BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF011N09

Length=678
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009415939.1|  PREDICTED: adenosylhomocysteinase                  232   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP39327.1|  hypothetical protein JCGZ_01084                         231   3e-69   Jatropha curcas
gb|AFV46215.1|  hypothetical protein                                    226   3e-69   Scutellaria baicalensis [Baikal skullcap]
ref|XP_008794647.1|  PREDICTED: adenosylhomocysteinase-like             231   3e-69   Phoenix dactylifera
gb|AFK46472.1|  unknown                                                 225   4e-69   Lotus japonicus
ref|XP_010247578.1|  PREDICTED: adenosylhomocysteinase                  231   5e-69   Nelumbo nucifera [Indian lotus]
gb|KJB72025.1|  hypothetical protein B456_011G154000                    224   5e-69   Gossypium raimondii
ref|XP_010268032.1|  PREDICTED: adenosylhomocysteinase-like             231   6e-69   Nelumbo nucifera [Indian lotus]
ref|XP_010551666.1|  PREDICTED: adenosylhomocysteinase 1-like           230   1e-68   Tarenaya hassleriana [spider flower]
ref|XP_002278000.1|  PREDICTED: adenosylhomocysteinase-like             229   1e-68   Vitis vinifera
ref|XP_009413566.1|  PREDICTED: adenosylhomocysteinase-like             229   2e-68   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG10896.1|  Adenosylhomocysteinase 1 -like protein                  229   2e-68   Gossypium arboreum [tree cotton]
ref|XP_004953493.1|  PREDICTED: adenosylhomocysteinase-like             229   3e-68   Setaria italica
gb|KJB72026.1|  hypothetical protein B456_011G154000                    224   3e-68   Gossypium raimondii
dbj|BAH57232.1|  AT4G13940                                              223   4e-68   Arabidopsis thaliana [mouse-ear cress]
emb|CDP11183.1|  unnamed protein product                                228   4e-68   Coffea canephora [robusta coffee]
ref|XP_003601687.1|  Adenosylhomocysteinase                             228   6e-68   Medicago truncatula
sp|P50246.1|SAHH_MEDSA  RecName: Full=Adenosylhomocysteinase; Sho...    228   6e-68   Medicago sativa [alfalfa]
ref|XP_010527457.1|  PREDICTED: adenosylhomocysteinase 1                228   7e-68   Tarenaya hassleriana [spider flower]
ref|XP_011102056.1|  PREDICTED: adenosylhomocysteinase                  228   8e-68   Sesamum indicum [beniseed]
ref|XP_011083449.1|  PREDICTED: adenosylhomocysteinase-like             228   8e-68   Sesamum indicum [beniseed]
ref|XP_010908558.1|  PREDICTED: adenosylhomocysteinase                  228   8e-68   
gb|EMT11613.1|  Adenosylhomocysteinase                                  222   9e-68   
emb|CAH69227.1|  putative adenosylhomocysteinase                        221   9e-68   Nicotiana glauca [glaucous tobacco]
gb|KJB37873.1|  hypothetical protein B456_006G223900                    227   1e-67   Gossypium raimondii
gb|KJB19538.1|  hypothetical protein B456_003G108500                    226   2e-67   Gossypium raimondii
ref|XP_008222807.1|  PREDICTED: adenosylhomocysteinase isoform X1       226   2e-67   Prunus mume [ume]
ref|XP_007222610.1|  hypothetical protein PRUPE_ppa004934mg             226   2e-67   Prunus persica
gb|KJB72027.1|  hypothetical protein B456_011G154000                    224   2e-67   Gossypium raimondii
ref|XP_007037836.1|  S-adenosyl-L-homocysteine hydrolase                226   3e-67   
ref|XP_008361486.1|  PREDICTED: adenosylhomocysteinase                  226   3e-67   Malus domestica [apple tree]
dbj|BAA03710.1|  cytokinin binding protein CBP57                        225   3e-67   Nicotiana sylvestris
gb|KHN12344.1|  Adenosylhomocysteinase                                  224   4e-67   Glycine soja [wild soybean]
ref|XP_010673385.1|  PREDICTED: adenosylhomocysteinase                  226   4e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009403608.1|  PREDICTED: adenosylhomocysteinase-like             226   4e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004973012.1|  PREDICTED: adenosylhomocysteinase-like             226   4e-67   Setaria italica
ref|XP_008776857.1|  PREDICTED: adenosylhomocysteinase-like             226   5e-67   Phoenix dactylifera
ref|XP_004502244.1|  PREDICTED: adenosylhomocysteinase-like             225   5e-67   Cicer arietinum [garbanzo]
gb|KJB28098.1|  hypothetical protein B456_005G027700                    225   5e-67   Gossypium raimondii
gb|EYU31514.1|  hypothetical protein MIMGU_mgv1a005403mg                225   6e-67   Erythranthe guttata [common monkey flower]
gb|AAA33855.1|  S-adenosylhomocysteine hydrolase                        218   6e-67   Petroselinum crispum
gb|KJB72029.1|  hypothetical protein B456_011G154000                    224   6e-67   Gossypium raimondii
ref|XP_010253338.1|  PREDICTED: adenosylhomocysteinase                  225   7e-67   Nelumbo nucifera [Indian lotus]
gb|KCW59952.1|  hypothetical protein EUGRSUZ_H02678                     224   7e-67   Eucalyptus grandis [rose gum]
gb|ABA93500.1|  Adenosylhomocysteinase, putative, expressed             224   7e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010052042.1|  PREDICTED: adenosylhomocysteinase 1                225   7e-67   Eucalyptus grandis [rose gum]
ref|XP_002870350.1|  hypothetical protein ARALYDRAFT_915516             225   8e-67   Arabidopsis lyrata subsp. lyrata
ref|XP_011102207.1|  PREDICTED: adenosylhomocysteinase-like             225   8e-67   Sesamum indicum [beniseed]
gb|ACJ11250.1|  S-adenosyl-L-homocystein hydrolase                      225   8e-67   Gossypium hirsutum [American cotton]
ref|XP_010913095.1|  PREDICTED: adenosylhomocysteinase-like             225   8e-67   Elaeis guineensis
gb|KJB72024.1|  hypothetical protein B456_011G154000                    225   9e-67   Gossypium raimondii
ref|NP_001031627.1|  adenosylhomocysteinase 1                           221   9e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009373550.1|  PREDICTED: adenosylhomocysteinase                  225   9e-67   Pyrus x bretschneideri [bai li]
ref|XP_009787091.1|  PREDICTED: adenosylhomocysteinase-like             225   9e-67   Nicotiana sylvestris
gb|AAO72664.1|  wheat adenosylhomocysteinase-like protein               225   9e-67   Oryza sativa Japonica Group [Japonica rice]
gb|KHG19993.1|  Adenosylhomocysteinase 1 -like protein                  224   1e-66   Gossypium arboreum [tree cotton]
ref|XP_010023650.1|  PREDICTED: adenosylhomocysteinase                  224   1e-66   Eucalyptus grandis [rose gum]
ref|XP_006283635.1|  hypothetical protein CARUB_v10004693mg             224   1e-66   Capsella rubella
ref|XP_010466741.1|  PREDICTED: adenosylhomocysteinase 2-like iso...    219   1e-66   Camelina sativa [gold-of-pleasure]
gb|EMS57067.1|  Adenosylhomocysteinase                                  223   1e-66   Triticum urartu
gb|KHG17040.1|  Adenosylhomocysteinase                                  224   1e-66   Gossypium arboreum [tree cotton]
gb|KFK28004.1|  hypothetical protein AALP_AA8G459100                    224   2e-66   Arabis alpina [alpine rockcress]
ref|XP_010097949.1|  hypothetical protein L484_026840                   224   2e-66   Morus notabilis
tpg|DAA38860.1|  TPA: hypothetical protein ZEAMMB73_022938              218   2e-66   
ref|XP_010905139.1|  PREDICTED: adenosylhomocysteinase-like             224   2e-66   Elaeis guineensis
ref|NP_001031628.1|  adenosylhomocysteinase 1                           223   2e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003577583.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    224   2e-66   
ref|XP_002522805.1|  adenosylhomocysteinase, putative                   224   2e-66   Ricinus communis
gb|KHN44476.1|  Adenosylhomocysteinase                                  218   2e-66   Glycine soja [wild soybean]
gb|EPS72602.1|  adenosylhomocysteinase                                  226   2e-66   Genlisea aurea
gb|AAV31755.1|  S-adenosyl-L-homocysteine hydrolase                     224   2e-66   Nicotiana tabacum [American tobacco]
ref|XP_003524926.1|  PREDICTED: adenosylhomocysteinase-like             224   2e-66   
ref|XP_004296983.1|  PREDICTED: adenosylhomocysteinase                  224   2e-66   Fragaria vesca subsp. vesca
ref|XP_009349913.1|  PREDICTED: adenosylhomocysteinase-like             224   3e-66   Pyrus x bretschneideri [bai li]
ref|XP_009606591.1|  PREDICTED: adenosylhomocysteinase-like             223   3e-66   Nicotiana tomentosiformis
ref|XP_008380474.1|  PREDICTED: adenosylhomocysteinase                  223   3e-66   Malus domestica [apple tree]
ref|XP_004247887.1|  PREDICTED: adenosylhomocysteinase                  223   3e-66   Solanum lycopersicum
ref|XP_006662925.1|  PREDICTED: adenosylhomocysteinase-like             223   4e-66   Oryza brachyantha
gb|AGT16642.1|  Adenosylhomocysteinase                                  223   4e-66   Saccharum hybrid cultivar R570
gb|AFZ78657.1|  S-adenosyl-L-homocysteine hydrolase                     223   4e-66   Populus tomentosa [Chinese white poplar]
gb|AGX26650.1|  S-adenosyl-l-homocysteine hydrolase A                   223   4e-66   Populus tomentosa [Chinese white poplar]
ref|NP_001148534.1|  adenosylhomocysteinase                             223   5e-66   
ref|XP_003531217.1|  PREDICTED: adenosylhomocysteinase-like             223   5e-66   Glycine max [soybeans]
gb|ACN34730.1|  unknown                                                 223   5e-66   Zea mays [maize]
ref|XP_006360925.1|  PREDICTED: adenosylhomocysteinase-like isofo...    223   5e-66   
ref|XP_002266154.1|  PREDICTED: adenosylhomocysteinase                  223   5e-66   Vitis vinifera
dbj|BAP47516.1|  S-adenosylhomocysteine hydrolase                       223   5e-66   Gentiana triflora
ref|XP_008222808.1|  PREDICTED: adenosylhomocysteinase isoform X2       224   5e-66   
gb|AGX26669.1|  S-adenosyl-l-homocysteine hydrolase A                   223   5e-66   Populus tomentosa [Chinese white poplar]
ref|NP_001067845.2|  Os11g0455500                                       223   5e-66   
gb|KFK36278.1|  hypothetical protein AALP_AA4G101800                    223   5e-66   Arabis alpina [alpine rockcress]
gb|AGX26649.1|  S-adenosyl-l-homocysteine hydrolase A                   223   5e-66   Populus tomentosa [Chinese white poplar]
gb|AGX26654.1|  S-adenosyl-l-homocysteine hydrolase A                   223   5e-66   Populus tomentosa [Chinese white poplar]
gb|AGX26687.1|  S-adenosyl-l-homocysteine hydrolase A                   223   5e-66   Populus tomentosa [Chinese white poplar]
gb|AGX26665.1|  S-adenosyl-l-homocysteine hydrolase A                   223   5e-66   Populus tomentosa [Chinese white poplar]
gb|AGX26663.1|  S-adenosyl-l-homocysteine hydrolase A                   223   5e-66   Populus tomentosa [Chinese white poplar]
gb|AGX26683.1|  S-adenosyl-l-homocysteine hydrolase A                   223   6e-66   Populus tomentosa [Chinese white poplar]
gb|AGX26652.1|  S-adenosyl-l-homocysteine hydrolase A                   223   6e-66   Populus tomentosa [Chinese white poplar]
ref|XP_011012490.1|  PREDICTED: adenosylhomocysteinase-like             223   6e-66   Populus euphratica
gb|AGX26646.1|  S-adenosyl-l-homocysteine hydrolase A                   223   6e-66   Populus tomentosa [Chinese white poplar]
gb|AGW81844.1|  S-(5'-adenosyl)-l-homocysteine hydrolase A              223   6e-66   Populus tomentosa [Chinese white poplar]
gb|AGX26671.1|  S-adenosyl-l-homocysteine hydrolase A                   223   6e-66   Populus tomentosa [Chinese white poplar]
gb|AGX26647.1|  S-adenosyl-l-homocysteine hydrolase A                   223   6e-66   Populus tomentosa [Chinese white poplar]
gb|AGX26662.1|  S-adenosyl-l-homocysteine hydrolase A                   223   6e-66   Populus tomentosa [Chinese white poplar]
gb|AGX26679.1|  S-adenosyl-l-homocysteine hydrolase A                   223   6e-66   Populus tomentosa [Chinese white poplar]
gb|AGX26676.1|  S-adenosyl-l-homocysteine hydrolase A                   223   6e-66   Populus tomentosa [Chinese white poplar]
gb|AGX26677.1|  S-adenosyl-l-homocysteine hydrolase A                   223   6e-66   Populus tomentosa [Chinese white poplar]
ref|XP_010532739.1|  PREDICTED: adenosylhomocysteinase 1                223   6e-66   Tarenaya hassleriana [spider flower]
gb|AGX26674.1|  S-adenosyl-l-homocysteine hydrolase A                   223   6e-66   Populus tomentosa [Chinese white poplar]
ref|XP_006349914.1|  PREDICTED: adenosylhomocysteinase-like             223   7e-66   Solanum tuberosum [potatoes]
ref|XP_004166113.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    223   7e-66   
ref|XP_004133979.1|  PREDICTED: adenosylhomocysteinase-like             222   7e-66   Cucumis sativus [cucumbers]
gb|KJB72028.1|  hypothetical protein B456_011G154000                    223   8e-66   Gossypium raimondii
gb|AAP92453.1|  S-adenosyl-L-homocystein hydrolase                      222   8e-66   Arabidopsis thaliana [mouse-ear cress]
gb|AGX26673.1|  S-adenosyl-l-homocysteine hydrolase A                   222   8e-66   Populus tomentosa [Chinese white poplar]
gb|AGX26689.1|  S-adenosyl-l-homocysteine hydrolase A                   222   9e-66   Populus tomentosa [Chinese white poplar]
ref|XP_007163813.1|  hypothetical protein PHAVU_001G266500g             222   9e-66   Phaseolus vulgaris [French bean]
emb|CCC55421.1|  S-adenosyl-L-homocysteine hydrolase                    222   9e-66   Pinus pinaster [cluster pine]
ref|NP_001265954.1|  adenosylhomocysteinase-like                        222   1e-65   Cicer arietinum [garbanzo]
ref|XP_004252985.1|  PREDICTED: adenosylhomocysteinase-like             222   1e-65   Solanum lycopersicum
ref|NP_193130.1|  adenosylhomocysteinase 1                              222   1e-65   Arabidopsis thaliana [mouse-ear cress]
gb|AFU51537.1|  S-adenosyl-homocysteine hydrolase protein               222   1e-65   Capsicum annuum
ref|XP_002987608.1|  hypothetical protein SELMODRAFT_158886             221   2e-65   Selaginella moellendorffii
gb|AGX26685.1|  S-adenosyl-l-homocysteine hydrolase A                   221   2e-65   Populus tomentosa [Chinese white poplar]
gb|AGX26664.1|  S-adenosyl-l-homocysteine hydrolase A                   221   2e-65   Populus tomentosa [Chinese white poplar]
gb|EMT01272.1|  Adenosylhomocysteinase                                  221   2e-65   
gb|AGX26655.1|  S-adenosyl-l-homocysteine hydrolase A                   221   2e-65   Populus tomentosa [Chinese white poplar]
gb|AGX26681.1|  S-adenosyl-l-homocysteine hydrolase A                   221   2e-65   Populus tomentosa [Chinese white poplar]
ref|XP_008803686.1|  PREDICTED: adenosylhomocysteinase                  221   2e-65   Phoenix dactylifera
emb|CAJ01707.1|  putative S-adenosylhomocystein hydrolase 2             221   2e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGX26667.1|  S-adenosyl-l-homocysteine hydrolase A                   221   2e-65   Populus tomentosa [Chinese white poplar]
emb|CAB09795.1|  S-adenosyl-L-homocysteine hydrolase                    221   3e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006414844.1|  hypothetical protein EUTSA_v10024750mg             223   3e-65   
gb|AAM62888.1|  adenosylhomocysteinase                                  221   3e-65   Arabidopsis thaliana [mouse-ear cress]
gb|AGX26651.1|  S-adenosyl-l-homocysteine hydrolase A                   221   3e-65   Populus tomentosa [Chinese white poplar]
gb|AAV31754.1|  S-adenosyl-L-homocysteine hydrolase                     221   3e-65   Nicotiana tabacum [American tobacco]
gb|AFK08605.1|  S-adenosyl homocysteine hydrolase                       221   3e-65   Nicotiana benthamiana
ref|NP_001289538.1|  adenosylhomocysteinase                             221   3e-65   Nicotiana sylvestris
gb|AGX26684.1|  S-adenosyl-l-homocysteine hydrolase A                   221   4e-65   Populus tomentosa [Chinese white poplar]
gb|ABI95857.1|  S-adenosyl-homocysteine hydrolase                       221   4e-65   Nicotiana suaveolens
gb|KDO43195.1|  hypothetical protein CISIN_1g011464mg                   219   4e-65   Citrus sinensis [apfelsine]
dbj|BAP47515.1|  S-adenosylhomocysteine hydrolase                       221   4e-65   Gentiana triflora
emb|CDP15078.1|  unnamed protein product                                220   4e-65   Coffea canephora [robusta coffee]
gb|AGX26678.1|  S-adenosyl-l-homocysteine hydrolase A                   220   4e-65   Populus tomentosa [Chinese white poplar]
gb|AGX26657.1|  S-adenosyl-l-homocysteine hydrolase A                   220   5e-65   Populus tomentosa [Chinese white poplar]
sp|Q9SP37.1|SAHH_LUPLU  RecName: Full=Adenosylhomocysteinase; Sho...    220   5e-65   Lupinus luteus
gb|AGX26666.1|  S-adenosyl-l-homocysteine hydrolase A                   220   5e-65   Populus tomentosa [Chinese white poplar]
emb|CAJ01706.1|  S-adenosyl-L-homocysteine hydrolase                    219   6e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
pdb|3OND|A  Chain A, Crystal Structure Of Lupinus Luteus S-adenos...    220   6e-65   Lupinus luteus
