP--AAPARR  450



>ref|XP_004980585.1| PREDICTED: galactomannan galactosyltransferase 1-like [Setaria 
italica]
Length=312

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 101/160 (63%), Gaps = 6/160 (4%)
 Frame = -3

Query  658  DQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRR  479
            DQS L YL++  +E+WG K Y+ +DYYF+GY+ EIVGKL  +   Y   E+ A    LRR
Sbjct  149  DQSALAYLLITGRERWGEKTYLGTDYYFQGYFAEIVGKLAGVAARYKAAERGAGHAGLRR  208

Query  478  RHAEKVSESYAEKWKEHLRNA-----GQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETC  314
            RHAE+    YA      +R A     G G+SGWRRP ITHFTGC PC G  N MYS E C
Sbjct  209  RHAEREHLRYAAARNAAVRAAVPGPDGGGQSGWRRPLITHFTGCNPCGGRRNPMYSRELC  268

Query  313  ADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
               M +AL FAD+QVLR YGF H   L+  +V+ LP+D+P
Sbjct  269  EGGMRRALGFADDQVLRAYGFRHAGPLND-TVLQLPFDYP  307



>gb|AHC98115.1| putative galacto(gluco)mannan alpha-1,6-galactosyltransferase 
[Pinus radiata]
Length=480

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 111/162 (69%), Gaps = 4/162 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
              D+   ESDDQS L+YL++KE++KWG KIY+E++YYF+G+W++IVG  +NI+  Y  +E
Sbjct  321  LPDRPVTESDDQSALVYLMIKEKKKWGGKIYIENEYYFQGFWLDIVGTFENISKRYEAME  380

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
              A   +L RR+AEK +  YA K + +L+    G    RRPF+THF GCQPCSG+HN +Y
Sbjct  381  --AEHTELSRRYAEKSARLYAVKRERYLKEIWAGLFE-RRPFVTHFAGCQPCSGNHNPIY  437

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPY  203
              E C + + ++L+FAD+QVLR YGF  R  L +  V P+ +
Sbjct  438  KAEDCQNGLQRSLDFADDQVLRIYGF-RRQQLQSVLVNPIHF  478



>tpg|DAA64590.1| TPA_inf: putative galacto(gluco)mannan alpha-1,6-galactosyltransferase 
[Pinus taeda]
Length=480

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 111/162 (69%), Gaps = 4/162 (2%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
              D+   ESDDQS L+YL++KE++KWG KIY+E++YYF+G+W++IVG  +NI+  Y  +E
Sbjct  321  LPDRPVTESDDQSALVYLMIKEKKKWGGKIYIENEYYFQGFWLDIVGTFENISKRYEAME  380

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
              A   +L RR+AEK +  YA K + +L+    G    RRPF+THF GCQPCSG+HN +Y
Sbjct  381  --AEHTELSRRYAEKSARLYAVKRERYLKEIWAGLFE-RRPFVTHFAGCQPCSGNHNPIY  437

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPY  203
              E C + + ++L+FAD+QVLR YGF  R  L +  V P+ +
Sbjct  438  KAEDCQNGLQRSLDFADDQVLRIYGF-RRQQLQSVLVNPIHF  478



>gb|EMS46901.1| Galactomannan galactosyltransferase 1 [Triticum urartu]
Length=316

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 99/170 (58%), Gaps = 12/170 (7%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
              DK   ESDDQS L YL+LK  +KWG + Y+E+ YYF+GYW EIV KLD + + Y   E
Sbjct  147  LSDKPDAESDDQSALAYLLLKNPKKWGARTYLENQYYFQGYWAEIVDKLDGVAERYRAAE  206

Query  508  KTAAGEKLRRRHAE----------KVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  359
            +   G  LRRRHAE            +    +         GQ  S WRRPF+THFTGC 
Sbjct  207  RRF-GPALRRRHAEGEHALYAAARNAALRKKDGGVPGPDGGGQKASAWRRPFVTHFTGCN  265

Query  358  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPL  209
            PC G  NE+YS E+CA+ M +ALN AD+QVLR YGF H   L    V PL
Sbjct  266  PCGGRANEIYSNESCAEGMRRALNLADDQVLRAYGFRHAGPLKD-DVRPL  314



>ref|XP_008679453.1| PREDICTED: galactomannan galactosyltransferase 1-like [Zea mays]
 gb|AFW64905.1| hypothetical protein ZEAMMB73_022035 [Zea mays]
Length=441

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 103/173 (60%), Gaps = 27/173 (16%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            +SDDQS L YL+L  +E+WG K Y+  DYYF+GY+ EIV KLD +   Y   E+      
Sbjct  274  QSDDQSALAYLLLTNRERWGKKTYLGIDYYFQGYFAEIVDKLDGVAARYEAAERKG-DPA  332

Query  487  LRRRHAEKVSESYAEKWKEHLRNA---------------GQGRSGWRRPFITHFTGCQPC  353
            LRRRHAE+          EHLR A               G G+SGWRRPF+THFTGC PC
Sbjct  333  LRRRHAER----------EHLRYAAARNAAVRAVVPGPDGGGQSGWRRPFVTHFTGCNPC  382

Query  352  SGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
             G  N +Y+ E C D M +AL FAD+QVLR YGF H   L+  SV  LP+D+P
Sbjct  383  GGKRNSIYTREICEDGMRRALGFADDQVLRAYGFRHAAPLND-SVRALPFDYP  434



>ref|XP_009406736.1| PREDICTED: galactomannan galactosyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 108/174 (62%), Gaps = 11/174 (6%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
             + K+   +DDQS L++L+ KEQ +W +K+++ES Y   GYW  IVG+L+++   Y  +E
Sbjct  308  IRGKLTSFADDQSALVHLLAKEQRRWRDKVHLESAYDLHGYWEPIVGRLEDVAAAYAEME  367

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHL------RNAGQGRSGW---RRPFITHFTGCQP  356
            +  A   LRRRHAEK + SY E    +L               W   RR F+THFTGCQP
Sbjct  368  RRDA--VLRRRHAEKEAGSYGETRSRYLDAAAGGGGEKGSGKRWPRKRRSFVTHFTGCQP  425

Query  355  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            C GDHN  Y+ + C D M +ALNFAD+QVLR YGF H +L D+AS+  LP+ +P
Sbjct  426  CGGDHNPAYTWQGCVDGMARALNFADDQVLRAYGFGHTNLNDSASIRSLPFGYP  479



>ref|XP_008679454.1| PREDICTED: galactomannan galactosyltransferase 1-like [Zea mays]
 gb|AFW64906.1| hypothetical protein ZEAMMB73_279475 [Zea mays]
Length=458

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 101/160 (63%), Gaps = 8/160 (5%)
 Frame = -3

Query  658  DQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLRR  479
            DQS L+YL+L   E+ G K +VE++Y+F+GYW E+V +LD +   Y  +E+ + G  LRR
Sbjct  295  DQSALVYLLLNNWERPGKKTFVETEYFFQGYWKEVVDRLDGVAARYEAVERRSPG--LRR  352

Query  478  RHAEKVSESYAEKWKEHLRNAGQGRS-----GWRRPFITHFTGCQPCSGDHNEMYSGETC  314
            RHAE+    YA      LR    G +     GWRRP ITHF GCQPCSG  N MYS E+C
Sbjct  353  RHAEQEHLRYAGARNAALRGVVPGPAGGGEVGWRRPLITHFVGCQPCSGGRNPMYSRESC  412

Query  313  ADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
             D M  AL FAD+QVLR YGF H   L+  SV  LP+D+P
Sbjct  413  DDGMRHALGFADDQVLRAYGFRHAAPLND-SVRGLPFDYP  451



>ref|XP_004980587.1| PREDICTED: galactomannan galactosyltransferase 1-like [Setaria 
italica]
Length=447

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 101/166 (61%), Gaps = 18/166 (11%)
 Frame = -3

Query  661  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  482
            DDQS L+YL+L   E+ G K ++E+DY+   YW+++V +LD +T  Y  +E+      LR
Sbjct  286  DDQSALVYLLLYNWERLGKKAFIETDYFLMAYWLDVVDRLDGVTARYEAVERRMPW--LR  343

Query  481  RRHAEKVSESYAEKWKEHLRNAGQGR----------SGWRRPFITHFTGCQPCSGDHNEM  332
            RRHAE+    YA       RNA               GWRRP ITHF GCQPC+G+ N M
Sbjct  344  RRHAEREHMRYAAA-----RNAAVSGAVPGPAGGGYKGWRRPLITHFVGCQPCNGERNPM  398

Query  331  YSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            YS E+C D M +AL FAD+QVLR YGF H   L+  SV PLP+D+P
Sbjct  399  YSRESCDDGMRRALGFADDQVLRAYGFRHAAPLND-SVRPLPFDYP  443



>ref|XP_004980588.1| PREDICTED: galactomannan galactosyltransferase 1-like, partial 
[Setaria italica]
Length=367

 Score =   151 bits (382),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 102/167 (61%), Gaps = 10/167 (6%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            ESDDQS L+YL+ K   +WGN+  +E+ YYF+GYW EIV +LD +   Y  +E+   G  
Sbjct  198  ESDDQSALVYLLSKHPARWGNRTLLETGYYFQGYWAEIVDRLDGVAKRYEAVERGGRGGS  257

Query  487  LRRR--HAEKVSESYAEKWKEHLRN-------AGQGRSGWRRPFITHFTGCQPCSGDHNE  335
               R  HAE+    YA      +         AG G+ GWRRPF+THFTGCQPC G  + 
Sbjct  258  SGLRRRHAEREHLRYAAARDAAVGRSGTVPGPAGGGQKGWRRPFVTHFTGCQPCGGAPDR  317

Query  334  MYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
             Y+   CA+ + +AL FAD+QVLR YGF H   L + SVVPLP+D+P
Sbjct  318  KYTRRRCAEGIRRALAFADDQVLRAYGFRHAAPL-SDSVVPLPFDYP  363



>dbj|BAJ96459.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=474

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 96/157 (61%), Gaps = 10/157 (6%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
              DK   ESDDQS L YL+LK ++KWG + Y+E DYYF+GYW EIV KLD +   Y    
Sbjct  308  LSDKPDAESDDQSALAYLLLKNRKKWGARTYLEHDYYFQGYWAEIVDKLDGVAARYR-AA  366

Query  508  KTAAGEKLRRRHAE---------KVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQP  356
            +   G  LRRRHAE         + +    +       + G  R+ WRRPF+THFTGC P
Sbjct  367  ERRFGPALRRRHAEGEHALYAAARSAALRKKDGGVPGPDGGGQRASWRRPFVTHFTGCNP  426

Query  355  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMH  245
            C G  NE+YS ETCAD M +ALN AD+QVLR YGF H
Sbjct  427  CGGKPNEIYSNETCADGMRRALNLADDQVLRVYGFRH  463



