BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF011L02

Length=685
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008348925.1|  PREDICTED: uncharacterized protein LOC103412105    204   1e-62   
gb|KJB25105.1|  hypothetical protein B456_004G177500                    213   2e-62   Gossypium raimondii
gb|KJB25103.1|  hypothetical protein B456_004G177500                    214   3e-62   Gossypium raimondii
ref|XP_011082185.1|  PREDICTED: uncharacterized protein LOC105165...    215   6e-62   Sesamum indicum [beniseed]
gb|KJB25104.1|  hypothetical protein B456_004G177500                    215   6e-62   Gossypium raimondii
gb|KJB25102.1|  hypothetical protein B456_004G177500                    215   8e-62   Gossypium raimondii
gb|KDP31566.1|  hypothetical protein JCGZ_15383                         215   9e-62   Jatropha curcas
ref|XP_011082184.1|  PREDICTED: uncharacterized protein LOC105165...    215   1e-61   Sesamum indicum [beniseed]
ref|XP_011082183.1|  PREDICTED: uncharacterized protein LOC105165...    215   1e-61   Sesamum indicum [beniseed]
ref|XP_007210882.1|  hypothetical protein PRUPE_ppa002815mg             212   1e-60   Prunus persica
ref|XP_007040865.1|  Xyloglucanase 113 isoform 1                        210   5e-60   
ref|XP_010518959.1|  PREDICTED: UDP-D-xylose:L-fucose alpha-1,3-D...    210   5e-60   Tarenaya hassleriana [spider flower]
ref|XP_004300682.1|  PREDICTED: uncharacterized protein LOC101298609    210   7e-60   Fragaria vesca subsp. vesca
ref|XP_006385158.1|  hypothetical protein POPTR_0004s24390g             207   5e-59   
ref|XP_007156344.1|  hypothetical protein PHAVU_003G278600g             196   9e-59   Phaseolus vulgaris [French bean]
ref|XP_002519934.1|  reticulon3-A3, putative                            207   1e-58   Ricinus communis
emb|CDP07209.1|  unnamed protein product                                206   1e-58   Coffea canephora [robusta coffee]
ref|XP_008365916.1|  PREDICTED: uncharacterized protein LOC103429...    206   1e-58   
ref|XP_009141500.1|  PREDICTED: uncharacterized protein LOC103865...    206   1e-58   Brassica rapa
ref|XP_009141501.1|  PREDICTED: uncharacterized protein LOC103865...    206   1e-58   Brassica rapa
gb|KJB51493.1|  hypothetical protein B456_008G219000                    206   2e-58   Gossypium raimondii
ref|XP_009143647.1|  PREDICTED: uncharacterized protein LOC103867343    206   2e-58   Brassica rapa
emb|CBI29197.3|  unnamed protein product                                205   3e-58   Vitis vinifera
ref|XP_002269181.2|  PREDICTED: uncharacterized protein LOC100263017    205   4e-58   Vitis vinifera
gb|KHG12903.1|  hypothetical protein F383_16835                         205   4e-58   Gossypium arboreum [tree cotton]
ref|XP_010266425.1|  PREDICTED: uncharacterized protein LOC104603...    205   4e-58   Nelumbo nucifera [Indian lotus]
ref|XP_010266424.1|  PREDICTED: uncharacterized protein LOC104603...    205   5e-58   Nelumbo nucifera [Indian lotus]
emb|CDP07210.1|  unnamed protein product                                206   5e-58   Coffea canephora [robusta coffee]
ref|XP_004142646.1|  PREDICTED: uncharacterized protein LOC101203732    204   7e-58   Cucumis sativus [cucumbers]
ref|XP_006410719.1|  hypothetical protein EUTSA_v10016368mg             204   1e-57   Eutrema salsugineum [saltwater cress]
ref|XP_009362859.1|  PREDICTED: uncharacterized protein LOC103952897    203   2e-57   Pyrus x bretschneideri [bai li]
gb|EYU37484.1|  hypothetical protein MIMGU_mgv1a002766mg                202   4e-57   Erythranthe guttata [common monkey flower]
gb|AAD15452.2|  unknown protein                                         200   7e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008444233.1|  PREDICTED: uncharacterized protein LOC103487624    201   1e-56   Cucumis melo [Oriental melon]
emb|CDP12729.1|  unnamed protein product                                200   3e-56   Coffea canephora [robusta coffee]
ref|XP_006293822.1|  hypothetical protein CARUB_v10022808mg             200   3e-56   Capsella rubella
ref|XP_009769854.1|  PREDICTED: uncharacterized protein LOC104220660    200   3e-56   Nicotiana sylvestris
ref|XP_004246017.1|  PREDICTED: uncharacterized protein LOC101254412    200   4e-56   Solanum lycopersicum
ref|XP_010056116.1|  PREDICTED: uncharacterized protein LOC104444...    200   4e-56   
ref|XP_011028505.1|  PREDICTED: uncharacterized protein LOC105128...    200   4e-56   Populus euphratica
ref|XP_011028504.1|  PREDICTED: uncharacterized protein LOC105128...    200   4e-56   Populus euphratica
ref|XP_009388198.1|  PREDICTED: uncharacterized protein LOC103975012    187   5e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010056115.1|  PREDICTED: uncharacterized protein LOC104444...    199   5e-56   Eucalyptus grandis [rose gum]
ref|XP_009388312.1|  PREDICTED: uncharacterized protein LOC103975128    187   5e-56   
dbj|BAD94473.1|  hypothetical protein                                   187   6e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010516741.1|  PREDICTED: uncharacterized protein LOC104792321    199   6e-56   Camelina sativa [gold-of-pleasure]
ref|XP_009603199.1|  PREDICTED: uncharacterized protein LOC104098231    199   8e-56   Nicotiana tomentosiformis
ref|XP_003517099.1|  PREDICTED: uncharacterized protein LOC100776463    198   1e-55   Glycine max [soybeans]
ref|XP_010505074.1|  PREDICTED: uncharacterized protein LOC104781967    198   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_006430896.1|  hypothetical protein CICLE_v10011269mg             197   2e-55   Citrus clementina [clementine]
ref|XP_010111777.1|  hypothetical protein L484_008781                   197   3e-55   Morus notabilis
ref|XP_006359953.1|  PREDICTED: uncharacterized protein LOC102605...    197   3e-55   Solanum tuberosum [potatoes]
gb|KFK36454.1|  hypothetical protein AALP_AA4G126700                    197   4e-55   Arabis alpina [alpine rockcress]
ref|XP_010676705.1|  PREDICTED: uncharacterized protein LOC104892...    195   4e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676704.1|  PREDICTED: uncharacterized protein LOC104892...    195   4e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003612490.1|  hypothetical protein MTR_5g025590                  196   9e-55   
ref|XP_009381925.1|  PREDICTED: uncharacterized protein LOC103970025    184   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006590766.1|  PREDICTED: uncharacterized protein LOC100789338    196   1e-54   Glycine max [soybeans]
ref|XP_007158076.1|  hypothetical protein PHAVU_002G122000g             196   1e-54   Phaseolus vulgaris [French bean]
ref|XP_010676703.1|  PREDICTED: uncharacterized protein LOC104892...    196   1e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010509590.1|  PREDICTED: uncharacterized protein LOC104785987    196   1e-54   Camelina sativa [gold-of-pleasure]
emb|CDY32116.1|  BnaC04g44500D                                          194   3e-54   Brassica napus [oilseed rape]
emb|CDP12731.1|  unnamed protein product                                195   3e-54   Coffea canephora [robusta coffee]
gb|KDO72261.1|  hypothetical protein CISIN_1g036925mg                   194   4e-54   Citrus sinensis [apfelsine]
ref|XP_006482352.1|  PREDICTED: uncharacterized protein LOC102613765    194   4e-54   Citrus sinensis [apfelsine]
ref|XP_004509491.1|  PREDICTED: uncharacterized protein LOC101505601    193   1e-53   Cicer arietinum [garbanzo]
ref|XP_008804433.1|  PREDICTED: uncharacterized protein LOC103717721    188   2e-53   
gb|AET03500.2|  nucleotide-diphospho-sugar transferase family pro...    192   2e-53   Medicago truncatula
gb|AES95448.2|  nucleotide-diphospho-sugar transferase family pro...    192   2e-53   Medicago truncatula
ref|XP_003629024.1|  hypothetical protein MTR_8g072310                  192   2e-53   
ref|XP_004512439.1|  PREDICTED: uncharacterized protein LOC101497257    191   5e-53   
emb|CDY40459.1|  BnaA04g20580D                                          191   1e-52   Brassica napus [oilseed rape]
gb|KHN05539.1|  hypothetical protein glysoja_020504                     190   2e-52   Glycine soja [wild soybean]
ref|XP_003547737.1|  PREDICTED: uncharacterized protein LOC100780346    190   2e-52   Glycine max [soybeans]
ref|XP_003548765.1|  PREDICTED: uncharacterized protein LOC100819032    189   3e-52   Glycine max [soybeans]
ref|NP_850250.1|  xyloglucanase 113                                     189   4e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010907098.1|  PREDICTED: uncharacterized protein LOC105033...    188   9e-52   Elaeis guineensis
ref|XP_010907097.1|  PREDICTED: uncharacterized protein LOC105033...    188   9e-52   Elaeis guineensis
ref|XP_006359954.1|  PREDICTED: uncharacterized protein LOC102605...    187   1e-51   Solanum tuberosum [potatoes]
dbj|BAH19600.1|  AT2G35610                                              187   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881404.1|  hypothetical protein ARALYDRAFT_902666             186   3e-51   
gb|KHN27499.1|  hypothetical protein glysoja_018611                     184   3e-50   Glycine soja [wild soybean]
emb|CDY31704.1|  BnaA05g08430D                                          182   9e-50   Brassica napus [oilseed rape]
emb|CDX84192.1|  BnaC04g09540D                                          181   2e-49   
ref|XP_009383104.1|  PREDICTED: uncharacterized protein LOC103970914    180   8e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006878624.1|  hypothetical protein AMTR_s00011p00260650          178   3e-48   Amborella trichopoda
gb|EPS68350.1|  hypothetical protein M569_06419                         173   7e-47   Genlisea aurea
gb|EPS68351.1|  hypothetical protein M569_06420                         157   3e-45   Genlisea aurea
ref|XP_006650304.1|  PREDICTED: uncharacterized protein LOC102706084    166   4e-44   Oryza brachyantha
ref|XP_003562333.1|  PREDICTED: uncharacterized protein LOC100845970    166   4e-44   Brachypodium distachyon [annual false brome]
gb|EPS58524.1|  hypothetical protein M569_16289                         163   4e-44   Genlisea aurea
ref|XP_002464281.1|  hypothetical protein SORBIDRAFT_01g015590          166   8e-44   Sorghum bicolor [broomcorn]
gb|KHG12902.1|  hypothetical protein F383_16835                         165   9e-44   Gossypium arboreum [tree cotton]
gb|EEE59420.1|  hypothetical protein OsJ_11574                          164   2e-43   Oryza sativa Japonica Group [Japonica rice]
gb|EEC75649.1|  hypothetical protein OsI_12401                          164   3e-43   Oryza sativa Indica Group [Indian rice]
gb|ABF97349.1|  expressed protein                                       164   3e-43   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001143144.1|  hypothetical protein                               163   4e-43   Zea mays [maize]
ref|XP_009383108.1|  PREDICTED: uncharacterized protein LOC103970917    157   9e-43   
ref|XP_004982506.1|  PREDICTED: uncharacterized protein LOC101753789    162   2e-42   Setaria italica
ref|XP_010235552.1|  PREDICTED: uncharacterized protein LOC100829311    160   1e-41   
gb|KHF98530.1|  hypothetical protein F383_12515                         156   2e-40   Gossypium arboreum [tree cotton]
ref|XP_010540709.1|  PREDICTED: uncharacterized protein LOC104814389    155   4e-40   Tarenaya hassleriana [spider flower]
emb|CDP12730.1|  unnamed protein product                                154   6e-40   Coffea canephora [robusta coffee]
gb|KHN03113.1|  hypothetical protein glysoja_049543                     134   2e-32   Glycine soja [wild soybean]
ref|XP_002988322.1|  glycosyltransferase-like protein                   130   1e-31   
ref|XP_001761094.1|  predicted protein                                  125   1e-29   
ref|XP_002991425.1|  glycosyltransferase-like protein                   124   2e-29   
gb|KHN41773.1|  Pentatricopeptide repeat-containing protein, mito...    126   4e-29   Glycine soja [wild soybean]
tpg|DAA50139.1|  TPA: hypothetical protein ZEAMMB73_624371              107   6e-26   
gb|KJB25101.1|  hypothetical protein B456_004G177500                    110   4e-24   Gossypium raimondii
gb|KCW72694.1|  hypothetical protein EUGRSUZ_E01147                     104   5e-22   Eucalyptus grandis [rose gum]
ref|XP_009383105.1|  PREDICTED: uncharacterized protein LOC103970915  83.2    1e-15   
ref|XP_002506735.1|  glycosyltransferase family 77 protein            77.8    7e-13   Micromonas commoda
ref|XP_004167890.1|  PREDICTED: uncharacterized protein LOC101229261  70.9    1e-12   
ref|XP_003062865.1|  glycosyltransferase family 77 protein            73.2    1e-11   Micromonas pusilla CCMP1545
gb|KIZ02111.1|  hypothetical protein MNEG_5846                        65.9    8e-10   Monoraphidium neglectum
ref|XP_002957630.1|  hypothetical protein VOLCADRAFT_77645            66.2    3e-09   Volvox carteri f. nagariensis
gb|KJB25098.1|  hypothetical protein B456_004G177500                  65.1    7e-09   Gossypium raimondii
ref|XP_002956941.1|  hypothetical protein VOLCADRAFT_83868            64.7    9e-09   Volvox carteri f. nagariensis
ref|XP_005843950.1|  hypothetical protein CHLNCDRAFT_37217            63.9    2e-08   Chlorella variabilis
ref|XP_005852062.1|  hypothetical protein CHLNCDRAFT_133059           60.8    2e-07   Chlorella variabilis
ref|XP_005646140.1|  hypothetical protein COCSUDRAFT_17381            60.5    2e-07   Coccomyxa subellipsoidea C-169
emb|CAN79199.1|  hypothetical protein VITISV_040773                   57.8    2e-06   Vitis vinifera
ref|XP_001692787.1|  predicted protein                                56.6    5e-06   Chlamydomonas reinhardtii
emb|CDX84231.1|  BnaC04g09930D                                        55.1    1e-05   
ref|XP_001690605.1|  hypothetical protein CHLREDRAFT_114491           53.1    6e-05   Chlamydomonas reinhardtii



