BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF011K19

Length=691
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011077579.1|  PREDICTED: uncharacterized protein LOC105161555    261   3e-80   Sesamum indicum [beniseed]
ref|XP_011094980.1|  PREDICTED: uncharacterized protein LOC105174543    261   3e-80   Sesamum indicum [beniseed]
emb|CDP06508.1|  unnamed protein product                                258   4e-80   Coffea canephora [robusta coffee]
gb|KJB17031.1|  hypothetical protein B456_002G261700                    249   2e-77   Gossypium raimondii
gb|KJB17033.1|  hypothetical protein B456_002G261700                    250   1e-76   Gossypium raimondii
gb|KJB17032.1|  hypothetical protein B456_002G261700                    250   2e-76   Gossypium raimondii
gb|EPS57405.1|  hypothetical protein M569_17413                         243   2e-76   Genlisea aurea
gb|KJB17030.1|  hypothetical protein B456_002G261700                    250   3e-76   Gossypium raimondii
ref|XP_006338993.1|  PREDICTED: phosphatidylinositol N-acetylgluc...    249   5e-76   Solanum tuberosum [potatoes]
ref|XP_006363049.1|  PREDICTED: uncharacterized protein LOC102604925    249   7e-76   Solanum tuberosum [potatoes]
ref|XP_004249580.1|  PREDICTED: uncharacterized protein LOC101249508    249   1e-75   Solanum lycopersicum
ref|XP_009593273.1|  PREDICTED: uncharacterized protein LOC104089...    244   1e-75   
gb|KHG08972.1|  GDP-mannose-dependent alpha-mannosyltransferase         248   2e-75   Gossypium arboreum [tree cotton]
gb|KDO53240.1|  hypothetical protein CISIN_1g009759mg                   242   2e-75   Citrus sinensis [apfelsine]
ref|XP_009787548.1|  PREDICTED: uncharacterized protein LOC104235470    248   2e-75   Nicotiana sylvestris
gb|KJB76911.1|  hypothetical protein B456_012G112200                    239   6e-75   Gossypium raimondii
ref|XP_009781169.1|  PREDICTED: phosphatidylinositol N-acetylgluc...    246   9e-75   Nicotiana sylvestris
ref|XP_009587153.1|  PREDICTED: uncharacterized protein LOC104084897    246   1e-74   Nicotiana tomentosiformis
ref|XP_010101801.1|  GDP-mannose-dependent alpha-mannosyltransferase    241   1e-74   
gb|KHG00374.1|  mgtA                                                    238   2e-74   Gossypium arboreum [tree cotton]
gb|KHG00375.1|  mgtA                                                    239   2e-74   Gossypium arboreum [tree cotton]
ref|XP_010558362.1|  PREDICTED: uncharacterized protein LOC104827042    246   2e-74   Tarenaya hassleriana [spider flower]
ref|XP_008442461.1|  PREDICTED: uncharacterized protein LOC103486318    246   2e-74   Cucumis melo [Oriental melon]
gb|KDO53239.1|  hypothetical protein CISIN_1g009759mg                   242   2e-74   Citrus sinensis [apfelsine]
gb|KDO53238.1|  hypothetical protein CISIN_1g009759mg                   242   2e-74   Citrus sinensis [apfelsine]
emb|CBI30420.3|  unnamed protein product                                243   2e-74   Vitis vinifera
ref|XP_009593272.1|  PREDICTED: uncharacterized protein LOC104089...    245   3e-74   Nicotiana tomentosiformis
ref|XP_004246336.1|  PREDICTED: uncharacterized protein LOC101252422    244   7e-74   Solanum lycopersicum
ref|XP_002278868.2|  PREDICTED: uncharacterized protein LOC100259616    244   1e-73   Vitis vinifera
ref|XP_010031046.1|  PREDICTED: uncharacterized protein LOC104420932    239   1e-73   Eucalyptus grandis [rose gum]
emb|CAN62120.1|  hypothetical protein VITISV_037025                     243   2e-73   Vitis vinifera
gb|AES79437.2|  group 1 family glycosyltransferase                      243   2e-73   Medicago truncatula
ref|XP_003623219.1|  Phosphatidylinositol N-acetylglucosaminyltra...    243   2e-73   
ref|XP_002309122.2|  hypothetical protein POPTR_0006s09880g             243   3e-73   
ref|XP_004137727.1|  PREDICTED: GDP-mannose-dependent alpha-manno...    243   3e-73   Cucumis sativus [cucumbers]
gb|KHN46311.1|  GDP-mannose-dependent alpha-mannosyltransferase         240   3e-73   Glycine soja [wild soybean]
gb|KJB76912.1|  hypothetical protein B456_012G112200                    239   3e-73   Gossypium raimondii
gb|KCW88121.1|  hypothetical protein EUGRSUZ_A00516                     240   4e-73   Eucalyptus grandis [rose gum]
ref|XP_007026774.1|  Sulfoquinovosyldiacylglycerol 2                    242   4e-73   
ref|XP_011019147.1|  PREDICTED: uncharacterized protein LOC105121959    242   5e-73   Populus euphratica
ref|XP_006480973.1|  PREDICTED: uncharacterized protein LOC102615235    242   5e-73   Citrus sinensis [apfelsine]
ref|XP_006429312.1|  hypothetical protein CICLE_v10011473mg             242   5e-73   Citrus clementina [clementine]
ref|XP_003516943.1|  PREDICTED: uncharacterized protein LOC100780899    242   8e-73   Glycine max [soybeans]
gb|KHN22725.1|  GDP-mannose-dependent alpha-mannosyltransferase         234   1e-72   Glycine soja [wild soybean]
emb|CDY40313.1|  BnaA10g27550D                                          232   2e-72   Brassica napus [oilseed rape]
ref|XP_006287534.1|  hypothetical protein CARUB_v10000742mg             240   3e-72   Capsella rubella
ref|XP_006583630.1|  PREDICTED: uncharacterized protein LOC100804237    234   9e-72   
gb|KEH28856.1|  group 1 family glycosyltransferase                      235   9e-72   Medicago truncatula
ref|XP_010553086.1|  PREDICTED: uncharacterized protein LOC104823284    239   1e-71   Tarenaya hassleriana [spider flower]
ref|XP_010490595.1|  PREDICTED: uncharacterized protein LOC104768346    238   1e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010452011.1|  PREDICTED: uncharacterized protein LOC104734184    238   2e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010678109.1|  PREDICTED: uncharacterized protein LOC104893676    237   2e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006398643.1|  hypothetical protein EUTSA_v10013276mg             237   4e-71   Eutrema salsugineum [saltwater cress]
ref|XP_002870938.1|  predicted protein                                  237   4e-71   Arabidopsis lyrata subsp. lyrata
ref|XP_008239560.1|  PREDICTED: uncharacterized protein LOC103338145    237   5e-71   Prunus mume [ume]
gb|EYU26645.1|  hypothetical protein MIMGU_mgv1a004620mg                237   5e-71   Erythranthe guttata [common monkey flower]
gb|KDP24481.1|  hypothetical protein JCGZ_25045                         234   6e-71   Jatropha curcas
ref|XP_004302644.1|  PREDICTED: phosphatidylinositol N-acetylgluc...    236   6e-71   Fragaria vesca subsp. vesca
ref|XP_002323560.1|  SULFOQUINOVOSYLDIACYLGLYCEROL 2 family protein     234   8e-71   
ref|XP_004506782.1|  PREDICTED: GDP-mannose-dependent alpha-manno...    236   1e-70   Cicer arietinum [garbanzo]
ref|XP_003604630.1|  Glycogen synthase                                  236   1e-70   Medicago truncatula
gb|AAK76635.1|  unknown protein                                         234   1e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130666.1|  PREDICTED: uncharacterized protein LOC103855432    236   1e-70   Brassica rapa
emb|CAB69850.1|  putative protein                                       234   1e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010424824.1|  PREDICTED: uncharacterized protein LOC104709996    239   1e-70   
emb|CDY11210.1|  BnaA03g00460D                                          236   2e-70   Brassica napus [oilseed rape]
ref|XP_007205049.1|  hypothetical protein PRUPE_ppa004263mg             235   2e-70   Prunus persica
gb|KHN24299.1|  GDP-mannose-dependent alpha-mannosyltransferase         233   2e-70   Glycine soja [wild soybean]
emb|CDY10486.1|  BnaCnng03870D                                          233   2e-70   Brassica napus [oilseed rape]
ref|XP_008800789.1|  PREDICTED: uncharacterized protein LOC103715059    234   3e-70   Phoenix dactylifera
ref|XP_003552228.1|  PREDICTED: uncharacterized protein LOC100807...    234   3e-70   Glycine max [soybeans]
gb|EYU41861.1|  hypothetical protein MIMGU_mgv1a004551mg                235   3e-70   Erythranthe guttata [common monkey flower]
ref|XP_006602643.1|  PREDICTED: uncharacterized protein LOC100807...    235   4e-70   Glycine max [soybeans]
ref|XP_010256624.1|  PREDICTED: uncharacterized protein LOC104596978    234   4e-70   Nelumbo nucifera [Indian lotus]
gb|KHN31576.1|  GDP-mannose-dependent alpha-mannosyltransferase         232   5e-70   Glycine soja [wild soybean]
emb|CDX80782.1|  BnaC03g00360D                                          232   6e-70   
ref|NP_568085.2|  sulfoquinovosyldiacylglycerol 2                       234   6e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011047421.1|  PREDICTED: uncharacterized protein LOC105141...    229   1e-69   Populus euphratica
ref|XP_009358856.1|  PREDICTED: uncharacterized protein LOC103949460    233   1e-69   Pyrus x bretschneideri [bai li]
ref|XP_009122830.1|  PREDICTED: uncharacterized protein LOC103847496    234   1e-69   Brassica rapa
ref|XP_008388188.1|  PREDICTED: uncharacterized protein LOC103450599    233   1e-69   
ref|XP_007140380.1|  hypothetical protein PHAVU_008G106900g             233   2e-69   Phaseolus vulgaris [French bean]
ref|XP_010909645.1|  PREDICTED: uncharacterized protein LOC105035694    233   2e-69   Elaeis guineensis
ref|XP_003520926.1|  PREDICTED: uncharacterized protein LOC100803792    233   2e-69   Glycine max [soybeans]
emb|CDY40312.1|  BnaA10g27560D                                          232   3e-69   Brassica napus [oilseed rape]
ref|XP_011047420.1|  PREDICTED: uncharacterized protein LOC105141...    229   3e-69   Populus euphratica
ref|XP_008370134.1|  PREDICTED: uncharacterized protein LOC103433646    229   4e-69   
emb|CDX97820.1|  BnaC04g41190D                                          230   4e-69   
ref|XP_011047417.1|  PREDICTED: uncharacterized protein LOC105141...    229   4e-69   Populus euphratica