>ref|XP_010943187.1| PREDICTED: galactomannan galactosyltransferase 1-like [Elaeis 
guineensis]
Length=537

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 111/161 (69%), Gaps = 5/161 (3%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            +SDDQS L++L++K+ ++WGNK+Y+E+ Y   GYW  I+G+LDNIT+ Y   +     ++
Sbjct  374  DSDDQSALVHLLVKDTKRWGNKVYLENSYDLHGYWEAIMGRLDNITERY--KKLEKKEKE  431

Query  487  LRRRHAEKVSESYAEKWKEHLRN---AGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGET  317
            LRRRHAEK + ++ E    HL +    G      RRPF+THFTGCQPC G +N  Y+ E+
Sbjct  432  LRRRHAEKDTVAFGETRLRHLDHEVGVGPQEKKKRRPFVTHFTGCQPCGGGYNPTYTWES  491

Query  316  CADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            C + MH+ALNFAD+QVLR YGF   D+ D +SV  LP+D+P
Sbjct  492  CYEGMHRALNFADDQVLRAYGFGRPDINDISSVQQLPFDYP  532



>ref|XP_008784727.1| PREDICTED: putative glycosyltransferase 7 [Phoenix dactylifera]
Length=436

 Score =   147 bits (371),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 110/179 (61%), Gaps = 25/179 (14%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGI-  512
             K K  PESDDQS L++L++ E+++WG+++Y+E+DY   GYW  ++G+L+  T+ YL + 
Sbjct  258  IKGKAAPESDDQSALLHLLVYEKDRWGDRVYLENDYDLHGYWAAVLGRLEKSTEDYLAME  317

Query  511  ------------EKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFT  368
                        + T A  ++R R+ ++  E+ A++W++  R         R PF+THFT
Sbjct  318  RREPPLRRRHAEKSTGAHGEMRGRYLDR--EAAADEWEQRRR---------RLPFVTHFT  366

Query  367  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  191
            GCQPC G HN  YS E+C  AM +AL+ AD+QVLR YGF   D      V PLPYDFP+
Sbjct  367  GCQPCGGGHNPAYSRESCLAAMQRALDLADDQVLRAYGFRRVDGCG-GHVRPLPYDFPS  424



>gb|EMT11268.1| Putative glycosyltransferase 7 [Aegilops tauschii]
Length=265

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 91/158 (58%), Gaps = 11/158 (7%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
              DK   ESDDQS L YL+LK  +KWG + Y+E +YYF+GYW EIV +LD +        
Sbjct  96   LSDKPDAESDDQSALAYLLLKNPKKWGARTYLEHEYYFQGYWAEIVDRLDGVA-ARYRAA  154

Query  508  KTAAGEKLRRRHAE----------KVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  359
            +   G  LRRRHAE            +              GQ  S WRRPF+THFTGC 
Sbjct  155  ERRFGPALRRRHAEGEHALYAAARNAALRKKAGGVPGPDGGGQKASYWRRPFVTHFTGCN  214

Query  358  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMH  245
            PC G  NE+YS E+CA+ M +ALN AD+QVLR YGF H
Sbjct  215  PCGGRPNEIYSNESCAEGMRRALNLADDQVLRAYGFPH  252



>ref|XP_002450906.1| hypothetical protein SORBIDRAFT_05g020930 [Sorghum bicolor]
 gb|EES09894.1| hypothetical protein SORBIDRAFT_05g020930 [Sorghum bicolor]
Length=443

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 107/171 (63%), Gaps = 14/171 (8%)
 Frame = -3

Query  667  ESDDQSGLIYLILK--EQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAG  494
            ESDDQS L+YL+ +  E+ +W N  ++ES YYF+GYW EIV +LD +   Y  +E+   G
Sbjct  271  ESDDQSALVYLLSRHPERARWSNATFLESGYYFQGYWAEIVDRLDGVAARYEAVERGGVG  330

Query  493  EKLRRRHAEKVSESYAEKWKEHLRNAGQG-----------RSGWRRPFITHFTGCQPCSG  347
              LRRRHAE+    YA   +E +R                + GWRRPF+THFTGCQPC G
Sbjct  331  RGLRRRHAEREHLLYAAARREAVRRRDGSGGGVPGPDGGGQKGWRRPFVTHFTGCQPCGG  390

Query  346  DHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
              N MY+ + CA+ + +AL FAD+QVLR YGF H   L + SV PLP+D+P
Sbjct  391  APNRMYTRKRCAEGIRRALAFADDQVLRAYGFRHAAPL-SDSVAPLPFDYP  440



>ref|XP_010919073.1| PREDICTED: galactomannan galactosyltransferase 1-like [Elaeis 
guineensis]
Length=436

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 105/170 (62%), Gaps = 9/170 (5%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
             K K  P++DDQS L++L++ E+++W +++Y+E+DY   GYW  ++G+L+N T+ YL +E
Sbjct  266  IKGKTTPDADDQSALLHLLVYEKDRWADRVYLENDYDLHGYWAAVMGRLENSTEDYLAME  325

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRR-----PFITHFTGCQPCSGD  344
            +     +  RRHAEK + ++ E     L     G   W R     PF+ HFTGCQPC G 
Sbjct  326  RREPPLR--RRHAEKFTRAHGEMRGRCLDREVAGDE-WERRRRRRPFVAHFTGCQPCGGG  382

Query  343  HNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  194
            HN  Y+ E+C  A+ +AL+ AD+QVLR YGF  R       V PLPYDFP
Sbjct  383  HNPAYTWESCFAAIQRALDLADDQVLRAYGF-GRVNGSGGYVRPLPYDFP  431



>emb|CBI25835.3| unnamed protein product [Vitis vinifera]
Length=267

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -3

Query  457  ESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFAD  278
            ESYAE+ + +L+ AG GR  WRRPFITHFTGCQPCSG HN+MY+GE+C ++M KALNFAD
Sbjct  149  ESYAEQREPYLKKAGNGRYSWRRPFITHFTGCQPCSGKHNQMYAGESCWNSMQKALNFAD  208

Query  277  NQVLRNYGFMHRDLLDTAS  221
            NQVLRN+GF+H DLLD+++
Sbjct  209  NQVLRNFGFVHPDLLDSST  227



>ref|XP_009379786.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009379787.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
Length=466

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 77/144 (53%), Gaps = 37/144 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L +Q+KWGNK+++E+ YY  GYW  +V + + + + Y           
Sbjct  330  EADDQSALIYLLLSQQDKWGNKVFIENSYYLHGYWAGLVDRYEEMMEKY-----------  378

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  379  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLG  412

Query  307  AMHKALNFADNQVLRNYGFMHRDL  236
            +M +A NFADNQ+LR YGF HR L
Sbjct  413  SMERAFNFADNQILRIYGFAHRGL  436



>ref|XP_010907157.1| PREDICTED: putative glycosyltransferase 5 [Elaeis guineensis]
Length=452

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 77/144 (53%), Gaps = 37/144 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L +QE+WGNK+Y+E+ YY  G+W  +V + + + + Y           
Sbjct  316  EADDQSALIYLLLSQQERWGNKVYIENSYYLHGFWAGLVERYEEMMEKY-----------  364

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  365  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVEKCLG  398

Query  307  AMHKALNFADNQVLRNYGFMHRDL  236
            +M +A NFADNQVLR YGF HR L
Sbjct  399  SMERAFNFADNQVLRLYGFGHRGL  422



>ref|XP_001761988.1| predicted protein [Physcomitrella patens]
 gb|EDQ73092.1| predicted protein [Physcomitrella patens]
Length=362

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 80/156 (51%), Gaps = 39/156 (25%)
 Frame = -3

Query  688  FKDKIFP-----ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDM  524
            F  K  P     E+DDQSGL+YL++ ++E+WG+K+Y+ES YYF+GYW  +  K +++   
Sbjct  213  FLSKALPDRGKGEADDQSGLVYLMITDRERWGSKVYLESSYYFQGYWKVLTEKFEDMMAK  272

Query  523  YLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGD  344
            Y                                +    G   W  PF+THF GC+ C G 
Sbjct  273  Y--------------------------------KPGIYGDDRW--PFVTHFCGCEFCCGA  298

Query  343  HNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  236
             N  Y+ + C   M +A+NFADNQVL  YGF+H+ L
Sbjct  299  INPEYTVDRCLTQMERAVNFADNQVLERYGFIHKSL  334



>ref|XP_010678459.1| PREDICTED: putative glycosyltransferase 5 [Beta vulgaris subsp. 
vulgaris]
Length=436

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 78/145 (54%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL++ ++EKW NK+YVE+ YY  G+W+ +V K + + + Y           
Sbjct  295  EADDQSALIYLLISQKEKWMNKVYVENSYYLHGFWLGLVDKYEEMAEKY-----------  343

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  344  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVEKCLK  377

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  378  SMERAFNFADNQVLKLYGFRHRGLL  402



>ref|XP_009385087.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
Length=459

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 77/144 (53%), Gaps = 37/144 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L +Q+KWG+K+Y+E+ YY  GYW  +V +                   
Sbjct  321  EADDQSALIYLLLSQQDKWGDKVYIENSYYLHGYWAGLVDR-------------------  361

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                        Y E  ++H  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  362  ------------YEEMMEKH--HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLS  403

Query  307  AMHKALNFADNQVLRNYGFMHRDL  236
            +M +A NFADNQVLR YGF H  L
Sbjct  404  SMERAFNFADNQVLRMYGFAHGSL  427



>ref|XP_009420521.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
Length=456

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 76/144 (53%), Gaps = 37/144 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L +Q++WG+KIY+E+ YY  GYW  +V + + + D             
Sbjct  318  EADDQSALIYLVLSQQDRWGDKIYIENSYYLHGYWAGLVDRYEEMMD-------------  364

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                             K H    G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  365  -----------------KHH---PGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLS  400

Query  307  AMHKALNFADNQVLRNYGFMHRDL  236
            +M +A NFADNQVLR YGF H  L
Sbjct  401  SMERAFNFADNQVLRMYGFAHGKL  424



>ref|XP_010912249.1| PREDICTED: putative glycosyltransferase 5 [Elaeis guineensis]
Length=451

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 77/144 (53%), Gaps = 37/144 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L +Q++WG+K+Y+E+ Y+  G+W  +V + + + D Y           
Sbjct  314  EADDQSALIYLLLSQQDRWGDKVYIENSYFLHGFWTGLVDRYEEMIDKY-----------  362

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  363  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVEKCLG  396

Query  307  AMHKALNFADNQVLRNYGFMHRDL  236
            +M +A NFADNQVLR YGF HR L
Sbjct  397  SMERAFNFADNQVLRLYGFGHRGL  420



>ref|XP_002990216.1| glycosyltransferase CAZy family GT34-like protein [Selaginella 
moellendorffii]
 ref|XP_002992472.1| glycosyltransferase CAZy family GT34-like protein [Selaginella 
moellendorffii]
 gb|EFJ06410.1| glycosyltransferase CAZy family GT34-like protein [Selaginella 
moellendorffii]
 gb|EFJ08776.1| glycosyltransferase CAZy family GT34-like protein [Selaginella 
moellendorffii]
Length=455