>ref|XP_008348925.1| PREDICTED: uncharacterized protein LOC103412105 [Malus domestica]
Length=154

 Score =   204 bits (519),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC++G+  C  S +TT +G LRFPK S EE FKTVFS FKDVKVIQFSSM 
Sbjct  31   VKESWLDVQLCQQGTRDCIASNTTTPSGALRFPKRSNEETFKTVFSSFKDVKVIQFSSMQ  90

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GFTDKARE +FRNR KRYVGIWCCV   TPGH+YYDMYWDEKP W+PIPPQT ++D
Sbjct  91   DAFPGFTDKAREEKFRNRAKRYVGIWCCVAEHTPGHIYYDMYWDEKPGWRPIPPQTREDD  150

Query  325  HPP  317
            HPP
Sbjct  151  HPP  153



>gb|KJB25105.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=488

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC+EG+E C  S +T+  G+LRFPKNSTEE FKTVFS FKDVKVIQFSSM 
Sbjct  365  VKESWLDVQLCQEGTEDCHASSNTSRPGLLRFPKNSTEEMFKTVFSSFKDVKVIQFSSMQ  424

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
             AF  FTDK RE +FRNR+KRYVGIWCCVEN TPGH+YYDMYWDEKP WKP PPQTP+ED
Sbjct  425  GAFYSFTDKTREGKFRNRMKRYVGIWCCVENHTPGHIYYDMYWDEKPGWKPAPPQTPEED  484

Query  325  HPPW  314
            HPP+
Sbjct  485  HPPF  488



>gb|KJB25103.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=533

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC+EG+E C  S +T+  G+LRFPKNSTEE FKTVFS FKDVKVIQFSSM 
Sbjct  410  VKESWLDVQLCQEGTEDCHASSNTSRPGLLRFPKNSTEEMFKTVFSSFKDVKVIQFSSMQ  469

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
             AF  FTDK RE +FRNR+KRYVGIWCCVEN TPGH+YYDMYWDEKP WKP PPQTP+ED
Sbjct  470  GAFYSFTDKTREGKFRNRMKRYVGIWCCVENHTPGHIYYDMYWDEKPGWKPAPPQTPEED  529

Query  325  HPPW  314
            HPP+
Sbjct  530  HPPF  533



>ref|XP_011082185.1| PREDICTED: uncharacterized protein LOC105165007 isoform X3 [Sesamum 
indicum]
Length=622

 Score =   215 bits (548),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VK+SWLDV LC+EGS GC+ S STT  GIL+FPK STE+ FKT+FS FKDVKVIQFSSM 
Sbjct  499  VKKSWLDVHLCQEGSHGCEASNSTTQVGILKFPKRSTEQMFKTIFSSFKDVKVIQFSSMQ  558

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF+DK RE RFR RVKRY GIWCCVENQ+PGH+YYDMYWDEKP WKP PPQTP+ED
Sbjct  559  DAFLGFSDKTREERFRKRVKRYTGIWCCVENQSPGHIYYDMYWDEKPGWKPKPPQTPEED  618

Query  325  HPP  317
            HPP
Sbjct  619  HPP  621



>gb|KJB25104.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=620

 Score =   215 bits (547),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC+EG+E C  S +T+  G+LRFPKNSTEE FKTVFS FKDVKVIQFSSM 
Sbjct  497  VKESWLDVQLCQEGTEDCHASSNTSRPGLLRFPKNSTEEMFKTVFSSFKDVKVIQFSSMQ  556

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
             AF  FTDK RE +FRNR+KRYVGIWCCVEN TPGH+YYDMYWDEKP WKP PPQTP+ED
Sbjct  557  GAFYSFTDKTREGKFRNRMKRYVGIWCCVENHTPGHIYYDMYWDEKPGWKPAPPQTPEED  616

Query  325  HPPW  314
            HPP+
Sbjct  617  HPPF  620



>gb|KJB25102.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=634

 Score =   215 bits (548),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC+EG+E C  S +T+  G+LRFPKNSTEE FKTVFS FKDVKVIQFSSM 
Sbjct  511  VKESWLDVQLCQEGTEDCHASSNTSRPGLLRFPKNSTEEMFKTVFSSFKDVKVIQFSSMQ  570

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
             AF  FTDK RE +FRNR+KRYVGIWCCVEN TPGH+YYDMYWDEKP WKP PPQTP+ED
Sbjct  571  GAFYSFTDKTREGKFRNRMKRYVGIWCCVENHTPGHIYYDMYWDEKPGWKPAPPQTPEED  630

Query  325  HPPW  314
            HPP+
Sbjct  631  HPPF  634



>gb|KDP31566.1| hypothetical protein JCGZ_15383 [Jatropha curcas]
Length=647

 Score =   215 bits (548),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC+EG+ GC  S  T+ +G+LRFPK+S E+  K VFS FKDVKVIQFSSM 
Sbjct  524  VKESWLDVQLCQEGTHGCVASNRTSPSGVLRFPKHSNEDMIKAVFSSFKDVKVIQFSSMQ  583

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            D F GFTDKARE +FRNRVKRYVGIWCCVEN TPGHVYYDMYWDEKP+WKP+PP+TP+ D
Sbjct  584  DGFLGFTDKAREEKFRNRVKRYVGIWCCVENHTPGHVYYDMYWDEKPDWKPMPPETPELD  643

Query  325  HPPW  314
            HPPW
Sbjct  644  HPPW  647



>ref|XP_011082184.1| PREDICTED: uncharacterized protein LOC105165007 isoform X2 [Sesamum 
indicum]
Length=639

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VK+SWLDV LC+EGS GC+ S STT  GIL+FPK STE+ FKT+FS FKDVKVIQFSSM 
Sbjct  516  VKKSWLDVHLCQEGSHGCEASNSTTQVGILKFPKRSTEQMFKTIFSSFKDVKVIQFSSMQ  575

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF+DK RE RFR RVKRY GIWCCVENQ+PGH+YYDMYWDEKP WKP PPQTP+ED
Sbjct  576  DAFLGFSDKTREERFRKRVKRYTGIWCCVENQSPGHIYYDMYWDEKPGWKPKPPQTPEED  635

Query  325  HPP  317
            HPP
Sbjct  636  HPP  638



>ref|XP_011082183.1| PREDICTED: uncharacterized protein LOC105165007 isoform X1 [Sesamum 
indicum]
Length=640

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VK+SWLDV LC+EGS GC+ S STT  GIL+FPK STE+ FKT+FS FKDVKVIQFSSM 
Sbjct  517  VKKSWLDVHLCQEGSHGCEASNSTTQVGILKFPKRSTEQMFKTIFSSFKDVKVIQFSSMQ  576

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF+DK RE RFR RVKRY GIWCCVENQ+PGH+YYDMYWDEKP WKP PPQTP+ED
Sbjct  577  DAFLGFSDKTREERFRKRVKRYTGIWCCVENQSPGHIYYDMYWDEKPGWKPKPPQTPEED  636

Query  325  HPP  317
            HPP
Sbjct  637  HPP  639



>ref|XP_007210882.1| hypothetical protein PRUPE_ppa002815mg [Prunus persica]
 gb|EMJ12081.1| hypothetical protein PRUPE_ppa002815mg [Prunus persica]
Length=630

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWL+VQLC+EG+  C  S +T+ +G+LRFPK S EE FKT+FS FKDVKVIQFSSM 
Sbjct  507  VKESWLEVQLCQEGTRDCVASNTTSPSGVLRFPKRSDEETFKTIFSSFKDVKVIQFSSMQ  566

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GFTDKARE +FRNRVKRYVGIWCCV   TPGH+YYDMYWDEKP WKPIPPQTP++D
Sbjct  567  DAFPGFTDKAREEKFRNRVKRYVGIWCCVAEHTPGHIYYDMYWDEKPGWKPIPPQTPEDD  626

Query  325  HPP  317
            HPP
Sbjct  627  HPP  629



>ref|XP_007040865.1| Xyloglucanase 113 isoform 1 [Theobroma cacao]
 gb|EOY25366.1| Xyloglucanase 113 isoform 1 [Theobroma cacao]
Length=636

 Score =   210 bits (535),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKE WLDVQLC+EG+E C  S +T+  G+LRFPK+S EE FKTVFS FKDVKVIQFSSM 
Sbjct  513  VKELWLDVQLCQEGTEDCHASSNTSRPGLLRFPKHSGEETFKTVFSAFKDVKVIQFSSMQ  572

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF+DK RE +FRNRVKRYVGIWCCV++ TPGH+YYDMYWDEKP WKP PPQTP++D
Sbjct  573  DAFLGFSDKTREEKFRNRVKRYVGIWCCVDSHTPGHIYYDMYWDEKPGWKPAPPQTPEDD  632

Query  325  HPPW  314
            HPP+
Sbjct  633  HPPF  636



>ref|XP_010518959.1| PREDICTED: UDP-D-xylose:L-fucose alpha-1,3-D-xylosyltransferase 
MGP4 [Tarenaya hassleriana]
Length=631

 Score =   210 bits (535),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDV+LC+EGSEGC+ S +T+ +G+L+FPK S+EE+FK +FS FKDVKVI+FSS+ 
Sbjct  508  VKESWLDVKLCQEGSEGCEASNNTSPSGVLKFPKRSSEERFKAIFSSFKDVKVIKFSSIQ  567

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF++K RE +FR RVK YVGIWCCVEN+TPGH+YYDMYWDEKP WKP+PPQTP+ED
Sbjct  568  DAFTGFSNKEREEKFRKRVKTYVGIWCCVENKTPGHIYYDMYWDEKPGWKPVPPQTPEED  627

Query  325  HPP  317
            HPP
Sbjct  628  HPP  630



>ref|XP_004300682.1| PREDICTED: uncharacterized protein LOC101298609 [Fragaria vesca 
subsp. vesca]
Length=629

 Score =   210 bits (534),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VK+SWL+VQLC+EG   C  S +T+ +G+LRFPK S+EE FKTVFS FKDVKVI+FSSM 
Sbjct  506  VKDSWLEVQLCQEGIRDCLASNNTSPSGVLRFPKRSSEETFKTVFSSFKDVKVIKFSSMQ  565

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF DK RE RFRNRVKRYVGIWCCV  QTPGH+YYDMYWDEKP WKP+PPQTPQ+D
Sbjct  566  DAFLGFADKIREERFRNRVKRYVGIWCCVAEQTPGHIYYDMYWDEKPGWKPLPPQTPQDD  625

Query  325  HPP  317
            HPP
Sbjct  626  HPP  628



>ref|XP_006385158.1| hypothetical protein POPTR_0004s24390g [Populus trichocarpa]
 gb|ERP62955.1| hypothetical protein POPTR_0004s24390g [Populus trichocarpa]
Length=638

 Score =   207 bits (528),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC+EG+E C  S  T+  GILRFPK S E+ FKT FS FKDVKVIQFSSM 
Sbjct  515  VKESWLDVQLCQEGAEDCGASNKTSRPGILRFPKRSNEDMFKTTFSSFKDVKVIQFSSMQ  574

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GFTDK RE +FRNR+KRYVGIWCCVEN  PGH+YYDMYWDEK NWKP+PPQ+ ++D
Sbjct  575  DAFVGFTDKRREEKFRNRMKRYVGIWCCVENHDPGHIYYDMYWDEKSNWKPMPPQSAEDD  634

Query  325  HPPW  314
            HPPW
Sbjct  635  HPPW  638



>ref|XP_007156344.1| hypothetical protein PHAVU_003G278600g [Phaseolus vulgaris]
 gb|ESW28338.1| hypothetical protein PHAVU_003G278600g [Phaseolus vulgaris]
Length=195

 Score =   196 bits (497),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 106/125 (85%), Gaps = 1/125 (1%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATG-ILRFPKNSTEEKFKTVFSLFKDVKVIQFSSM  509
            +K SWLDV+LC+EG++GC +S  TT+ G +L+FPK+S EE F  VFS FKDVKVI+FSS+
Sbjct  71   IKNSWLDVKLCKEGTQGCDVSNDTTSVGGVLKFPKHSNEETFMKVFSSFKDVKVIKFSSV  130

Query  508  HDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQE  329
             DAFQGFTDK RE +FRNRVKRYVGIWCCV + +PGH+YYDMYWDEKP WK IPPQT ++
Sbjct  131  QDAFQGFTDKEREDKFRNRVKRYVGIWCCVPDLSPGHIYYDMYWDEKPGWKAIPPQTSED  190

Query  328  DHPPW  314
            DHPPW
Sbjct  191  DHPPW  195



>ref|XP_002519934.1| reticulon3-A3, putative [Ricinus communis]
 gb|EEF42538.1| reticulon3-A3, putative [Ricinus communis]
Length=639

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 108/124 (87%), Gaps = 1/124 (1%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDV LC+EG++ C  +  TT++G+L+FPK S+EEKFKTVFS FKDVKVIQFSSM 
Sbjct  517  VKESWLDVHLCQEGAQACY-ANGTTSSGVLKFPKGSSEEKFKTVFSSFKDVKVIQFSSMQ  575

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GFTDK RE +FRNRVKRY+GIWCCV++ TPGH+YYDMYWDEKP WK +PP+TP+ D
Sbjct  576  DAFLGFTDKEREAKFRNRVKRYLGIWCCVDSHTPGHIYYDMYWDEKPGWKAMPPETPELD  635

Query  325  HPPW  314
            HPPW
Sbjct  636  HPPW  639



>emb|CDP07209.1| unnamed protein product [Coffea canephora]
Length=633

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDV LC+EGS GC++S ST+  GIL+FPK S+EE +KTVFS FKDV+VIQFSSM 
Sbjct  510  VKESWLDVNLCQEGSRGCEVSNSTSQAGILKFPKRSSEETYKTVFSSFKDVEVIQFSSMQ  569