gb|AGX26656.1|  S-adenosyl-l-homocysteine hydrolase A                   220   6e-65   Populus tomentosa [Chinese white poplar]
emb|CDY47309.1|  BnaAnng08830D                                          220   7e-65   Brassica napus [oilseed rape]
sp|P35007.1|SAHH_CATRO  RecName: Full=Adenosylhomocysteinase; Sho...    220   7e-65   Catharanthus roseus [chatas]
sp|Q01781.2|SAHH_PETCR  RecName: Full=Adenosylhomocysteinase; Sho...    220   7e-65   Petroselinum crispum
gb|KDO43194.1|  hypothetical protein CISIN_1g011464mg                   220   8e-65   Citrus sinensis [apfelsine]
ref|XP_006848518.1|  hypothetical protein AMTR_s00013p00261120          220   8e-65   Amborella trichopoda
gb|AGX26672.1|  S-adenosyl-l-homocysteine hydrolase A                   219   8e-65   Populus tomentosa [Chinese white poplar]
gb|AAX16000.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            219   8e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006492541.1|  PREDICTED: adenosylhomocysteinase-like             219   8e-65   Citrus sinensis [apfelsine]
gb|AAX15998.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            219   9e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102577.1|  PREDICTED: adenosylhomocysteinase 2                219   1e-64   Brassica rapa
ref|XP_006373090.1|  adenosylhomocysteinase family protein              219   1e-64   Populus trichocarpa [western balsam poplar]
ref|XP_009135865.1|  PREDICTED: adenosylhomocysteinase 2-like           219   1e-64   Brassica rapa
gb|EYU31513.1|  hypothetical protein MIMGU_mgv1a004058mg                221   1e-64   Erythranthe guttata [common monkey flower]
ref|XP_006418835.1|  hypothetical protein EUTSA_v10002505mg             219   1e-64   Eutrema salsugineum [saltwater cress]
ref|NP_001234012.1|  adenosylhomocysteinase                             219   1e-64   
gb|AGX26686.1|  S-adenosyl-l-homocysteine hydrolase A                   219   2e-64   Populus tomentosa [Chinese white poplar]
ref|XP_002883461.1|  S-adenosyl-L-homocysteine (sah) hydrolase 2        219   2e-64   
gb|AGX26653.1|  S-adenosyl-l-homocysteine hydrolase A                   219   2e-64   Populus tomentosa [Chinese white poplar]
gb|AGX26682.1|  S-adenosyl-l-homocysteine hydrolase A                   219   2e-64   Populus tomentosa [Chinese white poplar]
gb|AGX26661.1|  S-adenosyl-l-homocysteine hydrolase A                   219   2e-64   Populus tomentosa [Chinese white poplar]
ref|XP_003629610.1|  Adenosylhomocysteinase                             219   2e-64   Medicago truncatula
emb|CDY50423.1|  BnaCnng19320D                                          219   2e-64   Brassica napus [oilseed rape]
emb|CDY01177.1|  BnaA04g06420D                                          219   2e-64   
gb|EMS57266.1|  Adenosylhomocysteinase                                  224   2e-64   Triticum urartu
ref|XP_007153624.1|  hypothetical protein PHAVU_003G051200g             218   2e-64   Phaseolus vulgaris [French bean]
gb|AAX15999.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            218   3e-64   Arabidopsis thaliana [mouse-ear cress]
gb|KFK39678.1|  hypothetical protein AALP_AA3G275000                    218   3e-64   Arabis alpina [alpine rockcress]
sp|P93253.1|SAHH_MESCR  RecName: Full=Adenosylhomocysteinase; Sho...    218   3e-64   Mesembryanthemum crystallinum
ref|XP_001755929.1|  predicted protein                                  218   3e-64   
gb|ACN40278.1|  unknown                                                 218   3e-64   Picea sitchensis
gb|AHL20280.1|  S-adenosylhomocysteine hydrolase                        218   3e-64   Kalanchoe daigremontiana
ref|XP_001755926.1|  predicted protein                                  218   3e-64   
ref|XP_008671500.1|  PREDICTED: adenosylhomocysteinase-like             216   3e-64   
gb|AEI54335.1|  adenosylhomocysteinase                                  218   3e-64   Glycine max [soybeans]
gb|ABR17322.1|  unknown                                                 218   4e-64   Picea sitchensis
gb|ABR16138.1|  unknown                                                 218   4e-64   Picea sitchensis
gb|ABR16547.1|  unknown                                                 218   4e-64   Picea sitchensis
dbj|BAE71233.1|  putative adenosylhomocysteinase                        218   4e-64   Trifolium pratense [peavine clover]
ref|NP_189023.1|  adenosylhomocysteinase 2                              218   4e-64   Arabidopsis thaliana [mouse-ear cress]
gb|AAL16259.1|AF428329_1  AT3g23810/MYM9_15                             218   4e-64   Arabidopsis thaliana [mouse-ear cress]
gb|AAM19782.1|  AT3g23810/MYM9_15                                       218   4e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006421018.1|  hypothetical protein CICLE_v10004852mg             218   4e-64   Citrus clementina [clementine]
ref|XP_009106322.1|  PREDICTED: adenosylhomocysteinase 2                218   4e-64   Brassica rapa
ref|XP_006297468.1|  hypothetical protein CARUB_v10013488mg             218   5e-64   
ref|XP_008457223.1|  PREDICTED: adenosylhomocysteinase 1                218   5e-64   Cucumis melo [Oriental melon]
ref|XP_010512939.1|  PREDICTED: adenosylhomocysteinase 2-like           218   5e-64   Camelina sativa [gold-of-pleasure]
gb|KFK36282.1|  hypothetical protein AALP_AA4G102500                    207   5e-64   Arabis alpina [alpine rockcress]
gb|ABR16573.1|  unknown                                                 218   5e-64   Picea sitchensis
ref|XP_003538528.1|  PREDICTED: adenosylhomocysteinase-like             218   5e-64   Glycine max [soybeans]
ref|XP_010488460.1|  PREDICTED: adenosylhomocysteinase 2                218   6e-64   Camelina sativa [gold-of-pleasure]
ref|XP_007034216.1|  S-adenosyl-L-homocysteine hydrolase                218   7e-64   
ref|XP_010466740.1|  PREDICTED: adenosylhomocysteinase 2-like iso...    217   7e-64   Camelina sativa [gold-of-pleasure]
gb|ABR16616.1|  unknown                                                 216   7e-64   Picea sitchensis
ref|XP_008438321.1|  PREDICTED: adenosylhomocysteinase-like             217   7e-64   Cucumis melo [Oriental melon]
ref|XP_009139575.1|  PREDICTED: adenosylhomocysteinase 1                217   9e-64   Brassica rapa
gb|ABK24229.1|  unknown                                                 217   1e-63   Picea sitchensis
ref|XP_001755906.1|  predicted protein                                  217   1e-63   
gb|AER92590.1|  putative S-adenosyl-L-homocysteinase                    218   1e-63   Linum usitatissimum
gb|ABK25129.1|  unknown                                                 217   1e-63   Picea sitchensis
gb|EYU32710.1|  hypothetical protein MIMGU_mgv1a003606mg                218   2e-63   Erythranthe guttata [common monkey flower]
gb|AIG62149.1|  S-adenosyl-L-homocysteine hydrolase                     216   2e-63   Populus tomentosa [Chinese white poplar]
ref|XP_004138966.1|  PREDICTED: adenosylhomocysteinase-like             216   2e-63   
gb|AIG62157.1|  S-adenosyl-L-homocysteine hydrolase                     216   2e-63   Populus tomentosa [Chinese white poplar]
gb|AIG62163.1|  S-adenosyl-L-homocysteine hydrolase                     216   3e-63   Populus tomentosa [Chinese white poplar]
gb|AIG62170.1|  S-adenosyl-L-homocysteine hydrolase                     216   3e-63   Populus tomentosa [Chinese white poplar]
gb|AIG62171.1|  S-adenosyl-L-homocysteine hydrolase                     216   3e-63   Populus tomentosa [Chinese white poplar]
ref|XP_011003627.1|  PREDICTED: adenosylhomocysteinase                  216   3e-63   Populus euphratica
gb|AIG62191.1|  S-adenosyl-L-homocysteine hydrolase                     216   3e-63   Populus tomentosa [Chinese white poplar]
gb|AIG62182.1|  S-adenosyl-L-homocysteine hydrolase                     216   3e-63   Populus tomentosa [Chinese white poplar]
gb|AIG62173.1|  S-adenosyl-L-homocysteine hydrolase                     216   3e-63   Populus tomentosa [Chinese white poplar]
gb|AIG62176.1|  S-adenosyl-L-homocysteine hydrolase                     216   3e-63   Populus tomentosa [Chinese white poplar]
gb|AIG62152.1|  S-adenosyl-L-homocysteine hydrolase                     216   3e-63   Populus tomentosa [Chinese white poplar]
gb|AIG62164.1|  S-adenosyl-L-homocysteine hydrolase                     216   3e-63   Populus tomentosa [Chinese white poplar]
gb|AIG62190.1|  S-adenosyl-L-homocysteine hydrolase                     216   3e-63   Populus tomentosa [Chinese white poplar]
gb|AIG62186.1|  S-adenosyl-L-homocysteine hydrolase                     216   3e-63   Populus tomentosa [Chinese white poplar]
gb|AIG62161.1|  S-adenosyl-L-homocysteine hydrolase                     216   3e-63   Populus tomentosa [Chinese white poplar]
gb|AIG62187.1|  S-adenosyl-L-homocysteine hydrolase                     216   3e-63   Populus tomentosa [Chinese white poplar]
gb|AIG62160.1|  S-adenosyl-L-homocysteine hydrolase                     216   3e-63   Populus tomentosa [Chinese white poplar]
gb|AIG62151.1|  S-adenosyl-L-homocysteine hydrolase                     216   3e-63   Populus tomentosa [Chinese white poplar]
gb|AIG62150.1|  S-adenosyl-L-homocysteine hydrolase                     216   3e-63   Populus tomentosa [Chinese white poplar]
gb|AIG62184.1|  S-adenosyl-L-homocysteine hydrolase                     216   3e-63   Populus tomentosa [Chinese white poplar]
gb|AIG62166.1|  S-adenosyl-L-homocysteine hydrolase                     216   3e-63   Populus tomentosa [Chinese white poplar]
gb|AIG62168.1|  S-adenosyl-L-homocysteine hydrolase                     216   3e-63   Populus tomentosa [Chinese white poplar]
gb|AIG62181.1|  S-adenosyl-L-homocysteine hydrolase                     216   3e-63   Populus tomentosa [Chinese white poplar]
gb|ABQ18314.1|  S-adenosyl-L-homocysteine hydrolase                     216   3e-63   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AIG62185.1|  S-adenosyl-L-homocysteine hydrolase                     216   3e-63   Populus tomentosa [Chinese white poplar]
gb|AIG62148.1|  S-adenosyl-L-homocysteine hydrolase                     216   3e-63   Populus tomentosa [Chinese white poplar]
gb|AIG62158.1|  S-adenosyl-L-homocysteine hydrolase                     216   3e-63   Populus tomentosa [Chinese white poplar]
gb|AIG62180.1|  S-adenosyl-L-homocysteine hydrolase                     215   3e-63   Populus tomentosa [Chinese white poplar]
gb|ABJ53283.1|  S-adenosyl-L-homocysteine hydrolase                     211   4e-63   
gb|AIG62165.1|  S-adenosyl-L-homocysteine hydrolase                     215   4e-63   Populus tomentosa [Chinese white poplar]
sp|P32112.1|SAHH_WHEAT  RecName: Full=Adenosylhomocysteinase; Sho...    215   4e-63   Triticum aestivum [Canadian hard winter wheat]
gb|AAK92718.1|  putative S-adenosyl-L-homocysteinas protein             215   4e-63   Arabidopsis thaliana [mouse-ear cress]
gb|AIG62156.1|  S-adenosyl-L-homocysteine hydrolase                     215   6e-63   Populus tomentosa [Chinese white poplar]
gb|AIG62188.1|  S-adenosyl-L-homocysteine hydrolase                     214   8e-63   Populus tomentosa [Chinese white poplar]
gb|AHA84211.1|  S-adenosyl-L-homocysteine hydrolase                     214   9e-63   Phaseolus vulgaris [French bean]
gb|AAP92452.1|  S-adenosyl-L-homocystein hydrolase                      214   9e-63   Petunia x hybrida [garden petunia]
gb|AIG62177.1|  S-adenosyl-L-homocysteine hydrolase                     214   9e-63   Populus tomentosa [Chinese white poplar]
gb|AIG62159.1|  S-adenosyl-L-homocysteine hydrolase                     214   1e-62   Populus tomentosa [Chinese white poplar]
gb|AIG62169.1|  S-adenosyl-L-homocysteine hydrolase                     213   2e-62   Populus tomentosa [Chinese white poplar]
sp|P50249.1|SAHH_PHASS  RecName: Full=Adenosylhomocysteinase; Sho...    213   2e-62   Phalaenopsis sp.
ref|XP_002300147.1|  adenosylhomocysteinase family protein              213   2e-62   Populus trichocarpa [western balsam poplar]
gb|AIG62178.1|  S-adenosyl-L-homocysteine hydrolase                     213   3e-62   Populus tomentosa [Chinese white poplar]
gb|AIG62155.1|  S-adenosyl-L-homocysteine hydrolase                     213   3e-62   Populus tomentosa [Chinese white poplar]
gb|ADR30776.1|  S-adenosyl-L-homocysteine hydrolase                     213   3e-62   Cucumis sativus [cucumbers]
gb|AIG62174.1|  S-adenosyl-L-homocysteine hydrolase                     213   3e-62   Populus tomentosa [Chinese white poplar]
gb|AIG62179.1|  S-adenosyl-L-homocysteine hydrolase                     213   4e-62   Populus tomentosa [Chinese white poplar]
gb|AIG62154.1|  S-adenosyl-L-homocysteine hydrolase                     213   4e-62   Populus tomentosa [Chinese white poplar]
gb|ACI31554.1|  S-adenosyl homocysteine hydrolase                       203   1e-61   Nicotiana benthamiana
gb|ABB55380.1|  S-adenosyl-L-homocysteine hydrolase-like                210   5e-61   Solanum tuberosum [potatoes]
ref|XP_005843353.1|  S-adenosyl-L-homocysteine hydrolase                201   2e-57   Chlorella variabilis
gb|KIZ05177.1|  adenosylhomocysteinase                                  206   2e-57   Monoraphidium neglectum
gb|ACE96401.1|  C-x8-C-x5-C-x3-H type Zn-finger                         189   1e-56   Populus tremula [European aspen]
gb|ACE96407.1|  C-x8-C-x5-C-x3-H type Zn-finger                         189   1e-56   Populus tremula [European aspen]
gb|AAL09400.1|AF307335_1  cytokinin binding protein                     197   2e-56   Petunia x hybrida [garden petunia]
ref|XP_001693339.1|  S-Adenosyl homocysteine hydrolase                  198   2e-56   Chlamydomonas reinhardtii
ref|XP_003081254.1|  SAHH_PETCR Adenosylhomocysteinase (ISS)            196   3e-56   
ref|XP_002950429.1|  hypothetical protein VOLCADRAFT_74602              196   7e-56   Volvox carteri f. nagariensis
emb|CEF99088.1|  S-adenosyl-L-homocysteine hydrolase, conserved site    196   9e-56   Ostreococcus tauri
ref|XP_003057172.1|  adenosylhomocysteinase                             196   1e-55   Micromonas pusilla CCMP1545
ref|XP_002505983.1|  adenosylhomocysteinase                             195   2e-55   Micromonas commoda
ref|XP_001419579.1|  predicted protein                                  194   3e-55   Ostreococcus lucimarinus CCE9901
gb|ADQ00183.1|  S-adenosyl homocysteine hydrolase                       194   4e-55   Chlamydomonas sp. ICE-L
gb|ADJ96635.1|  S-adenosyl homocysteine hydrolase                       193   1e-54   Dunaliella salina
emb|CDY58805.1|  BnaC08g46780D                                          188   8e-53   Brassica napus [oilseed rape]
emb|CDX85127.1|  BnaC07g07790D                                          188   8e-53   
ref|XP_005708566.1|  adenosylhomocysteinase                             188   1e-52   Galdieria sulphuraria
emb|CBN20774.1|  S-Adenosyl homocysteine hydrolase                      187   1e-52   Polytomella sp. Pringsheim 198.80
ref|XP_005643510.1|  S-Adenosyl homocysteine hydrolase                  187   2e-52   Coccomyxa subellipsoidea C-169
gb|KCW59951.1|  hypothetical protein EUGRSUZ_H02678                     187   2e-52   
gb|AJD09650.1|  SAHH1                                                   177   4e-52   
gb|AJD09648.1|  SAHH1                                                   176   4e-52   
ref|XP_009107496.1|  PREDICTED: adenosylhomocysteinase 1-like           186   4e-52   
gb|AJD09657.1|  SAHH1                                                   176   6e-52   
gb|AJD09655.1|  SAHH1                                                   176   6e-52   
gb|AJD09647.1|  SAHH1                                                   176   9e-52   
gb|AJD09658.1|  SAHH1                                                   175   2e-51   
gb|KDD76058.1|  S-adenosyl-L-homocysteine hydrolase                     184   3e-51   
gb|AJD09646.1|  SAHH1                                                   174   3e-51   
gb|AJD09654.1|  SAHH1                                                   174   5e-51   
gb|AJD09659.1|  SAHH1                                                   174   6e-51   
gb|AJD09652.1|  SAHH1                                                   173   8e-51   
ref|XP_011397211.1|  Adenosylhomocysteinase                             182   3e-50   
gb|AAP92454.1|  S-adenosyl-L-homocystein hydrolase                      181   3e-50   
ref|XP_007510486.1|  S-adenosyl-L-homocysteine hydrolase                182   6e-50   
gb|AJD09649.1|  SAHH1                                                   169   4e-49   
ref|XP_003884366.1|  hypothetical protein NCLIV_047660                  177   1e-48   
gb|EJK64241.1|  hypothetical protein THAOC_15047                        170   2e-48   
gb|KFG60763.1|  putative adenosylhomocysteinase                         172   6e-48   
ref|XP_008881882.1|  adenosylhomocysteinase, putative                   174   9e-48   
gb|EJY87176.1|  Adenosylhomocysteinase                                  174   1e-47   
ref|XP_002366178.1|  adenosylhomocysteinase, putative                   173   3e-47   
ref|XP_009493630.1|  adenosylhomocysteinase 1                           173   4e-47   