 Score =   105 bits (261),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 77/153 (50%), Gaps = 36/153 (24%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            ESDDQ   IYL+  ++  WG+K+Y+E+ Y+  GYW +IV K                   
Sbjct  329  ESDDQGAFIYLLNADRNTWGSKVYLENSYFLNGYWKDIVDKY------------------  370

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                      E Y E       + G G   W  PF+THFTGCQ CSG  N +Y+ E C  
Sbjct  371  ----------EGYVES-----SHPGFGDDRW--PFVTHFTGCQICSGKINNVYTAEECTA  413

Query  307  AMHKALNFADNQVLRNYGFMHRDLLDTASVVPL  209
             M +AL  ADNQVL +YG+ H  L  TA +VP+
Sbjct  414  QMSRALTLADNQVLHSYGYAHPSLA-TAEIVPV  445



>ref|XP_001765298.1| predicted protein [Physcomitrella patens]
 gb|EDQ70026.1| predicted protein, partial [Physcomitrella patens]
Length=311

 Score =   103 bits (258),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 85/150 (57%), Gaps = 35/150 (23%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQSGL+YL++ ++E+WG+K+++ES YYF+GYW  +  K +++      +EK   G+ 
Sbjct  196  EADDQSGLVYLMVTDRERWGSKVFLESSYYFQGYWKVLTEKFEDM------MEKYQPGK-  248

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                        Y +                R PF+THF GC+ C G  N  Y+ + C  
Sbjct  249  ------------YGDD---------------RWPFVTHFCGCEFCCGAINPEYTVDRCLT  281

Query  307  AMHKALNFADNQVLRNYGFMHRDLLDTASV  218
             M +A+NFADNQV+  YGF+H+ +L +A V
Sbjct  282  QMERAVNFADNQVIGRYGFIHK-MLKSAEV  310



>ref|XP_006399253.1| hypothetical protein EUTSA_v10013509mg [Eutrema salsugineum]
 gb|ESQ40706.1| hypothetical protein EUTSA_v10013509mg [Eutrema salsugineum]
Length=454

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 77/145 (53%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++EKW  K+YVE+ YY  G+W  +V K + + D Y           
Sbjct  312  EADDQSALIYLLLSQKEKWMEKVYVENQYYLHGFWEGLVDKYEEMIDKY-----------  360

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y+ E C  
Sbjct  361  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAVERCLK  394

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVLR YGF HR LL
Sbjct  395  SMERAYNFADNQVLRLYGFGHRGLL  419



>ref|XP_008783986.1| PREDICTED: LOW QUALITY PROTEIN: putative glycosyltransferase 
5 [Phoenix dactylifera]
Length=452

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 77/144 (53%), Gaps = 37/144 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L +Q++WG+++Y+E+ YY  G+W  +V + + + D Y           
Sbjct  315  EADDQSALIYLLLSQQDRWGDRVYIENSYYLHGFWTGLVERYEEMMDKY-----------  363

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  364  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVEKCLG  397

Query  307  AMHKALNFADNQVLRNYGFMHRDL  236
            +M +A NFADNQVLR YGF HR L
Sbjct  398  SMERAFNFADNQVLRLYGFGHRGL  421



>ref|XP_004987031.1| PREDICTED: xyloglucan 6-xylosyltransferase-like [Setaria italica]
Length=437

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 77/148 (52%), Gaps = 34/148 (23%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS L+YL++ ++ +WG K ++ES Y   G+WVEIV       D Y         E+
Sbjct  294  EADDQSALVYLLVTQRGRWGGKTFLESSYSLHGFWVEIV-------DRY---------EE  337

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
            +RRRH      +  E+W                P +THF GC+PC G +   Y    C  
Sbjct  338  MRRRH-RTTPVAGGERW----------------PLVTHFVGCKPCGGQYAS-YDAARCRH  379

Query  307  AMHKALNFADNQVLRNYGFMHRDLLDTA  224
             M +ALNFAD+Q+LR YGF H  L  TA
Sbjct  380  GMERALNFADDQILRLYGFEHESLNTTA  407



>ref|XP_008453679.1| PREDICTED: putative glycosyltransferase 3 [Cucumis melo]
Length=190

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 77/147 (52%), Gaps = 37/147 (25%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++++W +K+++E+ YY  GYW  +V K + + + Y           
Sbjct  46   EADDQSALIYLLLSQKDQWMDKVFLENSYYLHGYWAGLVDKYEEMIEKY-----------  94

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  95   ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLS  128

Query  307  AMHKALNFADNQVLRNYGFMHRDLLDT  227
            +M +A NFADNQVL+ YGF HR LL  
Sbjct  129  SMERAFNFADNQVLKLYGFRHRGLLSP  155



>ref|XP_008788330.1| PREDICTED: putative glycosyltransferase 5 [Phoenix dactylifera]
Length=454

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 77/144 (53%), Gaps = 37/144 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L +Q++WG+K+Y+E+ YY  G+W  +V + + + + Y           
Sbjct  317  EADDQSALIYLLLSQQDRWGDKVYIENSYYLHGFWAGLVERYEEMMEKY-----------  365

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  366  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVEKCLG  399

Query  307  AMHKALNFADNQVLRNYGFMHRDL  236
            +M +A NFADNQVLR YGF HR L
Sbjct  400  SMERAFNFADNQVLRLYGFGHRGL  423



>gb|EMT32015.1| Xyloglucan 6-xylosyltransferase [Aegilops tauschii]
Length=170

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 77/148 (52%), Gaps = 36/148 (24%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS L+YL+  E+ +WG+K+++ES Y+  G+W EIVG+                 E+
Sbjct  26   EADDQSALVYLLATERGRWGDKVFLESSYHLHGFWEEIVGRY----------------EE  69

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
            +R R            W+      G G   W  P +THF GC+PC G+    Y    C +
Sbjct  70   MRSR------------WR-----PGLGDHRW--PLVTHFVGCKPC-GEPGATYEAAACRE  109

Query  307  AMHKALNFADNQVLRNYGFMHRDLLDTA  224
             M +ALNFAD+Q+L  YGF H  L  TA
Sbjct  110  GMERALNFADDQILGLYGFQHESLGTTA  137



>ref|XP_009393375.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393376.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
Length=466

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 77/144 (53%), Gaps = 37/144 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L +Q++WG+KIY+E+ YY  GYW  +V + + + + Y           
Sbjct  328  EADDQSALIYLLLSQQDRWGDKIYIENSYYLHGYWAGLVDRYEEMMEKY-----------  376

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  + C  
Sbjct  377  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVKRCLR  410

Query  307  AMHKALNFADNQVLRNYGFMHRDL  236
            +M +A NFADNQVLR YGF H +L
Sbjct  411  SMERAFNFADNQVLRMYGFAHGNL  434



>ref|XP_011075649.1| PREDICTED: putative glycosyltransferase 5 [Sesamum indicum]
Length=443

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 80/145 (55%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL++  +++W +K+++E+ YY  GYWV +V       D Y           
Sbjct  301  EADDQSALIYLLISRKDEWMDKVFLENSYYLHGYWVGLV-------DRY-----------  342

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                      E Y E++     + G G   W  PF+THF GC+PC G  +  YS E C  
Sbjct  343  ----------EEYIERY-----HPGLGDERW--PFVTHFVGCKPCGGYGD--YSLERCLQ  383

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M KA NFADNQ+L++YGF HR LL
Sbjct  384  SMEKAFNFADNQLLKSYGFSHRGLL  408



>dbj|BAK00169.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=441

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 77/146 (53%), Gaps = 37/146 (25%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LI+L+L E+E+W  K+YVE++YY  G+W  +V K                   
Sbjct  304  EADDQSALIHLLLTEKERWMEKVYVENEYYLHGFWAGLVDK-------------------  344

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                        Y E  ++H  + G G   W  PFITHF GC+PC G + + Y  E C  
Sbjct  345  ------------YEEMMEKH--HPGLGDERW--PFITHFVGCKPC-GSYGD-YPVEQCLT  386

Query  307  AMHKALNFADNQVLRNYGFMHRDLLD  230
             M +A NFADNQVLR YGF HR L +
Sbjct  387  GMERAFNFADNQVLRLYGFRHRSLTN  412



>gb|KHN48702.1| Putative glycosyltransferase 3 [Glycine soja]
Length=251

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 77/145 (53%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++EKW +K+++E+ +Y  GYW  +V + + + + Y           
Sbjct  109  EADDQSALIYLLLSKKEKWMDKVFLENSFYLHGYWAGLVDRYEEMIEKY-----------  157

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  158  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLS  191

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  192  SMERAFNFADNQVLKLYGFRHRGLL  216



>ref|XP_008453680.1| PREDICTED: putative glycosyltransferase 3 [Cucumis melo]
Length=197

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 77/145 (53%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++++W +K+++E+ YY  GYW  +V + + + + Y           
Sbjct  53   EADDQSALIYLLLSQKDQWMDKVFLENSYYLHGYWAGLVDRYEEMIEKY-----------  101

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  102  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLS  135

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  136  SMERAFNFADNQVLKLYGFRHRGLL  160



>ref|NP_001047014.1| Os02g0529600 [Oryza sativa Japonica Group]
 dbj|BAD25434.1| putative galactomannan galactosyltransferase [Oryza sativa Japonica 
Group]
 dbj|BAF08928.1| Os02g0529600 [Oryza sativa Japonica Group]
 dbj|BAG94866.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73308.1| hypothetical protein OsI_07488 [Oryza sativa Indica Group]
 gb|EEE57116.1| hypothetical protein OsJ_06989 [Oryza sativa Japonica Group]
Length=480

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 76/144 (53%), Gaps = 37/144 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++EKW NK+++E+ YY  G+W  +V                     
Sbjct  342  EADDQSALIYLLLSQKEKWMNKVFIENSYYLHGFWAGLV---------------------  380

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                          +K++E + N   G    R PF+THF GC+PC G + + Y  E C  
Sbjct  381  --------------DKYEEMMENHHPGLGDERWPFVTHFVGCKPC-GSYGD-YPVERCLR  424

Query  307  AMHKALNFADNQVLRNYGFMHRDL  236
            +M +A NFADNQVLR YGF H+ L
Sbjct  425  SMERAFNFADNQVLRLYGFAHKGL  448



>gb|KFK25153.1| hypothetical protein AALP_AA8G072800 [Arabis alpina]
Length=454

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 77/145 (53%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++EKW  K+YVE+ YY  G+W  +V K + + + Y           
Sbjct  315  EADDQSALIYLLLSQKEKWMEKVYVENQYYLHGFWEGLVDKYEEMIEKY-----------  363