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GFTDK+ E +FR RVK Y GIWCCVEN TPGH++YD+YWDEKP+WKP PPQTP+ED
Sbjct  570  DAFSGFTDKSMEDKFRKRVKIYTGIWCCVENHTPGHIFYDIYWDEKPDWKPKPPQTPEED  629

Query  325  HPP  317
            HPP
Sbjct  630  HPP  632



>ref|XP_008365916.1| PREDICTED: uncharacterized protein LOC103429549 isoform X1 [Malus 
domestica]
 ref|XP_008365917.1| PREDICTED: uncharacterized protein LOC103429549 isoform X2 [Malus 
domestica]
Length=630

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC++G+  C  S +TT +G LRFPK S EE FKTVFS FKDVKVIQFSSM 
Sbjct  507  VKESWLDVQLCQQGTRDCIASNTTTPSGALRFPKRSNEETFKTVFSSFKDVKVIQFSSMQ  566

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GFTDKARE +FRNR KRYVGIWCCV   TPGH+YYDMYWDEKP W+PIPPQT ++D
Sbjct  567  DAFPGFTDKAREEKFRNRAKRYVGIWCCVAEHTPGHIYYDMYWDEKPGWRPIPPQTREDD  626

Query  325  HPP  317
            HPP
Sbjct  627  HPP  629



>ref|XP_009141500.1| PREDICTED: uncharacterized protein LOC103865462 isoform X1 [Brassica 
rapa]
Length=644

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC+EG EGC  S  T+++G+L++PK S E+ FK +FS F DVKVI+FSS+ 
Sbjct  521  VKESWLDVQLCQEGKEGCVASNITSSSGVLKYPKRSNEDTFKAIFSSFNDVKVIKFSSIE  580

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF+DK RE RFR RVKRYVGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+ED
Sbjct  581  DAFTGFSDKGREERFRRRVKRYVGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEED  640

Query  325  HPP  317
            HPP
Sbjct  641  HPP  643



>ref|XP_009141501.1| PREDICTED: uncharacterized protein LOC103865462 isoform X2 [Brassica 
rapa]
Length=640

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC+EG EGC  S  T+++G+L++PK S E+ FK +FS F DVKVI+FSS+ 
Sbjct  517  VKESWLDVQLCQEGKEGCVASNITSSSGVLKYPKRSNEDTFKAIFSSFNDVKVIKFSSIE  576

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF+DK RE RFR RVKRYVGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+ED
Sbjct  577  DAFTGFSDKGREERFRRRVKRYVGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEED  636

Query  325  HPP  317
            HPP
Sbjct  637  HPP  639



>gb|KJB51493.1| hypothetical protein B456_008G219000 [Gossypium raimondii]
Length=628

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            V+ESWLDVQLC+EG+E C  S +T+  G+LRFPK S+EE  K VFS FKDVKVIQFSSM 
Sbjct  505  VRESWLDVQLCQEGTEDCHASSNTSRPGLLRFPKRSSEETLKKVFSSFKDVKVIQFSSMQ  564

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GFTDK RE +FR RVK+YVGIWCCVEN  PGH+YYDMYWDEKP WKPIPP+TP++D
Sbjct  565  DAFLGFTDKTREEKFRKRVKQYVGIWCCVENHIPGHIYYDMYWDEKPGWKPIPPKTPEDD  624

Query  325  HPPW  314
            HPP+
Sbjct  625  HPPF  628



>ref|XP_009143647.1| PREDICTED: uncharacterized protein LOC103867343 [Brassica rapa]
Length=643

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC+EG EGC+ S  T+ +G L+FPK S E+ FK +FS F DVKVI+FSS+ 
Sbjct  520  VKESWLDVQLCQEGKEGCEASNITSPSGFLKFPKRSNEDTFKAIFSSFNDVKVIKFSSVE  579

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF+DK RE RFR RVKRYVGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+ED
Sbjct  580  DAFTGFSDKGREERFRRRVKRYVGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEED  639

Query  325  HPP  317
            HPP
Sbjct  640  HPP  642



>emb|CBI29197.3| unnamed protein product [Vitis vinifera]
Length=642

 Score =   205 bits (522),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VK+SWLDVQLCREGS GC ++ +T++ GI R PK+STEE FK+VFSLFKDVKVIQFS+M 
Sbjct  520  VKDSWLDVQLCREGSPGCNVTNNTSSLGI-RLPKHSTEEMFKSVFSLFKDVKVIQFSTMQ  578

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GFTDK  E +FR RVKRYVGIWCCV+   PGH+YYDMYWDEKPNWKPIPPQ  ++D
Sbjct  579  DAFLGFTDKKTEEKFRKRVKRYVGIWCCVKGSDPGHIYYDMYWDEKPNWKPIPPQASEDD  638

Query  325  HPPW  314
            HPPW
Sbjct  639  HPPW  642



>ref|XP_002269181.2| PREDICTED: uncharacterized protein LOC100263017 [Vitis vinifera]
Length=631

 Score =   205 bits (522),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VK+SWLDVQLCREGS GC ++ +T++ GI R PK+STEE FK+VFSLFKDVKVIQFS+M 
Sbjct  509  VKDSWLDVQLCREGSPGCNVTNNTSSLGI-RLPKHSTEEMFKSVFSLFKDVKVIQFSTMQ  567

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GFTDK  E +FR RVKRYVGIWCCV+   PGH+YYDMYWDEKPNWKPIPPQ  ++D
Sbjct  568  DAFLGFTDKKTEEKFRKRVKRYVGIWCCVKGSDPGHIYYDMYWDEKPNWKPIPPQASEDD  627

Query  325  HPPW  314
            HPPW
Sbjct  628  HPPW  631



>gb|KHG12903.1| hypothetical protein F383_16835 [Gossypium arboreum]
Length=619

 Score =   205 bits (521),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            V+ESWLDVQLC+EG+E C  S +T+  G+LRFPK S+EE  K VFS FKDVKVIQFSSM 
Sbjct  496  VRESWLDVQLCQEGTEDCHASSNTSQPGLLRFPKRSSEETLKKVFSSFKDVKVIQFSSMQ  555

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GFTDK RE +FR RVK+YVGIWCCVEN  PGH+YYDMYWDEKP WKP+PP+TP++D
Sbjct  556  DAFLGFTDKTREEKFRKRVKQYVGIWCCVENHIPGHIYYDMYWDEKPGWKPVPPKTPEDD  615

Query  325  HPPW  314
            HPP+
Sbjct  616  HPPF  619



>ref|XP_010266425.1| PREDICTED: uncharacterized protein LOC104603944 isoform X2 [Nelumbo 
nucifera]
Length=616

 Score =   205 bits (521),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            +KESWLDVQLC  GS+ C ++  T+  G+LR PK+S+EE  KTV S FKDVKVIQFSSM 
Sbjct  493  IKESWLDVQLCHSGSQDCHVTNKTSRPGVLRLPKHSSEETLKTVLSSFKDVKVIQFSSMQ  552

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF+GF+DK RE +FRNR+KRYVGIWCCV + TPGH+YYDMYWDEKPNW+P PP+TPQ+D
Sbjct  553  DAFEGFSDKTRETKFRNRMKRYVGIWCCVLDHTPGHIYYDMYWDEKPNWEPAPPKTPQDD  612

Query  325  HPPW  314
            HPPW
Sbjct  613  HPPW  616



>ref|XP_010266424.1| PREDICTED: uncharacterized protein LOC104603944 isoform X1 [Nelumbo 
nucifera]
Length=634

 Score =   205 bits (521),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            +KESWLDVQLC  GS+ C ++  T+  G+LR PK+S+EE  KTV S FKDVKVIQFSSM 
Sbjct  511  IKESWLDVQLCHSGSQDCHVTNKTSRPGVLRLPKHSSEETLKTVLSSFKDVKVIQFSSMQ  570

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF+GF+DK RE +FRNR+KRYVGIWCCV + TPGH+YYDMYWDEKPNW+P PP+TPQ+D
Sbjct  571  DAFEGFSDKTRETKFRNRMKRYVGIWCCVLDHTPGHIYYDMYWDEKPNWEPAPPKTPQDD  630

Query  325  HPPW  314
            HPPW
Sbjct  631  HPPW  634



>emb|CDP07210.1| unnamed protein product [Coffea canephora]
Length=705

 Score =   206 bits (523),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDV  C+EGS GC++S ST+  G+L+FPK S+EE +KTVFS FKDVKVIQFSSM 
Sbjct  513  VKESWLDVNFCQEGSRGCEVSNSTSQAGVLKFPKRSSEETYKTVFSSFKDVKVIQFSSMQ  572

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF DK+RE +FR RVK Y G+WCCVEN TPGH+ YD+YWDEKPNWKP PPQTP+ED
Sbjct  573  DAFTGFADKSREDKFRKRVKAYTGLWCCVENHTPGHILYDIYWDEKPNWKPKPPQTPEED  632

Query  325  HPP  317
            HPP
Sbjct  633  HPP  635



>ref|XP_004142646.1| PREDICTED: uncharacterized protein LOC101203732 [Cucumis sativus]
 gb|KGN54526.1| hypothetical protein Csa_4G358640 [Cucumis sativus]
Length=640

 Score =   204 bits (520),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC++ SEGC  S  T   G+L+FPK S E+ FK +FS FKDVKVIQFS+M 
Sbjct  517  VKESWLDVQLCKQESEGCSASNDTVLPGVLKFPKGSNEDTFKAIFSTFKDVKVIQFSTMQ  576

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF+DK RE +FRNRVKRYVGIWCCVEN  PGH+YYDMYWDEKPNWKP PP+TP+ED
Sbjct  577  DAFPGFSDKKREEKFRNRVKRYVGIWCCVENAAPGHIYYDMYWDEKPNWKPHPPRTPEED  636

Query  325  HPP  317
             PP
Sbjct  637  RPP  639



>ref|XP_006410719.1| hypothetical protein EUTSA_v10016368mg [Eutrema salsugineum]
 gb|ESQ52172.1| hypothetical protein EUTSA_v10016368mg [Eutrema salsugineum]
Length=645

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC+EG EGC+ S  T+ + +L+FPK S E+ FK +FS F DVKVI+FSS+ 
Sbjct  522  VKESWLDVQLCQEGKEGCEASNRTSPSRVLKFPKRSNEDTFKAIFSTFHDVKVIKFSSVE  581

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF+DK RE RFR RVKRYVGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+ED
Sbjct  582  DAFIGFSDKGREERFRRRVKRYVGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEED  641

Query  325  HPP  317
            HPP
Sbjct  642  HPP  644



>ref|XP_009362859.1| PREDICTED: uncharacterized protein LOC103952897 [Pyrus x bretschneideri]
Length=632

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC+EG+       +T+  G LRFPK S EE FKTVFS FKDVKVIQFSSM 
Sbjct  509  VKESWLDVQLCQEGTRDSVALNTTSPLGALRFPKRSNEETFKTVFSSFKDVKVIQFSSMQ  568

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GFTDKARE +FRNR KRY+GIWCCV   TPGH+YYDMYWDEKP W PIPPQTP++D
Sbjct  569  DAFAGFTDKAREEKFRNRAKRYIGIWCCVAEHTPGHIYYDMYWDEKPGWIPIPPQTPEDD  628

Query  325  HPP  317
            HPP
Sbjct  629  HPP  631



>gb|EYU37484.1| hypothetical protein MIMGU_mgv1a002766mg [Erythranthe guttata]
Length=640

 Score =   202 bits (515),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VK+SWLDV LC  GS+GC+LS  TT  GIL+ PK STEE FKT+FS FKD KVIQFSSM 
Sbjct  517  VKDSWLDVHLCVPGSKGCELSNGTTQAGILKLPKRSTEETFKTIFSSFKDKKVIQFSSMQ  576

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            +AF GFTDK RE +FR RVK Y GIWCCVEN+TPGH+YYDMYWDEKP WK +PPQTP+ED
Sbjct  577  EAFLGFTDKKREEKFRKRVKIYPGIWCCVENKTPGHIYYDMYWDEKPGWKALPPQTPEED  636

Query  325  HPPW  314
            HPP+
Sbjct  637  HPPF  640



>gb|AAD15452.2| unknown protein [Arabidopsis thaliana]
Length=528

 Score =   200 bits (508),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 106/123 (86%), Gaps = 1/123 (1%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC+EG EGC+ S +T+ + +L+FPK S E+ FK +FS F DVKVI+FSS+ 
Sbjct  406  VKESWLDVQLCQEGKEGCEASNNTSPSRVLKFPKRSNEDTFKAIFSSFDDVKVIKFSSIE  465

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF+DKA+E RFR RVKRYVGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+ED
Sbjct  466  DAFIGFSDKAKE-RFRRRVKRYVGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEED  524

Query  325  HPP  317
            HPP
Sbjct  525  HPP  527



>ref|XP_008444233.1| PREDICTED: uncharacterized protein LOC103487624 [Cucumis melo]
Length=640

 Score =   201 bits (511),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDV LC++ SEGC  S  T   G+L+FPK S E+ FK +FS FKDVKVIQFS+M 
Sbjct  517  VKESWLDVHLCKQESEGCSASNDTVLPGVLKFPKGSNEDTFKAIFSTFKDVKVIQFSTMQ  576

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF+DK RE +FRNRVKRYVGIWCCVEN  PGH+YYDMYWDEKP+WKP PP+TP+ED
Sbjct  577  DAFPGFSDKKREEKFRNRVKRYVGIWCCVENAAPGHIYYDMYWDEKPDWKPHPPRTPEED  636

Query  325  HPP  317
             PP
Sbjct  637  RPP  639



>emb|CDP12729.1| unnamed protein product [Coffea canephora]
Length=615

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 107/125 (86%), Gaps = 2/125 (2%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTA--TGILRFPKNSTEEKFKTVFSLFKDVKVIQFSS  512
            VK+SWLDV LC+EGS GCQ+S S T   TG+++FPKNS+EE ++TVFSLFKDVKV+QFSS
Sbjct  490  VKDSWLDVFLCQEGSHGCQVSSSATTNRTGVVKFPKNSSEETYRTVFSLFKDVKVLQFSS  549

Query  511  MHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQ  332
            M DAF GFTDK RE +FR R+K Y+G WCCVE+  PGH+YYD+YWDEKP WKP+PPQTP+
Sbjct  550  MQDAFIGFTDKLREEKFRKRMKAYIGRWCCVEDHFPGHIYYDIYWDEKPGWKPVPPQTPE  609