ref|XP_005716982.1|  S-adenosyl-L-homocysteine hydrolase                172   6e-47   
gb|KDO17385.1|  hypothetical protein SPRG_17078                         163   8e-47   
gb|KFH13893.1|  putative adenosylhomocysteinase                         173   1e-46   
gb|EPT27008.1|  adenosylhomocysteinase, putative                        173   1e-46   
gb|EPR62066.1|  putative adenosylhomocysteinase                         173   1e-46   
gb|KFG42936.1|  putative adenosylhomocysteinase                         173   1e-46   
gb|KFG55060.1|  putative adenosylhomocysteinase                         173   1e-46   
gb|ESS32583.1|  putative adenosylhomocysteinase                         173   1e-46   
emb|CDW86895.1|  s-adenosyl-l-homocysteine hydrolase                    170   3e-46   
ref|XP_002177758.1|  adenosylhomocysteinase                             170   4e-46   
emb|CDY50106.1|  BnaC01g43540D                                          169   2e-45   
ref|WP_022926989.1|  S-adenosyl-L-homocysteine hydrolase                167   4e-45   
ref|XP_008872075.1|  adenosylhomocysteinase 2                           167   5e-45   
gb|ETO08386.1|  hypothetical protein RFI_29000                          162   7e-45   
gb|ETO04662.1|  hypothetical protein RFI_32734                          160   2e-44   
ref|XP_002781556.1|  adenosylhomocysteinase, putative                   157   2e-44   
gb|AHG90399.1|  Adenosylhomocysteinase                                  166   2e-44   
ref|XP_002290951.1|  hypothetical protein THAPSDRAFT_28496              165   3e-44   
emb|CDY67319.1|  BnaA03g57570D                                          157   5e-44   
ref|WP_043581849.1|  adenosylhomocysteinase                             164   6e-44   
ref|XP_008611237.1|  adenosylhomocysteinase                             164   8e-44   
ref|XP_005535237.1|  S-adenosyl-L-homocysteine hydrolase                164   9e-44   
ref|WP_026910859.1|  S-adenosyl-L-homocysteine hydrolase                163   1e-43   
ref|XP_004025117.1|  hypothetical protein IMG5_191490                   163   1e-43   
ref|WP_036944508.1|  hypothetical protein                               163   2e-43   
ref|XP_005830876.1|  hypothetical protein GUITHDRAFT_110013             163   2e-43   
ref|WP_018502367.1|  S-adenosyl-L-homocysteine hydrolase                162   3e-43   
ref|XP_009833581.1|  adenosylhomocysteinase 2                           162   3e-43   
ref|WP_017355275.1|  S-adenosyl-L-homocysteine hydrolase                162   3e-43   
ref|XP_001023087.1|  adenosylhomocysteinase family protein              162   4e-43   
emb|CDX77483.1|  BnaA07g06210D                                          161   6e-43   
ref|WP_008375899.1|  adenosylhomocysteinase                             162   6e-43   
dbj|BAF01736.1|  adenosylhomocysteinase                                 151   7e-43   
ref|WP_012157556.1|  S-adenosyl-L-homocysteine hydrolase                161   8e-43   
ref|WP_009155258.1|  S-adenosyl-L-homocysteine hydrolase                161   8e-43   
gb|ADR18482.1|  adenosylhomocysteinase                                  161   9e-43   
ref|WP_009947852.1|  S-adenosyl-L-homocysteine hydrolase                161   1e-42   
ref|WP_041723781.1|  adenosylhomocysteinase                             160   1e-42   
ref|WP_019878251.1|  S-adenosyl-L-homocysteine hydrolase                160   2e-42   
dbj|GAE21599.1|  adenosylhomocysteinase                                 157   2e-42   
ref|WP_028061676.1|  hypothetical protein                               160   2e-42   
dbj|GAE20305.1|  adenosylhomocysteinase                                 157   2e-42   
ref|WP_027006534.1|  hypothetical protein                               160   3e-42   
ref|WP_011438808.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    159   3e-42   
ref|XP_002765933.1|  conserved hypothetical protein                     160   3e-42   
ref|WP_023840013.1|  MULTISPECIES: adenosylhomocysteinase               159   3e-42   
ref|WP_009741556.1|  S-adenosyl-L-homocysteine hydrolase                159   4e-42   
ref|WP_041939978.1|  S-adenosyl-L-homocysteine hydrolase                159   4e-42   
emb|CAJ65404.1|  Adenosylhomocysteinase (S-adenosyl-L-homocystein...    159   5e-42   
ref|WP_028072773.1|  hypothetical protein                               150   5e-42   
ref|WP_026917209.1|  S-adenosyl-L-homocysteine hydrolase                159   6e-42   
ref|WP_030509358.1|  S-adenosyl-L-homocysteine hydrolase                159   6e-42   
ref|WP_018636612.1|  S-adenosyl-L-homocysteine hydrolase                159   7e-42   
ref|WP_005942517.1|  adenosylhomocysteinase                             159   7e-42   
ref|WP_030534490.1|  MULTISPECIES: adenosylhomocysteinase               159   7e-42   
ref|WP_007322036.1|  S-adenosyl-L-homocysteine hydrolase                159   9e-42   
ref|WP_013219512.1|  S-adenosyl-L-homocysteine hydrolase                157   9e-42   
ref|XP_002788757.1|  conserved hypothetical protein                     158   1e-41   
ref|WP_013808581.1|  S-adenosyl-L-homocysteine hydrolase                158   1e-41   
ref|WP_006895565.1|  adenosylhomocysteinase                             158   1e-41   
gb|ABR16332.1|  unknown                                                 158   1e-41   
ref|WP_039007649.1|  S-adenosyl-L-homocysteine hydrolase                158   1e-41   
emb|CDY53211.1|  BnaC03g74050D                                          158   1e-41   
ref|WP_020109343.1|  S-adenosyl-L-homocysteine hydrolase                158   2e-41   
ref|WP_009679225.1|  S-adenosyl-L-homocysteine hydrolase                158   2e-41   
ref|WP_003475714.1|  adenosylhomocysteinase                             157   2e-41   
ref|WP_009576960.1|  Adenosylhomocysteinase                             157   2e-41   
ref|WP_019815305.1|  S-adenosyl-L-homocysteine hydrolase                157   2e-41   
ref|WP_006538559.1|  S-adenosyl-L-homocysteine hydrolase                157   2e-41   
ref|WP_007315856.1|  S-adenosyl-L-homocysteine hydrolase                157   2e-41   
ref|WP_033834449.1|  S-adenosyl-L-homocysteine hydrolase                157   2e-41   
ref|WP_019661087.1|  S-adenosyl-L-homocysteine hydrolase                157   2e-41   
ref|WP_027079175.1|  S-adenosyl-L-homocysteine hydrolase                157   3e-41   
ref|WP_036327944.1|  S-adenosyl-L-homocysteine hydrolase                157   3e-41   
ref|WP_007470134.1|  S-adenosyl-L-homocysteine hydrolase                157   4e-41   
gb|EFV13068.2|  adenosylhomocysteinase                                  157   4e-41   
ref|WP_018180991.1|  S-adenosyl-L-homocysteine hydrolase                157   4e-41   
ref|WP_038031735.1|  adenosylhomocysteinase                             156   4e-41   
ref|WP_010409859.1|  S-adenosyl-L-homocysteine hydrolase                156   4e-41   
ref|WP_042723470.1|  S-adenosyl-L-homocysteine hydrolase                157   4e-41   
ref|WP_012936074.1|  S-adenosyl-L-homocysteine hydrolase                157   4e-41   
ref|WP_035880861.1|  S-adenosyl-L-homocysteine hydrolase                148   5e-41   
ref|WP_010481888.1|  S-adenosyl-L-homocysteine hydrolase [              156   5e-41   
ref|WP_013139118.1|  S-adenosyl-L-homocysteine hydrolase                156   5e-41   
ref|WP_027325990.1|  adenosylhomocysteinase                             156   5e-41   
ref|WP_015104941.1|  Adenosylhomocysteinase                             156   5e-41   
emb|CCA20123.1|  unnamed protein product                                156   5e-41   
gb|KJE22179.1|  adenosylhomocysteinase                                  156   6e-41   
ref|WP_005415311.1|  S-adenosyl-L-homocysteine hydrolase                156   6e-41   
ref|WP_005197546.1|  S-adenosyl-L-homocysteine hydrolase                156   6e-41   
ref|WP_003465484.1|  S-adenosyl-L-homocysteine hydrolase                156   6e-41   
ref|WP_038690480.1|  S-adenosyl-L-homocysteine hydrolase                156   6e-41   
ref|WP_027069325.1|  S-adenosyl-L-homocysteine hydrolase                156   7e-41   
ref|WP_002088505.1|  S-adenosyl-L-homocysteine hydrolase-like pro...    147   8e-41   
ref|WP_000574234.1|  hypothetical protein                               147   8e-41   
ref|WP_041448694.1|  adenosylhomocysteinase                             155   9e-41   
ref|WP_006979414.1|  S-adenosyl-L-homocysteine hydrolase                155   9e-41   
gb|EMF40486.1|  S-adenosyl-L-homocysteine hydrolase-like protein        147   9e-41   
gb|ABS24379.1|  adenosylhomocysteinase                                  156   9e-41   
ref|WP_005465635.1|  S-adenosyl-L-homocysteine hydrolase                155   9e-41   
ref|XP_010024044.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    155   9e-41   
ref|WP_012835338.1|  S-adenosyl-L-homocysteine hydrolase                155   1e-40   
ref|WP_034274048.1|  adenosylhomocysteinase                             155   1e-40   
ref|WP_022903794.1|  S-adenosyl-L-homocysteine hydrolase                155   1e-40   
ref|WP_014927787.1|  S-adenosyl-L-homocysteine hydrolase                155   1e-40   
ref|WP_004023516.1|  S-adenosyl-L-homocysteine hydrolase                155   1e-40   
ref|WP_006239887.1|  S-adenosyl-L-homocysteine hydrolase                155   1e-40   
ref|WP_010842176.1|  S-adenosyl-L-homocysteine hydrolase                155   1e-40   
ref|WP_017888805.1|  S-adenosyl-L-homocysteine hydrolase                155   1e-40   
ref|WP_037400614.1|  hypothetical protein                               147   1e-40   
ref|WP_025876541.1|  S-adenosyl-L-homocysteine hydrolase                155   1e-40   
ref|WP_043959717.1|  S-adenosyl-L-homocysteine hydrolase                155   1e-40   
ref|WP_006866982.1|  S-adenosyl-L-homocysteine hydrolase                155   1e-40   
ref|WP_039856658.1|  S-adenosyl-L-homocysteine hydrolase                155   1e-40   
ref|WP_027466500.1|  S-adenosyl-L-homocysteine hydrolase                155   1e-40   
ref|WP_044656141.1|  adenosylhomocysteinase                             152   1e-40   
ref|WP_033429119.1|  adenosylhomocysteinase                             155   1e-40   
ref|WP_005458181.1|  S-adenosyl-L-homocysteine hydrolase                155   2e-40   
ref|WP_015786997.1|  S-adenosyl-L-homocysteine hydrolase                155   2e-40   
ref|WP_007238886.1|  S-adenosyl-L-homocysteine hydrolase                155   2e-40   
ref|XP_009033133.1|  hypothetical protein AURANDRAFT_69644              155   2e-40   
ref|WP_041905710.1|  adenosylhomocysteinase                             146   2e-40   
ref|WP_005170542.1|  adenosylhomocysteinase                             155   2e-40   
dbj|BAH40894.1|  adenosylhomocysteinase                                 155   2e-40   
ref|WP_041266969.1|  adenosylhomocysteinase                             155   2e-40   
ref|WP_006360159.1|  S-adenosyl-L-homocysteine hydrolase                155   2e-40   
ref|WP_033830371.1|  S-adenosyl-L-homocysteine hydrolase                155   2e-40   
ref|WP_032974920.1|  S-adenosyl-L-homocysteine hydrolase                155   2e-40   
ref|XP_010024043.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    154   2e-40   
ref|WP_005447827.1|  S-adenosyl-L-homocysteine hydrolase                155   2e-40   
ref|WP_010568439.1|  S-adenosyl-L-homocysteine hydrolase                154   2e-40   
ref|WP_043584645.1|  S-adenosyl-L-homocysteine hydrolase                155   2e-40   
ref|WP_038508580.1|  adenosylhomocysteinase                             155   2e-40   
ref|WP_020541357.1|  S-adenosyl-L-homocysteine hydrolase                154   2e-40   
ref|WP_010311525.1|  S-adenosyl-L-homocysteine hydrolase                154   2e-40   
gb|AAX40985.1|  S-adenosyl-L-homocysteine hydrolase                     152   3e-40   
ref|WP_012037724.1|  S-adenosyl-L-homocysteine hydrolase                154   3e-40   
ref|WP_027072847.1|  S-adenosyl-L-homocysteine hydrolase                154   3e-40   
ref|WP_007028966.1|  S-adenosyl-L-homocysteine hydrolase                154   3e-40   
ref|WP_007081119.1|  S-adenosyl-L-homocysteine hydrolase                154   3e-40   
ref|WP_019182466.1|  S-adenosyl-L-homocysteine hydrolase                154   3e-40   
ref|WP_015489740.1|  S-adenosylhomocysteinase                           154   3e-40   
ref|WP_026869144.1|  adenosylhomocysteinase                             153   3e-40   
gb|KCW60455.1|  hypothetical protein EUGRSUZ_H03174                     154   3e-40   
ref|WP_005781763.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    154   3e-40   
ref|WP_012935821.1|  S-adenosyl-L-homocysteine hydrolase                154   3e-40   
ref|WP_023955902.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    154   3e-40   
ref|WP_044300351.1|  adenosylhomocysteinase                             154   3e-40   
ref|WP_030877564.1|  adenosylhomocysteinase                             154   4e-40   
ref|WP_032576381.1|  adenosylhomocysteinase                             154   4e-40   
dbj|GAB40911.1|  adenosylhomocysteinase                                 154   4e-40   
emb|CCI50303.1|  unnamed protein product                                154   4e-40   
ref|WP_027493191.1|  S-adenosyl-L-homocysteine hydrolase                154   4e-40   
ref|WP_016551225.1|  adenosylhomocysteinase                             153   4e-40   
ref|WP_008770078.1|  S-adenosyl-L-homocysteine hydrolase                154   4e-40   
ref|WP_009514080.1|  S-adenosyl-L-homocysteine hydrolase                154   5e-40   
ref|WP_035857732.1|  hypothetical protein                               154   5e-40   
ref|WP_004154241.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    154   5e-40   
ref|WP_043397992.1|  S-adenosyl-L-homocysteine hydrolase                154   5e-40   
ref|WP_019338084.1|  S-adenosyl-L-homocysteine hydrolase                154   5e-40   
ref|WP_007362338.1|  S-adenosyl-L-homocysteine hydrolase                154   5e-40   
ref|WP_039564728.1|  S-adenosyl-L-homocysteine hydrolase                154   5e-40   
ref|WP_021645958.1|  adenosylhomocysteinase                             154   5e-40   
ref|WP_014036003.1|  S-adenosyl-L-homocysteine hydrolase                154   5e-40   
ref|WP_002775930.1|  S-adenosyl-L-homocysteine hydrolase                153   5e-40   
gb|KGK58630.1|  S-adenosyl-L-homocysteine hydrolase                     154   5e-40   
ref|WP_014645960.1|  S-adenosyl-L-homocysteine hydrolase                154   5e-40   
ref|WP_019629152.1|  S-adenosyl-L-homocysteine hydrolase                154   5e-40   
ref|XP_011129374.1|  adenosylhomocysteinase                             154   5e-40   
ref|WP_024957291.1|  S-adenosyl-L-homocysteine hydrolase                153   6e-40   
ref|WP_028769932.1|  S-adenosyl-L-homocysteine hydrolase                153   6e-40   
ref|WP_019737854.1|  S-adenosyl-L-homocysteine hydrolase                152   6e-40   
ref|WP_006434582.1|  adenosylhomocysteinase                             154   6e-40   
ref|WP_006899670.1|  adenosylhomocysteinase                             153   6e-40   
ref|WP_013421278.1|  S-adenosyl-L-homocysteine hydrolase                153   6e-40   
dbj|GAC66200.1|  adenosylhomocysteinase                                 154   7e-40   
gb|KFA30189.1|  S-adenosyl-L-homocysteine hydrolase                     151   7e-40   
ref|WP_040508846.1|  S-adenosyl-L-homocysteine hydrolase                153   7e-40   
ref|WP_005991516.1|  S-adenosyl-L-homocysteine hydrolase                153   8e-40   
ref|WP_013164653.1|  S-adenosyl-L-homocysteine hydrolase                152   8e-40   
ref|WP_043530374.1|  adenosylhomocysteinase                             153   8e-40   
ref|WP_006550214.1|  S-adenosyl-L-homocysteine hydrolase                153   8e-40   
ref|WP_023371561.1|  S-adenosyl-L-homocysteine hydrolase                153   8e-40   
ref|WP_012854369.1|  S-adenosyl-L-homocysteine hydrolase                153   9e-40   
ref|WP_032397661.1|  S-adenosyl-L-homocysteine hydrolase                153   9e-40   
ref|WP_037189914.1|  S-adenosyl-L-homocysteine hydrolase                153   9e-40   
ref|WP_006338609.1|  S-adenosyl-L-homocysteine hydrolase                153   1e-39   
ref|WP_006914979.1|  S-adenosyl-L-homocysteine hydrolase                152   1e-39   
ref|WP_020631367.1|  S-adenosyl-L-homocysteine hydrolase                153   1e-39   
ref|WP_030426804.1|  hypothetical protein                               153   1e-39   
ref|WP_024877686.1|  adenosylhomocysteinase                             153   1e-39   
ref|WP_039584804.1|  S-adenosyl-L-homocysteine hydrolase                153   1e-39   
ref|WP_037340993.1|  adenosylhomocysteinase                             153   1e-39   
ref|WP_016934217.1|  S-adenosyl-L-homocysteine hydrolase                153   1e-39   
ref|WP_034305234.1|  adenosylhomocysteinase                             153   1e-39   
ref|WP_008213996.1|  S-adenosyl-L-homocysteine hydrolase                152   1e-39   
ref|WP_006370365.1|  S-adenosyl-L-homocysteine hydrolase                153   1e-39   