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PFITHF GC+PC G + + Y+ E C  
Sbjct  364  ----------------------HPGLGDERW--PFITHFVGCKPC-GSYAD-YAVERCLK  397

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  398  SMERAFNFADNQVLKLYGFGHRGLL  422



>ref|XP_010943718.1| PREDICTED: putative glycosyltransferase 5 [Elaeis guineensis]
Length=453

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 77/144 (53%), Gaps = 37/144 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL++ +Q++W +K+Y+E+ Y+  G+WV +V K + + D             
Sbjct  316  EADDQSALIYLLISQQDRWSDKVYIENSYFLHGFWVGLVDKYEEMMD-------------  362

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                             K H    G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  363  -----------------KHH---PGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLG  398

Query  307  AMHKALNFADNQVLRNYGFMHRDL  236
            +M +A NFADNQVLR YGF HR L
Sbjct  399  SMERAFNFADNQVLRLYGFGHRGL  422



>gb|KEH31956.1| xyloglucan xylosyltransferase [Medicago truncatula]
Length=448

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 77/145 (53%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++EKW +K+++E+ YY  GYW  +V + + + + Y           
Sbjct  306  EADDQSALIYLLLSKKEKWMDKVFLENSYYLHGYWAGLVDRYEEMIEKY-----------  354

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  355  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLS  388

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  389  SMERAFNFADNQVLKLYGFRHRGLL  413



>gb|EMT32465.1| Putative glycosyltransferase 3 [Aegilops tauschii]
Length=445

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 76/146 (52%), Gaps = 37/146 (25%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LI+L+L E+E+W  K+YVE+ YY  G+W  +V K                   
Sbjct  308  EADDQSALIHLLLTEKERWMEKVYVENQYYLHGFWAGLVDK-------------------  348

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                        Y E  ++H  + G G   W  PFITHF GC+PC G + + Y  E C  
Sbjct  349  ------------YEEMMEKH--HPGLGDERW--PFITHFVGCKPC-GSYGD-YPVEQCLT  390

Query  307  AMHKALNFADNQVLRNYGFMHRDLLD  230
             M +A NFADNQVLR YGF HR L +
Sbjct  391  GMERAFNFADNQVLRLYGFRHRSLTN  416



>gb|ACN27080.1| unknown [Zea mays]
Length=228

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 76/144 (53%), Gaps = 37/144 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L +++KW +K+++E+ YY  G+W  +V                     
Sbjct  90   EADDQSALIYLLLSQKDKWMDKVFIENSYYLHGFWAGLV---------------------  128

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                          +K++E + N   G    R PF+THF GC+PC G + + Y  E C  
Sbjct  129  --------------DKYEEMMENHHPGLGDERWPFVTHFVGCKPC-GSYGD-YPVERCLR  172

Query  307  AMHKALNFADNQVLRNYGFMHRDL  236
            +M +A NFADNQVLR YGF H+ L
Sbjct  173  SMERAFNFADNQVLRLYGFSHKGL  196



>ref|XP_006494985.1| PREDICTED: putative glycosyltransferase 3-like [Citrus sinensis]
Length=458

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 79/145 (54%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L +++KW +K+++ES++Y  GYWV +V + + + + Y           
Sbjct  318  EADDQSALIYLLLTQKDKWIDKVFIESEFYLHGYWVGLVDRYEEMMEKY-----------  366

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  367  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLK  400

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQV++ YGF HR LL
Sbjct  401  SMERAFNFADNQVIKLYGFGHRGLL  425



>ref|XP_001767750.1| predicted protein [Physcomitrella patens]
 gb|EDQ67501.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 76/144 (53%), Gaps = 33/144 (23%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS L+YL+   +EKWG+K+++E  Y   GYWV +V +L+ +  M LG      GEK
Sbjct  271  EADDQSALVYLLAMNKEKWGSKVFLEHSYCLHGYWVMLVERLEEL--MELG---PRGGEK  325

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                        + +R PF+THF GC+PC  D    Y+ + C  
Sbjct  326  ----------------------------NSFRWPFVTHFVGCKPCGRDGTSHYATDRCLK  357

Query  307  AMHKALNFADNQVLRNYGFMHRDL  236
             M +A NFADNQ+L +YGF H+ L
Sbjct  358  HMERAFNFADNQILEHYGFHHQTL  381



>ref|XP_006440652.1| hypothetical protein CICLE_v10020086mg [Citrus clementina]
 gb|ESR53892.1| hypothetical protein CICLE_v10020086mg [Citrus clementina]
 gb|KDO55481.1| hypothetical protein CISIN_1g012705mg [Citrus sinensis]
Length=458

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 79/145 (54%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L +++KW +K+++ES++Y  GYWV +V + + + + Y           
Sbjct  318  EADDQSALIYLLLTQKDKWIDKVFIESEFYLHGYWVGLVDRYEEMMEKY-----------  366

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  367  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLK  400

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQV++ YGF HR LL
Sbjct  401  SMERAFNFADNQVIKLYGFGHRGLL  425



>ref|XP_011047184.1| PREDICTED: putative glycosyltransferase 5 [Populus euphratica]
Length=453

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 82/162 (51%), Gaps = 44/162 (27%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++++W +K+Y+E+ YY  GYW  +V + + + + Y           
Sbjct  311  EADDQSALIYLLLSQKDQWMDKVYIENQYYLHGYWAGLVDRYEEMMEKY-----------  359

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  360  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVEQCMR  393

Query  307  AMHKALNFADNQVLRNYGFMHRDLLDTA-------SVVPLPY  203
            +M +A NFADNQVL+ YGF HR LL          +V PL Y
Sbjct  394  SMERAFNFADNQVLKLYGFGHRGLLSPKIKRIRNETVTPLEY  435



>dbj|BAK03947.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=478

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 76/144 (53%), Gaps = 37/144 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++EKW +K+Y+E+ YY  G+W  +V                     
Sbjct  340  EADDQSALIYLLLSQKEKWMDKVYIENSYYLHGFWAGLV---------------------  378

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                          +K++E + N   G    R PF+THF GC+PC G + + Y  + C  
Sbjct  379  --------------DKYEEMMENHHPGLGDERWPFVTHFVGCKPC-GSYGD-YPVDRCLK  422

Query  307  AMHKALNFADNQVLRNYGFMHRDL  236
            +M +A NFADNQVLR YGF H+ L
Sbjct  423  SMERAFNFADNQVLRLYGFAHKGL  446



>gb|AFK30382.1| galactosyltransferase A [Triticum aestivum]
Length=478

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 76/144 (53%), Gaps = 37/144 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++EKW +K+Y+E+ YY  G+W  +V                     
Sbjct  340  EADDQSALIYLLLSQKEKWMDKVYIENSYYLHGFWAGLV---------------------  378

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                          +K++E + N   G    R PF+THF GC+PC G + + Y  + C  
Sbjct  379  --------------DKYEEMMENHHPGLGDERWPFVTHFVGCKPC-GSYGD-YPVDRCLK  422

Query  307  AMHKALNFADNQVLRNYGFMHRDL  236
            +M +A NFADNQVLR YGF H+ L
Sbjct  423  SMERAFNFADNQVLRLYGFAHKGL  446



>ref|XP_002514720.1| Xyloglucan 6-xylosyltransferase, putative [Ricinus communis]
 gb|EEF47826.1| Xyloglucan 6-xylosyltransferase, putative [Ricinus communis]
Length=454

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 82/162 (51%), Gaps = 44/162 (27%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++++W +K+Y+E+ YY  GYW  +V + + + + Y           
Sbjct  315  EADDQSALIYLLLSQKDQWMDKVYIENQYYLHGYWAGLVDRYEEMMEKY-----------  363

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  364  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLK  397

Query  307  AMHKALNFADNQVLRNYGFMHRDLLD-------TASVVPLPY  203
            +M +A NFADNQVL+ YGF HR LL          +V PL Y
Sbjct  398  SMERAFNFADNQVLKLYGFGHRGLLSPKIKRIRNETVTPLEY  439



>ref|XP_004508717.1| PREDICTED: putative glycosyltransferase 5-like [Cicer arietinum]
Length=446

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 81/162 (50%), Gaps = 44/162 (27%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++EKW  K+++E+ YY  GYW  +V + + + + Y           
Sbjct  304  EADDQSALIYLLLSKKEKWMGKVFLENSYYLHGYWAGLVDRYEEMIEKY-----------  352

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  353  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLS  386

Query  307  AMHKALNFADNQVLRNYGFMHRDLLDTA-------SVVPLPY  203
            +M +A NFADNQVL+ YGF HR LL          +V PL +
Sbjct  387  SMERAFNFADNQVLKLYGFRHRGLLSPKIKRIRNETVTPLEF  428



>ref|XP_008239899.1| PREDICTED: putative glycosyltransferase 5 [Prunus mume]
 ref|XP_008239903.1| PREDICTED: putative glycosyltransferase 5 [Prunus mume]
Length=459

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 77/145 (53%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++++W +K+YVE+ YY  GYW  +V + + + + Y           
Sbjct  316  EADDQSALIYLLLSQKDQWMDKVYVENSYYLHGYWAGLVDRYEEMIEKY-----------  364

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  365  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLG  398

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  399  SMERAFNFADNQVLKLYGFRHRGLL  423



>ref|XP_009338860.1| PREDICTED: putative glycosyltransferase 5 [Pyrus x bretschneideri]
Length=460

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 76/145 (52%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++++W  K+YVE+ YY  GYW  +V + + + + Y           
Sbjct  317  EADDQSALIYLLLSQKDQWMEKVYVENSYYLHGYWAGLVDRYEEMIEKY-----------  365

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  366  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLS  399

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  400  SMERAFNFADNQVLKLYGFRHRGLL  424



>ref|XP_007209124.1| hypothetical protein PRUPE_ppa005479mg [Prunus persica]
 gb|EMJ10323.1| hypothetical protein PRUPE_ppa005479mg [Prunus persica]
Length=459

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 76/145 (52%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++++W  K+YVE+ YY  GYW  +V + + + + Y           
Sbjct  316  EADDQSALIYLLLSQKDQWMEKVYVENSYYLHGYWAGLVDRYEEMIEKY-----------  364

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  365  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLS  398

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  399  SMERAFNFADNQVLKLYGFRHRGLL  423



>ref|XP_009339134.1| PREDICTED: putative glycosyltransferase 5 [Pyrus x bretschneideri]
Length=460

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 76/145 (52%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++++W  K+YVE+ YY  GYW  +V + + + + Y           
Sbjct  317  EADDQSALIYLLLSQKDQWMEKVYVENSYYLHGYWAGLVDRYEEMIEKY-----------  365

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  366  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLS  399

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  400  SMERAFNFADNQVLKLYGFRHRGLL  424