Query  331  EDHPP  317
            +DHPP
Sbjct  610  DDHPP  614



>ref|XP_006293822.1| hypothetical protein CARUB_v10022808mg [Capsella rubella]
 gb|EOA26720.1| hypothetical protein CARUB_v10022808mg [Capsella rubella]
Length=645

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC+EG EGC+ S +T+ + +L+FPK S E+ FK +FS F DVKVI+FSS+ 
Sbjct  522  VKESWLDVQLCQEGKEGCEASNNTSPSRVLKFPKRSNEDTFKAIFSSFNDVKVIKFSSVE  581

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF+DK RE +FR RVKRYVGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+ED
Sbjct  582  DAFIGFSDKEREEKFRRRVKRYVGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEED  641

Query  325  HP  320
            HP
Sbjct  642  HP  643



>ref|XP_009769854.1| PREDICTED: uncharacterized protein LOC104220660 [Nicotiana sylvestris]
Length=636

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 102/124 (82%), Gaps = 1/124 (1%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VK SWLDV LC+EGS GCQ++ ST+ TG+L+ P+++ EE  KTVFS F DVKVIQFSSM 
Sbjct  514  VKRSWLDVHLCQEGSLGCQVN-STSQTGVLKLPRHTNEETLKTVFSKFNDVKVIQFSSMQ  572

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GFTDK RE RFRNRVKRYVGIWCCVEN TPGH+YYDMYWDEKP WK   P + ++D
Sbjct  573  DAFDGFTDKTREERFRNRVKRYVGIWCCVENHTPGHIYYDMYWDEKPGWKAAAPNSTEDD  632

Query  325  HPPW  314
            HPPW
Sbjct  633  HPPW  636



>ref|XP_004246017.1| PREDICTED: uncharacterized protein LOC101254412 [Solanum lycopersicum]
Length=635

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 103/124 (83%), Gaps = 1/124 (1%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDV LC+EGS GCQ++ ST+ +G L+ PK+STEE  KTVFS FKDVKVIQFS+M 
Sbjct  513  VKESWLDVHLCQEGSPGCQVN-STSQSGALKLPKHSTEETLKTVFSKFKDVKVIQFSTMQ  571

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF  FTDK RE +FRNRVKRYVGIWCCVEN TPGH+YYDMYWDEKP WK  PP +  +D
Sbjct  572  DAFDRFTDKTREEQFRNRVKRYVGIWCCVENHTPGHIYYDMYWDEKPGWKAAPPNSTVDD  631

Query  325  HPPW  314
            HPPW
Sbjct  632  HPPW  635



>ref|XP_010056116.1| PREDICTED: uncharacterized protein LOC104444183 isoform X2 [Eucalyptus 
grandis]
Length=636

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDV+LC+ G++ CQ++ ST++ G++R PK S EE  KT FS FKD+KVIQFSSM 
Sbjct  513  VKESWLDVKLCQGGTKDCQVTNSTSSPGMIRLPKRSNEETLKTAFSSFKDIKVIQFSSMQ  572

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF+GFTD+  E RFRNRVKRYVGIWCC  +  PGH+YYDMYWDEKP WKP+PPQT  +D
Sbjct  573  DAFEGFTDQKTEERFRNRVKRYVGIWCCTVDHVPGHIYYDMYWDEKPGWKPVPPQTSADD  632

Query  325  HPPW  314
            HPPW
Sbjct  633  HPPW  636



>ref|XP_011028505.1| PREDICTED: uncharacterized protein LOC105128495 isoform X2 [Populus 
euphratica]
Length=648

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKES LDVQLC+EG++ C  S  T+  GILRFPK S E+ FKT FS FKDVKVIQFSSM 
Sbjct  525  VKESRLDVQLCQEGAKDCGASNKTSRPGILRFPKRSNEDMFKTTFSSFKDVKVIQFSSMQ  584

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GFTDK RE +FRNR+KRYVGIWCCVEN  PGH+YYDMYWDEK +WKP+PPQ+ ++D
Sbjct  585  DAFVGFTDKRREEKFRNRMKRYVGIWCCVENHDPGHIYYDMYWDEKSDWKPMPPQSAEDD  644

Query  325  HPPW  314
            HPPW
Sbjct  645  HPPW  648



>ref|XP_011028504.1| PREDICTED: uncharacterized protein LOC105128495 isoform X1 [Populus 
euphratica]
Length=652

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKES LDVQLC+EG++ C  S  T+  GILRFPK S E+ FKT FS FKDVKVIQFSSM 
Sbjct  529  VKESRLDVQLCQEGAKDCGASNKTSRPGILRFPKRSNEDMFKTTFSSFKDVKVIQFSSMQ  588

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GFTDK RE +FRNR+KRYVGIWCCVEN  PGH+YYDMYWDEK +WKP+PPQ+ ++D
Sbjct  589  DAFVGFTDKRREEKFRNRMKRYVGIWCCVENHDPGHIYYDMYWDEKSDWKPMPPQSAEDD  648

Query  325  HPPW  314
            HPPW
Sbjct  649  HPPW  652



>ref|XP_009388198.1| PREDICTED: uncharacterized protein LOC103975012 [Musa acuminata 
subsp. malaccensis]
Length=155

 Score =   187 bits (475),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKES L+VQLC   S+GC +S  TT+ G ++FP+NSTE+ +  VFS +KD+KV+ FSSM 
Sbjct  31   VKESLLNVQLCDAHSKGCNISDGTTSRGFIQFPRNSTEQMYMQVFSQYKDIKVLHFSSMA  90

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            +AFQGF D+ARE +FRNR+KRYVG+WCCVEN+ PGH+YYD+YWDEKP WKP PP+T Q+D
Sbjct  91   NAFQGFNDEAREVKFRNRMKRYVGLWCCVENRDPGHIYYDIYWDEKPEWKPEPPRTSQDD  150

Query  325  HPPW  314
            HPPW
Sbjct  151  HPPW  154



>ref|XP_010056115.1| PREDICTED: uncharacterized protein LOC104444183 isoform X1 [Eucalyptus 
grandis]
 gb|KCW72693.1| hypothetical protein EUGRSUZ_E01147 [Eucalyptus grandis]
Length=638

 Score =   199 bits (507),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDV+LC+ G++ CQ++ ST++ G++R PK S EE  KT FS FKD+KVIQFSSM 
Sbjct  515  VKESWLDVKLCQGGTKDCQVTNSTSSPGMIRLPKRSNEETLKTAFSSFKDIKVIQFSSMQ  574

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF+GFTD+  E RFRNRVKRYVGIWCC  +  PGH+YYDMYWDEKP WKP+PPQT  +D
Sbjct  575  DAFEGFTDQKTEERFRNRVKRYVGIWCCTVDHVPGHIYYDMYWDEKPGWKPVPPQTSADD  634

Query  325  HPPW  314
            HPPW
Sbjct  635  HPPW  638



>ref|XP_009388312.1| PREDICTED: uncharacterized protein LOC103975128 [Musa acuminata 
subsp. malaccensis]
Length=155

 Score =   187 bits (475),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKES L+VQLC   S+GC +S  TT+ G ++FP+NSTE+ +  VFS +KD+KV+ FSSM 
Sbjct  31   VKESLLNVQLCDAHSKGCNISDGTTSRGFIQFPRNSTEQMYMQVFSQYKDIKVLHFSSMA  90

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            +AFQGF D+ARE +FRNR+KRYVG+WCCVEN+ PGH+YYD+YWDEKP WKP PP+T Q+D
Sbjct  91   NAFQGFNDEAREVKFRNRMKRYVGMWCCVENRDPGHIYYDIYWDEKPEWKPEPPRTSQDD  150

Query  325  HPPW  314
            HPPW
Sbjct  151  HPPW  154



>dbj|BAD94473.1| hypothetical protein [Arabidopsis thaliana]
Length=145

 Score =   187 bits (474),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC+EG EGC+ S +T+ + +L+FPK S E+ FK +FS F DVKVI+FSS+ 
Sbjct  22   VKESWLDVQLCQEGKEGCEASNNTSPSRVLKFPKRSNEDTFKAIFSSFDDVKVIKFSSIE  81

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF+DK RE RFR RVKRYVGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+ED
Sbjct  82   DAFIGFSDKEREERFRRRVKRYVGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEED  141

Query  325  HPP  317
            HPP
Sbjct  142  HPP  144



>ref|XP_010516741.1| PREDICTED: uncharacterized protein LOC104792321 [Camelina sativa]
Length=644

 Score =   199 bits (506),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC+EG + C+ S  T+ + +L+FPK S E+ FK +FS F DVKVI+FSS+ 
Sbjct  521  VKESWLDVQLCQEGKDECEASNKTSPSRVLKFPKRSNEDTFKAIFSFFDDVKVIKFSSVE  580

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF+DK RE +FR RVKRYVGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+ED
Sbjct  581  DAFAGFSDKEREEKFRKRVKRYVGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEED  640

Query  325  HPP  317
            HPP
Sbjct  641  HPP  643



>ref|XP_009603199.1| PREDICTED: uncharacterized protein LOC104098231 [Nicotiana tomentosiformis]
Length=636

 Score =   199 bits (506),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 102/124 (82%), Gaps = 1/124 (1%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VK+SWLDV LC EGS GCQ++ ST+ TG+L+ PK++ EE  KTVFS F DVKVIQFSSM 
Sbjct  514  VKKSWLDVHLCHEGSLGCQVN-STSQTGVLKLPKHTNEETLKTVFSKFNDVKVIQFSSMQ  572

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GFTDK RE +FRNRVKRYVGIWCCVEN TPGH+YYDMYWDEKP WK   P + ++D
Sbjct  573  DAFDGFTDKTREEQFRNRVKRYVGIWCCVENHTPGHIYYDMYWDEKPGWKAAAPNSTEDD  632

Query  325  HPPW  314
            HPPW
Sbjct  633  HPPW  636



>ref|XP_003517099.1| PREDICTED: uncharacterized protein LOC100776463 [Glycine max]
Length=627

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VK+SWLDVQLC++G++ C  S +TT  G+L+FP++S EE++  VFS FKD+KVIQFSSM 
Sbjct  504  VKKSWLDVQLCKDGTQDCFASNNTTVGGVLKFPRHSNEERYMKVFSSFKDIKVIQFSSMQ  563

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF+DK RE RFR RVKRY GIWCCV + TPGH+YYDMYWDEKP WKPIPPQT  +D
Sbjct  564  DAFAGFSDKEREDRFRKRVKRYPGIWCCVLDHTPGHIYYDMYWDEKPEWKPIPPQTSADD  623

Query  325  HPPW  314
            HPPW
Sbjct  624  HPPW  627



>ref|XP_010505074.1| PREDICTED: uncharacterized protein LOC104781967 [Camelina sativa]
Length=644

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC++G + C+ S  T+ + +L+FPK S E+ FK +FS F DVKVI+FSS+ 
Sbjct  521  VKESWLDVQLCQDGKDECEASNKTSPSRVLKFPKRSNEDTFKAIFSFFDDVKVIKFSSVE  580

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF+DK RE +FR RVKRYVGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+ED
Sbjct  581  DAFTGFSDKEREEKFRKRVKRYVGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEED  640

Query  325  HPP  317
            HPP
Sbjct  641  HPP  643



>ref|XP_006430896.1| hypothetical protein CICLE_v10011269mg [Citrus clementina]
 gb|ESR44136.1| hypothetical protein CICLE_v10011269mg [Citrus clementina]
Length=639

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKES L+VQLC +    CQ S +T++ GILRFP++S+EE FKTVFS FKDVKVI FSSM 
Sbjct  516  VKESRLEVQLCDDTLIDCQASSNTSSPGILRFPRHSSEETFKTVFSSFKDVKVINFSSMK  575

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            +AF  FTDK RE RFR RVKRYVGIWCCV++ TPGH+YYDMYWDEKP+WKPIPPQTP +D
Sbjct  576  NAFLNFTDKTREERFRRRVKRYVGIWCCVDSHTPGHIYYDMYWDEKPDWKPIPPQTPGDD  635

Query  325  HPPW  314
            HPPW
Sbjct  636  HPPW  639



>ref|XP_010111777.1| hypothetical protein L484_008781 [Morus notabilis]
 gb|EXC31691.1| hypothetical protein L484_008781 [Morus notabilis]
Length=635

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 102/123 (83%), Gaps = 1/123 (1%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VK+SWL+V LC EG+E C  S  T+  G+LRFPK+S EE  KT+FS FKDVKVIQFSSMH
Sbjct  513  VKDSWLEVHLCEEGAEDCHASNDTSRPGVLRFPKHSNEETLKTIFSSFKDVKVIQFSSMH  572

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
             AF GFTDK RE +FR R+KRYVGIWCCV + TPGH+YYDMYWDEKP+WKPIPPQ P++D
Sbjct  573  -AFMGFTDKTREEKFRRRMKRYVGIWCCVMDHTPGHIYYDMYWDEKPDWKPIPPQKPEDD  631

Query  325  HPP  317
            HPP
Sbjct  632  HPP  634



>ref|XP_006359953.1| PREDICTED: uncharacterized protein LOC102605574 isoform X1 [Solanum 
tuberosum]
Length=635

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 103/124 (83%), Gaps = 1/124 (1%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VK+SWLDV LC+EGS GCQ++ ST+ +G+L+ PK+STEE  KT FS FKDVKVIQFSSM 
Sbjct  513  VKKSWLDVHLCQEGSPGCQVN-STSQSGVLKLPKHSTEETLKTAFSKFKDVKVIQFSSMQ  571

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF  FTDK RE +FRNRVKRYVGIWCCVE  TPGH+YYDMYWDEKP WK  PP + ++D
Sbjct  572  DAFDRFTDKTREEQFRNRVKRYVGIWCCVETGTPGHIYYDMYWDEKPGWKAAPPNSTKDD  631

Query  325  HPPW  314
            HPPW
Sbjct  632  HPPW  635



>gb|KFK36454.1| hypothetical protein AALP_AA4G126700 [Arabis alpina]
Length=642

 Score =   197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC+EG EGC+ S +T+ + +L+FPK S E+ FK +FS F +VKVI+FSS+ 
Sbjct  519  VKESWLDVQLCQEGKEGCEASNNTSPSQVLKFPKRSNEDTFKAIFSSFNNVKVIKFSSVE  578