>ref|XP_009415939.1| PREDICTED: adenosylhomocysteinase [Musa acuminata subsp. malaccensis]
Length=485

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLETYPGVKRITIKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETYPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YIS+
Sbjct  413  FTNQVIAQLELWKEKTTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  473  PIEGPYKPAHYRY  485



>gb|KDP39327.1| hypothetical protein JCGZ_01084 [Jatropha curcas]
Length=485

 Score =   231 bits (590),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLETYPGVKRITIKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETYPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW+EK TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWREKATGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKPPHYRY
Sbjct  473  PVEGPYKPPHYRY  485



>gb|AFV46215.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=302

 Score =   226 bits (576),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPETK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  170  NEIDMQGLETYPGVKRITIKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCS  229

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ YISI
Sbjct  230  FTNQVIAQLELWKERTSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYISI  289

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKPPHYRY
Sbjct  290  PVEGPYKPPHYRY  302



>ref|XP_008794647.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLETYPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YIS+
Sbjct  413  FTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYISV  472

Query  316  PVEGPYKPPHYRY  278
            P EGPYKPPHYRY
Sbjct  473  PTEGPYKPPHYRY  485



>gb|AFK46472.1| unknown [Lotus japonicus]
Length=290

 Score =   225 bits (574),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLETYPGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  158  NEIDMHGLETYPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  217

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK +GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL  +Q+ YISI
Sbjct  218  FTNQVIAQLELWKEKGSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLRKDQSDYISI  277