gb|ABA55726.1|  sulfoquinovosyldiacylglycerol synthase type 2           232   5e-69   Vigna unguiculata
ref|XP_007133940.1|  hypothetical protein PHAVU_010G005100g             232   6e-69   Phaseolus vulgaris [French bean]
ref|XP_009370203.1|  PREDICTED: uncharacterized protein LOC103959579    230   2e-68   Pyrus x bretschneideri [bai li]
ref|XP_002531354.1|  glycosyltransferase, putative                      228   2e-68   
gb|KFK44566.1|  hypothetical protein AALP_AA1G274200                    229   5e-68   Arabis alpina [alpine rockcress]
gb|EEC81364.1|  hypothetical protein OsI_24561                          218   2e-67   Oryza sativa Indica Group [Indian rice]
ref|XP_009407545.1|  PREDICTED: phosphatidylinositol N-acetylgluc...    226   6e-67   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ85864.1|  predicted protein                                      224   2e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACN26074.1|  unknown                                                 214   4e-66   Zea mays [maize]
ref|XP_003561543.1|  PREDICTED: uncharacterized protein LOC100842...    223   6e-66   Brachypodium distachyon [annual false brome]
ref|XP_010228495.1|  PREDICTED: uncharacterized protein LOC100842...    223   1e-65   Brachypodium distachyon [annual false brome]
ref|XP_009409491.1|  PREDICTED: phosphatidylinositol N-acetylgluc...    221   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT15547.1|  Putative glycosyltransferase                            222   2e-65   
gb|ACN35476.1|  unknown                                                 214   4e-65   Zea mays [maize]
ref|NP_001130956.1|  uncharacterized protein LOC100192061 precursor     214   1e-64   
dbj|BAD31817.1|  putative sulfolipid synthase                           219   2e-64   Oryza sativa Japonica Group [Japonica rice]
gb|AFW80016.1|  hypothetical protein ZEAMMB73_479455                    213   2e-64   
ref|XP_006657378.1|  PREDICTED: uncharacterized protein LOC102710508    217   7e-64   
ref|XP_002457385.1|  hypothetical protein SORBIDRAFT_03g006480          215   2e-63   Sorghum bicolor [broomcorn]
ref|NP_001041991.1|  Os01g0142300                                       215   2e-63   
ref|XP_004987290.1|  PREDICTED: uncharacterized protein LOC101765158    215   6e-63   Setaria italica
gb|EAY72486.1|  hypothetical protein OsI_00342                          214   6e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_004968167.1|  PREDICTED: uncharacterized protein LOC101764078    213   1e-62   
ref|XP_008650829.1|  PREDICTED: uncharacterized protein LOC100192...    214   2e-62   Zea mays [maize]
ref|XP_008650830.1|  PREDICTED: uncharacterized protein LOC100192...    214   2e-62   
ref|NP_001144658.1|  uncharacterized protein LOC100277683               212   3e-62   Zea mays [maize]
gb|EPS57661.1|  hypothetical protein M569_17157                         204   7e-62   Genlisea aurea
ref|XP_002459190.1|  hypothetical protein SORBIDRAFT_02g000240          212   9e-62   Sorghum bicolor [broomcorn]
ref|XP_006643739.1|  PREDICTED: uncharacterized protein LOC102711739    210   1e-61   Oryza brachyantha
ref|XP_002468134.1|  hypothetical protein SORBIDRAFT_01g040150          205   6e-60   Sorghum bicolor [broomcorn]
ref|XP_003568443.1|  PREDICTED: uncharacterized protein LOC100832140    206   7e-60   Brachypodium distachyon [annual false brome]
gb|ACN34235.1|  unknown                                                 204   2e-59   Zea mays [maize]
gb|ACG31912.1|  glycosyl transferase, group 1 family protein            204   2e-59   Zea mays [maize]
ref|NP_001150015.1|  glycosyl transferase, group 1 family protein       204   3e-59   Zea mays [maize]
ref|XP_008653982.1|  PREDICTED: uncharacterized protein LOC103634168    204   3e-59   Zea mays [maize]
ref|XP_004984689.1|  PREDICTED: uncharacterized protein LOC101779471    201   3e-58   Setaria italica
ref|XP_003558286.1|  PREDICTED: uncharacterized protein LOC100846446    201   4e-58   Brachypodium distachyon [annual false brome]
gb|EMS60261.1|  GDP-mannose-dependent alpha-mannosyltransferase         202   2e-57   Triticum urartu
emb|CDM81044.1|  unnamed protein product                                199   3e-57   Triticum aestivum [Canadian hard winter wheat]
gb|EMT15719.1|  Putative glycosyltransferase                            198   3e-57   
ref|XP_006649799.1|  PREDICTED: uncharacterized protein LOC102700221    196   3e-56   Oryza brachyantha
ref|NP_001049645.1|  Os03g0265100                                       194   8e-56   
gb|EAY89357.1|  hypothetical protein OsI_10861                          194   8e-56   Oryza sativa Indica Group [Indian rice]
dbj|BAJ94304.1|  predicted protein                                      191   3e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ91585.1|  predicted protein                                      191   1e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS55944.1|  GDP-mannose-dependent alpha-mannosyltransferase         193   2e-54   Triticum urartu
gb|EMT15626.1|  Lipopolysaccharide core biosynthesis glycosyltran...    191   2e-54   
ref|XP_002968644.1|  UDP-sulfoquinovose: alpha-diacylglycerol-sul...    189   5e-53   Selaginella moellendorffii
ref|XP_001766232.1|  predicted protein                                  188   7e-53   
ref|XP_001756850.1|  predicted protein                                  188   9e-53   
gb|EEE66415.1|  hypothetical protein OsJ_22761                          177   6e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005843576.1|  hypothetical protein CHLNCDRAFT_33086              145   2e-37   Chlorella variabilis
gb|KIZ07633.1|  sulfoquinovosyltransferase                              139   5e-36   Monoraphidium neglectum
ref|XP_001689662.1|  sulfolipid synthase                                140   3e-35   Chlamydomonas reinhardtii
ref|XP_002953985.1|  hypothetical protein VOLCADRAFT_82536              140   6e-35   Volvox carteri f. nagariensis
emb|CBJ27894.1|  UDP-sulfoquinovose: diacylglycerol alpha-sulfoqu...    134   3e-34   Ectocarpus siliculosus
ref|XP_005715110.1|  unnamed protein product                            138   3e-34   Chondrus crispus [carageen]
ref|WP_013178429.1|  glycosyl transferase family 1                      134   2e-33   Truepera radiovictrix
ref|XP_005705641.1|  UDP-sulfoquinovose:DAG sulfoquinovosyltransf...    134   3e-33   Galdieria sulphuraria
ref|WP_010145366.1|  glycosyl transferase family 1                      133   5e-33   Citricoccus sp. CH26A
ref|XP_005706721.1|  sulfoquinovosyltransferase                         134   9e-33   Galdieria sulphuraria
ref|XP_005644605.1|  UDP-Glycosyltransferase/glycogen phosphorylase     132   2e-32   Coccomyxa subellipsoidea C-169
ref|XP_002185276.1|  glycosyl transferase, group 1                      129   3e-31   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_005538341.1|  sulfoquinovosyldiacylglycerol biosynthesis p...    127   1e-30   Cyanidioschyzon merolae strain 10D
ref|XP_009035363.1|  hypothetical protein AURANDRAFT_2613               125   3e-30   Aureococcus anophagefferens
gb|EWM27152.1|  gdp-mannose-dependent alpha-mannosyltransferase         124   3e-29   Nannochloropsis gaditana
ref|WP_040657553.1|  glycosyl transferase                               120   2e-28   
gb|AFA36602.1|  putative sulfolipid synthase                            114   1e-27   Lolium perenne [perennial ryegrass]
ref|WP_015175196.1|  glycosyl transferase group 1                       117   2e-27   Oscillatoria nigro-viridis
gb|AGF71936.1|  glycogen synthase                                       117   3e-27   Corynebacterium halotolerans YIM 70093 = DSM 44683
ref|WP_027004308.1|  glycosyl transferase                               117   3e-27   Corynebacterium halotolerans
ref|WP_017288576.1|  glycosyl transferase                               117   3e-27   Leptolyngbya boryana
ref|WP_006633738.1|  glycosyl transferase                               117   3e-27   Microcoleus vaginatus
ref|WP_017292828.1|  glycosyl transferase                               116   7e-27   Geminocystis herdmanii
ref|WP_019501737.1|  hypothetical protein                               115   1e-26   Pseudanabaena sp. PCC 6802
ref|WP_012596832.1|  glycosyl transferase                               115   2e-26   Cyanothece sp. PCC 8801
ref|WP_036477227.1|  glycosyl transferase                               115   2e-26   Myxosarcina sp. GI1
ref|WP_011243256.1|  MULTISPECIES: glycosyl transferase                 115   2e-26   Synechococcus
ref|WP_015784192.1|  glycosyl transferase                               115   2e-26   Cyanothece sp. PCC 8802
ref|WP_018021886.1|  hypothetical protein                               114   2e-26   Corynebacterium doosanense
ref|XP_002295162.1|  predicted protein                                  114   3e-26   Thalassiosira pseudonana CCMP1335
ref|WP_015184883.1|  glycosyltransferase                                114   4e-26   Microcoleus sp. PCC 7113
tpg|DAA44536.1|  TPA: hypothetical protein ZEAMMB73_879639              114   4e-26   
ref|WP_026936851.1|  glycosyl transferase                               114   4e-26   Gulosibacter molinativorax
ref|WP_023066667.1|  glycosyl transferases group 1 family protein       113   7e-26   Lyngbya aestuarii
ref|WP_010147154.1|  glycosyl transferase group 1 protein               112   7e-26   
ref|WP_019157421.1|  hypothetical protein                               113   9e-26   Brevibacterium senegalense
ref|WP_011610261.1|  glycosyl transferase                               113   9e-26   Trichodesmium erythraeum
ref|WP_011316987.1|  glycosyl transferase                               113   1e-25   Trichormus variabilis
ref|WP_009786934.1|  glycosyl transferase                               112   1e-25   Lyngbya sp. PCC 8106