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF+DK RE +FR RVKRYVGIWCC EN+TPGH+YY+MYWDEKP WKP+PP TP+ED
Sbjct  579  DAFIGFSDKGREEKFRRRVKRYVGIWCCEENKTPGHIYYNMYWDEKPGWKPVPPLTPEED  638

Query  325  HPPW  314
            HPP+
Sbjct  639  HPPF  642



>ref|XP_010676705.1| PREDICTED: uncharacterized protein LOC104892459 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=531

 Score =   195 bits (496),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC+ GS+ C ++ +++A G+LRFPK   EE +KTVFS FK+VKVI F S+ 
Sbjct  408  VKESWLDVQLCQVGSKDCHVTDNSSAPGLLRFPKYGNEETYKTVFSSFKNVKVINFLSIQ  467

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF DK RE +FR RVKRYVGIWCCV N+T GH+YYDMYWDEKP WKP+PPQTP+ED
Sbjct  468  DAFTGFADKEREQKFRRRVKRYVGIWCCVTNRTIGHIYYDMYWDEKPGWKPLPPQTPEED  527

Query  325  HPP  317
            HPP
Sbjct  528  HPP  530



>ref|XP_010676704.1| PREDICTED: uncharacterized protein LOC104892459 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=533

 Score =   195 bits (496),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC+ GS+ C ++ +++A G+LRFPK   EE +KTVFS FK+VKVI F S+ 
Sbjct  410  VKESWLDVQLCQVGSKDCHVTDNSSAPGLLRFPKYGNEETYKTVFSSFKNVKVINFLSIQ  469

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF DK RE +FR RVKRYVGIWCCV N+T GH+YYDMYWDEKP WKP+PPQTP+ED
Sbjct  470  DAFTGFADKEREQKFRRRVKRYVGIWCCVTNRTIGHIYYDMYWDEKPGWKPLPPQTPEED  529

Query  325  HPP  317
            HPP
Sbjct  530  HPP  532



>ref|XP_003612490.1| hypothetical protein MTR_5g025590 [Medicago truncatula]
Length=628

 Score =   196 bits (498),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 98/124 (79%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VK+SWLDV LC+EG++ C  S + T  G+L+FPK+S EE F  VFS FKDVKVIQFSSM 
Sbjct  505  VKKSWLDVHLCKEGTQNCNASNNVTVGGVLKFPKHSNEEMFMKVFSSFKDVKVIQFSSMQ  564

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF DK RE RFR RVK Y GIWCCV + TPGH+YYD+YWDEKP WKPIPPQT  +D
Sbjct  565  DAFTGFKDKEREDRFRKRVKHYTGIWCCVTDHTPGHIYYDIYWDEKPGWKPIPPQTSADD  624

Query  325  HPPW  314
            HPPW
Sbjct  625  HPPW  628



>ref|XP_009381925.1| PREDICTED: uncharacterized protein LOC103970025 [Musa acuminata 
subsp. malaccensis]
Length=155

 Score =   184 bits (466),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKES L+VQLC   S+GC +S  TT+   ++FP+NSTE+ +  VFS +KD+KV+ FSSM 
Sbjct  31   VKESLLNVQLCDAHSKGCNISDGTTSRDFIQFPRNSTEQMYMQVFSQYKDIKVLHFSSMA  90

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            +AFQGF D+ARE +FRNR+KRYVG+WCCVEN+ PGH+YYD+YWDEKP WKP PP+T Q+D
Sbjct  91   NAFQGFDDEAREVKFRNRMKRYVGMWCCVENRDPGHIYYDIYWDEKPEWKPEPPRTSQDD  150

Query  325  HPPW  314
            HPPW
Sbjct  151  HPPW  154



>ref|XP_006590766.1| PREDICTED: uncharacterized protein LOC100789338 [Glycine max]
Length=627

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VK SWLDVQLC++G++ C  S +TT  G+L+FP++S EE +  VF  FKD+KVIQFSSM 
Sbjct  504  VKMSWLDVQLCKDGTQDCFASNNTTVGGVLKFPRHSNEETYMKVFLSFKDIKVIQFSSMQ  563

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF+DK RE RFR RVKRY GIWCCV + TPGH+YYDMYWDEKP WKPIPPQT  +D
Sbjct  564  DAFSGFSDKEREDRFRKRVKRYTGIWCCVLDHTPGHIYYDMYWDEKPEWKPIPPQTSADD  623

Query  325  HPPW  314
            HPPW
Sbjct  624  HPPW  627



>ref|XP_007158076.1| hypothetical protein PHAVU_002G122000g [Phaseolus vulgaris]
 gb|ESW30070.1| hypothetical protein PHAVU_002G122000g [Phaseolus vulgaris]
Length=626

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VK+SWLDV LC+EG++ C  S +T+  G+L+FP++S EE +  +FS FKD+KVIQFSSM 
Sbjct  503  VKKSWLDVHLCKEGTQDCVASNNTSIGGVLKFPRHSNEETYMKIFSSFKDIKVIQFSSMQ  562

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF+DK RE +FR RVKRYVGIWCCV + TPGH+YYDMYWDEKP WKP+PPQT  +D
Sbjct  563  DAFTGFSDKEREDKFRKRVKRYVGIWCCVLDHTPGHIYYDMYWDEKPEWKPLPPQTSADD  622

Query  325  HPPW  314
            HPPW
Sbjct  623  HPPW  626



>ref|XP_010676703.1| PREDICTED: uncharacterized protein LOC104892459 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=629

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC+ GS+ C ++ +++A G+LRFPK   EE +KTVFS FK+VKVI F S+ 
Sbjct  506  VKESWLDVQLCQVGSKDCHVTDNSSAPGLLRFPKYGNEETYKTVFSSFKNVKVINFLSIQ  565

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF DK RE +FR RVKRYVGIWCCV N+T GH+YYDMYWDEKP WKP+PPQTP+ED
Sbjct  566  DAFTGFADKEREQKFRRRVKRYVGIWCCVTNRTIGHIYYDMYWDEKPGWKPLPPQTPEED  625

Query  325  HPP  317
            HPP
Sbjct  626  HPP  628



>ref|XP_010509590.1| PREDICTED: uncharacterized protein LOC104785987 [Camelina sativa]
Length=644

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC++G + C+ S  T+ + +L+FPK S E+ FK++FS F DVKVI+FSS+ 
Sbjct  521  VKESWLDVQLCQDGKDECEASNKTSPSRVLKFPKRSNEDTFKSIFSFFDDVKVIKFSSVE  580

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF+DK RE +FR RVKRYVGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQT +ED
Sbjct  581  DAFTGFSDKEREEKFRKRVKRYVGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTAEED  640

Query  325  HPP  317
            HPP
Sbjct  641  HPP  643



>emb|CDY32116.1| BnaC04g44500D [Brassica napus]
Length=636

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 101/123 (82%), Gaps = 4/123 (3%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC    +GC+ S  T+++G L+FPK S E+ FK +FS F DVKVI+FSS+ 
Sbjct  517  VKESWLDVQLC----QGCEASNITSSSGALKFPKRSNEDTFKAIFSTFNDVKVIKFSSVE  572

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF+DK RE RFR RV RYVGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+ED
Sbjct  573  DAFTGFSDKGREERFRRRVMRYVGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEED  632

Query  325  HPP  317
            HPP
Sbjct  633  HPP  635



>emb|CDP12731.1| unnamed protein product [Coffea canephora]
Length=646

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 105/125 (84%), Gaps = 2/125 (2%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTA--TGILRFPKNSTEEKFKTVFSLFKDVKVIQFSS  512
            VK+SWLDV LC EGS+GCQ+S   T   TG+L+FPKNS++E + TVFSLFKDVKV+QFSS
Sbjct  521  VKDSWLDVDLCHEGSQGCQVSSYATINQTGVLKFPKNSSQETYWTVFSLFKDVKVLQFSS  580

Query  511  MHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQ  332
            M DAF GFTDK RE +FR R+K Y+G WCCVE+ +PGH+YYD+YWDEKP WKP PP+TP+
Sbjct  581  MEDAFIGFTDKLREEKFRKRMKAYIGRWCCVEDHSPGHIYYDIYWDEKPGWKPEPPRTPE  640

Query  331  EDHPP  317
            +DHPP
Sbjct  641  DDHPP  645



>gb|KDO72261.1| hypothetical protein CISIN_1g036925mg [Citrus sinensis]
Length=639

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKES L+VQLC +    CQ S +T++ GILRFP++S+EE FKTVFS FKDVKVI FSSM 
Sbjct  516  VKESRLEVQLCDDTLIDCQASSNTSSPGILRFPRHSSEETFKTVFSSFKDVKVINFSSMK  575

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            +AF  FTDK RE RFR RVKRYVGIWCCV++ TPGH+YYDMYWDEKP+WKPIPPQTP +D
Sbjct  576  NAFLNFTDKTREERFRRRVKRYVGIWCCVDSHTPGHIYYDMYWDEKPDWKPIPPQTPGDD  635

Query  325  HPPW  314
            H PW
Sbjct  636  HLPW  639



>ref|XP_006482352.1| PREDICTED: uncharacterized protein LOC102613765 [Citrus sinensis]
Length=639

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKES L+VQLC +    CQ S +T++ GILRFP++S+EE FKTVFS FKDVKVI FSSM 
Sbjct  516  VKESRLEVQLCDDTLIDCQASSNTSSPGILRFPRHSSEETFKTVFSSFKDVKVINFSSMK  575

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            +AF  FTDK RE RFR RVKRYVGIWCCV++ TPGH+YYDMYWDEKP+WKPIPPQTP +D
Sbjct  576  NAFLNFTDKTREERFRRRVKRYVGIWCCVDSHTPGHIYYDMYWDEKPDWKPIPPQTPGDD  635

Query  325  HPPW  314
            H PW
Sbjct  636  HLPW  639



>ref|XP_004509491.1| PREDICTED: uncharacterized protein LOC101505601 [Cicer arietinum]
Length=638

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VK+SWLDVQLC+EG++ C  S ++T  G+L+FPKNS+EE F  VFS FKDVKVIQ SS+ 
Sbjct  515  VKKSWLDVQLCKEGTQDCDGSYNSTVEGVLKFPKNSSEEMFTKVFSSFKDVKVIQLSSVQ  574

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GFT+K RE RFRNRVK+YVGIWCC+ + T GH+YYDMYWDEKP WKPIPPQ+ ++D
Sbjct  575  DAFTGFTNKEREDRFRNRVKQYVGIWCCMPDTTIGHIYYDMYWDEKPGWKPIPPQSSEDD  634

Query  325  HPPW  314
            HPP+
Sbjct  635  HPPF  638



>ref|XP_008804433.1| PREDICTED: uncharacterized protein LOC103717721 [Phoenix dactylifera]
Length=396

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            +KES L+VQLC + S  CQ++  TT  G+LRFPK+ST++ F   FSL+KDVKVIQFSSM 
Sbjct  273  IKESLLEVQLCDDHSAKCQIANETTRRGVLRFPKHSTQQMFIQAFSLYKDVKVIQFSSME  332

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAFQGFTD+ RE +FR RVKRYVG+WCCVE++ PGH+YYDMYWDEKP WKP PP+T ++D
Sbjct  333  DAFQGFTDEVREEKFRKRVKRYVGLWCCVESRDPGHIYYDMYWDEKPGWKPEPPRTREDD  392

Query  325  HPPW  314
             PPW
Sbjct  393  RPPW  396



>gb|AET03500.2| nucleotide-diphospho-sugar transferase family protein [Medicago 
truncatula]
Length=637

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VK+SWLDVQLC+EG++GC  S ++T  G+L+FPK+S EE F  VFS FKDVKVI+ SS+ 
Sbjct  514  VKKSWLDVQLCKEGTQGCDGSYNSTVGGVLKFPKHSNEEMFMKVFSSFKDVKVIKLSSVE  573

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GFT+K RE RFRNRVKRYVGIWCC+ +   GH+YYDMYWDEKP WK IPPQ+P+ED
Sbjct  574  DAFTGFTNKEREDRFRNRVKRYVGIWCCMPDTPIGHIYYDMYWDEKPGWKAIPPQSPEED  633

Query  325  HPP  317
            HPP
Sbjct  634  HPP  636



>gb|AES95448.2| nucleotide-diphospho-sugar transferase family protein [Medicago 
truncatula]
Length=688

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VK+SWLDV LC+EG++ C  S + T  G+L+FPK+S EE F  VFS FKDVKVIQFSSM 
Sbjct  505  VKKSWLDVHLCKEGTQNCNASNNVTVGGVLKFPKHSNEEMFMKVFSSFKDVKVIQFSSMQ  564

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF DK RE RFR RVK Y GIWCCV + TPGH+YYD+YWDEKP WKPIPPQT  +D
Sbjct  565  DAFTGFKDKEREDRFRKRVKHYTGIWCCVTDHTPGHIYYDIYWDEKPGWKPIPPQTSADD  624

Query  325  HPP  317
            HPP
Sbjct  625  HPP  627



>ref|XP_003629024.1| hypothetical protein MTR_8g072310 [Medicago truncatula]
Length=655

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VK+SWLDVQLC+EG++GC  S ++T  G+L+FPK+S EE F  VFS FKDVKVI+ SS+ 
Sbjct  532  VKKSWLDVQLCKEGTQGCDGSYNSTVGGVLKFPKHSNEEMFMKVFSSFKDVKVIKLSSVE  591

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GFT+K RE RFRNRVKRYVGIWCC+ +   GH+YYDMYWDEKP WK IPPQ+P+ED
Sbjct  592  DAFTGFTNKEREDRFRNRVKRYVGIWCCMPDTPIGHIYYDMYWDEKPGWKAIPPQSPEED  651

Query  325  HPP  317
            HPP
Sbjct  652  HPP  654



>ref|XP_004512439.1| PREDICTED: uncharacterized protein LOC101497257 [Cicer arietinum]
Length=623

 Score =   191 bits (485),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VK S LDV LC+EG++ C +S + T  G+L+FPK+S EE F  VF+ FKDVKVIQFSSM 
Sbjct  500  VKMSRLDVHLCKEGTQYCNVSNNVTVGGVLKFPKHSNEESFMKVFTSFKDVKVIQFSSMQ  559