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  278  PIEGPYKPAHYRY  290



>ref|XP_010247578.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   231 bits (588),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLETYPGVKRITIKPQTDR+VFP+T +GII+LA+GRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETYPGVKRITIKPQTDRWVFPDTNSGIIVLADGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQ+ELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPEQAAYIS+
Sbjct  413  FTNQVIAQIELWKEKGTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPEQAAYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|KJB72025.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=265

 Score =   224 bits (571),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLE YPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  133  NEIDMLGLENYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  192

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+
Sbjct  193  FTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISV  252

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKPPHYRY
Sbjct  253  PIEGPYKPPHYRY  265



>ref|XP_010268032.1| PREDICTED: adenosylhomocysteinase-like [Nelumbo nucifera]
Length=485

 Score =   231 bits (588),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T  GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTNRGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPEQAAYIS+
Sbjct  413  FTNQVIAQLELWKEKGTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPEQAAYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|XP_010551666.1| PREDICTED: adenosylhomocysteinase 1-like [Tarenaya hassleriana]
Length=485

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWKEKGTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSTDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKPPHYRY
Sbjct  473  PIEGPYKPPHYRY  485



>ref|XP_002278000.1| PREDICTED: adenosylhomocysteinase-like [Vitis vinifera]
Length=485

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPET +GIIILAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPETNSGIIILAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+PEQAAYIS+
Sbjct  413  FTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSPEQAAYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPTHYRY  485



>ref|XP_009413566.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLETYPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKE+ TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YIS+
Sbjct  413  FTNQVIAQLELWKERETGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYISV  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  473  PIEGPYKPAHYRY  485



>gb|KHG10896.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +QA YIS+
Sbjct  413  FTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKPPHYRY
Sbjct  473  PVEGPYKPPHYRY  485



>ref|XP_004953493.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLETYPGVKRITIKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETYPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+  QA YIS+
Sbjct  413  FTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKSQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  473  PIEGPYKPAHYRY  485



>gb|KJB72026.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=345

 Score =   224 bits (572),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLE YPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  213  NEIDMLGLENYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  272

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+
Sbjct  273  FTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISV  332

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKPPHYRY
Sbjct  333  PIEGPYKPPHYRY  345



>dbj|BAH57232.1| AT4G13940 [Arabidopsis thaliana]
Length=291

 Score =   223 bits (567),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPETK GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  159  NEIDMLGLETYPGVKRITIKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCS  218

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +Q+ Y+SI
Sbjct  219  FTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSI  278

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKPPHYRY
Sbjct  279  PIEGPYKPPHYRY  291



>emb|CDP11183.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   228 bits (582),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPETK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKPPHYRY
Sbjct  473  PVEGPYKPPHYRY  485



>ref|XP_003601687.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89238.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AES71938.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   228 bits (581),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLETYPGVKRITIKPQTDR+VFPETK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETYPGVKRITIKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQ+ELWKEK +GKYEKKVYVLPKHLDEKVAALHLG+LGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQIELWKEKTSGKYEKKVYVLPKHLDEKVAALHLGQLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>sp|P50246.1|SAHH_MEDSA RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Medicago sativa]
 gb|AAB41814.1| adenosylhomocysteinase [Medicago sativa]
Length=485

 Score =   228 bits (580),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLETYPGVKRITIKPQTDR+VFPETK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETYPGVKRITIKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQ+ELWKEK +GKYEKKVYVLPKHLDEKVAALHLG+LGAKLTKL+ +QA YIS+
Sbjct  413  FTNQVIAQIELWKEKTSGKYEKKVYVLPKHLDEKVAALHLGQLGAKLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|XP_010527457.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   228 bits (580),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YIS+
Sbjct  413  FTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISV  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKPPHYRY
Sbjct  473  PIEGPYKPPHYRY  485



>ref|XP_011102056.1| PREDICTED: adenosylhomocysteinase [Sesamum indicum]
Length=485

 Score =   228 bits (580),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKE+ TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQA YIS+
Sbjct  413  FTNQVIAQLELWKERATGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKPPHYRY
Sbjct  473  PVEGPYKPPHYRY  485



>ref|XP_011083449.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   228 bits (580),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLETYPGVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETYPGVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKPPHYRY
Sbjct  473  PIEGPYKPPHYRY  485



>ref|XP_010908558.1| PREDICTED: adenosylhomocysteinase [Elaeis guineensis]
Length=485

 Score =   228 bits (580),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLETYPGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETYPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YIS+
Sbjct  413  FTNQVIAQLELWKERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPAQAEYISV  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKPPHYRY
Sbjct  473  PIEGPYKPPHYRY  485



>gb|EMT11613.1| Adenosylhomocysteinase [Aegilops tauschii]
Length=292

 Score =   222 bits (565),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM+GLETYPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  160  NEIDMNGLETYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  219

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT  Q+ YISI
Sbjct  220  FTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKAQSEYISI  279

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  280  PVEGPYKPAAYRY  292



>emb|CAH69227.1| putative adenosylhomocysteinase [Nicotiana glauca]
Length=264

 Score =   221 bits (562),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  132  NEIDMLGLETYPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  191

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+
Sbjct  192  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISV  251

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  252  PVEGPYKPAHYRY  264



>gb|KJB37873.1| hypothetical protein B456_006G223900 [Gossypium raimondii]
Length=485

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLE YPGVKRITIKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLENYPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +QA YIS+
Sbjct  413  FTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKPPHYRY
Sbjct  473  PVEGPYKPPHYRY  485



>gb|KJB19538.1| hypothetical protein B456_003G108500 [Gossypium raimondii]
Length=485

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPG+KRITIKPQTDR++FPET  GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGIKRITIKPQTDRWIFPETNRGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDEKVA+LHLGKLGAKLTKLTP+QAAYIS+
Sbjct  413  FTNQVIAQLELWKERGSGKYEKKVYVLPKHLDEKVASLHLGKLGAKLTKLTPDQAAYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKPPHYRY
Sbjct  473  PVEGPYKPPHYRY  485



>ref|XP_008222807.1| PREDICTED: adenosylhomocysteinase isoform X1 [Prunus mume]
Length=485

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLETYPGVKRITIKPQTDR+VFPET TGIIILAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETYPGVKRITIKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+
Sbjct  413  FTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|XP_007222610.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
 gb|EMJ23809.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
Length=485

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLETYPGVKRITIKPQTDR+VFPET TGIIILAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETYPGVKRITIKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQA YIS+
Sbjct  413  FTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|KJB72027.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=423

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLE YPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  291  NEIDMLGLENYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  350

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+
Sbjct  351  FTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISV  410

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKPPHYRY
Sbjct  411  PIEGPYKPPHYRY  423



>ref|XP_007037836.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY22337.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=485

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPG+KRITIKPQTDR+VFPET  GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGIKRITIKPQTDRWVFPETNRGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKE+ TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPEQAAYIS+
Sbjct  413  FTNQVIAQLELWKERGTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPEQAAYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKPP YRY
Sbjct  473  PVEGPYKPPRYRY  485



>ref|XP_008361486.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLETYPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+
Sbjct  413  FTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>dbj|BAA03710.1| cytokinin binding protein CBP57 [Nicotiana sylvestris]
Length=450

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  318  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  377

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+
Sbjct  378  FTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISV  437

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKPPHYRY
Sbjct  438  PVEGPYKPPHYRY  450



>gb|KHN12344.1| Adenosylhomocysteinase [Glycine soja]
Length=408

 Score =   224 bits (570),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLE YPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  276  NEIDMLGLENYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  335

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLT+L+  QA YIS+
Sbjct  336  FTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTQLSKSQADYISV  395

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  396  PVEGPYKPAHYRY  408



>ref|XP_010673385.1| PREDICTED: adenosylhomocysteinase [Beta vulgaris subsp. vulgaris]
 dbj|BAE07182.1| S-adenosyl-L-homocysteine hydrolase [Beta vulgaris]
Length=487

 Score =   226 bits (575),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLETYPG+KRITIKPQTDRFVFPETK+G+IILAEGRLMNLGCATGHPSFVMSCS
Sbjct  355  NEIDMHGLETYPGIKRITIKPQTDRFVFPETKSGVIILAEGRLMNLGCATGHPSFVMSCS  414

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVAALHL KLGAKLTKLT +Q+ Y+SI
Sbjct  415  FTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVAALHLNKLGAKLTKLTKDQSDYLSI  474

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  475  PVEGPYKPAHYRY  487



>ref|XP_009403608.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   226 bits (575),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPG+KRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMQGLETYPGIKRITIKPQTDRWVFPETSTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKE+ TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YIS+
Sbjct  413  FTNQVIAQLELWKERKTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPVHYRY  485



>ref|XP_004973012.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   226 bits (575),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLETYPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+  Q+ YIS+
Sbjct  413  FTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKSQSDYISV  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  473  PIEGPYKPAHYRY  485



>ref|XP_008776857.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   226 bits (575),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLETYPGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETYPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YIS+
Sbjct  413  FTNQVIAQLELWKERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  473  PIEGPYKPAHYRY  485



>ref|XP_004502244.1| PREDICTED: adenosylhomocysteinase-like [Cicer arietinum]
Length=485

 Score =   225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLETYPGVKRITIKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQ+ELWKEK +GKYEKKVYVLPKHLDEKVAALHLG+LGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQIELWKEKTSGKYEKKVYVLPKHLDEKVAALHLGQLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|KJB28098.1| hypothetical protein B456_005G027700 [Gossypium raimondii]
Length=485

 Score =   225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLE YPGVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLENYPGVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK+TGKYEKKVYVLPKHLDEKVAALHL KLGAKLTKLT +QA YIS+
Sbjct  413  FTNQVIAQLELWTEKSTGKYEKKVYVLPKHLDEKVAALHLVKLGAKLTKLTKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKPPHYRY
Sbjct  473  PIEGPYKPPHYRY  485



>gb|EYU31514.1| hypothetical protein MIMGU_mgv1a005403mg [Erythranthe guttata]
Length=485

 Score =   225 bits (574),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLETYPGVKRITIKPQTDR+VFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETYPGVKRITIKPQTDRWVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKY K+VYVLPKHLDEKVAALHLGKLGAKLTKLT EQ+ YISI
Sbjct  413  FTNQVIAQLELWNERKSGKYGKEVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQSDYISI  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKPPHYRY
Sbjct  473  PVEGPYKPPHYRY  485



>gb|AAA33855.1| S-adenosylhomocysteine hydrolase [Petroselinum crispum]
Length=227

 Score =   218 bits (554),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFP+T  GIIILAEGRLMNLGCATGHPSFVMSCS
Sbjct  95   NEIDMLGLETYPGVKRITIKPQTDRWVFPDTGRGIIILAEGRLMNLGCATGHPSFVMSCS  154

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYV PKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+
Sbjct  155  FTNQVIAQLELWNEKSSGKYEKKVYVCPKHLDEKVAALHLGKLGAKLTKLSKDQADYISV  214

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  215  PVEGPYKPAHYRY  227



>gb|KJB72029.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=456

 Score =   224 bits (572),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLE YPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  324  NEIDMLGLENYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  383

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+
Sbjct  384  FTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISV  443

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKPPHYRY
Sbjct  444  PIEGPYKPPHYRY  456



>ref|XP_010253338.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   225 bits (573),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLE  PGVKRITIKPQTDR+VFP+T +G+I+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLEILPGVKRITIKPQTDRWVFPDTNSGVIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQAAYIS+
Sbjct  413  FTNQVIAQLELWKEKGTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTSEQAAYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|KCW59952.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=467

 Score =   224 bits (572),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLE +PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  335  NEIDMHGLENFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  394

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK++GKY+K+VYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+
Sbjct  395  FTNQVIAQLELWKEKSSGKYKKEVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISV  454

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKPPHYRY
Sbjct  455  PVEGPYKPPHYRY  467



>gb|ABA93500.1| Adenosylhomocysteinase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA93501.1| Adenosylhomocysteinase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG93815.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99677.1| unnamed protein product [Oryza sativa Japonica Group]
Length=450

 Score =   224 bits (571),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  318  NEIDMLGLETYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  377

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+  QA YIS+
Sbjct  378  FTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKSQADYISV  437

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  438  PVEGPYKPAHYRY  450



>ref|XP_010052042.1| PREDICTED: adenosylhomocysteinase 1 [Eucalyptus grandis]
 gb|KCW75898.1| hypothetical protein EUGRSUZ_D00281 [Eucalyptus grandis]
Length=485

 Score =   225 bits (573),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKPPHYRY
Sbjct  473  PVEGPYKPPHYRY  485



>ref|XP_002870350.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46609.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   225 bits (573),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YISI
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISI  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKPPHYRY
Sbjct  473  PIEGPYKPPHYRY  485



>ref|XP_011102207.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   225 bits (573),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMQGLETYPGVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKPPHYRY
Sbjct  473  PIEGPYKPPHYRY  485



>gb|ACJ11250.1| S-adenosyl-L-homocystein hydrolase [Gossypium hirsutum]
Length=485

 Score =   225 bits (573),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLE YPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLENYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+
Sbjct  413  FTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKPPHYRY
Sbjct  473  PIEGPYKPPHYRY  485



>ref|XP_010913095.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   225 bits (573),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLE YPGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLENYPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YISI
Sbjct  413  FTNQVIAQLELWKERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYISI  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  473  PIEGPYKPAHYRY  485



>gb|KJB72024.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=485

 Score =   225 bits (573),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLE YPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLENYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+
Sbjct  413  FTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKPPHYRY
Sbjct  473  PIEGPYKPPHYRY  485



>ref|NP_001031627.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83346.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=364

 Score =   221 bits (564),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPETK GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  232  NEIDMLGLETYPGVKRITIKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCS  291

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +Q+ Y+SI
Sbjct  292  FTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSI  351

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKPPHYRY
Sbjct  352  PIEGPYKPPHYRY  364



>ref|XP_009373550.1| PREDICTED: adenosylhomocysteinase [Pyrus x bretschneideri]
Length=485

 Score =   225 bits (573),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLETYPGVKRITIKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQA YIS+
Sbjct  413  FTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|XP_009787091.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana sylvestris]
Length=485

 Score =   225 bits (573),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKPPHYRY
Sbjct  473  PVEGPYKPPHYRY  485