>ref|XP_010258549.1| PREDICTED: putative glycosyltransferase 5 isoform X2 [Nelumbo 
nucifera]
Length=457

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 77/145 (53%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL++ ++E+W NK+++E+ YY  GYW  +V + + + + Y           
Sbjct  313  EADDQSALIYLLMSKKEEWMNKVFIENSYYLHGYWAGLVDRYEEMIEKY-----------  361

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  362  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLK  395

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  396  SMERAFNFADNQVLKLYGFRHRGLL  420



>ref|XP_010498276.1| PREDICTED: putative glycosyltransferase 5 [Camelina sativa]
Length=456

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 79/147 (54%), Gaps = 37/147 (25%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIY++L +++KW +K+YVE+ YY  G+W  +V K + + + Y           
Sbjct  317  EADDQSALIYILLSQKDKWIDKVYVENQYYLHGFWEGLVDKYEEMVEKY-----------  365

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y+ + C  
Sbjct  366  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAVDRCFK  399

Query  307  AMHKALNFADNQVLRNYGFMHRDLLDT  227
            +M +A NFADNQVL+ YGF HR LL T
Sbjct  400  SMERAFNFADNQVLKLYGFSHRGLLST  426



>ref|XP_010258542.1| PREDICTED: putative glycosyltransferase 5 isoform X1 [Nelumbo 
nucifera]
Length=461

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 77/147 (52%), Gaps = 37/147 (25%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL++ ++E+W NK+++E+ YY  GYW  +V + + + + Y           
Sbjct  313  EADDQSALIYLLMSKKEEWMNKVFIENSYYLHGYWAGLVDRYEEMIEKY-----------  361

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  362  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLK  395

Query  307  AMHKALNFADNQVLRNYGFMHRDLLDT  227
            +M +A NFADNQVL+ YGF HR LL  
Sbjct  396  SMERAFNFADNQVLKLYGFRHRGLLSP  422



>ref|XP_008374566.1| PREDICTED: putative glycosyltransferase 5 [Malus domestica]
Length=458

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 76/145 (52%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++++W  K+YVE+ YY  GYW  +V + + + + Y           
Sbjct  315  EADDQSALIYLLLSQKDQWMEKVYVENSYYLHGYWAGLVDRYEEMIEKY-----------  363

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  364  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLS  397

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  398  SMERAFNFADNQVLKLYGFRHRGLL  422



>ref|XP_006647332.1| PREDICTED: putative glycosyltransferase 5-like [Oryza brachyantha]
Length=481

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 76/144 (53%), Gaps = 37/144 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++EKW +K+++E+ YY  G+W  +V                     
Sbjct  343  EADDQSALIYLLLSQKEKWMDKVFIENSYYLHGFWAGLV---------------------  381

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                          +K++E + N   G    R PF+THF GC+PC G + + Y  E C  
Sbjct  382  --------------DKYEEMMENHHPGLGDERWPFVTHFVGCKPC-GSYGD-YPVERCLK  425

Query  307  AMHKALNFADNQVLRNYGFMHRDL  236
            +M +A NFADNQVLR YGF H+ L
Sbjct  426  SMERAFNFADNQVLRLYGFAHKGL  449



>ref|XP_010683109.1| PREDICTED: putative glycosyltransferase 5 [Beta vulgaris subsp. 
vulgaris]
Length=446

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 76/145 (52%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL++ ++E W NK++VE+ YY  G+W  +V K + + + Y           
Sbjct  309  EADDQSALIYLLISQKEVWMNKVFVENSYYLHGFWTGLVDKYEEMLEKY-----------  357

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  358  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YPVEKCLK  391

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  392  SMERAFNFADNQVLKLYGFRHRGLL  416



>gb|AHC98117.1| putative xyloglucan alpha-1,6-xylosyltransferase [Pinus radiata]
 tpg|DAA64592.1| TPA_inf: xyloglucan alpha-1,6-xylosyltransferase [Pinus taeda]
Length=449

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 81/150 (54%), Gaps = 38/150 (25%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL++ +++ WG+K+++ES Y+  G+WV +V K +++   Y           
Sbjct  308  EADDQSALIYLLISQKKLWGDKVFLESSYFLHGFWVVVVDKYEDMIRTY-----------  356

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  357  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLK  390

Query  307  AMHKALNFADNQVLRNYGFMHRDLLDTASV  218
            +M +A NFADNQ+L+ YGF H+  L+TA V
Sbjct  391  SMERAFNFADNQILQIYGFKHKS-LNTAKV  419



>ref|XP_006374450.1| hypothetical protein POPTR_0015s07290g [Populus trichocarpa]
 gb|ERP52247.1| hypothetical protein POPTR_0015s07290g [Populus trichocarpa]
Length=453

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 81/162 (50%), Gaps = 44/162 (27%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++ +W +K+Y+E+ YY  GYW  +V + + + + Y           
Sbjct  311  EADDQSALIYLLLSQKAQWMDKVYIENQYYLHGYWAGLVDRYEEMMEKY-----------  359

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  360  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVEQCMR  393

Query  307  AMHKALNFADNQVLRNYGFMHRDLLD-------TASVVPLPY  203
            +M +A NFADNQVL+ YGF HR LL          +V PL Y
Sbjct  394  SMERAFNFADNQVLKLYGFGHRGLLSPKIKRIRNETVTPLEY  435



>emb|CDX85826.1| BnaC06g23080D [Brassica napus]
 emb|CDX68187.1| BnaA07g22270D [Brassica napus]
Length=223

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 81/162 (50%), Gaps = 44/162 (27%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L +++ W  K++VE+ YY  G+W  +V K + + + Y           
Sbjct  81   EADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLVDKYEEMMEKY-----------  129

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y+ E C  
Sbjct  130  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAVERCLK  163

Query  307  AMHKALNFADNQVLRNYGFMHRDLLDTA-------SVVPLPY  203
            +M +A NFADNQVL+ YGF HR LL          +V PL +
Sbjct  164  SMERAFNFADNQVLKLYGFGHRGLLSPKIKRIRNETVTPLEF  205



>ref|XP_010030248.1| PREDICTED: putative glycosyltransferase 5 [Eucalyptus grandis]
 gb|KCW83656.1| hypothetical protein EUGRSUZ_B00540 [Eucalyptus grandis]
Length=449

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 78/145 (54%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL++ +++KW +K++VE+ YY  GYW+ +V + + + + Y           
Sbjct  309  EADDQSALIYLLISQKDKWMDKVFVENSYYLHGYWLGLVERYEEMIEKY-----------  357

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  358  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVEKCLG  391

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  392  SMERAFNFADNQVLKLYGFRHRGLL  416



>gb|KJB50959.1| hypothetical protein B456_008G195000 [Gossypium raimondii]
Length=460

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 78/145 (54%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++++W +K+++E+ YY  GYW  +V + + + + Y           
Sbjct  318  EADDQSALIYLLLSQKDQWMDKVFIENQYYLHGYWAGLVDRYEEMMEKY-----------  366

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + YS E C  
Sbjct  367  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YSVERCLR  400

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  401  SMQRAFNFADNQVLKLYGFRHRGLL  425



>ref|XP_010230173.1| PREDICTED: xyloglucan 6-xylosyltransferase 1-like [Brachypodium 
distachyon]
Length=436

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 77/148 (52%), Gaps = 36/148 (24%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS ++YL++ E+ KWG+K+++ES Y   G+WV IV K                 E+
Sbjct  292  EADDQSAIVYLLVTERAKWGDKVFLESSYLLHGFWVSIVDKY----------------EE  335

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
            +R +    + +   E+W                P +THF GC+PCSG+    Y    C  
Sbjct  336  MRSKGRPGLGD---ERW----------------PLVTHFVGCKPCSGE-GATYEAARCRR  375

Query  307  AMHKALNFADNQVLRNYGFMHRDLLDTA  224
             M +ALNFAD+Q+L+ YGF H  L  TA
Sbjct  376  GMERALNFADDQILKLYGFQHESLNTTA  403



>ref|XP_004952632.1| PREDICTED: putative glycosyltransferase 5-like [Setaria italica]
Length=475

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 76/144 (53%), Gaps = 37/144 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++EKW +K+++E+ YY  G+W  +V                     
Sbjct  337  EADDQSALIYLLLSQKEKWMDKVFIENSYYLHGFWAGLV---------------------  375

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                          +K++E + N   G    R PF+THF GC+PC G + + Y  E C  
Sbjct  376  --------------DKYEEMMENHHPGLGDERWPFVTHFVGCKPC-GSYGD-YPVERCLK  419

Query  307  AMHKALNFADNQVLRNYGFMHRDL  236
            +M +A NFADNQVLR YGF H+ L
Sbjct  420  SMERAFNFADNQVLRLYGFSHKGL  443



>ref|XP_010238722.1| PREDICTED: putative glycosyltransferase 5 [Brachypodium distachyon]
Length=458

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 82/156 (53%), Gaps = 38/156 (24%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LI+L+L ++++W +K+YVE  +Y  G+W  +V                     
Sbjct  322  EADDQSALIHLLLADKQRWMDKVYVEDKFYLHGFWAGLV---------------------  360

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                      + Y E  ++H  + G G   W  PF+THF GC+PC G + + Y  + C  
Sbjct  361  ----------DRYEEMMEKH--HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPKDVCLA  404

Query  307  AMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYD  200
            AM +A NFADNQVLR YGF HR L  +  V P+P +
Sbjct  405  AMERAFNFADNQVLRIYGFRHRSLA-SPKVKPVPVN  439



>gb|KDP31286.1| hypothetical protein JCGZ_11662 [Jatropha curcas]
Length=422

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 77/145 (53%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++++W +K+Y+E+ YY  GYW  +V + + + + Y           
Sbjct  280  EADDQSALIYLLLSQKDQWMDKVYIENQYYLHGYWAGLVDRYEEMIEKY-----------  328

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  329  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVEQCLR  362

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  363  SMERAFNFADNQVLKLYGFGHRGLL  387



>gb|KHN18571.1| Putative glycosyltransferase 3 [Glycine soja]
Length=249

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 76/145 (52%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++EKW ++ ++E+ +Y  GYW  +V + + + + Y           
Sbjct  107  EADDQSALIYLLLSKKEKWMDRTFLENSFYLHGYWAGLVDRYEEMIEKY-----------  155

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  156  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLS  189

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  190  SMERAFNFADNQVLKLYGFRHRGLL  214



>ref|XP_003524717.1| PREDICTED: putative glycosyltransferase 5-like [Glycine max]
Length=447

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 77/145 (53%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++EKW +K+++E+ +Y  GYW  +V + + + + Y           
Sbjct  305  EADDQSALIYLLLSKKEKWMDKVFLENSFYLHGYWAGLVDRYEEMIEKY-----------  353

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  354  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLS  387

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  388  SMERAFNFADNQVLKLYGFRHRGLL  412