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GFT+K RE RFR RVK Y GIWCCV + TPGH+YYD+YWDEKP WKPIPPQT ++D
Sbjct  560  DAFTGFTNKEREDRFRKRVKHYTGIWCCVMDHTPGHIYYDIYWDEKPGWKPIPPQTSEDD  619

Query  325  HPPW  314
            HPPW
Sbjct  620  HPPW  623



>emb|CDY40459.1| BnaA04g20580D [Brassica napus]
Length=640

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC+EG EGC  S  TT +G L+FPK S E+ FK +FS F DVKVI+FSS+ 
Sbjct  517  VKESWLDVQLCQEGKEGCVASNITTPSGALKFPKRSNEDTFKAIFSSFNDVKVIKFSSVE  576

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF+DK RE RFR RVKRYVGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+ED
Sbjct  577  DAFTGFSDKEREERFRRRVKRYVGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEED  636

Query  325  HPP  317
            HPP
Sbjct  637  HPP  639



>gb|KHN05539.1| hypothetical protein glysoja_020504 [Glycine soja]
Length=637

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 101/134 (75%), Gaps = 10/134 (7%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VK SWLDVQLC++G++ C  S +TT  G+L+FP++S EE +  VF  FKD+KVIQFSSM 
Sbjct  504  VKMSWLDVQLCKDGTQDCFASNNTTVGGVLKFPRHSNEETYMKVFLSFKDIKVIQFSSMQ  563

Query  505  DAFQGFTDKAR----------EHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWK  356
            DAF GF+DKAR          E RFR RVKRY GIWCCV + TPGH+YYDMYWDEKP WK
Sbjct  564  DAFSGFSDKARTSTLISFEEREDRFRKRVKRYTGIWCCVLDHTPGHIYYDMYWDEKPEWK  623

Query  355  PIPPQTPQEDHPPW  314
            PIPPQT  +DHPPW
Sbjct  624  PIPPQTSADDHPPW  637



>ref|XP_003547737.1| PREDICTED: uncharacterized protein LOC100780346 [Glycine max]
Length=638

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 103/126 (82%), Gaps = 2/126 (2%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXS--TTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSS  512
            VK+SWLDVQLC++G++ C  S S  TT  G+L+FPK+S EE F  VFS  KDVKVI+FS+
Sbjct  513  VKKSWLDVQLCKDGTQDCDASASNDTTVGGVLKFPKHSNEEMFMKVFSSLKDVKVIKFST  572

Query  511  MHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQ  332
            + DAF GFTDK RE +FRNRVKRYVGIWCCV + +PGH+YYDMYWDEKP WK +PPQT +
Sbjct  573  VQDAFTGFTDKEREEKFRNRVKRYVGIWCCVPDHSPGHIYYDMYWDEKPGWKAVPPQTSE  632

Query  331  EDHPPW  314
            +DHPP+
Sbjct  633  DDHPPY  638



>ref|XP_003548765.1| PREDICTED: uncharacterized protein LOC100819032 [Glycine max]
Length=639

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 102/127 (80%), Gaps = 3/127 (2%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXST---TATGILRFPKNSTEEKFKTVFSLFKDVKVIQFS  515
            VK+SWLDVQLC+EG++ C  S S       G+L+FPK+S EE F  VFS FKDVKVI+FS
Sbjct  513  VKKSWLDVQLCKEGTQDCDASASNDTNVGGGVLKFPKHSNEETFMKVFSSFKDVKVIKFS  572

Query  514  SMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTP  335
            S+ +AF GFTDK RE +FRNRVKRYVGIWCCV + TPGH+YYDMYWDEKP WK +PPQT 
Sbjct  573  SVQEAFTGFTDKEREDKFRNRVKRYVGIWCCVPDHTPGHIYYDMYWDEKPGWKAVPPQTS  632

Query  334  QEDHPPW  314
            ++DHPP+
Sbjct  633  EDDHPPY  639



>ref|NP_850250.1| xyloglucanase 113 [Arabidopsis thaliana]
 gb|AAL67023.1| unknown protein [Arabidopsis thaliana]
 gb|AEC09128.1| xyloglucanase 113 [Arabidopsis thaliana]
 gb|AHL38813.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=644

 Score =   189 bits (480),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC+EG EGC+ S +T+ + +L+FPK S E+ FK +FS F DVKVI+FSS+ 
Sbjct  521  VKESWLDVQLCQEGKEGCEASNNTSPSRVLKFPKRSNEDTFKAIFSSFDDVKVIKFSSIE  580

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF+DK RE RFR RVKRYVGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+ED
Sbjct  581  DAFIGFSDKEREERFRRRVKRYVGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEED  640

Query  325  HPP  317
            HPP
Sbjct  641  HPP  643



>ref|XP_010907098.1| PREDICTED: uncharacterized protein LOC105033849 isoform X2 [Elaeis 
guineensis]
Length=641

 Score =   188 bits (477),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKES L+VQLC + S  CQ++  TT  G+LRFPK+ST++ F  VFSL+KDVKV+QFSSM 
Sbjct  518  VKESLLEVQLCDDRSAKCQIANETTRRGVLRFPKHSTQQMFIQVFSLYKDVKVLQFSSME  577

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            D FQGFTD+ARE +FR RVKRYVG+WCCVE++  GH+YYDMYWDEKP WKP PPQT ++D
Sbjct  578  DVFQGFTDEAREEKFRKRVKRYVGLWCCVEHRDRGHIYYDMYWDEKPGWKPEPPQTREDD  637

Query  325  HPPW  314
             PPW
Sbjct  638  RPPW  641



>ref|XP_010907097.1| PREDICTED: uncharacterized protein LOC105033849 isoform X1 [Elaeis 
guineensis]
Length=643

 Score =   188 bits (477),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKES L+VQLC + S  CQ++  TT  G+LRFPK+ST++ F  VFSL+KDVKV+QFSSM 
Sbjct  520  VKESLLEVQLCDDRSAKCQIANETTRRGVLRFPKHSTQQMFIQVFSLYKDVKVLQFSSME  579

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            D FQGFTD+ARE +FR RVKRYVG+WCCVE++  GH+YYDMYWDEKP WKP PPQT ++D
Sbjct  580  DVFQGFTDEAREEKFRKRVKRYVGLWCCVEHRDRGHIYYDMYWDEKPGWKPEPPQTREDD  639

Query  325  HPPW  314
             PPW
Sbjct  640  RPPW  643



>ref|XP_006359954.1| PREDICTED: uncharacterized protein LOC102605574 isoform X2 [Solanum 
tuberosum]
Length=634

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 100/123 (81%), Gaps = 1/123 (1%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VK+SWLDV LC+EGS GCQ++ ST+ +G+L+ PK+STEE  KT FS FKDVKVIQFSSM 
Sbjct  513  VKKSWLDVHLCQEGSPGCQVN-STSQSGVLKLPKHSTEETLKTAFSKFKDVKVIQFSSMQ  571

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF  FTDK RE +FRNRVKRYVGIWCCVE  TPGH+YYDMYWDEKP WK  PP + ++ 
Sbjct  572  DAFDRFTDKTREEQFRNRVKRYVGIWCCVETGTPGHIYYDMYWDEKPGWKAAPPNSTEDY  631

Query  325  HPP  317
            H P
Sbjct  632  HMP  634



>dbj|BAH19600.1| AT2G35610 [Arabidopsis thaliana]
Length=644

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC+EG EGC+ S +T+ + +L+FPK S E+ FK +FS F DVKVI+FSS+ 
Sbjct  521  VKESWLDVQLCQEGKEGCEASNNTSPSRVLKFPKRSNEDTFKAIFSSFDDVKVIKFSSIE  580

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF+DK RE RFR RVKRYVGIWCC EN+TPGH+YY+MYWDEKP WKP+PPQTP+ED
Sbjct  581  DAFIGFSDKEREERFRRRVKRYVGIWCCEENKTPGHIYYEMYWDEKPGWKPVPPQTPEED  640

Query  325  HPP  317
            HPP
Sbjct  641  HPP  643



>ref|XP_002881404.1| hypothetical protein ARALYDRAFT_902666 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57663.1| hypothetical protein ARALYDRAFT_902666 [Arabidopsis lyrata subsp. 
lyrata]
Length=640

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC+EG EGC+ S +T+ + +L+FPK S E+ FK +FS F++VKVI+FSS+ 
Sbjct  517  VKESWLDVQLCQEGKEGCEPSNNTSPSQVLKFPKRSNEDTFKAIFSSFENVKVIKFSSIE  576

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF+DK RE RFR RVKRYVGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+ED
Sbjct  577  DAFIGFSDKEREERFRRRVKRYVGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEED  636

Query  325  HPP  317
            HPP
Sbjct  637  HPP  639



>gb|KHN27499.1| hypothetical protein glysoja_018611 [Glycine soja]
Length=648

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 104/136 (76%), Gaps = 12/136 (9%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXS--TTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSS  512
            VK+SWLDVQLC++G++ C  S S  TT  G+L+FPK+S EE F  VFS  KDVKVI+FS+
Sbjct  513  VKKSWLDVQLCKDGTQDCDASASNDTTVGGVLKFPKHSNEEMFMKVFSSLKDVKVIKFST  572

Query  511  MHDAFQGFTDKA----------REHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPN  362
            + DAF GFTDKA          RE +FRNRVKRYVGIWCCV + +PGH+YYDMYWDEKP 
Sbjct  573  VQDAFTGFTDKAGTFCFFSFEEREEKFRNRVKRYVGIWCCVPDHSPGHIYYDMYWDEKPG  632

Query  361  WKPIPPQTPQEDHPPW  314
            WK +PPQT ++DHPP+
Sbjct  633  WKAVPPQTSEDDHPPY  648



>emb|CDY31704.1| BnaA05g08430D [Brassica napus]
Length=632

 Score =   182 bits (462),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 95/123 (77%), Gaps = 11/123 (9%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC+EG EGC+ S  T+ +G L+FPK S E+ FK +FS F DVKVI+FSS  
Sbjct  520  VKESWLDVQLCQEGKEGCEASNITSPSGFLKFPKRSNEDTFKAIFSSFNDVKVIKFSS--  577

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
                      RE RFR RVKRYVGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+ED
Sbjct  578  ---------GREERFRRRVKRYVGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEED  628

Query  325  HPP  317
            HPP
Sbjct  629  HPP  631



>emb|CDX84192.1| BnaC04g09540D [Brassica napus]
Length=632

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 95/123 (77%), Gaps = 11/123 (9%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VK+SWLDVQLC+EG EGC+ +  TT +G L+FPK S E+ FK +FS F DVKVI+FSS  
Sbjct  520  VKDSWLDVQLCQEGKEGCEATNITTPSGFLKFPKRSNEDTFKAIFSSFNDVKVIKFSS--  577

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
                      RE RFR RVKRYVGIWCC EN+TPGH+YYDMYWDEKP WKP+PPQTP+ED
Sbjct  578  ---------GREERFRRRVKRYVGIWCCEENKTPGHIYYDMYWDEKPGWKPVPPQTPEED  628

Query  325  HPP  317
            HPP
Sbjct  629  HPP  631



>ref|XP_009383104.1| PREDICTED: uncharacterized protein LOC103970914 [Musa acuminata 
subsp. malaccensis]
Length=682

 Score =   180 bits (456),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKES L+VQLC   S+GC +S  TT+ G ++FP+NSTE+ +  VFS +KD+KV+ FSSM 
Sbjct  558  VKESLLNVQLCDAHSKGCNISNETTSRGFIQFPRNSTEQMYMQVFSQYKDIKVLHFSSMA  617

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            +AF+GF+D+ARE +FR+RVKRYVG WCC+EN+  GHVYYDMYWDEKP WKP PP+T ++D
Sbjct  618  NAFKGFSDEAREAKFRSRVKRYVGKWCCLENRDLGHVYYDMYWDEKPGWKPEPPRTNEDD  677

Query  325  HPPW  314
            +PPW
Sbjct  678  YPPW  681



>ref|XP_006878624.1| hypothetical protein AMTR_s00011p00260650 [Amborella trichopoda]
 gb|ERM94769.1| hypothetical protein AMTR_s00011p00260650 [Amborella trichopoda]
Length=638

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 1/124 (1%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKES LDV+LC EGS  C  +      G+LRFPK+S EE FK VFS +K VKVI+FSSM 
Sbjct  516  VKESMLDVELCDEGSFNCH-ANEKEQHGVLRFPKHSNEETFKAVFSSYKHVKVIRFSSMQ  574

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAFQGF+D+ RE +FR+RVKRYVGIWCCV+ +  GH+YYDMYWDEKPNWKP+ P+T  ED
Sbjct  575  DAFQGFSDEGREEKFRHRVKRYVGIWCCVDQKRIGHIYYDMYWDEKPNWKPVLPETEHED  634

Query  325  HPPW  314
            HP W
Sbjct  635  HPNW  638



>gb|EPS68350.1| hypothetical protein M569_06419, partial [Genlisea aurea]
Length=546

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 96/124 (77%), Gaps = 1/124 (1%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VK SWLDV LC   S+GC+++ +T +T +++FP+ S EE F  VFS FKDVKVI+FSSM 
Sbjct  424  VKYSWLDVTLCNPKSKGCEVT-TTNSTALIKFPRESAEETFMAVFSAFKDVKVIRFSSMQ  482

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
             AF  F D+ RE  FR RVKRY+G WCC+EN+  GH++YDMYWDEKPNWKP+PP+T  ED
Sbjct  483  RAFSRFNDETREELFRKRVKRYLGAWCCLENKALGHIFYDMYWDEKPNWKPVPPKTKAED  542

Query  325  HPPW  314
            HPP+
Sbjct  543  HPPF  546



>gb|EPS68351.1| hypothetical protein M569_06420, partial [Genlisea aurea]
Length=92

 Score =   157 bits (398),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -1

Query  598  LRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCV  419
            L+ P+ S+EE FK VFS FKDVKVI+FSSM  AF GFTDK RE  FR RVK Y GIWCCV
Sbjct  1    LKLPRESSEETFKAVFSPFKDVKVIRFSSMQRAFAGFTDKTREASFRKRVKGYTGIWCCV  60