>gb|AAO72664.1| wheat adenosylhomocysteinase-like protein [Oryza sativa Japonica 
Group]
 gb|EAY80818.1| hypothetical protein OsI_35998 [Oryza sativa Indica Group]
 gb|EEE52055.1| hypothetical protein OsJ_33804 [Oryza sativa Japonica Group]
 gb|AIR95993.1| adenosylhomocysteinase [Oryza sativa Japonica Group]
Length=485

 Score =   225 bits (573),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+  QA YIS+
Sbjct  413  FTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKSQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|KHG19993.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPG+KRITIKPQTDR++FPET  GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGIKRITIKPQTDRWIFPETNRGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDE V +LHLGKLGAKLTKLTP+QAAYIS+
Sbjct  413  FTNQVIAQLELWKERGSGKYEKKVYVLPKHLDEMVGSLHLGKLGAKLTKLTPDQAAYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKPPHYRY
Sbjct  473  PVEGPYKPPHYRY  485



>ref|XP_010023650.1| PREDICTED: adenosylhomocysteinase [Eucalyptus grandis]
 gb|KCW59953.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=485

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLE +PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLENFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK++GKY+K+VYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+
Sbjct  413  FTNQVIAQLELWKEKSSGKYKKEVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKPPHYRY
Sbjct  473  PVEGPYKPPHYRY  485



>ref|XP_006283635.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
 ref|XP_010435212.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450125.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450146.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 gb|EOA16533.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
Length=485

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SI
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSI  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKPPHYRY
Sbjct  473  PIEGPYKPPHYRY  485



>ref|XP_010466741.1| PREDICTED: adenosylhomocysteinase 2-like isoform X2 [Camelina 
sativa]
Length=291

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  159  NEIDMLGLETYPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  218

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SI
Sbjct  219  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSI  278

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP +YRY
Sbjct  279  PIEGPYKPANYRY  291



>gb|EMS57067.1| Adenosylhomocysteinase [Triticum urartu]
Length=416

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM+GLETYPGVKRITIKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  284  NEIDMNGLETYPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCS  343

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT  Q+ YISI
Sbjct  344  FTNQVIAQLELWNEKATGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKSQSDYISI  403

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  404  PVEGPYKPAAYRY  416



>gb|KHG17040.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=485

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLE YPGVKRITIKPQTDR+VFPET TGI++LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLENYPGVKRITIKPQTDRWVFPETNTGIVVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+
Sbjct  413  FTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKPPHYRY
Sbjct  473  PIEGPYKPPHYRY  485



>gb|KFK28004.1| hypothetical protein AALP_AA8G459100 [Arabis alpina]
Length=485

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ YISI
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYISI  472

Query  316  PVEGPYKPPHYRY  278
            P++GPYKPPHYRY
Sbjct  473  PIQGPYKPPHYRY  485



>ref|XP_010097949.1| hypothetical protein L484_026840 [Morus notabilis]
 gb|EXB73679.1| hypothetical protein L484_026840 [Morus notabilis]
Length=485

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPET TGIIILAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYEKKVYVLPKHLDEKVAALHL KLGAKLTKLT EQA YIS+
Sbjct  413  FTNQVIAQLELWNERTTGKYEKKVYVLPKHLDEKVAALHLSKLGAKLTKLTKEQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>tpg|DAA38860.1| TPA: hypothetical protein ZEAMMB73_022938 [Zea mays]
Length=270

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQ DR+VFPET TGIIILAEGRLMNLGCATGHPSFVMSCS
Sbjct  138  NEIDMLGLETYPGVKRITIKPQIDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCS  197

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQV+AQLELWKEKN+GKYEKKVYVLPKHLDEKV ALHLGK GAKLTKLT  QA YI +
Sbjct  198  FTNQVLAQLELWKEKNSGKYEKKVYVLPKHLDEKVNALHLGKHGAKLTKLTKSQADYIRV  257

Query  316  PVEGPYKPPHYRY  278
            P+EGPYK  HYRY
Sbjct  258  PIEGPYKLAHYRY  270



>ref|XP_010905139.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLE YPGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLENYPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YISI
Sbjct  413  FTNQVIAQLELWKERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYISI  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  473  PIEGPYKPAHYRY  485



>ref|NP_001031628.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83347.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=440

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPETK GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  308  NEIDMLGLETYPGVKRITIKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCS  367

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +Q+ Y+SI
Sbjct  368  FTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSI  427

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKPPHYRY
Sbjct  428  PIEGPYKPPHYRY  440



>ref|XP_003577583.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Brachypodium 
distachyon]
Length=485

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM+GLETYPGVKRITIKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMNGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKE++TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT  QA YISI
Sbjct  413  FTNQVIAQLELWKERSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKSQADYISI  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  473  PIEGPYKPAHYRY  485



>ref|XP_002522805.1| adenosylhomocysteinase, putative [Ricinus communis]
 gb|EEF39656.1| adenosylhomocysteinase, putative [Ricinus communis]
Length=485

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW+EK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWREKATGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|KHN44476.1| Adenosylhomocysteinase [Glycine soja]
Length=291

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET PGVKRI IKPQTDR+VFP+TK GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  159  NEIDMLGLETCPGVKRINIKPQTDRWVFPDTKRGIIVLAEGRLMNLGCATGHPSFVMSCS  218

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK +GKYEKKVYVLPKHLDEKVA+LHLG+LGA+LTKL+ +QA YIS+
Sbjct  219  FTNQVIAQLELWKEKGSGKYEKKVYVLPKHLDEKVASLHLGQLGARLTKLSKDQADYISV  278

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  279  PVEGPYKPAHYRY  291



>gb|EPS72602.1| adenosylhomocysteinase, partial [Genlisea aurea]
Length=567

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLETYPGV+RITIKPQTDR+VFP+TKTGIIILAEGRLMNLGCATGHPSFVMSCS
Sbjct  435  NEIDMHGLETYPGVERITIKPQTDRYVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCS  494

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKE+++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+
Sbjct  495  FTNQVIAQLELWKERSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISV  554

Query  316  PVEGPYKPPHYRY  278
             VEGPYKP HYRY
Sbjct  555  AVEGPYKPAHYRY  567



>gb|AAV31755.1| S-adenosyl-L-homocysteine hydrolase, partial [Nicotiana tabacum]
Length=479

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  347  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  406

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+
Sbjct  407  FTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISV  466

Query  316  PVEGPYKPPHYRY  278
            PV+GPYKPPHYRY
Sbjct  467  PVDGPYKPPHYRY  479



>ref|XP_003524926.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLE YPGVKRITIKPQTDR+VFPET  GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLENYPGVKRITIKPQTDRWVFPETNVGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+P QA YIS+
Sbjct  413  FTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSPAQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|XP_004296983.1| PREDICTED: adenosylhomocysteinase [Fragaria vesca subsp. vesca]
Length=485

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGV+RITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVQRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+
Sbjct  413  FTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  473  PIEGPYKPAHYRY  485



>ref|XP_009349913.1| PREDICTED: adenosylhomocysteinase-like [Pyrus x bretschneideri]
Length=485

 Score =   224 bits (570),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLETY GVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETYAGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+
Sbjct  413  FTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|XP_009606591.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana tomentosiformis]
Length=485

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PV+GPYKPPHYRY
Sbjct  473  PVDGPYKPPHYRY  485



>ref|XP_008380474.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLETYPGVKRITIKPQTDR+VFPETK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETYPGVKRITIKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQA YIS+
Sbjct  413  FTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAAYRY  485



>ref|XP_004247887.1| PREDICTED: adenosylhomocysteinase [Solanum lycopersicum]
Length=485

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|XP_006662925.1| PREDICTED: adenosylhomocysteinase-like [Oryza brachyantha]
Length=485

 Score =   223 bits (568),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK+TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT  QA YIS+
Sbjct  413  FTNQVIAQLELWNEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKSQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AGT16642.1| Adenosylhomocysteinase [Saccharum hybrid cultivar R570]
Length=485

 Score =   223 bits (568),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT  QA YIS+
Sbjct  413  FTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKSQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  473  PIEGPYKPAHYRY  485



>gb|AFZ78657.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AGX26645.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   223 bits (568),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AGX26650.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   223 bits (568),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|NP_001148534.1| adenosylhomocysteinase [Zea mays]
 gb|ACG31873.1| adenosylhomocysteinase [Zea mays]
Length=485

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT  QA YIS+
Sbjct  413  FTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKSQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  473  PIEGPYKPAHYRY  485



>ref|XP_003531217.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLE YPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLENYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLT+L+  QA YIS+
Sbjct  413  FTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTQLSKSQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|ACN34730.1| unknown [Zea mays]
 gb|AFW60832.1| adenosyl homocysteine hydrolase1 isoform 1 [Zea mays]
 gb|AFW60833.1| adenosyl homocysteine hydrolase1 isoform 2 [Zea mays]
Length=485

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT  QA YIS+
Sbjct  413  FTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKSQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  473  PIEGPYKPAHYRY  485



>ref|XP_006360925.1| PREDICTED: adenosylhomocysteinase-like isoform X1 [Solanum tuberosum]
Length=485

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +QA YIS+
Sbjct  413  FTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|XP_002266154.1| PREDICTED: adenosylhomocysteinase [Vitis vinifera]
 emb|CAN64242.1| hypothetical protein VITISV_022595 [Vitis vinifera]
Length=485

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWKEKASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKPPHYRY
Sbjct  473  PIEGPYKPPHYRY  485



>dbj|BAP47516.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLETYPGVK+ITIKPQTDR+VFP+T +GIIILAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETYPGVKKITIKPQTDRWVFPDTNSGIIILAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPLHYRY  485



>ref|XP_008222808.1| PREDICTED: adenosylhomocysteinase isoform X2 [Prunus mume]
Length=547

 Score =   224 bits (571),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLETYPGVKRITIKPQTDR+VFPET TGIIILAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETYPGVKRITIKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+
Sbjct  413  FTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISV  472

Query  316  PVEGPYKPPHYR  281
            PVEGPYKP HYR
Sbjct  473  PVEGPYKPAHYR  484



>gb|AGX26669.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|NP_001067845.2| Os11g0455500 [Oryza sativa Japonica Group]
 dbj|BAF28208.2| Os11g0455500, partial [Oryza sativa Japonica Group]
Length=515

 Score =   223 bits (569),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  383  NEIDMLGLETYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  442

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+  QA YIS+
Sbjct  443  FTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKSQADYISV  502

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  503  PVEGPYKPAHYRY  515



>gb|KFK36278.1| hypothetical protein AALP_AA4G101800 [Arabis alpina]
Length=485

 Score =   223 bits (567),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YISI
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISI  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  473  PIEGPYKPAHYRY  485



>gb|AGX26649.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   223 bits (567),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AGX26654.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   223 bits (567),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AGX26687.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   223 bits (567),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AGX26665.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   223 bits (567),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AGX26663.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   223 bits (567),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+L KL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLAKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AGX26683.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AGX26652.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|XP_011012490.1| PREDICTED: adenosylhomocysteinase-like [Populus euphratica]
Length=485

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AGX26646.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26648.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26658.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26659.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26668.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26670.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26675.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26680.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26688.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AGW81844.1| S-(5'-adenosyl)-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26660.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AGX26671.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AGX26647.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AGX26662.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AGX26679.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AGX26676.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AGX26677.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|XP_010532739.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK TGKY+K+VYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWKEKGTGKYKKEVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            P++GPYKPPHYRY
Sbjct  473  PIDGPYKPPHYRY  485



>gb|AGX26674.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|XP_006349914.1| PREDICTED: adenosylhomocysteinase-like [Solanum tuberosum]
Length=485

 Score =   223 bits (567),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK +GKYEKKVYVLPKHLDEKVAALHLG+LG KLTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWKEKASGKYEKKVYVLPKHLDEKVAALHLGQLGVKLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|XP_004166113.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Cucumis 
sativus]
Length=485

 Score =   223 bits (567),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+P VKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPDVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNERKTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  473  PIEGPYKPAHYRY  485



>ref|XP_004133979.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN56709.1| hypothetical protein Csa_3G129660 [Cucumis sativus]
Length=485

 Score =   222 bits (566),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+P VKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPDVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNERKTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  473  PIEGPYKPAHYRY  485



>gb|KJB72028.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=487

 Score =   223 bits (567),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLE YPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLENYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+
Sbjct  413  FTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISV  472

Query  316  PVEGPYKPPHYR  281
            P+EGPYKPPHYR
Sbjct  473  PIEGPYKPPHYR  484



>gb|AAP92453.1| S-adenosyl-L-homocystein hydrolase [Arabidopsis thaliana]
Length=485

 Score =   222 bits (566),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMQGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ Y+SI
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSI  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKPPHYRY
Sbjct  473  PIEGPYKPPHYRY  485



>gb|AGX26673.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   222 bits (566),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AGX26689.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   222 bits (566),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|XP_007163813.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
 gb|ESW35807.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
Length=485

 Score =   222 bits (566),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKR  IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRTNIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVA+LHLG+LGAKLTKLT EQA YIS+
Sbjct  413  FTNQVIAQLELWKEKGTGKYEKKVYVLPKHLDEKVASLHLGQLGAKLTKLTKEQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPVHYRY  485



>emb|CCC55421.1| S-adenosyl-L-homocysteine hydrolase [Pinus pinaster]
Length=485

 Score =   222 bits (566),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVK+ITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMQGLETFPGVKKITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVAALHL KLGA LTKL+PEQAAYI++
Sbjct  413  FTNQVIAQLELWNEKKSGKYEKKVYVLPKHLDEKVAALHLPKLGAHLTKLSPEQAAYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|NP_001265954.1| adenosylhomocysteinase-like [Cicer arietinum]
 emb|CAI56440.1| S-adenosyl-L-homocysteine hydrolase [Cicer arietinum]
Length=485

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLE YPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMAGLENYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+N+GKYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+  QA YIS+
Sbjct  413  FTNQVIAQLELWNERNSGKYEKKVYVLPKHLDEKVAALHLNKLGAKLTKLSQSQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|XP_004252985.1| PREDICTED: adenosylhomocysteinase-like [Solanum lycopersicum]
Length=485