ref|WP_015223063.1|  group 1 glycosyl transferase                       112   1e-25   
ref|WP_015956855.1|  glycosyl transferase                               112   1e-25   Cyanothece sp. PCC 7424
ref|WP_011056273.1|  glycosyl transferase                               112   2e-25   Thermosynechococcus elongatus
ref|WP_028782924.1|  glycosyl transferase                               112   2e-25   Thalassobacillus devorans
ref|WP_026793415.1|  MULTISPECIES: glycosyl transferase                 112   2e-25   Planktothrix
ref|WP_017655891.1|  glycosyl transferase                               112   2e-25   Fortiea contorta
ref|WP_024125070.1|  sulfoquinovosyldiacylglycerol biosynthesis p...    112   3e-25   Thermosynechococcus sp. NK55a
ref|WP_015230997.1|  glycosyltransferase                                112   3e-25   Dactylococcopsis salina
ref|WP_015133176.1|  group 1 glycosyl transferase                       111   3e-25   Leptolyngbya sp. PCC 7376
ref|WP_024289317.1|  glycosyl transferase                               112   3e-25   Microbacterium sp. KROCY2
ref|WP_006215756.1|  Glycosyltransferase                                112   3e-25   Kocuria palustris
ref|WP_035923791.1|  glycosyl transferase                               111   4e-25   
ref|WP_025943510.1|  glycosyl transferase                               111   5e-25   
ref|WP_007356158.1|  MULTISPECIES: glycosyl transferase                 110   5e-25   Kamptonema
ref|WP_015225187.1|  group 1 glycosyl transferase                       110   6e-25   Halothece sp. PCC 7418
ref|XP_003083256.1|  sulfolipid synthase (ISS)                          112   7e-25   
ref|XP_001421416.1|  predicted protein                                  111   7e-25   Ostreococcus lucimarinus CCE9901
ref|WP_015220908.1|  group 1 glycosyl transferase                       110   8e-25   Cyanobacterium aponinum
emb|CEG01736.1|  Glycosyl transferase, family 1                         113   8e-25   Ostreococcus tauri
ref|XP_003057606.1|  glycosyltransferase family 4 protein               113   8e-25   Micromonas pusilla CCMP1545
ref|WP_010996422.1|  glycosyl transferase                               110   9e-25   Nostocaceae
ref|XP_009034698.1|  hypothetical protein AURANDRAFT_52616              110   1e-24   Aureococcus anophagefferens
ref|WP_015124487.1|  glycosyltransferase                                110   1e-24   Synechococcus sp. PCC 6312
ref|WP_012629991.1|  glycosyl transferase                               110   1e-24   Cyanothece sp. PCC 7425
ref|WP_017719528.1|  glycosyl transferase                               109   1e-24   Oscillatoria sp. PCC 10802
ref|WP_008314395.1|  glycosyltransferase                                109   1e-24   Leptolyngbya sp. PCC 6406
ref|WP_025928974.1|  glycosyl transferase                               109   2e-24   
gb|KGF85728.1|  Glycosyltransferase                                     109   2e-24   Prochlorococcus marinus str. GP2
ref|WP_006196765.1|  glycosyl transferase                               109   2e-24   Nodularia spumigena
ref|WP_040944057.1|  glycosyl transferase                               105   2e-24   
ref|WP_032525173.1|  glycosyl transferase                               109   2e-24   Prochlorococcus marinus
ref|WP_035371326.1|  glycosyl transferase family 1                      109   2e-24   
ref|WP_040933043.1|  glycosyl transferase                               104   2e-24   
ref|WP_025976056.1|  glycosyl transferase                               108   2e-24   
ref|WP_015170725.1|  group 1 glycosyl transferase                       109   2e-24   Geitlerinema sp. PCC 7407
ref|WP_032522712.1|  glycosyl transferase                               109   2e-24   Prochlorococcus marinus
ref|WP_006101106.1|  glycosyl transferase                               109   2e-24   Coleofasciculus chthonoplastes
ref|WP_025927153.1|  glycosyl transferase                               108   2e-24   
ref|WP_022608621.1|  glycosyltransferase                                108   3e-24   Rubidibacter lacunae
ref|XP_007514956.1|  SqdX                                               112   3e-24   Bathycoccus prasinos
ref|WP_019494764.1|  glycosyl transferase                               108   3e-24   Calothrix sp. PCC 7103
ref|WP_025980084.1|  MULTISPECIES: glycosyl transferase                 108   3e-24   Prochlorococcus marinus
ref|WP_025939760.1|  glycosyl transferase                               108   3e-24   
ref|WP_025923704.1|  glycosyl transferase                               108   3e-24   
ref|WP_025971371.1|  glycosyl transferase                               108   3e-24   
ref|WP_025961606.1|  glycosyl transferase                               108   3e-24   
ref|WP_044106990.1|  glycosyl transferase                               108   3e-24   cyanobacterium endosymbiont of Epithemia turgida
ref|WP_025927759.1|  MULTISPECIES: glycosyl transferase                 108   3e-24   
ref|WP_025882496.1|  glycosyl transferase                               108   3e-24   
ref|WP_025965084.1|  glycosyl transferase                               108   3e-24   
ref|WP_025938801.1|  glycosyl transferase                               108   3e-24   
ref|WP_025913940.1|  MULTISPECIES: glycosyl transferase                 108   3e-24   
ref|WP_025967336.1|  glycosyl transferase                               108   3e-24   
ref|WP_025925654.1|  MULTISPECIES: glycosyl transferase                 108   3e-24   
ref|WP_025947613.1|  glycosyl transferase                               108   3e-24   
ref|WP_025945509.1|  glycosyl transferase                               108   3e-24   
gb|ABO18479.1|  SqdX                                                    108   3e-24   Prochlorococcus marinus str. MIT 9301
ref|WP_025958086.1|  glycosyl transferase                               108   3e-24   
ref|WP_025893675.1|  glycosyl transferase                               108   4e-24   
ref|WP_025968880.1|  glycosyl transferase                               108   4e-24   
ref|WP_042851210.1|  glycosyl transferase                               108   4e-24   Prochlorococcus sp. MIT 0604
ref|WP_011819276.1|  glycosyl transferase                               108   4e-24   Prochlorococcus marinus
ref|WP_015113812.1|  group 1 glycosyl transferase                       108   5e-24   Nostoc sp. PCC 7107
ref|WP_042156569.1|  glycosyl transferase                               108   6e-24   Planktothrix agardhii
gb|KIZ02980.1|  sulfoquinovosyltransferase                              108   6e-24   Monoraphidium neglectum
ref|WP_025974177.1|  glycosyl transferase                               107   7e-24   
ref|WP_025921690.1|  glycosyl transferase                               107   7e-24   
ref|WP_032513539.1|  glycosyl transferase                               107   8e-24   Prochlorococcus marinus
ref|XP_001699258.1|  sulfolipid synthase                                107   8e-24   Chlamydomonas reinhardtii
gb|KGF92154.1|  Glycosyltransferase                                     107   8e-24   Prochlorococcus marinus str. MIT 9107
gb|ABE11344.1|  SqdX                                                    107   8e-24   uncultured Prochlorococcus marinus clone HOT0M-10E12
ref|WP_008180177.1|  glycosyl transferase                               107   9e-24   Moorea producens
ref|WP_003846375.1|  glycosyl transferase family 1                      107   9e-24   Corynebacterium ammoniagenes
ref|WP_025935527.1|  glycosyl transferase                               107   9e-24   
ref|WP_032516163.1|  glycosyl transferase                               107   9e-24   Prochlorococcus marinus
ref|WP_025936122.1|  MULTISPECIES: glycosyl transferase                 107   1e-23   
ref|WP_025922712.1|  MULTISPECIES: glycosyl transferase                 107   1e-23   
ref|WP_025934143.1|  MULTISPECIES: glycosyl transferase                 107   1e-23   
ref|WP_015136558.1|  glycosyltransferase                                107   1e-23   Nostoc sp. PCC 7524
ref|WP_025937741.1|  glycosyl transferase                               107   1e-23   Prochlorococcus marinus
ref|WP_025947052.1|  glycosyl transferase                               107   1e-23   
ref|WP_025956304.1|  glycosyl transferase                               107   1e-23   
ref|WP_017662025.1|  glycosyl transferase                               107   1e-23   Geitlerinema sp. PCC 7105
ref|WP_015168332.1|  glycosyltransferase                                107   1e-23   Synechococcus sp. PCC 7502
ref|WP_039726013.1|  MULTISPECIES: glycosyl transferase                 107   1e-23   Lyngbya confervoides
ref|WP_018581139.1|  hypothetical protein                               102   1e-23   Corynebacterium pilosum
ref|WP_011377300.1|  glycosyl transferase                               107   1e-23   Prochlorococcus marinus
ref|WP_025915258.1|  glycosyl transferase                               107   1e-23   
ref|WP_032517996.1|  glycosyl transferase                               107   1e-23   Prochlorococcus marinus
ref|WP_025781484.1|  glycosyl transferase                               107   1e-23   Candidatus Synechococcus spongiarum
gb|KGG03241.1|  Glycosyltransferase                                     107   1e-23   Prochlorococcus marinus str. MIT 9321
ref|WP_025967691.1|  glycosyl transferase                               106   2e-23   
ref|WP_025965969.1|  glycosyl transferase                               106   2e-23   
ref|WP_028085475.1|  glycosyl transferase                               106   2e-23   Dolichospermum circinale
ref|WP_017713210.1|  glycosyl transferase                               106   2e-23   Prochlorothrix hollandica
ref|WP_010467672.1|  glycosyl transferase                               106   2e-23   Acaryochloris sp. CCMEE 5410