Query  418  ENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDH  323
            EN+TPGH+YYDMYWDEKPNWKP+PPQTP EDH
Sbjct  61   ENKTPGHIYYDMYWDEKPNWKPVPPQTPAEDH  92



>ref|XP_006650304.1| PREDICTED: uncharacterized protein LOC102706084 [Oryza brachyantha]
Length=618

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKES+ +V+LC E S  C  +  T     +  P+NSTE+    +F  +KD+K++QFSSM 
Sbjct  494  VKESFREVELCNEHSTRCSATNRTNKGAPVLLPRNSTEQTILNIFKPYKDIKILQFSSMV  553

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF+GF+D A E +FRNRVKRYVG+WCCV+ +  GH+YYDMYWDEKP WKP+PPQT +ED
Sbjct  554  DAFRGFSDAAVETKFRNRVKRYVGLWCCVQFREIGHIYYDMYWDEKPGWKPLPPQTKEED  613

Query  325  HPPW  314
            HPPW
Sbjct  614  HPPW  617



>ref|XP_003562333.1| PREDICTED: uncharacterized protein LOC100845970 [Brachypodium 
distachyon]
Length=614

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKES+L+VQLC E S  C  +  T     L   +NSTEE    VFSL+K++K+IQFSSM 
Sbjct  490  VKESFLEVQLCDEHSTRCSTANGTNKHRPLILARNSTEETLLNVFSLYKNIKIIQFSSMV  549

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF+GF D A E +FR+RVKRYVGIWCCVE +  GH+YYDMYWDEKP WKP PP+  +ED
Sbjct  550  DAFRGFADAAVETKFRDRVKRYVGIWCCVELREIGHIYYDMYWDEKPGWKPHPPRNREED  609

Query  325  HPPW  314
            HPPW
Sbjct  610  HPPW  613



>gb|EPS58524.1| hypothetical protein M569_16289, partial [Genlisea aurea]
Length=402

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = -1

Query  682  KESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHD  503
            +ESWL V LC   S+GC++S +TT   IL+ P+NS+EE  + VFS FKDVK IQFSSM D
Sbjct  295  EESWLKVHLCDTKSKGCRISNATTTGRILKLPENSSEETLRAVFSRFKDVKTIQFSSMQD  354

Query  502  AFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNW  359
            AF+GFTDK R   FR R+KRY G+WCCVEN TPGH+YYDMYWDEKPNW
Sbjct  355  AFRGFTDKTRAESFRRRMKRYTGLWCCVENVTPGHIYYDMYWDEKPNW  402



>ref|XP_002464281.1| hypothetical protein SORBIDRAFT_01g015590 [Sorghum bicolor]
 gb|EER91279.1| hypothetical protein SORBIDRAFT_01g015590 [Sorghum bicolor]
Length=615

 Score =   166 bits (419),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VK+S LDVQLC E S  C     T        P+NSTEEK   + S +KDVK+IQFSSM 
Sbjct  491  VKDSLLDVQLCDEHSSRCSAVDETDKHRPFLLPRNSTEEKLLDLLSPYKDVKIIQFSSMV  550

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF D A E +FRNRVKRYVG+WCCVE +  GH+YYDMYWDEKP WKP PP+T ++D
Sbjct  551  DAFGGFADAAVEKKFRNRVKRYVGLWCCVEFRDIGHIYYDMYWDEKPGWKPHPPETREQD  610

Query  325  HPPW  314
            HPPW
Sbjct  611  HPPW  614



>gb|KHG12902.1| hypothetical protein F383_16835 [Gossypium arboreum]
Length=611

 Score =   165 bits (418),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 90/124 (73%), Gaps = 17/124 (14%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            V+ESWLDVQLC+EG+E C  S +T+  G+LRFPK S+EE  K VFS FKDVK        
Sbjct  505  VRESWLDVQLCQEGTEDCHASSNTSQPGLLRFPKRSSEETLKKVFSSFKDVK--------  556

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
                      RE +FR RVK+YVGIWCCVEN  PGH+YYDMYWDEKP WKP+PP+TP++D
Sbjct  557  ---------TREEKFRKRVKQYVGIWCCVENHIPGHIYYDMYWDEKPGWKPVPPKTPEDD  607

Query  325  HPPW  314
            HPP+
Sbjct  608  HPPF  611



>gb|EEE59420.1| hypothetical protein OsJ_11574 [Oryza sativa Japonica Group]
Length=683

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKES+L+V+LC E S  C  +  T     +  P+NSTE+    +F  +KD+K++QFSSM 
Sbjct  430  VKESFLEVELCNEHSTRCSTTNRTNKGAPVLLPRNSTEQTLLDIFKPYKDIKILQFSSMV  489

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            +AF GF+D A + +FRNRVKRYVG+WCCV+ +  GH+YYDMYWDEKP WKP+PPQT  ED
Sbjct  490  NAFGGFSDAAVDTKFRNRVKRYVGLWCCVQLREIGHIYYDMYWDEKPGWKPLPPQTKVED  549

Query  325  HPPW  314
            HPPW
Sbjct  550  HPPW  553



>gb|EEC75649.1| hypothetical protein OsI_12401 [Oryza sativa Indica Group]
Length=622

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKES+L+V+LC E S  C  +  T     +  P+NSTE+    +F  +KD+K++QFSSM 
Sbjct  494  VKESFLEVELCNEHSTRCSTTNRTNKGAPVLLPRNSTEQTLLDIFKPYKDIKILQFSSMV  553

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            +AF GF+D A + +FRNRVKRYVG+WCCV+ +  GH+YYDMYWDEKP WKP+PPQT  ED
Sbjct  554  NAFGGFSDAAVDTKFRNRVKRYVGLWCCVQLREIGHIYYDMYWDEKPGWKPLPPQTKVED  613

Query  325  HPPW  314
            HPPW
Sbjct  614  HPPW  617



>gb|ABF97349.1| expressed protein [Oryza sativa Japonica Group]
Length=622

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKES+L+V+LC E S  C  +  T     +  P+NSTE+    +F  +KD+K++QFSSM 
Sbjct  494  VKESFLEVELCNEHSTRCSTTNRTNKGAPVLLPRNSTEQTLLDIFKPYKDIKILQFSSMV  553

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            +AF GF+D A + +FRNRVKRYVG+WCCV+ +  GH+YYDMYWDEKP WKP+PPQT  ED
Sbjct  554  NAFGGFSDAAVDTKFRNRVKRYVGLWCCVQLREIGHIYYDMYWDEKPGWKPLPPQTKVED  613

Query  325  HPPW  314
            HPPW
Sbjct  614  HPPW  617



>ref|NP_001143144.1| hypothetical protein [Zea mays]
 gb|ACG29327.1| hypothetical protein [Zea mays]
 gb|ACN27867.1| unknown [Zea mays]
 gb|ACR35913.1| unknown [Zea mays]
 tpg|DAA50140.1| TPA: hypothetical protein ZEAMMB73_624371 [Zea mays]
Length=615

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VK+S L+V+LC E S  C         G    P+NSTEEK   + S +KDVK+IQFSSM 
Sbjct  491  VKDSLLEVELCDEHSSRCSAIDEIDKHGTFLLPRNSTEEKLLDLLSSYKDVKIIQFSSMV  550

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF D A E +FRNRV RYVG+WCCVE +  GH+YYDMYWDEKP WKP PP+T ++D
Sbjct  551  DAFGGFADAAVEKKFRNRVNRYVGLWCCVEFREIGHIYYDMYWDEKPGWKPHPPETREQD  610

Query  325  HPPW  314
            HPPW
Sbjct  611  HPPW  614



>ref|XP_009383108.1| PREDICTED: uncharacterized protein LOC103970917 [Musa acuminata 
subsp. malaccensis]
Length=272

 Score =   157 bits (396),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKES L+VQLC   S+GC +S  TT+ G ++FP+NSTE+ +  VFS +KD++V+ FSSM 
Sbjct  166  VKESLLNVQLCDAHSKGCNISNETTSRGFIQFPRNSTEQVYMQVFSQYKDIQVLHFSSMS  225

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKP  365
            +AF GF+D+ARE  FRNRVKRYVG WCCV NQ+P H+YYDMYWDEKP
Sbjct  226  NAFLGFSDEAREATFRNRVKRYVGTWCCVRNQSPSHIYYDMYWDEKP  272



>ref|XP_004982506.1| PREDICTED: uncharacterized protein LOC101753789 [Setaria italica]
Length=619

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKES L+VQLC + S  C     T     L   +NSTEEK   +FS +K VKVIQFSSM 
Sbjct  495  VKESLLEVQLCDDHSSRCSAVNGTDKHRPLLLSRNSTEEKLLNIFSSYKSVKVIQFSSMV  554

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF GF D   E +FRNRVKRYVG+WCCVE +  GH+YYDMYWDEKP WKP PP+T ++D
Sbjct  555  DAFGGFADADVEMKFRNRVKRYVGLWCCVELREIGHIYYDMYWDEKPGWKPHPPETREQD  614

Query  325  HPPW  314
            HPPW
Sbjct  615  HPPW  618



>ref|XP_010235552.1| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
 ref|XP_010235553.1| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
 ref|XP_010235554.1| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
 ref|XP_010235555.1| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
 ref|XP_003572620.2| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
Length=642

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKES+L+VQLC E S  C  +  T     L   +N+TEE    VFS +K++K++QFSS+ 
Sbjct  518  VKESFLEVQLCDEHSTRCSTANETNKHRPLILARNNTEETLLNVFSPYKNIKILQFSSIV  577

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            DAF+GF D A E +FR+RVKRYVGIWCCVE +  GH+YYDMYWDEKP WKP PPQ  ++D
Sbjct  578  DAFRGFADAAVETKFRDRVKRYVGIWCCVEFREIGHIYYDMYWDEKPGWKPHPPQNREDD  637

Query  325  HPPW  314
            HPPW
Sbjct  638  HPPW  641



>gb|KHF98530.1| hypothetical protein F383_12515 [Gossypium arboreum]
Length=605

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 83/124 (67%), Gaps = 29/124 (23%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC+EG+E C  S +T+  G+LRFPKNSTEE                     
Sbjct  511  VKESWLDVQLCQEGTEDCHASSNTSRPGLLRFPKNSTEEM--------------------  550

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
                      RE +FRNR+KRYVGIWCCVEN TPGH+YYDMYWDEKP WKP PPQTP+ED
Sbjct  551  ---------TREEKFRNRMKRYVGIWCCVENHTPGHIYYDMYWDEKPGWKPAPPQTPEED  601

Query  325  HPPW  314
            HPP+
Sbjct  602  HPPF  605



>ref|XP_010540709.1| PREDICTED: uncharacterized protein LOC104814389 [Tarenaya hassleriana]
Length=598

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 85/107 (79%), Gaps = 3/107 (3%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDV+LC EG   C+ S +T ++G ++FPK S+EE+FK  FS  KDVKVI F S+ 
Sbjct  491  VKESWLDVKLCHEG---CETSDNTISSGFIKFPKRSSEERFKATFSSLKDVKVINFYSVQ  547

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKP  365
            DAF GF+DK RE +FR RVKRYVG WCCVEN+T GH+YYDMYWDEKP
Sbjct  548  DAFTGFSDKEREEKFRRRVKRYVGRWCCVENRTLGHIYYDMYWDEKP  594



>emb|CDP12730.1| unnamed protein product [Coffea canephora]
Length=622

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 91/118 (77%), Gaps = 2/118 (2%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKES L V LC+EGSE CQ+S +T+ TG+L+ PKNS+EE +KTVFS FKDVKV+QFSSM 
Sbjct  507  VKESRLVVSLCQEGSEDCQVSNATSQTGVLKVPKNSSEETYKTVFSSFKDVKVVQFSSMQ  566

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQ  332
            DAF+GFTDK+ E  FR RV  Y  IWCCV N T   + YD+YWDEKP+WKP P + P+
Sbjct  567  DAFRGFTDKSMEENFRKRVTAYTSIWCCV-NYT-QVISYDIYWDEKPDWKPKPSRIPE  622



>gb|KHN03113.1| hypothetical protein glysoja_049543 [Glycine soja]
Length=610

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 78/127 (61%), Gaps = 32/127 (25%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXS---TTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFS  515
            VK+SWLDVQLC+EG++ C  S S       G+L+FPK+S EE                  
Sbjct  513  VKKSWLDVQLCKEGTQDCDASASNDTNVGGGVLKFPKHSNEE------------------  554

Query  514  SMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTP  335
                         RE +FRNRVKRYVGIWCCV + TPGH+YYDMYWDEKP WK +PPQT 
Sbjct  555  -----------TEREDKFRNRVKRYVGIWCCVPDHTPGHIYYDMYWDEKPGWKAVPPQTS  603

Query  334  QEDHPPW  314
            ++DHPP+
Sbjct  604  EDDHPPY  610



>ref|XP_002988322.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ10741.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=557

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 80/124 (65%), Gaps = 4/124 (3%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            +K S L ++LC  G +      S  + G +  P N T+ + +  FS  KDVK++ FS+M 
Sbjct  437  IKTSRLSIRLCSRGKD----CSSEVSQGAIELPINMTDTQLRDEFSRHKDVKILDFSTMQ  492

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            + F GF DK +  +FR R+++Y GIWCC+E+   GH+YYD +WDEKP WKP+PP  P+ D
Sbjct  493  NVFGGFVDKDKALKFRRRLQKYTGIWCCLESLERGHIYYDFFWDEKPGWKPLPPTRPEND  552

Query  325  HPPW  314
            HPP+
Sbjct  553  HPPF  556



>ref|XP_001761094.1| predicted protein [Physcomitrella patens]
 gb|EDQ74161.1| predicted protein, partial [Physcomitrella patens]
Length=526

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 74/113 (65%), Gaps = 2/113 (2%)
 Frame = -1

Query  655  CREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKA  476
            C     GC    +  ++G+L+ PKNST+E+      +F   K+++F+S  D F GF +  
Sbjct  415  CDRKLAGCS-HKNKVSSGVLKLPKNSTDEELSAKLDIFNKFKILEFTSAIDVFGGFRNIV  473

Query  475  REHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  317
               +F  R+K Y GIWCCV ++TPGH++YD+YWDEKPNWKP+PP TP +DH P
Sbjct  474  -SMKFTRRIKSYTGIWCCVMDKTPGHIWYDIYWDEKPNWKPLPPATPADDHQP  525