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFP+TK+GI++LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPDTKSGILVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK +GKYEKKVYVLPKHLDEKVAALHLG+LG KLTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWKEKASGKYEKKVYVLPKHLDEKVAALHLGQLGVKLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|NP_193130.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 sp|O23255.1|SAHH1_ARATH RecName: Full=Adenosylhomocysteinase 1; Short=AdoHcyase 1; AltName: 
Full=Protein EMBRYO DEFECTIVE 1395; AltName: Full=Protein 
HOMOLOGY-DEPENDENT GENE SILENCING 1; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase 1; Short=SAH hydrolase 1 [Arabidopsis 
thaliana]
 gb|AAG40389.1|AF325037_1 AT4g13940 [Arabidopsis thaliana]
 emb|CAB10173.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAC14714.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
 emb|CAB78436.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK68806.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK83621.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAL90945.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAM10030.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAO00764.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AEE83345.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPETK GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +Q+ Y+SI
Sbjct  413  FTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSI  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKPPHYRY
Sbjct  473  PIEGPYKPPHYRY  485



>gb|AFU51537.1| S-adenosyl-homocysteine hydrolase protein [Capsicum annuum]
Length=485

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +G+I+LAEGRLMNLGCA GHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTNSGVIVLAEGRLMNLGCAAGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQA YIS+
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|XP_002987608.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
 ref|XP_002987645.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11220.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11444.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
Length=485

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPETGTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+ +QAAYI++
Sbjct  413  FTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGAKLTKLSADQAAYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AGX26685.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVAPLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AGX26664.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKH DEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHFDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|EMT01272.1| Adenosylhomocysteinase [Aegilops tauschii]
Length=485

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM+GLETYPGVKRITIKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMNGLETYPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT  Q+ YISI
Sbjct  413  FTNQVIAQLELWNEKATGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKSQSDYISI  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAAYRY  485



>gb|AGX26655.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITI+PQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIEPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AGX26681.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PG KRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGAKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|XP_008803686.1| PREDICTED: adenosylhomocysteinase [Phoenix dactylifera]
Length=485

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLE +PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLENFPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKE+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YI++
Sbjct  413  FTNQVIAQLELWKERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYINV  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  473  PIEGPYKPAHYRY  485



>emb|CAJ01707.1| putative S-adenosylhomocystein hydrolase 2 [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ88218.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM+GLETYPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMNGLETYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT  Q+ YISI
Sbjct  413  FTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKAQSEYISI  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPSAYRY  485



>gb|AGX26667.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKV+VLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVHVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>emb|CAB09795.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
Length=467

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPETK GII+LA+GRLMNLGCATGHPSFVMSCS
Sbjct  335  NEIDMLGLETYPGVKRITIKPQTDRWVFPETKAGIIVLAQGRLMNLGCATGHPSFVMSCS  394

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA LHLGKLGA+L KL+ +Q+ Y+SI
Sbjct  395  FTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLRKLSKDQSDYVSI  454

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKPPHYRY
Sbjct  455  PIEGPYKPPHYRY  467



>ref|XP_006414844.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
 gb|ESQ56297.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
Length=588

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  456  NEIDMLGLETYPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCS  515

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YISI
Sbjct  516  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISI  575

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  576  PIEGPYKPAHYRY  588



>gb|AAM62888.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPETK GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +Q  Y+SI
Sbjct  413  FTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQXDYVSI  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKPPHYRY
Sbjct  473  PIEGPYKPPHYRY  485



>gb|AGX26651.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWSEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYR+
Sbjct  473  PVEGPYKPAHYRH  485



>gb|AAV31754.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AFK08605.1| S-adenosyl homocysteine hydrolase [Nicotiana benthamiana]
Length=485

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|NP_001289538.1| adenosylhomocysteinase [Nicotiana sylvestris]
 ref|XP_009622119.1| PREDICTED: adenosylhomocysteinase [Nicotiana tomentosiformis]
 ref|XP_009800926.1| PREDICTED: adenosylhomocysteinase [Nicotiana sylvestris]
 sp|P68172.1|SAHH_NICSY RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana sylvestris]
 sp|P68173.1|SAHH_TOBAC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana tabacum]
 dbj|BAA03709.1| S-adenosyl-L-homocystein hydrolase [Nicotiana sylvestris]
 dbj|BAA08142.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 dbj|BAA23164.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 gb|AAV31756.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AGX26684.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   221 bits (562),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPVTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|ABI95857.1| S-adenosyl-homocysteine hydrolase [Nicotiana suaveolens]
Length=485

 Score =   221 bits (562),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|KDO43195.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=445

 Score =   219 bits (559),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  313  NEIDMLGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCS  372

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLT+LT EQA YIS+
Sbjct  373  FTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISV  432

Query  316  PVEGPYKPPHYRY  278
              +GPYKP HYRY
Sbjct  433  SADGPYKPLHYRY  445



>dbj|BAP47515.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   221 bits (562),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVK+ITIKPQTDR+VFPETK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKKITIKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQA YIS+
Sbjct  413  FTNQVIAQLELWKEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPLAYRY  485



>emb|CDP15078.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   220 bits (561),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLE YPGVKR+TIKPQTDR++FPE +TGIIILAEGRL NLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLENYPGVKRVTIKPQTDRWIFPENETGIIILAEGRLTNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT  QAAYI++
Sbjct  413  FTNQVIAQLELWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTSGQAAYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKPPHYRY
Sbjct  473  PVEGPYKPPHYRY  485



>gb|AGX26678.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   220 bits (561),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+  +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDISSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AGX26657.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   220 bits (561),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK + KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSSKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>sp|Q9SP37.1|SAHH_LUPLU RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Lupinus luteus]
 gb|AAD56048.1|AF185635_1 S-adenosyl-L-homocysteinase [Lupinus luteus]
Length=485

 Score =   220 bits (561),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFPET TGIIILAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETHPGVKRITIKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLEKLGAKLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPFHYRY  485



>gb|AGX26666.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   220 bits (561),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITI PQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITILPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>emb|CAJ01706.1| S-adenosyl-L-homocysteine hydrolase [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   219 bits (558),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM+GLETYPGVKRITIKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  318  NEIDMNGLETYPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCS  377

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT  Q+ YISI
Sbjct  378  FTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKSQSDYISI  437

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP  YRY
Sbjct  438  PIEGPYKPAAYRY  450



>pdb|3OND|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3OND|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3ONE|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONE|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONF|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
 pdb|3ONF|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
Length=488

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFPET TGIIILAEGRLMNLGCATGHPSFVMSCS
Sbjct  356  NEIDMLGLETHPGVKRITIKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCS  415

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+ +QA YIS+
Sbjct  416  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLEKLGAKLTKLSKDQADYISV  475

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  476  PVEGPYKPFHYRY  488



>gb|AGX26656.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLD KVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDGKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>emb|CDY47309.1| BnaAnng08830D [Brassica napus]
Length=486

 Score =   220 bits (560),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  354  NEIDMQGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  413

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ Y+SI
Sbjct  414  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSI  473

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  474  PIEGPYKPAHYRY  486



>sp|P35007.1|SAHH_CATRO RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
 emb|CAA81527.1| S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
Length=485

 Score =   220 bits (560),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +QA YIS+
Sbjct  413  FTNQVIAQLELWNERKTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  473  PIEGPYKPAHYRY  485



>sp|Q01781.2|SAHH_PETCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Petroselinum crispum]
 gb|AAA33856.1| S-adenosylhomocysteine hydrolase [Petroselinum crispum]
Length=485

 Score =   220 bits (560),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFP+T  GIIILAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPDTGRGIIILAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|KDO43194.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=485

 Score =   220 bits (560),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLT+LT EQA YIS+
Sbjct  413  FTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISV  472

Query  316  PVEGPYKPPHYRY  278
              +GPYKP HYRY
Sbjct  473  SADGPYKPLHYRY  485



>ref|XP_006848518.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
 gb|ERN10099.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
Length=485

 Score =   220 bits (560),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKR TIKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMQGLETYPGVKRNTIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK TGKY+K+VYVLPKHLDEKVA+LHLGKLGA LTKL+P+QA YI++
Sbjct  413  FTNQVIAQLELWKEKGTGKYQKQVYVLPKHLDEKVASLHLGKLGAHLTKLSPDQAEYINV  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKPP YRY
Sbjct  473  PIEGPYKPPQYRY  485



>gb|AGX26672.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   219 bits (559),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEI MHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIGMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AAX16000.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   219 bits (559),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPETK GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHL+EKVA LHLGKLGA+LTKL+ +Q+ Y+SI
Sbjct  413  FTNQVIAQLELWNEKASGKYEKKVYVLPKHLNEKVALLHLGKLGARLTKLSKDQSDYVSI  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKPPHYRY
Sbjct  473  PIEGPYKPPHYRY  485



>ref|XP_006492541.1| PREDICTED: adenosylhomocysteinase-like [Citrus sinensis]
Length=485

 Score =   219 bits (559),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLT+LT EQA YIS+
Sbjct  413  FTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISV  472

Query  316  PVEGPYKPPHYRY  278
              +GPYKP HYRY
Sbjct  473  SADGPYKPLHYRY  485



>gb|AAX15998.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   219 bits (559),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPETK GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            F NQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +Q+ Y+SI
Sbjct  413  FINQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSI  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKPPHYRY
Sbjct  473  PIEGPYKPPHYRY  485



>ref|XP_009102577.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SI
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSI  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPVHYRY  485



>ref|XP_006373090.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|ABK96105.1| unknown [Populus trichocarpa]
 gb|ERP50887.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+TK+GI++LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTKSGILVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>ref|XP_009135865.1| PREDICTED: adenosylhomocysteinase 2-like [Brassica rapa]
Length=485

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMQGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SI
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSI  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  473  PIEGPYKPGHYRY  485



>gb|EYU31513.1| hypothetical protein MIMGU_mgv1a004058mg [Erythranthe guttata]
Length=547

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+TK+GIIILAEGRLMNLGCATGHPSFVMSCS
Sbjct  415  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTKSGIIILAEGRLMNLGCATGHPSFVMSCS  474

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKY K+VYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ Y+SI
Sbjct  475  FTNQVIAQLELWNERKSGKYGKEVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSI  534

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKPPHYRY
Sbjct  535  PVEGPYKPPHYRY  547



>ref|XP_006418835.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
 gb|ESQ37271.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
Length=485

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SI
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSI  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  473  PIEGPYKPVHYRY  485



>ref|NP_001234012.1| adenosylhomocysteinase [Solanum lycopersicum]
 sp|Q9SWF5.1|SAHH_SOLLC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Solanum lycopersicum]
 gb|AAD50775.1|AF161705_1 S-adenosyl-l-homocysteine hydrolase [Solanum lycopersicum]
Length=485

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+++GKYEKKVYVLPKHLDEKVAALHLGK GAKLTKLT +QA YI +
Sbjct  413  FTNQVIAQLELWNERSSGKYEKKVYVLPKHLDEKVAALHLGKFGAKLTKLTKDQADYIYV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AGX26686.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHG ET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGPETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|XP_002883461.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH59720.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=485

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SI
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSI  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  473  PIEGPYKPVHYRY  485



>gb|AGX26653.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGR MNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRPMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AGX26682.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQ ELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQPELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AGX26661.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDMHGLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGR MNLGCATGHPSFVMSCS
Sbjct  353  NEIDMHGLETFPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRPMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|XP_003629610.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89237.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AET04086.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLE YPGVKR+TIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMSGLENYPGVKRVTIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+  QA YIS+
Sbjct  413  FTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSQSQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>emb|CDY50423.1| BnaCnng19320D [Brassica napus]
Length=485

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ Y+SI
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSI  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  473  PIEGPYKPAHYRY  485



>emb|CDY01177.1| BnaA04g06420D [Brassica napus]
Length=485

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ Y+SI
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSI  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  473  PIEGPYKPAHYRY  485



>gb|EMS57266.1| Adenosylhomocysteinase [Triticum urartu]
Length=752

 Score =   224 bits (570),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 119/133 (89%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM+GLETYPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  620  NEIDMNGLETYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  679

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK TGKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT  Q+ YISI
Sbjct  680  FTNQVIAQLELWNEKATGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKAQSEYISI  739

Query  316  PVEGPYKPPHYRY  278
            PV+GPYKP  YRY
Sbjct  740  PVDGPYKPAAYRY  752



>ref|XP_007153624.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
 gb|ESW25618.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
Length=485

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLE YPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLENYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
             VEGPYKP HYRY
Sbjct  473  AVEGPYKPTHYRY  485



>gb|AAX15999.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPETK  II+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPETKAEIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +Q+ Y+SI
Sbjct  413  FTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSI  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKPPHYRY
Sbjct  473  PIEGPYKPPHYRY  485



>gb|KFK39678.1| hypothetical protein AALP_AA3G275000 [Arabis alpina]
Length=485

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SI
Sbjct  413  FTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSI  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  473  PIEGPYKPVHYRY  485



>sp|P93253.1|SAHH_MESCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Mesembryanthemum 
crystallinum]
 gb|AAB38499.1| S-adenosyl-L-homocystein hydrolase [Mesembryanthemum crystallinum]
Length=485

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLE YPGVKRITIKPQTDRFVFPET TGII+LAEGRLM LGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLENYPGVKRITIKPQTDRFVFPETNTGIIVLAEGRLMKLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|XP_001755929.1| predicted protein [Physcomitrella patens]
 gb|EDQ79214.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFP+TK G+IILAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMEGLETYPGVKRITIKPQTDRWVFPDTKRGVIILAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA LHL KLGA+LTKL+ +QA+YI++
Sbjct  413  FTNQVIAQLELWNEKKSGKYEKKVYVLPKHLDEKVALLHLEKLGARLTKLSEDQASYINV  472

Query  316  PVEGPYKPPHYRY  278
            PV GPYKP HYRY
Sbjct  473  PVGGPYKPAHYRY  485



>gb|ACN40278.1| unknown [Picea sitchensis]
Length=485

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVK+ITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMQGLETFPGVKKITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVAALHL KLGA+LTKL+P+QA YI++
Sbjct  413  FTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AHL20280.1| S-adenosylhomocysteine hydrolase [Kalanchoe daigremontiana]
Length=485

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVAALHL KLGAKLTKLT EQA YIS+
Sbjct  413  FTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVAALHLSKLGAKLTKLTKEQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP  YRY
Sbjct  473  PIEGPYKPAAYRY  485