ref|WP_035156195.1|  glycosyl transferase                               106   2e-23   Calothrix sp. 336/3
ref|WP_028091028.1|  glycosyl transferase                               106   2e-23   Dolichospermum circinale
ref|WP_036905889.1|  glycosyl transferase                               106   2e-23   Prochlorococcus marinus
ref|WP_032526403.1|  glycosyl transferase                               106   2e-23   Prochlorococcus marinus
ref|WP_040944064.1|  glycosyl transferase                               104   2e-23   
ref|WP_011429929.1|  glycosyl transferase                               106   2e-23   
ref|WP_040937982.1|  glycosyl transferase                               103   3e-23   
ref|WP_038654761.1|  glycosyl transferase                               106   3e-23   
ref|WP_006527890.1|  glycosyltransferase                                105   3e-23   
ref|WP_020934264.1|  glycogen synthase                                  105   3e-23   
ref|WP_025923959.1|  glycosyl transferase                               105   4e-23   
ref|WP_010187536.1|  glycosyl transferase family 1                      105   4e-23   
ref|WP_011824631.1|  glycosyl transferase                               105   4e-23   
ref|WP_012164458.1|  glycosyl transferase                               105   5e-23   
ref|WP_009768435.1|  glycosyltransferase                                105   5e-23   
ref|WP_002806204.1|  glycosyl transferase                               105   6e-23   
ref|WP_006513788.1|  glycosyltransferase                                105   6e-23   
ref|WP_015208499.1|  glycosyltransferase                                105   6e-23   
ref|WP_011133293.1|  glycosyl transferase                               105   6e-23   
ref|WP_036916971.1|  glycosyl transferase                               101   6e-23   
ref|WP_025891213.1|  glycosyl transferase                               105   7e-23   
ref|WP_036899853.1|  glycosyl transferase                               104   8e-23   
ref|WP_014068185.1|  glycosyl transferase family 1                      105   8e-23   
ref|WP_012845217.1|  glycosyl transferase family 1                      105   8e-23   
ref|WP_011295609.1|  glycosyl transferase                               104   8e-23   
ref|WP_019474951.1|  glycosyl transferase                               104   9e-23   
ref|WP_036913154.1|  MULTISPECIES: glycosyl transferase                 104   1e-22   
gb|ETJ98150.1|  glycosyltransferases group 1                            100   1e-22   
ref|WP_013192302.1|  glycosyl transferase                               104   1e-22   
ref|WP_019476471.1|  glycosyl transferase                               104   1e-22   
ref|WP_015200905.1|  group 1 glycosyl transferase                       104   1e-22   
gb|KIY98280.1|  sulfoquinovosyltransferase                              105   1e-22   
ref|WP_018297528.1|  hypothetical protein                               104   1e-22   
ref|WP_039753013.1|  glycosyl transferase                               104   1e-22   
ref|WP_015109858.1|  glycosyltransferase                                103   2e-22   
ref|WP_012008540.1|  glycosyl transferase                               103   2e-22   
ref|WP_012409446.1|  glycosyl transferase                               103   2e-22   
ref|WP_011433965.1|  glycosyl transferase                               103   2e-22   
ref|XP_011396666.1|  GDP-mannose-dependent alpha-mannosyltransferase    103   2e-22   
ref|WP_015165224.1|  group 1 glycosyl transferase                       103   2e-22   
ref|WP_040937362.1|  glycosyl transferase                               103   2e-22   
ref|WP_037218313.1|  glycosyl transferase                               103   2e-22   
emb|CDN11933.1|  Glycosyltransferase                                    103   2e-22   
gb|KFI56128.1|  group 1 glycosyl transferase                            100   2e-22   
ref|WP_015940902.1|  glycosyl transferase family 1                      103   2e-22   
ref|YP_002049079.1|  SqdX                                               103   3e-22   
ref|WP_010312701.1|  glycosyl transferase                               103   3e-22   
ref|WP_043463083.1|  glycoside hydrolase                                103   3e-22   
ref|WP_039202474.1|  glycosyl transferase                               103   3e-22   
ref|WP_043694049.1|  glycosyl transferase                               103   3e-22   
ref|WP_016953042.1|  glycosyl transferase                               102   3e-22   
ref|WP_015083608.1|  group 1 glycosyl transferase                       102   3e-22   
ref|XP_002501927.1|  glycosyltransferase family 4 protein               105   4e-22   
ref|WP_006841027.1|  glycosyl transferase family 1                      102   4e-22   
ref|WP_010313930.1|  glycosyl transferase                               102   4e-22   
ref|WP_015215962.1|  glycosyl transferase group 1                       102   5e-22   
ref|WP_006910279.1|  glycosyl transferase                               102   5e-22   
ref|WP_041840032.1|  glycosyl transferase                               102   5e-22   
ref|WP_019618011.1|  hypothetical protein                               102   6e-22   
gb|ACO31913.1|  glycosyl transferase, group 1 family                    102   6e-22   
ref|WP_017297313.1|  glycosyl transferase                               102   7e-22   
ref|WP_011824740.1|  glycosyl transferase                               102   7e-22   
ref|WP_041384827.1|  glycosyl transferase                               102   7e-22   
ref|WP_038681464.1|  glycosyl transferase                               102   8e-22   
ref|WP_026700800.1|  hypothetical protein                               101   8e-22   
ref|WP_027403809.1|  glycosyl transferase                               101   1e-21   
ref|XP_009492483.1|  hypothetical protein H696_00361                    101   1e-21   
emb|CAE20224.1|  SqdX                                                   101   1e-21   
ref|WP_012196344.1|  glycosyl transferase                               101   1e-21   
ref|WP_012257396.1|  MULTISPECIES: glycosyl transferase family 1        101   1e-21   
ref|WP_029150485.1|  glycosyl transferase                               101   1e-21   
ref|WP_023072791.1|  group 1 glycosyl transferase                       101   1e-21   
ref|WP_016669929.1|  hypothetical protein                               101   1e-21   
ref|WP_038014997.1|  glycosyl transferase                               101   1e-21   
ref|WP_031283693.1|  glycosyl transferase                               101   1e-21   
ref|WP_029636073.1|  glycosyl transferase [                             101   1e-21   
ref|WP_043165013.1|  hypothetical protein                               101   2e-21   
ref|WP_036533451.1|  glycosyl transferase                               100   2e-21   
ref|WP_028822531.1|  glycosyl transferase                               100   2e-21   
gb|EHA59149.1|  glycosyl transferase group 1                            100   2e-21   
ref|WP_017823218.1|  glycosyl transferase                               100   2e-21   
ref|WP_038374036.1|  glycosyl transferase                               100   2e-21   
ref|WP_011821147.1|  glycosyl transferase                               100   2e-21   
ref|WP_008638153.1|  group 1 glycosyltransferase                        100   2e-21   
ref|WP_007101086.1|  glycosyl transferase                               100   2e-21   
ref|WP_022925163.1|  glycosyl transferase family 1                      100   2e-21   
ref|WP_006172769.1|  glycosyl transferase                               100   2e-21   
ref|WP_006457040.1|  glycosyl transferase                               100   3e-21   
ref|WP_042405397.1|  glycosyl transferase                               100   3e-21   
ref|WP_019477192.1|  glycosyl transferase                               100   4e-21   
ref|WP_010650574.1|  glycosyl transferase                             99.8    4e-21   
ref|WP_015614135.1|  glycosyltransferase                              99.8    5e-21   
ref|WP_034999531.1|  glycosyl transferase                             99.8    5e-21   
ref|WP_016456164.1|  hypothetical protein                             99.8    5e-21   
ref|WP_026963964.1|  glycosyl transferase                             99.4    5e-21   
ref|WP_005530085.1|  glycosyl transferase family 1                    99.4    6e-21   
ref|WP_011934471.1|  glycosyl transferase                             99.4    6e-21   
ref|WP_035833307.1|  glycosyl transferase                             99.4    7e-21   
gb|AEN87270.1|  Glycosyl transferase, group 1                         97.1    7e-21   
ref|WP_028953281.1|  glycosyl transferase                             99.0    8e-21   
ref|WP_036919584.1|  MULTISPECIES: glycosyl transferase               99.0    8e-21   
ref|WP_039812190.1|  glycosyl transferase                             99.0    9e-21   
ref|WP_011126929.1|  glycosyl transferase                             99.0    9e-21   
ref|WP_025387872.1|  glycosyl transferase                             98.6    1e-20   
ref|WP_035388034.1|  glycosyl transferase                             98.6    1e-20   
ref|WP_038542489.1|  glycosyl transferase                             98.6    1e-20   
ref|WP_018396637.1|  glycosyl transferase                             98.6    1e-20   
ref|WP_020006731.1|  hypothetical protein                             98.6    1e-20   
ref|WP_008276523.1|  glycosyl transferase                             98.6    1e-20   
ref|WP_036822268.1|  glycosyl transferase                             98.6    1e-20   
ref|WP_007099486.1|  glycosyl transferase                             98.6    1e-20   
ref|WP_015202192.1|  group 1 glycosyl transferase                     98.6    1e-20   