>ref|XP_002991425.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ07537.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=545

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 79/124 (64%), Gaps = 5/124 (4%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            +K S L ++LC  G + C    S  + G +  P N T+ + +  FS  KDVK++ FS+M 
Sbjct  426  IKTSRLSIRLCSRG-KNCS---SEVSQGAIELPINMTDTQLRDEFSRHKDVKILDFSTMK  481

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
            + F GF DK    +FR R++RY  IWCC+E+   GH+YYD +WDEKP WKP+PP  P+ D
Sbjct  482  NVFGGFVDKV-TLKFRRRLQRYTAIWCCLESLERGHIYYDFFWDEKPGWKPLPPTRPEND  540

Query  325  HPPW  314
            HPP+
Sbjct  541  HPPF  544



>gb|KHN41773.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine 
soja]
Length=1470

 Score =   126 bits (317),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 59/123 (48%), Positives = 74/123 (60%), Gaps = 29/123 (24%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VK+SWLDVQLC++G++ C  S +TT  G+L+FP++S EE+ +                  
Sbjct  504  VKKSWLDVQLCKDGTQDCFASNNTTVGGVLKFPRHSNEEREREDRFR-------------  550

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQED  326
                             RVKRY GIWCCV + TPGH+YYDMYWDEKP WKPIPPQT  +D
Sbjct  551  ----------------KRVKRYPGIWCCVLDHTPGHIYYDMYWDEKPEWKPIPPQTSADD  594

Query  325  HPP  317
            HPP
Sbjct  595  HPP  597



>tpg|DAA50139.1| TPA: hypothetical protein ZEAMMB73_624371 [Zea mays]
Length=67

 Score =   107 bits (266),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -1

Query  511  MHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQ  332
            M DAF GF D A E +FRNRV RYVG+WCCVE +  GH+YYDMYWDEKP WKP PP+T +
Sbjct  1    MVDAFGGFADAAVEKKFRNRVNRYVGLWCCVEFREIGHIYYDMYWDEKPGWKPHPPETRE  60

Query  331  EDHPPW  314
            +DHPPW
Sbjct  61   QDHPPW  66



>gb|KJB25101.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=588

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDVQLC+EG+E C  S +T+  G+LRFPKNSTEE FKTVFS FKDVKVIQFSSM 
Sbjct  511  VKESWLDVQLCQEGTEDCHASSNTSRPGLLRFPKNSTEEMFKTVFSSFKDVKVIQFSSMQ  570

Query  505  DAFQGFTDKAR  473
             AF  FTDKA+
Sbjct  571  GAFYSFTDKAK  581



>gb|KCW72694.1| hypothetical protein EUGRSUZ_E01147 [Eucalyptus grandis]
Length=611

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKESWLDV+LC+ G++ CQ++ ST++ G++R PK S EE  KT FS FKD+KVIQFSSM 
Sbjct  515  VKESWLDVKLCQGGTKDCQVTNSTSSPGMIRLPKRSNEETLKTAFSSFKDIKVIQFSSMQ  574

Query  505  DAFQGFTDKAREHRF  461
            DAF+GFTD+ R H +
Sbjct  575  DAFEGFTDQVRIHLY  589



>ref|XP_009383105.1| PREDICTED: uncharacterized protein LOC103970915 [Musa acuminata 
subsp. malaccensis]
Length=245

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            VKES L+V LC   SE C +S  T++ G ++FP+NSTE+ +  VFS +KD+KV+ FSSM 
Sbjct  166  VKESLLNVHLCDAHSEECNISNETSSHGFIQFPRNSTEQMYMQVFSQYKDIKVLHFSSMT  225

Query  505  DAFQGFTDKA  476
            +AFQGF+D+ 
Sbjct  226  NAFQGFSDQV  235



>ref|XP_002506735.1| glycosyltransferase family 77 protein [Micromonas sp. RCC299]
 gb|ACO67993.1| glycosyltransferase family 77 protein [Micromonas sp. RCC299]
Length=746

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 65/112 (58%), Gaps = 5/112 (4%)
 Frame = -1

Query  685  VKESWLDVQLCRE-GSEGCQLSXSTTATG---ILRFPKNSTEEKFKTVFSLFKDVKVIQF  518
            V++S + V L  E G E C  +    A      +   +N T+ + +T+ + +KDVKV+ F
Sbjct  615  VRDSTVTVSLVDECGREECTQAVGKAAPAGQDTIVAARNFTDVQVQTLLTEYKDVKVLNF  674

Query  517  SSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPN  362
            +SM  AF  F D     +F NR+K+Y  IWCC +++ PGH++YDM +D  P+
Sbjct  675  TSMVGAFSQFEDPEDAKKFSNRIKKYAAIWCC-KHRNPGHIWYDMEFDIVPH  725



>ref|XP_004167890.1| PREDICTED: uncharacterized protein LOC101229261 [Cucumis sativus]
Length=77

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -2

Query  537  MSK*FSSHQCMMPSKVLLTRPGNTDSGTESSGMWVYGVVWKIKHQVTYTTTCIGMRNLIG  358
            MS+  SS QC MPS V L R G   SGTESS    YGVVW+++   TY TTC GMRN IG
Sbjct  1    MSRLSSSLQCKMPSLVSLIRKGKRSSGTESSVTSAYGVVWRMQLLATYITTCTGMRNPIG  60

Query  357  NQYRPRLHKKITPLGEI  307
            N  R    +KI  L ++
Sbjct  61   NHTRLEHPRKIDLLCKV  77



>ref|XP_003062865.1| glycosyltransferase family 77 protein [Micromonas pusilla CCMP1545]
 gb|EEH52804.1| glycosyltransferase family 77 protein [Micromonas pusilla CCMP1545]
Length=525

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 50/92 (54%), Gaps = 2/92 (2%)
 Frame = -1

Query  631  QLSXSTTATGILRF--PKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFR  458
            Q       +G+ R   P N+T+ +   + S    VKV+ F+S   AF    D A   +F 
Sbjct  416  QAEGEPAPSGVKRVVAPGNATDVEIANLLSNHAGVKVLNFTSTLGAFGRHADAADAKKFS  475

Query  457  NRVKRYVGIWCCVENQTPGHVYYDMYWDEKPN  362
             RVKRY G+WCCV +  PGH++YDM +D  P+
Sbjct  476  TRVKRYAGLWCCVFDAVPGHIWYDMEFDVVPH  507



>gb|KIZ02111.1| hypothetical protein MNEG_5846 [Monoraphidium neglectum]
Length=233

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 51/99 (52%), Gaps = 9/99 (9%)
 Frame = -1

Query  655  CREGSEGCQLSXSTTATGILRFPKNSTEEKFKT-----VFSLFKDVKVIQFSSMHDAFQG  491
            CR GS GC    +      L F +   EE+  +       S    + V+ F+S+  AF  
Sbjct  117  CRHGSVGCATGDNPA---TLEFNRLFVEERLDSDRLAMALSSVASISVLNFTSIGSAFGN  173

Query  490  FTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWD  374
            F+  A   RF+ R+ +Y  +WCCV+   PGHV+YD++WD
Sbjct  174  FSRPADFTRFQRRMAQYGAVWCCVDAH-PGHVHYDLWWD  211



>ref|XP_002957630.1| hypothetical protein VOLCADRAFT_77645 [Volvox carteri f. nagariensis]
 gb|EFJ41296.1| hypothetical protein VOLCADRAFT_77645 [Volvox carteri f. nagariensis]
Length=535

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 53/110 (48%), Gaps = 7/110 (6%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGI------LRFPKNSTEEKFKTVFSLFKDVKVI  524
            V++  + V+LC  G+  C          I      +R        + +   S  K  KV+
Sbjct  406  VRDDRVVVELCNPGTPECSDGREPAKLQIDGGVAKVRVQAGLPSGQLEVALSSVKTTKVL  465

Query  523  QFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWD  374
             F++M +A   F+D A   RF NR+K Y  IWCCV    PGH++YDM +D
Sbjct  466  HFTTMANAMGDFSDSAVAARFTNRMKLYGSIWCCVLAH-PGHIHYDMLFD  514



>gb|KJB25098.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=559

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLF  542
            VKESWLDVQLC+EG+E C  S +T+  G+LRFPKNSTEE    +  L 
Sbjct  511  VKESWLDVQLCQEGTEDCHASSNTSRPGLLRFPKNSTEEMVWLILHLL  558



>ref|XP_002956941.1| hypothetical protein VOLCADRAFT_83868 [Volvox carteri f. nagariensis]
 gb|EFJ42066.1| hypothetical protein VOLCADRAFT_83868 [Volvox carteri f. nagariensis]
Length=647

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 52/104 (50%), Gaps = 1/104 (1%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMH  506
            V ES + V +C+ G   C    +    G++R       ++        +  K+I  S+  
Sbjct  417  VNESRVTVVICKPGEADCSNGDAPAPDGVVRLAPQLNSDQINKALEAVRGFKIITLSNAA  476

Query  505  DAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWD  374
            +AF+ F+ K ++ +F NR+  Y  ++CC+ N  PG ++YD + D
Sbjct  477  EAFKEFSSKEKQDQFVNRMNHYASVFCCLAN-NPGWIWYDFFAD  519



>ref|XP_005843950.1| hypothetical protein CHLNCDRAFT_37217 [Chlorella variabilis]
 gb|EFN51848.1| hypothetical protein CHLNCDRAFT_37217 [Chlorella variabilis]
Length=631

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 51/94 (54%), Gaps = 5/94 (5%)
 Frame = -1

Query  634  CQLSXSTTATGILRFPKNSTEEKFKTVFSLFK--DVKVIQF-SSMHDAFQGFTDKAREHR  464
            CQ   ST A G  +      EE  K   +  K  + KV+ F   +   F G+TD+A   R
Sbjct  522  CQ-DASTCADGADKLKPQLHEEALKAALTEGKVAEAKVLHFVGGIERLFGGWTDEAAGER  580

Query  463  FRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPN  362
            F+ R+ RY  IWCCV N  PGH++YD ++D+ P+
Sbjct  581  FKRRLDRYGSIWCCV-NAHPGHIWYDFFFDQLPH  613



>ref|XP_005852062.1| hypothetical protein CHLNCDRAFT_133059 [Chlorella variabilis]
 gb|EFN59960.1| hypothetical protein CHLNCDRAFT_133059 [Chlorella variabilis]
Length=727

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/81 (31%), Positives = 49/81 (60%), Gaps = 3/81 (4%)
 Frame = -1

Query  601  ILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCC  422
            ++R P+  T+ + + + + +KDV+++ F+++H AF G+ DKA   +F++R+   +G +CC
Sbjct  646  VVRIPQGQTDAQLRELLAPYKDVQLLHFNTLHKAFGGWEDKAMVGKFQHRLSHMMGFFCC  705

Query  421  ---VENQTPGHVYYDMYWDEK  368
                E +  G+ YY    D K
Sbjct  706  KKVKEGEDGGYAYYRFLEDPK  726



>ref|XP_005646140.1| hypothetical protein COCSUDRAFT_17381, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21596.1| hypothetical protein COCSUDRAFT_17381, partial [Coccomyxa subellipsoidea 
C-169]
Length=529

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 35/65 (54%), Gaps = 1/65 (2%)
 Frame = -1

Query  556  VFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYW  377
              + F   +V+ F  M  A+  F  K    RF  R K Y  +WCCV+   PGHV+YDM+W
Sbjct  448  ALAPFSSKRVLHFEDMRHAYGNFPTKEYRDRFEQRTKLYTSLWCCVDKH-PGHVWYDMWW  506

Query  376  DEKPN  362
            D  P+
Sbjct  507  DVIPH  511



>emb|CAN79199.1| hypothetical protein VITISV_040773 [Vitis vinifera]
Length=715

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = -1

Query  685  VKESWLDVQLCREGSEGCQLSXSTTATGILRFPKNSTEE  569
            VK+SWLDVQLCREGS GC ++ +T++ GI R PK+STEE
Sbjct  603  VKDSWLDVQLCREGSPGCNVTNNTSSLGI-RLPKHSTEE  640



>ref|XP_001692787.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP03806.1| predicted protein [Chlamydomonas reinhardtii]
Length=703

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 36/98 (37%), Positives = 48/98 (49%), Gaps = 6/98 (6%)
 Frame = -1

Query  655  CREGSEGCQLSXSTTATGILRFPKNSTEEKFKTVFS--LFKDVKVIQFSSM--HDAFQGF  488
            C +GS+  QL        I   P  S+ E   T  S    K  KV+ F+SM   +  Q F
Sbjct  587  CSDGSKPAQLVTEGGVKKIKIAPFLSSAE-LATALSDPAVKGAKVLHFTSMAGFNFPQAF  645

Query  487  TDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWD  374
            ++     RF  R+K Y  IWCCV    PGH++YD+ WD
Sbjct  646  SEPGAAARFVERMKLYGSIWCCVLAH-PGHIHYDLLWD  682



>emb|CDX84231.1| BnaC04g09930D [Brassica napus]
Length=384

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 5/50 (10%)
 Frame = -1

Query  610  ATGILRFPKNSTEEK-----FKTVFSLFKDVKVIQFSSMHDAFQGFTDKA  476
             +G L+FPK S E+      F ++FS F DVKVI+FSS+ DAF GF+DKA
Sbjct  318  PSGFLKFPKRSNEDTVTKDLFSSIFSSFNDVKVIKFSSVEDAFTGFSDKA  367



>ref|XP_001690605.1| hypothetical protein CHLREDRAFT_114491 [Chlamydomonas reinhardtii]
 gb|EDP05864.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=501

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 51/99 (52%), Gaps = 4/99 (4%)
 Frame = -1

Query  685  VKESWLDVQLCREG-SEGCQLSXSTTATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSM  509
            V ES + V++C    + GC+   +  A G+++   N             +D K+I   + 
Sbjct  406  VNESRVTVEICAPPDATGCE-EGAGPADGVVKLMPNLKSAAVAKALEAVQDKKIIVLKNA  464

Query  508  HDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVY  392
             DAF GF+D   + R+ NR+K Y  ++CC++ + PG ++
Sbjct  465  KDAFSGFSDP-EQARYENRLKHYTSVFCCLD-KNPGWIW  501



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1131443780880