>ref|XP_001755926.1| predicted protein [Physcomitrella patens]
 gb|EDQ79211.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFP+TK G+IILAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMEGLETYPGVKRITIKPQTDRWVFPDTKRGVIILAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVA LHL KLGA+LTKL+ +QA+YI++
Sbjct  413  FTNQVIAQLELWNEKKSGKYEKKVYVLPKHLDEKVALLHLEKLGARLTKLSEDQASYINV  472

Query  316  PVEGPYKPPHYRY  278
            PV GPYKP HYRY
Sbjct  473  PVGGPYKPAHYRY  485



>ref|XP_008671500.1| PREDICTED: adenosylhomocysteinase-like [Zea mays]
Length=426

 Score =   216 bits (551),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQ DR+VFPET TGIIILAEGRLMNLGCATGHPSFVMSCS
Sbjct  294  NEIDMLGLETYPGVKRITIKPQIDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCS  353

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQV+AQLELWKEKN+GKYEKKVYVLPKHLDEKV ALHLGK GAKLTKLT  QA YI +
Sbjct  354  FTNQVLAQLELWKEKNSGKYEKKVYVLPKHLDEKVNALHLGKHGAKLTKLTKSQADYIRV  413

Query  316  PVEGPYKPPHYRY  278
            P+EGPYK  HYRY
Sbjct  414  PIEGPYKLAHYRY  426



>gb|AEI54335.1| adenosylhomocysteinase [Glycine max]
Length=485

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLE YPGVKRITIKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLENYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQL LWKEK+ GKYEKKVYVLPKHLDEKVAALHLGKLGAKLT+L+  QA YIS+
Sbjct  413  FTNQVIAQLGLWKEKSIGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTQLSKSQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|ABR17322.1| unknown [Picea sitchensis]
Length=485

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVK+ITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMQGLETFPGVKKITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVAALHL KLGA+LTKL+P+QA YI++
Sbjct  413  FTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|ABR16138.1| unknown [Picea sitchensis]
Length=485

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVK+ITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMQGLETFPGVKKITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVAALHL KLGA+LTKL+P+QA YI++
Sbjct  413  FTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|ABR16547.1| unknown [Picea sitchensis]
 gb|ABR18363.1| unknown [Picea sitchensis]
Length=485

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVK+ITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMQGLETFPGVKKITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVAALHL KLGA+LTKL+P+QA YI++
Sbjct  413  FTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>dbj|BAE71233.1| putative adenosylhomocysteinase [Trifolium pratense]
 dbj|BAE71257.1| putative adenosylhomocysteinase [Trifolium pratense]
Length=485

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLE YPGVKRITIKPQTDR++FPET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMSGLENYPGVKRITIKPQTDRWLFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+  QA YIS+
Sbjct  413  FTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSQSQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|NP_189023.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
 sp|Q9LK36.1|SAHH2_ARATH RecName: Full=Adenosylhomocysteinase 2; Short=AdoHcyase 2; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase 1; AltName: 
Full=SAH hydrolase 2 [Arabidopsis thaliana]
 dbj|BAB01858.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAL24370.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAM13384.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAN12996.1| putative S-adenosyl-L-homocysteinase [Arabidopsis thaliana]
 gb|AEE76817.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
Length=485

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SI
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSI  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPVHYRY  485



>gb|AAL16259.1|AF428329_1 AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SI
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSI  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPVHYRY  485



>gb|AAM19782.1| AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SI
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSI  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPVHYRY  485



>ref|XP_006421018.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
 gb|ESR34258.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
Length=485

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEID+ GLETYPGVKRITIKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDVLGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK+TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLT+LT EQA YIS+
Sbjct  413  FTNQVIAQLELWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISV  472

Query  316  PVEGPYKPPHYRY  278
              +GPYKP HYRY
Sbjct  473  SADGPYKPLHYRY  485



>ref|XP_009106322.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   218 bits (554),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMQGLETYPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SI
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSI  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPVSYRY  485



>ref|XP_006297468.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
 gb|EOA30366.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
Length=507

 Score =   218 bits (556),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GIIILAEGRLMNLGCATGHPSFVMSCS
Sbjct  375  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIILAEGRLMNLGCATGHPSFVMSCS  434

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SI
Sbjct  435  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSI  494

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  495  PIEGPYKPVHYRY  507



>ref|XP_008457223.1| PREDICTED: adenosylhomocysteinase 1 [Cucumis melo]
Length=485

 Score =   218 bits (554),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPET  GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPETNVGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|XP_010512939.1| PREDICTED: adenosylhomocysteinase 2-like [Camelina sativa]
Length=485

 Score =   218 bits (554),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SI
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSI  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP +YRY
Sbjct  473  PIEGPYKPANYRY  485



>gb|KFK36282.1| hypothetical protein AALP_AA4G102500 [Arabis alpina]
Length=154

 Score =   207 bits (528),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VF ETK+GII+LAEGRLMNLGCATGH SF+MSCS
Sbjct  22   NEIDMLGLETYPGVKRITIKPQTDRWVFQETKSGIIVLAEGRLMNLGCATGHLSFIMSCS  81

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTN VIAQLELW EK++GKYEKKVY LPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YISI
Sbjct  82   FTNHVIAQLELWNEKSSGKYEKKVYGLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISI  141

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP H+RY
Sbjct  142  PIEGPYKPAHHRY  154



>gb|ABR16573.1| unknown [Picea sitchensis]
Length=485

 Score =   218 bits (554),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVK+ITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMQGLETFPGVKKITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVAALHL KLGA+LTKL+P+QA YI++
Sbjct  413  FTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINV  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  473  PIEGPYKPAHYRY  485



>ref|XP_003538528.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   218 bits (554),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET PGVKRI IKPQTDR+VFP+TK GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETCPGVKRINIKPQTDRWVFPDTKRGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELWKEK +GKYEKKVYVLPKHLDEKVA+LHLG+LGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWKEKGSGKYEKKVYVLPKHLDEKVASLHLGQLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|XP_010488460.1| PREDICTED: adenosylhomocysteinase 2 [Camelina sativa]
Length=485

 Score =   218 bits (554),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SI
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSI  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP +YRY
Sbjct  473  PIEGPYKPANYRY  485



>ref|XP_007034216.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY05142.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=510

 Score =   218 bits (555),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLE YPGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMCGLENYPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK TGKYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+ EQA YIS+
Sbjct  413  FTNQVIAQLELWNEKATGKYEKKVYVLPKHLDEKVAALHLPKLGAKLTKLSKEQADYISV  472

Query  316  PVEGPYKPPHYR  281
            PVEGPYKP HYR
Sbjct  473  PVEGPYKPAHYR  484



>ref|XP_010466740.1| PREDICTED: adenosylhomocysteinase 2-like isoform X1 [Camelina 
sativa]
Length=485

 Score =   217 bits (553),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SI
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSI  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP +YRY
Sbjct  473  PIEGPYKPANYRY  485



>gb|ABR16616.1| unknown [Picea sitchensis]
Length=450

 Score =   216 bits (551),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVK+ITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  318  NEIDMQGLETFPGVKKITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  377

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVAALHL KLGA+LTKL+P+QA YI++
Sbjct  378  FTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINV  437

Query  316  PVEGPYKPPHYRY  278
            PV+GPYKP HYRY
Sbjct  438  PVDGPYKPAHYRY  450



>ref|XP_008438321.1| PREDICTED: adenosylhomocysteinase-like [Cucumis melo]
Length=485

 Score =   217 bits (553),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM+GLET+P VKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMNGLETFPDVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNERKTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  473  PIEGPYKPAHYRY  485



>ref|XP_009139575.1| PREDICTED: adenosylhomocysteinase 1 [Brassica rapa]
Length=485

 Score =   217 bits (552),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ Y+SI
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSI  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP HYRY
Sbjct  473  PIEGPYKPAHYRY  485



>gb|ABK24229.1| unknown [Picea sitchensis]
 gb|ACN40819.1| unknown [Picea sitchensis]
Length=485

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEID+ GLE +PGVK+ITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDIQGLENFPGVKKITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+P+QA YI++
Sbjct  413  FTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGAKLTKLSPDQAEYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>ref|XP_001755906.1| predicted protein [Physcomitrella patens]
 gb|EDQ79191.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK G+IILAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMEGLETFPGVKRITIKPQTDRWVFPDTKRGVIILAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA LHL KLGA+LTKL+ +QA+YI++
Sbjct  413  FTNQVIAQLELWNERTSGKYEKKVYVLPKHLDEKVALLHLEKLGARLTKLSDDQASYINV  472

Query  316  PVEGPYKPPHYRY  278
            PV GPYKP HYRY
Sbjct  473  PVGGPYKPAHYRY  485



>gb|AER92590.1| putative S-adenosyl-L-homocysteinase [Linum usitatissimum]
Length=561

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM+GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  429  NEIDMNGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  488

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+
Sbjct  489  FTNQVIAQLELWNERASGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISV  548

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  549  PVEGPYKPAQYRY  561



>gb|ABK25129.1| unknown [Picea sitchensis]
Length=485

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEID+ GLE +PGVK+ITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDIQGLENFPGVKKITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+P+QA YI++
Sbjct  413  FTNQVIAQLELWNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGAKLTKLSPDQAEYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|EYU32710.1| hypothetical protein MIMGU_mgv1a003606mg [Erythranthe guttata]
Length=574

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLE YPGVKRITIKPQTDR+VFPETK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  442  NEIDMQGLENYPGVKRITIKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCS  501

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKY K+VYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ YISI
Sbjct  502  FTNQVIAQLELWNERKSGKYGKEVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYISI  561

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKPPHYRY
Sbjct  562  PVEGPYKPPHYRY  574



>gb|AIG62149.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>ref|XP_004138966.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 ref|XP_004162424.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN61486.1| hypothetical protein Csa_2G140370 [Cucumis sativus]
Length=485

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLE YPGVKRITIKPQTDR+VFPET  GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLENYPGVKRITIKPQTDRWVFPETNVGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPAHYRY  485



>gb|AIG62157.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|AIG62163.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|AIG62170.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|AIG62171.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>ref|XP_011003627.1| PREDICTED: adenosylhomocysteinase [Populus euphratica]
Length=485

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|AIG62191.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|AIG62182.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|AIG62173.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|AIG62176.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|AIG62152.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|AIG62164.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62189.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|AIG62190.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|AIG62186.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|AIG62161.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|AIG62187.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|AIG62160.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62162.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62167.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62172.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62183.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|AIG62151.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|AIG62150.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62153.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|AIG62184.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|AIG62166.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|AIG62168.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|AIG62181.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|ABQ18314.1| S-adenosyl-L-homocysteine hydrolase [Chrysanthemum x morifolium]
Length=485

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFPETK+G+IILAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPETKSGVIILAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK TGKY+K+VYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ Y+SI
Sbjct  413  FTNQVIAQLELWNEKGTGKYKKEVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYLSI  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYKP  YRY
Sbjct  473  PIEGPYKPAAYRY  485



>gb|AIG62185.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|AIG62148.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62175.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62192.1| S-adenosyl-L-homocysteine hydrolase [Populus alba x Populus glandulosa]
Length=485

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LT+L+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTELSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|AIG62158.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|AIG62180.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|ABJ53283.1| S-adenosyl-L-homocysteine hydrolase [Ligularia fischeri]
Length=327

 Score =   211 bits (537),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGV+RITIKPQTDR+VFPETK GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  195  NEIDMLGLETYPGVQRITIKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCS  254

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ +GKY+ +VYVLPKHLDEKVAALHLGKLGAKLT L+ +QA YI++
Sbjct  255  FTNQVIAQLELWNERKSGKYKNEVYVLPKHLDEKVAALHLGKLGAKLTVLSKDQADYINV  314

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP +YRY
Sbjct  315  PVEGPYKPLNYRY  327



>gb|AIG62165.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   215 bits (548),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGV+RITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVRRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+L LGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLRLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>sp|P32112.1|SAHH_WHEAT RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
 gb|AAA34303.1| S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
Length=485

 Score =   215 bits (548),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM+GLETYPGVKRITIKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMNGLETYPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK +GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT  Q+ YISI
Sbjct  413  FTNQVIAQLELWNEKASGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKSQSDYISI  472

Query  316  PVEGPYKPPHYRY  278
            P+EGPYK   YRY
Sbjct  473  PIEGPYKLRLYRY  485



>gb|AAK92718.1| putative S-adenosyl-L-homocysteinas protein [Arabidopsis thaliana]
Length=485

 Score =   215 bits (548),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLETYPGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETYPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPK LDEKVAALHLGKLGA+LTKLT +Q+ Y+SI
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKRLDEKVAALHLGKLGARLTKLTKDQSDYVSI  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPVHYRY  485



>gb|AIG62156.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGV+RITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVRRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|AIG62188.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   214 bits (546),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP++K+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDSKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|AHA84211.1| S-adenosyl-L-homocysteine hydrolase [Phaseolus vulgaris]
Length=485

 Score =   214 bits (546),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLE YPGVKRITIKPQTDR+VF ET TGII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLENYPGVKRITIKPQTDRWVFLETNTGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISV  472

Query  316  PVEGPYKPPHYRY  278
             VEGPYKP HYRY
Sbjct  473  AVEGPYKPTHYRY  485



>gb|AAP92452.1| S-adenosyl-L-homocystein hydrolase [Petunia x hybrida]
Length=485

 Score =   214 bits (546),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPS VMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSVVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW EK++GKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP HYRY
Sbjct  473  PVEGPYKPVHYRY  485



>gb|AIG62177.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   214 bits (545),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI+ 
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINA  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|AIG62159.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            NEIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  NEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FT+QVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTDQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



>gb|AIG62169.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  676  NEIDMHGLETYPGVKRITIKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCS  497
            +EIDM GLET+PGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCS
Sbjct  353  SEIDMLGLETFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCS  412

Query  496  FTNQVIAQLELWKEKNTGKYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISI  317
            FTNQVIAQLELW E+ TGKYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++
Sbjct  413  FTNQVIAQLELWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSEDQADYINV  472

Query  316  PVEGPYKPPHYRY  278
            PVEGPYKP  YRY
Sbjct  473  PVEGPYKPAQYRY  485



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1104504643240