ref|WP_026962708.1|  glycosyl transferase                             98.6    1e-20   
ref|WP_008050780.1|  glycosyl transferase                             98.2    1e-20   
ref|WP_029319929.1|  glycosyl transferase                             98.2    1e-20   
ref|WP_006617169.1|  glycosyl transferase                             98.2    1e-20   
ref|WP_034663927.1|  glycosyl transferase                             98.2    1e-20   
ref|WP_006669182.1|  glycosyl transferase                             98.2    2e-20   
ref|WP_006625687.1|  glycosyl transferase                             98.2    2e-20   
ref|WP_036779033.1|  glycosyl transferase                             98.2    2e-20   
ref|WP_005291244.1|  glycosyl transferase family 1                    98.2    2e-20   
ref|WP_039713912.1|  glycosyl transferase                             97.8    2e-20   
ref|WP_022862824.1|  glycosyl transferase family 1                    97.8    2e-20   
ref|WP_015156349.1|  group 1 glycosyl transferase                     97.8    2e-20   
ref|WP_009633426.1|  glycosyltransferase                              97.8    2e-20   
ref|WP_019194160.1|  hypothetical protein                             97.8    2e-20   
ref|WP_024110873.1|  glycosyltransferase, group 1 family protein      97.8    2e-20   
ref|WP_009628051.1|  glycosyl transferase group 1                     97.8    2e-20   
ref|WP_011931986.1|  glycosyl transferase                             97.8    2e-20   
ref|WP_011957064.1|  glycosyl transferase family 1                    97.8    2e-20   
ref|WP_035505073.1|  MULTISPECIES: glycosyl transferase               97.4    3e-20   
ref|WP_005884691.1|  glycosyl transferase family 1                    97.4    3e-20   
ref|WP_036922652.1|  glycosyl transferase                             97.4    3e-20   
ref|WP_028457565.1|  glycosyl transferase family 1                    97.4    3e-20   
ref|WP_017328405.1|  glycosyl transferase                             97.4    3e-20   
ref|WP_003464026.1|  group 1 glycosyltransferase                      97.4    3e-20   
ref|WP_042530129.1|  glycosyl transferase                             97.4    3e-20   
ref|WP_025601492.1|  glycosyl transferase                             97.4    3e-20   
ref|WP_013059535.1|  glycosyl transferase                             97.4    3e-20   
ref|WP_043975900.1|  glycosyl transferase                             97.4    3e-20   
ref|WP_011618042.1|  glycosyl transferase                             97.4    3e-20   
ref|WP_010549462.1|  glycosyl transferase                             97.1    4e-20   
ref|WP_013085259.1|  glycosyl transferase                             97.1    4e-20   
ref|WP_033579587.1|  glycosyl transferase                             97.1    4e-20   
ref|WP_016765764.1|  glycosyl transferase                             97.1    4e-20   
ref|WP_036833280.1|  glycosyl transferase                             97.1    4e-20   
ref|WP_012121618.1|  glycosyl transferase family 1                    97.1    4e-20   
ref|WP_034648601.1|  glycosyl transferase                             97.1    4e-20   
ref|WP_028410473.1|  glycosyl transferase                             97.1    4e-20   
ref|WP_025750709.1|  glycosyl transferase                             97.1    4e-20   
ref|WP_006822730.1|  glycosyl transferase family 1                    97.1    4e-20   
ref|WP_009344130.1|  glycosyl transferase                             97.1    4e-20   
ref|WP_026799308.1|  glycosyl transferase                             96.7    5e-20   
ref|WP_035544456.1|  glycosyl transferase                             97.1    5e-20   
ref|WP_006042635.1|  glycosyl transferase                             96.7    5e-20   
ref|WP_027254623.1|  glycosyl transferase                             96.7    6e-20   
ref|WP_040054255.1|  glycosyl transferase                             96.3    6e-20   
ref|WP_019507997.1|  glycosyl transferase                             96.3    7e-20   
ref|WP_031458015.1|  glycosyl transferase family 1                    96.3    8e-20   
ref|WP_015158023.1|  glycosyltransferase                              96.3    8e-20   
ref|WP_029421832.1|  glycosyl transferase                             96.3    8e-20   
ref|WP_036900899.1|  glycosyl transferase                             96.3    8e-20   
ref|WP_017933998.1|  hypothetical protein                             95.9    9e-20   
ref|WP_005390180.1|  glycosyl transferase family 1                    95.9    9e-20   
ref|WP_017303625.1|  glycosyl transferase                             95.9    1e-19   
ref|WP_007308077.1|  glycosyl transferase                             95.9    1e-19   
ref|WP_005393867.1|  glycosyl transferase family 1                    95.5    1e-19   
ref|WP_024750270.1|  MULTISPECIES: glycosyl transferase               95.5    1e-19   
ref|WP_034271402.1|  glycosyl transferase                             95.5    1e-19   
gb|AHF62481.1|  SqdX                                                  95.5    1e-19   
ref|WP_041036120.1|  glycosyl transferase                             95.5    1e-19   
ref|WP_026974775.1|  glycosyl transferase                             95.5    1e-19   
gb|EXK30289.1|  hypothetical protein FOMG_13891                       97.1    1e-19   
gb|EGU87935.1|  hypothetical protein FOXB_01526                       97.1    2e-19   
gb|EWG51461.1|  hypothetical protein FVEG_10422                       97.1    2e-19   
gb|EMT66059.1|  GDP-mannose-dependent alpha-mannosyltransferase       97.1    2e-19   
gb|ACB50919.1|  probable sulfolipid sulfoquinovosyldiacylglycerol...  95.5    2e-19   
ref|WP_012636054.1|  glycosyl transferase family 1                    95.1    2e-19   
ref|WP_009788501.1|  glycosyl transferase                             95.1    2e-19   
gb|EWY85121.1|  hypothetical protein FOYG_12392                       96.7    2e-19   
ref|WP_034629959.1|  glycosyl transferase                             95.1    2e-19   
ref|WP_011358891.1|  glycosyl transferase                             95.1    2e-19   
ref|WP_039674592.1|  glycosyl transferase                             95.1    2e-19   
ref|WP_036004685.1|  glycosyl transferase                             95.1    2e-19   
ref|WP_008587692.1|  glycosyl transferase                             94.7    2e-19   
ref|WP_026797347.1|  glycosyl transferase                             94.7    2e-19   
ref|WP_010666284.1|  sulfolipid synthase                              92.4    2e-19   
ref|WP_011125976.1|  MULTISPECIES: glycosyl transferase               94.7    2e-19   
ref|WP_026787523.1|  glycosyl transferase                             94.7    2e-19   
gb|AIA15409.1|  Glycosyl transferases group 1                         91.3    2e-19   
ref|WP_010529716.1|  glycosyl transferase                             94.7    2e-19   
ref|WP_006275757.1|  glycosyl transferase                             94.7    2e-19   
ref|WP_028411847.1|  glycosyl transferase                             94.7    2e-19   
ref|WP_017314735.1|  glycosyl transferase                             94.7    3e-19   
ref|WP_040105286.1|  glycosyl transferase                             94.4    3e-19   
ref|WP_024544755.1|  glycosyl transferase                             94.4    3e-19   
ref|WP_012308070.1|  glycosyl transferase                             94.4    4e-19   
ref|WP_011363092.1|  glycosyl transferase                             94.4    4e-19   
ref|XP_005834049.1|  hypothetical protein GUITHDRAFT_45198            93.6    4e-19   
ref|WP_036841630.1|  glycosyl transferase                             94.0    4e-19   
ref|WP_016116750.1|  hypothetical protein                             91.3    4e-19   
ref|WP_026799309.1|  glycosyl transferase                             94.0    4e-19   
ref|WP_038551862.1|  glycosyl transferase                             94.0    4e-19   
ref|WP_030007647.1|  glycosyl transferase                             94.0    4e-19   
ref|WP_041123694.1|  glycosyl transferase                             94.0    4e-19   
gb|KIE08753.1|  glycosyl transferase                                  94.0    5e-19   
ref|WP_029131229.1|  glycosyl transferase family 1                    94.0    5e-19   
ref|WP_012953900.1|  glycosyl transferase                             93.6    5e-19   
ref|WP_036610337.1|  glycosyl transferase                             93.6    6e-19   
ref|WP_034672731.1|  glycosyl transferase                             93.6    6e-19   
ref|WP_036669524.1|  glycosyl transferase                             93.6    6e-19   
ref|WP_031547642.1|  glycosyl transferase                             93.6    7e-19   
ref|WP_017744576.1|  glycosyl transferase                             93.2    7e-19   
gb|EWZ35571.1|  hypothetical protein FOZG_11469                       94.7    8e-19   
ref|WP_011403223.1|  sulfolipid synthase                              94.4    1e-18   
ref|WP_033671571.1|  glycosyl transferase                             91.3    1e-18   
ref|WP_018017998.1|  hypothetical protein                             92.8    1e-18   
ref|WP_040606020.1|  glycosyl transferase family 1                    93.2    1e-18   
ref|WP_038610617.1|  glycosyl transferase                             92.8    1e-18   
emb|CCT73512.1|  related to glycosyl transferase                      94.4    1e-18   
ref|XP_001700169.1|  glycosyl transferase                             92.0    1e-18   
ref|WP_041050218.1|  glycosyl transferase                             92.8    1e-18   
ref|XP_001557873.1|  hypothetical protein BC1G_03455                  90.1    1e-18   
ref|WP_028391941.1|  glycosyl transferase                             92.8    1e-18   
ref|WP_015195528.1|  glycosyl transferase group 1                     92.4    1e-18   