>ref|XP_008393187.1| PREDICTED: putative glycosyltransferase 5 [Malus domestica]
Length=460

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 75/145 (52%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L +++ W  K+YVE+ YY  GYW  +V + + + + Y           
Sbjct  317  EADDQSALIYLLLSQKDXWMEKVYVENSYYLHGYWAGLVDRYEEMIEKY-----------  365

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  366  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLS  399

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  400  SMERAFNFADNQVLKLYGFRHRGLL  424



>ref|XP_006838788.1| hypothetical protein AMTR_s00002p00259350 [Amborella trichopoda]
 gb|ERN01357.1| hypothetical protein AMTR_s00002p00259350 [Amborella trichopoda]
Length=439

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 76/150 (51%), Gaps = 41/150 (27%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS ++YL++ ++EKWG+K+Y+ES YY  GYW  +V                     
Sbjct  297  EADDQSAMVYLLITQREKWGDKVYLESAYYLHGYWGILV---------------------  335

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS--GDHNEMYSGETC  314
                          ++++E + N   G    R P +THF GC+PC   GD    YS E C
Sbjct  336  --------------DRYEEMIENYHPGLGDHRWPLVTHFVGCKPCGKFGD----YSVEKC  377

Query  313  ADAMHKALNFADNQVLRNYGFMHRDLLDTA  224
               M +A NF DNQ+L+ YGFMH+ L   A
Sbjct  378  LKQMDRAFNFGDNQILQMYGFMHKSLSSRA  407



>ref|XP_010497538.1| PREDICTED: putative glycosyltransferase 5, partial [Camelina 
sativa]
Length=182

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 81/162 (50%), Gaps = 44/162 (27%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L +++ W  K++VE+ YY  G+W  +V + + + + Y           
Sbjct  51   EADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLVDRYEEMVEKY-----------  99

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y+ E C  
Sbjct  100  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAVERCLK  133

Query  307  AMHKALNFADNQVLRNYGFMHRDLLDTA-------SVVPLPY  203
            +M +A NFADNQVL+ YGF HR LL          +V PL +
Sbjct  134  SMERAFNFADNQVLKLYGFGHRGLLSPKIKRIRNETVTPLEF  175



>ref|XP_004500012.1| PREDICTED: putative glycosyltransferase 5-like [Cicer arietinum]
Length=452

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 82/162 (51%), Gaps = 44/162 (27%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L +++KW +K+++E+ YY  GYW  +V + + + + Y           
Sbjct  310  EADDQSALIYLLLSKKDKWMDKVFLENSYYLHGYWAGLVDRYEEMMEKY-----------  358

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  359  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLS  392

Query  307  AMHKALNFADNQVLRNYGFMHRDLLDTA-------SVVPLPY  203
            +M +A NFADNQVL+ YGF HR LL          +V PL +
Sbjct  393  SMERAFNFADNQVLKLYGFRHRGLLSPKIKRIRNETVTPLEF  434



>ref|XP_010477058.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477059.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477061.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477062.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477063.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
Length=456

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 78/145 (54%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L +++KW +K+YVE+ YY  G+W  +V K + + + Y           
Sbjct  317  EADDQSALIYLLLSQKDKWIDKVYVENQYYLHGFWEGLVDKYEEMVEKY-----------  365

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y+ + C  
Sbjct  366  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAVDRCFK  399

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  400  SMERAFNFADNQVLKLYGFSHRGLL  424



>ref|XP_002318600.2| hypothetical protein POPTR_0012s07020g [Populus trichocarpa]
 gb|EEE96820.2| hypothetical protein POPTR_0012s07020g [Populus trichocarpa]
Length=452

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 81/162 (50%), Gaps = 44/162 (27%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++++W +K+Y+E+ YY  GYW  +V + + + + Y           
Sbjct  310  EADDQSALIYLLLSQKDQWMDKVYIENQYYLHGYWAGLVDRYEEMIEKY-----------  358

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  359  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLR  392

Query  307  AMHKALNFADNQVLRNYGFMHRDLLD-------TASVVPLPY  203
            +M +A NFADNQVL  YGF HR LL          +V PL Y
Sbjct  393  SMERAFNFADNQVLNLYGFGHRGLLSPKIKRIRNETVTPLEY  434



>emb|CDX96540.1| BnaA07g31510D [Brassica napus]
 emb|CDX73082.1| BnaC06g35300D [Brassica napus]
Length=222

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 81/162 (50%), Gaps = 44/162 (27%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L +++ W  K++VE+ YY  G+W  +V + + + + Y           
Sbjct  81   EADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLVDRYEEMMEKY-----------  129

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y+ E C  
Sbjct  130  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAVERCLK  163

Query  307  AMHKALNFADNQVLRNYGFMHRDLLDTA-------SVVPLPY  203
            +M +A NFADNQVL+ YGF HR LL          +V PL +
Sbjct  164  SMERAFNFADNQVLKLYGFGHRGLLSPKIKRIRNETVAPLEF  205



>ref|XP_010459505.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010459506.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010459508.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010459509.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
Length=472

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 78/145 (54%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L +++KW +K+YVE+ YY  G+W  +V K + + + Y           
Sbjct  333  EADDQSALIYLLLSQKDKWIDKVYVENQYYLHGFWEGLVDKYEEMVEKY-----------  381

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y+ + C  
Sbjct  382  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAVDRCFK  415

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  416  SMERAFNFADNQVLKLYGFSHRGLL  440



>ref|NP_001049886.1| Os03g0305800 [Oryza sativa Japonica Group]
 gb|ABF95525.1| Glycosyltransferase 5, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11800.1| Os03g0305800 [Oryza sativa Japonica Group]
 gb|EAY89695.1| hypothetical protein OsI_11231 [Oryza sativa Indica Group]
 gb|EAZ26651.1| hypothetical protein OsJ_10555 [Oryza sativa Japonica Group]
 dbj|BAG97093.1| unnamed protein product [Oryza sativa Japonica Group]
Length=483

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 81/150 (54%), Gaps = 36/150 (24%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS L++L++ ++ +WG K+++E+ Y   G+W +IV       D Y         E+
Sbjct  330  EADDQSALVFLLVTQRHRWGAKVFLENSYNLHGFWADIV-------DRY---------EE  373

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
            +RR            +W    R+ G G   W  P ITHF GC+PC GD +  Y GE C  
Sbjct  374  MRR------------QW----RHPGLGDDRW--PLITHFVGCKPCGGD-DASYDGERCRR  414

Query  307  AMHKALNFADNQVLRNYGFMHRDLLDTASV  218
             M +A NFAD+Q+L  YGF H   LDT +V
Sbjct  415  GMDRAFNFADDQILELYGFAHES-LDTMAV  443



>ref|XP_007155288.1| hypothetical protein PHAVU_003G188200g [Phaseolus vulgaris]
 gb|ESW27282.1| hypothetical protein PHAVU_003G188200g [Phaseolus vulgaris]
Length=445

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 77/145 (53%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++EKW +K+++E+ +Y  GYW  +V + + + + Y           
Sbjct  303  EADDQSALIYLLLSKKEKWMDKVFLENSFYLHGYWAGLVDRYEEMIEKY-----------  351

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  352  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLS  385

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  386  SMERAYNFADNQVLKLYGFRHRGLL  410



>gb|EAY82266.1| hypothetical protein OsI_37474 [Oryza sativa Indica Group]
Length=463

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 75/144 (52%), Gaps = 37/144 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LI+++L ++E+W +K+YVE  Y+  G+W  +V K                 E+
Sbjct  326  EADDQSALIHILLTQKERWMDKVYVEDKYFLHGFWAGLVDKY----------------EE  369

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
            +  RH   + +   E+W                PF+THF GC+PC G  +  Y  E C  
Sbjct  370  MMERHHPGLGD---ERW----------------PFVTHFVGCKPCGGYGD--YPRERCLG  408

Query  307  AMHKALNFADNQVLRNYGFMHRDL  236
             M +A NFADNQVLR YGF HR L
Sbjct  409  GMERAFNFADNQVLRLYGFRHRSL  432



>ref|XP_004154960.1| PREDICTED: putative glycosyltransferase 5-like [Cucumis sativus]
Length=460

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 77/145 (53%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++++W +K+++E+ YY  GYW  +V + + + + Y           
Sbjct  316  EADDQSALIYLLLSQKDQWMDKVFLENSYYLHGYWAGLVDRYEEMVEKY-----------  364

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  365  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLS  398

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  399  SMERAFNFADNQVLKLYGFRHRGLL  423



>ref|XP_004138178.1| PREDICTED: putative glycosyltransferase 5-like [Cucumis sativus]
 gb|KGN63689.1| hypothetical protein Csa_1G009930 [Cucumis sativus]
Length=460

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 77/145 (53%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++++W +K+++E+ YY  GYW  +V + + + + Y           
Sbjct  316  EADDQSALIYLLLSQKDQWMDKVFLENSYYLHGYWAGLVDRYEEMVEKY-----------  364

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  365  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLS  398

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  399  SMERAFNFADNQVLKLYGFRHRGLL  423



>ref|XP_004154959.1| PREDICTED: putative glycosyltransferase 3-like [Cucumis sativus]
Length=460

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 77/145 (53%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++++W +K+++E+ YY  GYW  +V + + + + Y           
Sbjct  316  EADDQSALIYLLLSQKDQWMDKVFLENSYYLHGYWAGLVDRYEEMIEKY-----------  364

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  365  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLS  398

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  399  SMERAFNFADNQVLKLYGFRHRGLL  423



>ref|XP_010108713.1| Putative glycosyltransferase 3 [Morus notabilis]
 gb|EXC20024.1| Putative glycosyltransferase 3 [Morus notabilis]
Length=449

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 77/145 (53%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL++ ++++W NK+YVE+ Y+  GYW  +V + + + + Y           
Sbjct  310  EADDQSALIYLLISKKDQWMNKVYVENSYFLHGYWAGLVDRYEEMMEKY-----------  358

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y+ + C  
Sbjct  359  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YAVDRCLK  392

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL  YGF HR LL
Sbjct  393  SMERAFNFADNQVLNLYGFSHRGLL  417



>gb|AFK30383.1| galactosyltransferase B1 [Triticum aestivum]
 gb|AFK30384.1| galactosyltransferase B2 [Triticum aestivum]
 gb|AFK30385.1| galactosyltransferase B3 [Triticum aestivum]
Length=478

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 76/144 (53%), Gaps = 37/144 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LI+L+L ++EKW +K+Y+E+ YY  G+W  +V                     
Sbjct  340  EADDQSALIHLLLSQKEKWMDKVYIENSYYLHGFWAGLV---------------------  378

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                          +K++E + N   G    R PF+THF GC+PC G + + Y  + C  
Sbjct  379  --------------DKYEEMMENHHPGLGDERWPFVTHFVGCKPC-GSYGD-YPVDRCLK  422