>ref|XP_011077579.1| PREDICTED: uncharacterized protein LOC105161555 [Sesamum indicum]
Length=520

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 138/152 (91%), Gaps = 2/152 (1%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYASGDVFVMPSESETLG VVLEAMSSGLPVVAARAGGIP+II +D
Sbjct  367  AVFTGMLQGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGLPVVAARAGGIPDIIPED  426

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            QQGK GYLFNPGDLDDCL KLKPLL D  LRETIGKAAR E+EKYDW+AAT+KIRNEQYN
Sbjct  427  QQGKTGYLFNPGDLDDCLSKLKPLLHDSVLRETIGKAARVEMEKYDWRAATRKIRNEQYN  486

Query  329  AAISFWRKERSQSPGPLQWLFKRIF--QTPDI  240
            AAI FWRK+R+Q  GPLQWLF+R+F  QTP I
Sbjct  487  AAIWFWRKKRAQFLGPLQWLFRRVFQPQTPAI  518



>ref|XP_011094980.1| PREDICTED: uncharacterized protein LOC105174543 [Sesamum indicum]
Length=526

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYASGDVFVMPSESETLG VVLEAMSSGLPVVAARAGGIP+II +D
Sbjct  375  AVFTGMLQGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGLPVVAARAGGIPDIIPED  434

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            QQGK GYLFNPGDLDDCL KLKPLL + ELRETIGKAAR E+EKYDW+AAT+KIRNEQYN
Sbjct  435  QQGKTGYLFNPGDLDDCLSKLKPLLHNQELRETIGKAARVEMEKYDWRAATRKIRNEQYN  494

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIE  237
            AAI FWRK+R+Q   P QWLF+R+F+ P IE
Sbjct  495  AAIWFWRKKRAQFLRPFQWLFRRVFRAPAIE  525



>emb|CDP06508.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   258 bits (660),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVF GML GEELSQAYASGDVF+MPSESETLG VVLEAMSSGLPVVAARAGGIP+II +D
Sbjct  282  AVFMGMLHGEELSQAYASGDVFIMPSESETLGLVVLEAMSSGLPVVAARAGGIPDIIPED  341

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            QQGKIGYLFNPGD+DDCL KLKPLL D ELRETIG AAR E+EK+DW+AAT+KIRNEQYN
Sbjct  342  QQGKIGYLFNPGDVDDCLSKLKPLLHDLELRETIGNAARLEMEKFDWRAATRKIRNEQYN  401

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI FWRK+R+Q   P QWLFKRIFQ P+++ R
Sbjct  402  AAIWFWRKKRAQLLRPFQWLFKRIFQAPEVDYR  434



>gb|KJB17031.1| hypothetical protein B456_002G261700 [Gossypium raimondii]
 gb|KJB17035.1| hypothetical protein B456_002G261700 [Gossypium raimondii]
Length=372

 Score =   249 bits (636),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
             VFTG LQGEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGG+P+II  D
Sbjct  220  VVFTGTLQGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGARAGGVPDIIPAD  279

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LFNPGDLDDCL KLKPLL + E+RETIGKAAR E+EKYDW+AATKKIRNEQYN
Sbjct  280  QEGKTGFLFNPGDLDDCLSKLKPLLQNKEMRETIGKAARQEMEKYDWRAATKKIRNEQYN  339

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI FWRK+R+Q   PLQWL KR+F +P I +R
Sbjct  340  AAIWFWRKKRAQLLRPLQWLAKRVFPSPKISHR  372



>gb|KJB17033.1| hypothetical protein B456_002G261700 [Gossypium raimondii]
Length=470

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
             VFTG LQGEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGG+P+II  D
Sbjct  318  VVFTGTLQGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGARAGGVPDIIPAD  377

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LFNPGDLDDCL KLKPLL + E+RETIGKAAR E+EKYDW+AATKKIRNEQYN
Sbjct  378  QEGKTGFLFNPGDLDDCLSKLKPLLQNKEMRETIGKAARQEMEKYDWRAATKKIRNEQYN  437

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI FWRK+R+Q   PLQWL KR+F +P I +R
Sbjct  438  AAIWFWRKKRAQLLRPLQWLAKRVFPSPKISHR  470



>gb|KJB17032.1| hypothetical protein B456_002G261700 [Gossypium raimondii]
Length=490

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
             VFTG LQGEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGG+P+II  D
Sbjct  338  VVFTGTLQGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGARAGGVPDIIPAD  397

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LFNPGDLDDCL KLKPLL + E+RETIGKAAR E+EKYDW+AATKKIRNEQYN
Sbjct  398  QEGKTGFLFNPGDLDDCLSKLKPLLQNKEMRETIGKAARQEMEKYDWRAATKKIRNEQYN  457

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI FWRK+R+Q   PLQWL KR+F +P I +R
Sbjct  458  AAIWFWRKKRAQLLRPLQWLAKRVFPSPKISHR  490



>gb|EPS57405.1| hypothetical protein M569_17413, partial [Genlisea aurea]
Length=238

 Score =   243 bits (619),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYASGDVF+MPSESETLG VVLEAMSSGLPVVAARAGGIP+II D+
Sbjct  89   AVFTGMLQGEELSQAYASGDVFIMPSESETLGLVVLEAMSSGLPVVAARAGGIPDIIPDE  148

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            QQGK GYLFNPGDLDDCL KL+PLL D ELRE IG+ AR EVEKYDWKAAT+KIR+E YN
Sbjct  149  QQGKTGYLFNPGDLDDCLGKLRPLLRDRELREAIGREARAEVEKYDWKAATRKIRDENYN  208

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDI  240
            AAI FWR+++++   P QWLF++ F  P I
Sbjct  209  AAIWFWRRKKAEFLRPFQWLFRQFFHVPAI  238



>gb|KJB17030.1| hypothetical protein B456_002G261700 [Gossypium raimondii]
Length=516

 Score =   250 bits (639),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
             VFTG LQGEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGG+P+II  D
Sbjct  364  VVFTGTLQGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGARAGGVPDIIPAD  423

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LFNPGDLDDCL KLKPLL + E+RETIGKAAR E+EKYDW+AATKKIRNEQYN
Sbjct  424  QEGKTGFLFNPGDLDDCLSKLKPLLQNKEMRETIGKAARQEMEKYDWRAATKKIRNEQYN  483

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI FWRK+R+Q   PLQWL KR+F +P I +R
Sbjct  484  AAIWFWRKKRAQLLRPLQWLAKRVFPSPKISHR  516



>ref|XP_006338993.1| PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase 
GPI3 subunit-like [Solanum tuberosum]
Length=503

 Score =   249 bits (637),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
             VFTGML GEELSQAYASGD+FVMPSESETLG VVLEAMSSGLPV+AARAGGIP+II DD
Sbjct  353  VVFTGMLLGEELSQAYASGDIFVMPSESETLGFVVLEAMSSGLPVLAARAGGIPDIIPDD  412

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            QQGK GYL+NPGD+DDCL KL+PLL++ ELRETIG+AAR E+EK+DW+AAT+KIRNEQYN
Sbjct  413  QQGKTGYLYNPGDIDDCLSKLEPLLYNAELRETIGRAARTEMEKFDWRAATRKIRNEQYN  472

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDI  240
            AAI FWRK+R+Q   P QWLFKR  Q P +
Sbjct  473  AAIWFWRKKRAQLSRPFQWLFKRRLQAPKV  502



>ref|XP_006363049.1| PREDICTED: uncharacterized protein LOC102604925 [Solanum tuberosum]
Length=506

 Score =   249 bits (636),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTG L GEELSQAYASGDVF+MPSESETLG VVLEAMSSGLPVVAARAGG+P+II DD
Sbjct  354  AVFTGTLLGEELSQAYASGDVFLMPSESETLGLVVLEAMSSGLPVVAARAGGVPDIIPDD  413

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            QQGKIGYLF PGDLDDC+ KL PLL D ELRET+GKAAR E+EKYDWKAAT+ IRNEQY+
Sbjct  414  QQGKIGYLFTPGDLDDCMSKLVPLLRDTELRETMGKAARVEMEKYDWKAATRTIRNEQYS  473

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI FWRK+++Q   P QWLF+RIF  P +E R
Sbjct  474  AAIWFWRKQKAQFLRPFQWLFQRIFAAPKVEYR  506



>ref|XP_004249580.1| PREDICTED: uncharacterized protein LOC101249508 [Solanum lycopersicum]
Length=504

 Score =   249 bits (635),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
             VFTGML GEELSQAYASGD+FVMPSESETLG VVLEAMSSGLPV+AARAGGIP+II DD
Sbjct  354  VVFTGMLLGEELSQAYASGDIFVMPSESETLGFVVLEAMSSGLPVLAARAGGIPDIIPDD  413

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
             QGK GYL+NPGD+DDCL KL+PLL++ ELRETIG+AAR E+EK+DW+AAT+KIRNEQYN
Sbjct  414  HQGKTGYLYNPGDIDDCLSKLEPLLYNAELRETIGRAARTEMEKFDWRAATRKIRNEQYN  473