Query  307  AMHKALNFADNQVLRNYGFMHRDL  236
            +M +A NFADNQVLR YGF H+ L
Sbjct  423  SMERAFNFADNQVLRLYGFAHKGL  446



>ref|NP_196389.1| xyloglucan 6-xylosyltransferase [Arabidopsis thaliana]
 sp|Q9LF80.1|GT3_ARATH RecName: Full=Putative glycosyltransferase 3; Short=AtGT3 [Arabidopsis 
thaliana]
 emb|CAC01676.1| putative golgi glycosyltransferase [Arabidopsis thaliana]
 dbj|BAB11451.1| alpha galactosyltransferase protein [Arabidopsis thaliana]
 gb|AAQ56808.1| At5g07720 [Arabidopsis thaliana]
 dbj|BAE99734.1| alpha galactosyltransferase protein [Arabidopsis thaliana]
 gb|AED91197.1| xyloglucan 6-xylosyltransferase [Arabidopsis thaliana]
 gb|AHL38639.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=457

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 76/145 (52%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++E W  K++VE+ YY  G+W  +V K + + + Y           
Sbjct  315  EADDQSALIYLLLSQKETWMEKVFVENQYYLHGFWEGLVDKYEEMMEKY-----------  363

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PFITHF GC+PC G + + Y+ E C  
Sbjct  364  ----------------------HPGLGDERW--PFITHFVGCKPC-GSYAD-YAVERCLK  397

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  398  SMERAFNFADNQVLKLYGFGHRGLL  422



>ref|XP_004138179.1| PREDICTED: putative glycosyltransferase 3-like [Cucumis sativus]
 gb|KGN63690.1| hypothetical protein Csa_1G010930 [Cucumis sativus]
Length=460

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 77/145 (53%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++++W +K+++E+ YY  GYW  +V + + + + Y           
Sbjct  316  EADDQSALIYLLLSQKDQWMDKVFLENSYYLHGYWAGLVDRYEEMIEKY-----------  364

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  365  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLS  398

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  399  SMERAFNFADNQVLKLYGFRHRGLL  423



>gb|KJB19373.1| hypothetical protein B456_003G098400 [Gossypium raimondii]
Length=458

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 76/145 (52%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++E W +K+++E+ YY  GYW  +V + + + + Y           
Sbjct  316  EADDQSALIYLLLSQKEMWMDKVFLENQYYLHGYWAGLVDRYEEMMEKY-----------  364

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  365  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLR  398

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  399  SMQRAFNFADNQVLKLYGFRHRGLL  423



>gb|AFW56047.1| hypothetical protein ZEAMMB73_697365 [Zea mays]
Length=1067

 Score =   102 bits (253),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 54/149 (36%), Positives = 74/149 (50%), Gaps = 37/149 (25%)
 Frame = -3

Query  667   ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
             E+DDQS L++L++ E+E+W +++Y+E+ YY  G W  +VGK                 EK
Sbjct  889   EADDQSALVHLLITEKERWMDRVYLENQYYLHGVWTALVGKY----------------EK  932

Query  487   LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHN--EMYSGETC  314
                +H                 + G G   W  PF+T+F GC PC    N  + Y  + C
Sbjct  933   AMEKH-----------------HPGYGDDRW--PFVTNFAGCNPCDDGKNRSDEYPLDRC  973

Query  313   ADAMHKALNFADNQVLRNYGFMHRDLLDT  227
             A  M +A NFADNQVLR YGF H  L  T
Sbjct  974   ASGMERAFNFADNQVLRLYGFRHESLAST  1002



>ref|XP_009149356.1| PREDICTED: putative glycosyltransferase 4 [Brassica rapa]
Length=503

 Score =   100 bits (249),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 76/145 (52%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++EKW  K+YVE+ YY  G+W  +V K + + + Y           
Sbjct  364  EADDQSALIYLLLSQKEKWMEKVYVENQYYLHGFWEGLVDKYEEMIEKY-----------  412

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y+ E C  
Sbjct  413  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAEERCFK  446

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF H  LL
Sbjct  447  SMERAFNFADNQVLKLYGFSHMGLL  471



>ref|XP_001781241.1| predicted protein [Physcomitrella patens]
 gb|EDQ53939.1| predicted protein, partial [Physcomitrella patens]
Length=309

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 75/144 (52%), Gaps = 34/144 (24%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQSG++YL++ ++E+WG+KI++E+ YYF+GYW  +  K + +   Y           
Sbjct  195  EADDQSGIVYLMITDRERWGSKIFLENSYYFQGYWRVLTDKFEEMMAKY-----------  243

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                 +    G   W  PF+THF GC+ C G  N  Y+ + C  
Sbjct  244  ---------------------KPGLYGDDRW--PFVTHFCGCEFCCGSINPEYTRDQCLV  280

Query  307  AMHKALNFADNQVLRNYGFMHRDL  236
             M +A+NFADNQV+  YGF H+ L
Sbjct  281  HMERAINFADNQVIGRYGFRHKSL  304



>ref|XP_002453927.1| hypothetical protein SORBIDRAFT_04g021570 [Sorghum bicolor]
 gb|EES06903.1| hypothetical protein SORBIDRAFT_04g021570 [Sorghum bicolor]
Length=480

 Score =   100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 76/144 (53%), Gaps = 37/144 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L +++KW +K+++E+ YY  G+W  +V                     
Sbjct  342  EADDQSALIYLLLSQKDKWMDKVFIENSYYLHGFWAGLV---------------------  380

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                          +K++E + N   G    R PF+THF GC+PC G + + Y  E C  
Sbjct  381  --------------DKYEEMMENHHPGLGDERWPFVTHFVGCKPC-GSYGD-YPVERCLR  424

Query  307  AMHKALNFADNQVLRNYGFMHRDL  236
            +M +A NFADNQVLR YGF H+ L
Sbjct  425  SMERAFNFADNQVLRLYGFSHKGL  448



>gb|AFW71661.1| putative glycosyltransferase [Zea mays]
Length=478

 Score =   100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 76/144 (53%), Gaps = 37/144 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L +++KW +K+++E+ YY  G+W  +V                     
Sbjct  340  EADDQSALIYLLLSQKDKWMDKVFIENSYYLHGFWAGLV---------------------  378

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                          +K++E + N   G    R PF+THF GC+PC G + + Y  E C  
Sbjct  379  --------------DKYEEMMENHHPGLGDERWPFVTHFVGCKPC-GSYGD-YPVERCLR  422

Query  307  AMHKALNFADNQVLRNYGFMHRDL  236
            +M +A NFADNQVLR YGF H+ L
Sbjct  423  SMERAFNFADNQVLRLYGFSHKGL  446



>ref|NP_001105849.1| putative glycosyltransferase [Zea mays]
 emb|CAJ57382.1| putative glycosyltransferase [Zea mays]
Length=478

 Score =   100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 76/144 (53%), Gaps = 37/144 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L +++KW +K+++E+ YY  G+W  +V                     
Sbjct  340  EADDQSALIYLLLSQKDKWMDKVFIENSYYLHGFWAGLV---------------------  378

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                          +K++E + N   G    R PF+THF GC+PC G + + Y  E C  
Sbjct  379  --------------DKYEEMMENHHPGLGDERWPFVTHFVGCKPC-GSYGD-YPVERCLR  422

Query  307  AMHKALNFADNQVLRNYGFMHRDL  236
            +M +A NFADNQVLR YGF H+ L
Sbjct  423  SMERAFNFADNQVLRLYGFSHKGL  446



>gb|KCW44805.1| hypothetical protein EUGRSUZ_L01630 [Eucalyptus grandis]
Length=169

 Score = 95.9 bits (237),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 74/153 (48%), Gaps = 41/153 (27%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
             KD+   E+DDQS ++YL+  +++KWG K+Y+ES YY  GYW  +V              
Sbjct  19   LKDRPVFEADDQSAMVYLLATQRDKWGEKVYLESAYYLHGYWGILV--------------  64

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS--GDHNE  335
                                 ++++E + N   G    R P +THF GC+PC   GD   
Sbjct  65   ---------------------DRYEEMIENYHPGLGDHRWPLVTHFVGCKPCGKFGD---  100

Query  334  MYSGETCADAMHKALNFADNQVLRNYGFMHRDL  236
             Y  E C   M +A NF DNQ+L+ YGF H+ L
Sbjct  101  -YPVERCLKQMDRAFNFGDNQILQMYGFTHKSL  132



>dbj|BAK06850.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=443

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 75/144 (52%), Gaps = 36/144 (25%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS L+YL++ E+ +WG K+++ES Y+  G+W EIVG+                 E+
Sbjct  298  EADDQSALVYLLVTERGRWGGKVFLESSYHLHGFWEEIVGRY----------------EE  341

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
            +R R            W+      G G   W  P +THF GC+PC G+    Y    C +
Sbjct  342  MRSR------------WRP-----GLGDERW--PLVTHFVGCKPC-GEPGATYDAVACRE  381

Query  307  AMHKALNFADNQVLRNYGFMHRDL  236
             M +ALNFAD+Q+L  YGF H  L
Sbjct  382  GMERALNFADDQILGLYGFQHESL  405



>emb|CBX24469.1| hypothetical_protein [Oryza glaberrima]
Length=443

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 74/144 (51%), Gaps = 37/144 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LI+++L ++E+W  K+YVE  Y+  G+W  +V K                 E+
Sbjct  306  EADDQSALIHILLTQKERWMEKVYVEDKYFLHGFWAGLVDKY----------------EE  349

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
            +  RH   + +   E+W                PF+THF GC+PC G  +  Y  E C  
Sbjct  350  MMERHHPGLGD---ERW----------------PFVTHFVGCKPCGGYGD--YPRERCLG  388

Query  307  AMHKALNFADNQVLRNYGFMHRDL  236
             M +A NFADNQVLR YGF HR L
Sbjct  389  GMERAFNFADNQVLRLYGFRHRSL  412



>dbj|BAD43079.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01601.1| hypothetical protein [Arabidopsis thaliana]
Length=513

 Score =   100 bits (248),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 77/145 (53%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++EKW  K+YVE+ YY  G+W  +V + + + + Y           
Sbjct  374  EADDQSALIYLLLSQKEKWIEKVYVENQYYLHGFWEGLVDRYEEMIEKY-----------  422

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y+ + C  
Sbjct  423  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAVDRCFK  456

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  457  SMERAFNFADNQVLKLYGFSHRGLL  481



>gb|EAY89696.1| hypothetical protein OsI_11232 [Oryza sativa Indica Group]
Length=448

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 75/148 (51%), Gaps = 39/148 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL++ ++++WG+K+++ES Y   G+W       + I D Y           
Sbjct  307  EADDQSALIYLLVTQRQRWGDKVFIESSYDLNGFW-------EGIVDRY-----------  348