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDI  240
            AAI FWRK+R+Q   P QWLFKR  Q P++
Sbjct  474  AAIWFWRKKRAQLSRPFQWLFKRRLQAPEV  503



>ref|XP_009593273.1| PREDICTED: uncharacterized protein LOC104089958 isoform X2 [Nicotiana 
tomentosiformis]
Length=376

 Score =   244 bits (624),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGD+FVMPSESETLG VVLEAMSSGLPVVAARAGGIP+II DD
Sbjct  225  AVFTGMLLGEELSQAYASGDIFVMPSESETLGFVVLEAMSSGLPVVAARAGGIPDIIPDD  284

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            QQGK G+LFNPGDLDDCL KLKPLL D ELR TIG+AAR E+EKYDW+AAT+KIRNEQYN
Sbjct  285  QQGKTGFLFNPGDLDDCLNKLKPLLHDAELRGTIGQAARVEMEKYDWRAATRKIRNEQYN  344

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDI  240
            AAI FWRK+R+Q   P QWL K   Q P++
Sbjct  345  AAIWFWRKKRAQLLRPFQWLLKFRVQAPEV  374



>gb|KHG08972.1| GDP-mannose-dependent alpha-mannosyltransferase [Gossypium arboreum]
Length=516

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
             VFTGMLQGEELSQAYASGD+FVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II  D
Sbjct  364  VVFTGMLQGEELSQAYASGDIFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPAD  423

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LFNPGDLDDCL KL PLL + E+RETIGKAAR E+EKYDW+AATKKIRNEQYN
Sbjct  424  QEGKTGFLFNPGDLDDCLTKLGPLLQNKEMRETIGKAARQEMEKYDWRAATKKIRNEQYN  483

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI FWRK+R+Q   PLQWL KR+F +P I  R
Sbjct  484  AAIWFWRKKRAQLLRPLQWLAKRVFPSPKISYR  516



>gb|KDO53240.1| hypothetical protein CISIN_1g009759mg [Citrus sinensis]
Length=294

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV  RAGGIP+II +D
Sbjct  142  AVFTGMLLGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGVRAGGIPDIIPED  201

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q GKIGYLFNPGDLDDCL KL+PLL++ ELRET+G+AAR E+EKYDW+AAT+ IRNEQYN
Sbjct  202  QDGKIGYLFNPGDLDDCLSKLEPLLYNQELRETMGQAARQEMEKYDWRAATRTIRNEQYN  261

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDI  240
            AAI FWRK+R+Q   P+QWL KRIF + ++
Sbjct  262  AAIWFWRKKRAQLLRPIQWLAKRIFPSAEV  291



>ref|XP_009787548.1| PREDICTED: uncharacterized protein LOC104235470 [Nicotiana sylvestris]
Length=506

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGD+FVMPSESETLG VVLEAMSSGLPVVAARAGGIP+II DD
Sbjct  355  AVFTGMLLGEELSQAYASGDIFVMPSESETLGFVVLEAMSSGLPVVAARAGGIPDIIPDD  414

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            QQGK G+LFNPGDLDDCL KLKPLL D ELR TIG+AAR E+EKYDW+AAT+KIRNEQYN
Sbjct  415  QQGKTGFLFNPGDLDDCLSKLKPLLHDAELRGTIGQAARVEMEKYDWRAATRKIRNEQYN  474

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDI  240
            AAI FWRK+R+Q   P QWLFK   Q P++
Sbjct  475  AAIWFWRKKRAQLLRPFQWLFKFRVQAPEV  504



>gb|KJB76911.1| hypothetical protein B456_012G112200 [Gossypium raimondii]
Length=244

 Score =   239 bits (609),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGM QGEELS+AYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II  +
Sbjct  92   AVFTGMFQGEELSEAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPAE  151

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LF PGD++DC+ KL PLL + ELRETIGKAAR+E+EKYDWKAATK IRNEQY 
Sbjct  152  QEGKTGFLFTPGDIEDCMSKLVPLLQNKELRETIGKAAREEMEKYDWKAATKTIRNEQYE  211

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI FWRK+R+++ GPLQWL KR+F +P I  R
Sbjct  212  AAIWFWRKKRAEALGPLQWLTKRLFPSPAINFR  244



>ref|XP_009781169.1| PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase 
GPI3 subunit-like [Nicotiana sylvestris]
Length=508

 Score =   246 bits (629),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVF+MPSESETLG VVLEAMSSGLPVVAARAGG+P+II DD
Sbjct  356  AVFTGMLLGEELSQAYASGDVFLMPSESETLGLVVLEAMSSGLPVVAARAGGVPDIIPDD  415

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            QQGKIGYLFNPGDLDDC+ KL PLL D ELRET+GK AR E+EKYDWKAAT+ IRNEQY+
Sbjct  416  QQGKIGYLFNPGDLDDCMSKLVPLLHDAELRETMGKTARVEMEKYDWKAATRTIRNEQYS  475

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI FW+K+R+    P QW+F+ IF  P+++ R
Sbjct  476  AAIWFWKKQRAVFLRPFQWMFRCIFAVPEVDYR  508



>ref|XP_009587153.1| PREDICTED: uncharacterized protein LOC104084897 [Nicotiana tomentosiformis]
Length=509

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVF+MPSESETLG VVLEAMSSGLPVVAARAGG+P+II DD
Sbjct  357  AVFTGMLLGEELSQAYASGDVFLMPSESETLGLVVLEAMSSGLPVVAARAGGVPDIIPDD  416

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            QQGKIGYLFNPGDLDDC+ KL PLL D ELRET+GK AR E+EKYDWKAAT+ IRNEQY+
Sbjct  417  QQGKIGYLFNPGDLDDCMSKLVPLLRDAELRETMGKTARIEMEKYDWKAATRTIRNEQYS  476

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI FW+K+R+    P QW+F+ IF  P+++ R
Sbjct  477  AAIWFWKKQRTVFLRPFQWMFRCIFAAPEVDYR  509



>ref|XP_010101801.1| GDP-mannose-dependent alpha-mannosyltransferase [Morus notabilis]
 gb|EXB89938.1| GDP-mannose-dependent alpha-mannosyltransferase [Morus notabilis]
Length=337

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 135/154 (88%), Gaps = 1/154 (1%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSGLPVVAARAGGIP+II  D
Sbjct  184  AVFTGMLGGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGLPVVAARAGGIPDIIPAD  243

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK  +L+NPGD+DDCL KL+PLL + ELRE IGKAAR+E+EKYDWKAAT+KIRNEQYN
Sbjct  244  QEGKTSFLYNPGDVDDCLSKLQPLLHNQELREAIGKAAREEMEKYDWKAATRKIRNEQYN  303

Query  329  AAISFWRKERSQSPGPLQWLFKRIF-QTPDIENR  231
            AAI FWRK+R+Q  GP+QWL K IF  +P++  R
Sbjct  304  AAIWFWRKKRAQFLGPVQWLIKCIFPPSPEVNCR  337



>gb|KHG00374.1| mgtA [Gossypium arboreum]
Length=244

 Score =   238 bits (606),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELS+AYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II  +
Sbjct  92   AVFTGMLQGEELSEAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPAE  151

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LF PGD +DC+RKL PLL + ELRETIGKAAR+E+E YDWKAATK IRNEQY 
Sbjct  152  QEGKTGFLFTPGDTEDCMRKLVPLLENKELRETIGKAAREEMENYDWKAATKTIRNEQYE  211

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI FWRK+R+++ GPLQWL +R+F +P I  R
Sbjct  212  AAIWFWRKKRAEALGPLQWLTERLFPSPAINFR  244



>gb|KHG00375.1| mgtA [Gossypium arboreum]
Length=275

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELS+AYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II  +
Sbjct  123  AVFTGMLQGEELSEAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPAE  182

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LF PGD +DC+RKL PLL + ELRETIGKAAR+E+E YDWKAATK IRNEQY 
Sbjct  183  QEGKTGFLFTPGDTEDCMRKLVPLLENKELRETIGKAAREEMENYDWKAATKTIRNEQYE  242

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI FWRK+R+++ GPLQWL +R+F +P I  R
Sbjct  243  AAIWFWRKKRAEALGPLQWLTERLFPSPAINFR  275



>ref|XP_010558362.1| PREDICTED: uncharacterized protein LOC104827042 [Tarenaya hassleriana]
Length=518

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYASGDVFVMPSESETLG VVLEAMSSGLPVVAARAGGIP+II ++
Sbjct  367  AVFTGMLQGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGLPVVAARAGGIPDIIPEE  426

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LFNPGD++DCL K++ LL DPE RETIGKAAR+E+EKYDW+AAT+KIRNEQY+
Sbjct  427  QEGKTGFLFNPGDVEDCLSKVRQLLDDPEKRETIGKAAREEMEKYDWRAATRKIRNEQYS  486

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIE  237
            AAI FWRK+RSQ  GP  WL  R+F +P+++
Sbjct  487  AAIWFWRKKRSQLLGPFHWLVNRLFPSPEVD  517



>ref|XP_008442461.1| PREDICTED: uncharacterized protein LOC103486318 [Cucumis melo]
Length=514

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PV+ ARAGG+P+II  +
Sbjct  362  AVFTGMLSGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVIGARAGGVPDIIPPE  421

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q GKIGYL+ PGD+DDCL KLKPLL + ELRET+GKAAR+E+EKYDWKAAT+ IRNEQYN
Sbjct  422  QDGKIGYLYTPGDIDDCLSKLKPLLENRELRETMGKAAREEMEKYDWKAATRTIRNEQYN  481

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDI  240
            AAI FWRK+R+Q   P QWLFKRIF +P++
Sbjct  482  AAIWFWRKKRAQFLRPFQWLFKRIFPSPEV  511