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                              E LR AG+    W  PF+THF GC+PC   + + Y  E C  
Sbjct  349  ------------------EELRRAGRDDGRW--PFVTHFVGCKPCR-RYADSYPAERCRR  387

Query  307  AMHKALNFADNQVLRNYGFMHRDLLDTA  224
             M +A NFAD+Q+L+ YGF H  L  TA
Sbjct  388  GMERAFNFADDQILKLYGFAHESLNTTA  415



>ref|NP_001066160.1| Os12g0149300 [Oryza sativa Japonica Group]
 gb|ABA95806.1| Glycosyltransferase 3, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29179.1| Os12g0149300 [Oryza sativa Japonica Group]
 gb|EAZ19653.1| hypothetical protein OsJ_35230 [Oryza sativa Japonica Group]
 dbj|BAG99053.1| unnamed protein product [Oryza sativa Japonica Group]
Length=463

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 74/144 (51%), Gaps = 37/144 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LI+++L ++E+W  K+YVE  Y+  G+W  +V K                 E+
Sbjct  326  EADDQSALIHILLTQKERWMEKVYVEDKYFLHGFWAGLVDKY----------------EE  369

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
            +  RH   + +   E+W                PF+THF GC+PC G  +  Y  E C  
Sbjct  370  MMERHHPGLGD---ERW----------------PFVTHFVGCKPCGGYGD--YPRERCLG  408

Query  307  AMHKALNFADNQVLRNYGFMHRDL  236
             M +A NFADNQVLR YGF HR L
Sbjct  409  GMERAFNFADNQVLRLYGFRHRSL  432



>ref|XP_002465379.1| hypothetical protein SORBIDRAFT_01g037540 [Sorghum bicolor]
 gb|EER92377.1| hypothetical protein SORBIDRAFT_01g037540 [Sorghum bicolor]
Length=446

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 76/149 (51%), Gaps = 34/149 (23%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+ DQS L+YL++ E+ +WG+K ++ES Y   G+WV IV KL                E+
Sbjct  299  EACDQSALVYLLVTERRRWGDKTFLESSYCLSGFWVYIVDKL----------------EE  342

Query  487  LRRRHAEKV-SESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCA  311
            +RRR +     E   E+W                P  THF GC+PC GD +  Y    C 
Sbjct  343  MRRRDSTTTPPEPGHERW----------------PLTTHFMGCKPCGGD-DSTYDAAWCR  385

Query  310  DAMHKALNFADNQVLRNYGFMHRDLLDTA  224
             +M +ALNF D+Q+L  YGF H+ L  TA
Sbjct  386  RSMERALNFGDDQILNLYGFEHKTLNTTA  414



>ref|XP_003549688.1| PREDICTED: putative glycosyltransferase 5-like [Glycine max]
Length=447

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 76/145 (52%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++EKW +K ++E+ +Y  GYW  +V + + + + Y           
Sbjct  305  EADDQSALIYLLLSKKEKWMDKTFLENSFYLHGYWAGLVDRYEEMIEKY-----------  353

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  354  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLS  387

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  388  SMERAFNFADNQVLKLYGFRHRGLL  412



>gb|ADE59448.1| galactosyltransferase [Triticum aestivum]
Length=478

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 75/144 (52%), Gaps = 37/144 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++EKW +K+Y+E+ YY  G+W  +V                     
Sbjct  340  EADDQSALIYLLLSQKEKWMDKVYIENSYYLHGFWAGLV---------------------  378

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                          +K++E + N   G    R PF+THF GC+PC G + + Y  + C  
Sbjct  379  --------------DKYEEMMENHHPGLGDERWPFVTHFVGCKPC-GSYGD-YPVDRCLK  422

Query  307  AMHKALNFADNQVLRNYGFMHRDL  236
            +M +A NFADNQVL  YGF H+ L
Sbjct  423  SMERAFNFADNQVLHLYGFAHKGL  446



>ref|NP_173304.2| putative glycosyltransferase 4 [Arabidopsis thaliana]
 sp|Q9M9U0.1|GT4_ARATH RecName: Full=Putative glycosyltransferase 4; Short=AtGT4 [Arabidopsis 
thaliana]
 gb|AAF27110.1|AC011809_19 Similar to galactosyltransferase [Arabidopsis thaliana]
 gb|AEE29746.1| putative glycosyltransferase 4 [Arabidopsis thaliana]
 gb|AHL38941.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=513

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 77/145 (53%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++EKW  K+YVE+ YY  G+W  +V + + + + Y           
Sbjct  374  EADDQSALIYLLLSQKEKWIEKVYVENQYYLHGFWEGLVDRYEEMIEKY-----------  422

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y+ + C  
Sbjct  423  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYAD-YAVDRCFK  456

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  457  SMERAFNFADNQVLKLYGFSHRGLL  481



>ref|XP_007037433.1| Galactosyl transferase GMA12/MNN10 family protein [Theobroma 
cacao]
 gb|EOY21934.1| Galactosyl transferase GMA12/MNN10 family protein [Theobroma 
cacao]
Length=460

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 77/145 (53%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L ++++W +K+++E+ YY  GYW  +V + + + + Y           
Sbjct  318  EADDQSALIYLLLSQKDQWMDKVFLENQYYLHGYWAGLVDRYEEMIEKY-----------  366

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y  E C  
Sbjct  367  ----------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-YPVERCLR  400

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  401  SMQRAFNFADNQVLKLYGFRHRGLL  425



>gb|ABF95527.1| Glycosyltransferase 3, putative [Oryza sativa Japonica Group]
 gb|EAZ26652.1| hypothetical protein OsJ_10556 [Oryza sativa Japonica Group]
Length=448

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 75/148 (51%), Gaps = 39/148 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL++ ++++WG+K+++ES Y   G+W       + I D Y           
Sbjct  307  EADDQSALIYLLVTQRQRWGDKVFIESSYDLNGFW-------EGIVDKY-----------  348

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                              E LR AG+    W  PF+THF GC+PC   + + Y  E C  
Sbjct  349  ------------------EELRRAGRDDGRW--PFVTHFVGCKPCR-RYADSYPAERCRR  387

Query  307  AMHKALNFADNQVLRNYGFMHRDLLDTA  224
             M +A NFAD+Q+L+ YGF H  L  TA
Sbjct  388  GMERAFNFADDQILKLYGFAHESLNTTA  415



>ref|NP_001173389.1| Os03g0306100 [Oryza sativa Japonica Group]
 dbj|BAH92117.1| Os03g0306100 [Oryza sativa Japonica Group]
Length=449

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 75/148 (51%), Gaps = 39/148 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL++ ++++WG+K+++ES Y   G+W       + I D Y           
Sbjct  308  EADDQSALIYLLVTQRQRWGDKVFIESSYDLNGFW-------EGIVDKY-----------  349

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                              E LR AG+    W  PF+THF GC+PC   + + Y  E C  
Sbjct  350  ------------------EELRRAGRDDGRW--PFVTHFVGCKPCR-RYADSYPAERCRR  388

Query  307  AMHKALNFADNQVLRNYGFMHRDLLDTA  224
             M +A NFAD+Q+L+ YGF H  L  TA
Sbjct  389  GMERAFNFADDQILKLYGFAHESLNTTA  416



>ref|XP_003558113.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Brachypodium 
distachyon]
Length=445

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 76/153 (50%), Gaps = 41/153 (27%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
             KD+   E+DDQS ++Y++  ++EKWGNK+Y+E+ YY  GYW  +V              
Sbjct  296  LKDRPVFEADDQSAMVYILATQREKWGNKVYLENGYYLHGYWGILV--------------  341

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS--GDHNE  335
                                 ++++E L N   G    R P +THF GC+PCS  GD   
Sbjct  342  ---------------------DRYEEMLENYKPGLGDHRWPLVTHFVGCKPCSKFGD---  377

Query  334  MYSGETCADAMHKALNFADNQVLRNYGFMHRDL  236
             Y  E C   M +A NF DNQVL+ YGF H+ L
Sbjct  378  -YPVERCLKQMDRAFNFGDNQVLQMYGFEHKSL  409



>ref|XP_009764347.1| PREDICTED: putative glycosyltransferase 5 [Nicotiana sylvestris]
Length=455

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 77/152 (51%), Gaps = 37/152 (24%)
 Frame = -3

Query  688  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  509
             KD+   E+DDQS LIYL + +++KW  K++VE+ YY  GYW  +V + + + + Y    
Sbjct  310  LKDRPAFEADDQSALIYLFVSQKDKWMQKVFVENSYYLHGYWAGLVDRYEEMIEKY----  365

Query  508  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  329
                                         + G G   W  PF+THF GC+PC G + + Y
Sbjct  366  -----------------------------HPGLGDERW--PFVTHFVGCKPC-GSYGD-Y  392

Query  328  SGETCADAMHKALNFADNQVLRNYGFMHRDLL  233
              E C  +M +A NFADNQVL  YGF H+ LL
Sbjct  393  PVERCLKSMERAFNFADNQVLNLYGFRHKGLL  424



>ref|XP_001759108.1| predicted protein [Physcomitrella patens]
 gb|EDQ76177.1| predicted protein [Physcomitrella patens]
Length=411

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 75/147 (51%), Gaps = 34/147 (23%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS L+YL+   +E+WG+K+++E  Y   GYWV +V + + +  M LG         
Sbjct  271  EADDQSALVYLLATNKERWGSKVFLEHSYCLHGYWVMLVERFEEL--MELGS--------  320

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSG---WRRPFITHFTGCQPCSGDHNEMYSGET  317
                                 R  G   SG   +R PF+THF GC+PC  D    Y+ + 
Sbjct  321  ---------------------RGGGGIDSGTDYYRWPFVTHFVGCKPCGRDGTSHYATDR  359

Query  316  CADAMHKALNFADNQVLRNYGFMHRDL  236
            C   M +A NFADNQ+L +YGF H+ L
Sbjct  360  CLKHMERAFNFADNQILEHYGFQHQTL  386



>ref|XP_006307492.1| hypothetical protein CARUB_v10009116mg [Capsella rubella]
 gb|EOA40390.1| hypothetical protein CARUB_v10009116mg [Capsella rubella]
Length=451

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 78/145 (54%), Gaps = 37/145 (26%)
 Frame = -3

Query  667  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  488
            E+DDQS LIYL+L +++KW +K+YVE+ YY  G+W  +V + + + + Y           
Sbjct  312  EADDQSALIYLLLSQKDKWIDKVYVENQYYLHGFWEGLVDRYEEMIEKY-----------  360

Query  487  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  308
                                  + G G   W  PF+THF GC+PC G + + Y+ + C  
Sbjct  361  ----------------------HPGLGDERW--PFVTHFVGCKPC-GKYAD-YAVDRCFK  394

Query  307  AMHKALNFADNQVLRNYGFMHRDLL  233
            +M +A NFADNQVL+ YGF HR LL
Sbjct  395  SMERAFNFADNQVLKLYGFSHRGLL  419



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520