>gb|KDO53239.1| hypothetical protein CISIN_1g009759mg [Citrus sinensis]
Length=385

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV  RAGGIP+II +D
Sbjct  233  AVFTGMLLGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGVRAGGIPDIIPED  292

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q GKIGYLFNPGDLDDCL KL+PLL++ ELRET+G+AAR E+EKYDW+AAT+ IRNEQYN
Sbjct  293  QDGKIGYLFNPGDLDDCLSKLEPLLYNQELRETMGQAARQEMEKYDWRAATRTIRNEQYN  352

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIE  237
            AAI FWRK+R+Q   P+QWL KRIF + ++ 
Sbjct  353  AAIWFWRKKRAQLLRPIQWLAKRIFPSAEVN  383



>gb|KDO53238.1| hypothetical protein CISIN_1g009759mg [Citrus sinensis]
Length=377

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV  RAGGIP+II +D
Sbjct  225  AVFTGMLLGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGVRAGGIPDIIPED  284

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q GKIGYLFNPGDLDDCL KL+PLL++ ELRET+G+AAR E+EKYDW+AAT+ IRNEQYN
Sbjct  285  QDGKIGYLFNPGDLDDCLSKLEPLLYNQELRETMGQAARQEMEKYDWRAATRTIRNEQYN  344

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIE  237
            AAI FWRK+R+Q   P+QWL KRIF + ++ 
Sbjct  345  AAIWFWRKKRAQLLRPIQWLAKRIFPSAEVN  375



>emb|CBI30420.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II  D
Sbjct  284  AVFTGMLQGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGVPVVGARAGGIPDIIPRD  343

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
             +GK G+L+NPGD++DCL KL+PLL   ELRETIGKAAR+E+EKYDW+AAT+KIRNEQYN
Sbjct  344  DEGKTGFLYNPGDIEDCLSKLEPLLHSHELRETIGKAAREEMEKYDWRAATRKIRNEQYN  403

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI FWRK+R+Q   PLQWL +  F+TP+I  R
Sbjct  404  AAIWFWRKKRAQLLRPLQWLTRLFFRTPEINYR  436



>ref|XP_009593272.1| PREDICTED: uncharacterized protein LOC104089958 isoform X1 [Nicotiana 
tomentosiformis]
Length=505

 Score =   245 bits (626),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGD+FVMPSESETLG VVLEAMSSGLPVVAARAGGIP+II DD
Sbjct  354  AVFTGMLLGEELSQAYASGDIFVMPSESETLGFVVLEAMSSGLPVVAARAGGIPDIIPDD  413

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            QQGK G+LFNPGDLDDCL KLKPLL D ELR TIG+AAR E+EKYDW+AAT+KIRNEQYN
Sbjct  414  QQGKTGFLFNPGDLDDCLNKLKPLLHDAELRGTIGQAARVEMEKYDWRAATRKIRNEQYN  473

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDI  240
            AAI FWRK+R+Q   P QWL K   Q P++
Sbjct  474  AAIWFWRKKRAQLLRPFQWLLKFRVQAPEV  503



>ref|XP_004246336.1| PREDICTED: uncharacterized protein LOC101252422 [Solanum lycopersicum]
Length=506

 Score =   244 bits (623),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTG L GEELSQAYASGDVF+MPSESETLG VVLEAMSSGLPVVAARAGG+P+II DD
Sbjct  354  AVFTGTLLGEELSQAYASGDVFLMPSESETLGLVVLEAMSSGLPVVAARAGGVPDIIPDD  413

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            QQGKIGYLF PGDLDDC+ KL PLL D ELRET+GKAAR E+EKYDWKAAT+ IRNEQY+
Sbjct  414  QQGKIGYLFTPGDLDDCMSKLVPLLRDIELRETMGKAARIEMEKYDWKAATRTIRNEQYS  473

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI F RK+++Q   P QWLF+RIF  P+++ R
Sbjct  474  AAIWFCRKQKAQFLRPFQWLFQRIFAAPEVDCR  506



>ref|XP_002278868.2| PREDICTED: uncharacterized protein LOC100259616 [Vitis vinifera]
Length=519

 Score =   244 bits (622),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II  D
Sbjct  367  AVFTGMLQGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGVPVVGARAGGIPDIIPRD  426

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
             +GK G+L+NPGD++DCL KL+PLL   ELRETIGKAAR+E+EKYDW+AAT+KIRNEQYN
Sbjct  427  DEGKTGFLYNPGDIEDCLSKLEPLLHSHELRETIGKAAREEMEKYDWRAATRKIRNEQYN  486

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI FWRK+R+Q   PLQWL +  F+TP+I  R
Sbjct  487  AAIWFWRKKRAQLLRPLQWLTRLFFRTPEINYR  519



>ref|XP_010031046.1| PREDICTED: uncharacterized protein LOC104420932 [Eucalyptus grandis]
Length=377

 Score =   239 bits (611),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYASGDVF+MPSESETLG VVLEAMSSG+PVVAARAGG+P+II  +
Sbjct  225  AVFTGMLQGEELSQAYASGDVFMMPSESETLGLVVLEAMSSGIPVVAARAGGVPDIIPPE  284

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q GK  +LF+PGDLDDC+ KL+PLL + ELRETIGKAAR+E+EKYDW+AAT+KIRNEQYN
Sbjct  285  QDGKTSFLFSPGDLDDCMSKLEPLLQNSELRETIGKAAREEMEKYDWRAATRKIRNEQYN  344

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI FWRK+R+Q   P+QWL KR F +P+   R
Sbjct  345  AAIWFWRKKRAQLLRPIQWLAKRFFPSPEATYR  377



>emb|CAN62120.1| hypothetical protein VITISV_037025 [Vitis vinifera]
Length=497

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II  D
Sbjct  345  AVFTGMLQGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGVPVVGARAGGIPDIIPRD  404

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
             +GK G+L+NPGD++DCL KL+PLL   ELRETIGKAAR+E+EKYDW+AAT+KIRNEQYN
Sbjct  405  DEGKTGFLYNPGDIEDCLSKLEPLLHSHELRETIGKAAREEMEKYDWRAATRKIRNEQYN  464

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI FWRK+R+Q   PLQWL +  F+TP+I  R
Sbjct  465  AAIWFWRKKRAQLLRPLQWLTRLFFRTPEINYR  497



>gb|AES79437.2| group 1 family glycosyltransferase [Medicago truncatula]
Length=515

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GE LSQAYASGDVF+MPSESETLG VVLEAMSSG+PVVAARAGGIP+II  D
Sbjct  363  AVFTGMLGGEVLSQAYASGDVFIMPSESETLGFVVLEAMSSGIPVVAARAGGIPDIIPAD  422

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK GYL+NPGDL+DCL KLKPLL+D ELRETIGKAAR+E+EK+DWKAAT+K+RNEQYN
Sbjct  423  QEGKTGYLYNPGDLEDCLSKLKPLLFDKELRETIGKAARNEMEKFDWKAATRKVRNEQYN  482

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI FWRK+R+    PLQW+ KR+F  P +  R
Sbjct  483  AAIWFWRKKRAILLRPLQWISKRVFPPPQVNYR  515



>ref|XP_003623219.1| Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit 
[Medicago truncatula]
Length=539

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GE LSQAYASGDVF+MPSESETLG VVLEAMSSG+PVVAARAGGIP+II  D
Sbjct  387  AVFTGMLGGEVLSQAYASGDVFIMPSESETLGFVVLEAMSSGIPVVAARAGGIPDIIPAD  446

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK GYL+NPGDL+DCL KLKPLL+D ELRETIGKAAR+E+EK+DWKAAT+K+RNEQYN
Sbjct  447  QEGKTGYLYNPGDLEDCLSKLKPLLFDKELRETIGKAARNEMEKFDWKAATRKVRNEQYN  506

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI FWRK+R+    PLQW+ KR+F  P +  R
Sbjct  507  AAIWFWRKKRAILLRPLQWISKRVFPPPQVNYR  539



>ref|XP_002309122.2| hypothetical protein POPTR_0006s09880g [Populus trichocarpa]
 gb|EEE92645.2| hypothetical protein POPTR_0006s09880g [Populus trichocarpa]
Length=520

 Score =   243 bits (620),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVVAARAGGIP+II  +
Sbjct  371  AVFTGMLGGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVAARAGGIPDIIPPE  430

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q GK G+LFNPGDLDDCL KL+PLL + ELRET+GKAAR ++EKYDWKAATKKIRNEQYN
Sbjct  431  QDGKTGFLFNPGDLDDCLSKLEPLLDNQELRETMGKAARHDMEKYDWKAATKKIRNEQYN  490

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDI  240
            AAI FWRK+R+Q   P+QWL KR+F +P++
Sbjct  491  AAIWFWRKKRAQLLRPIQWLVKRLFPSPEV  520



>ref|XP_004137727.1| PREDICTED: GDP-mannose-dependent alpha-mannosyltransferase-like 
[Cucumis sativus]
 ref|XP_004156597.1| PREDICTED: GDP-mannose-dependent alpha-mannosyltransferase-like 
[Cucumis sativus]
 gb|KGN58788.1| hypothetical protein Csa_3G732460 [Cucumis sativus]
Length=515

 Score =   243 bits (619),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PV+ ARAGG+P+II  +
Sbjct  363  AVFTGMLSGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVIGARAGGVPDIIPPE  422

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q GKIGYL+ PGD+DDCL KLKPLL + ELRET+GKAAR+E+EKYDWKAAT+ IRNEQYN
Sbjct  423  QDGKIGYLYTPGDVDDCLSKLKPLLENRELRETMGKAAREEMEKYDWKAATRTIRNEQYN  482

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDI  240
            AAI FWRK+R+Q   P QWLFKRIF + ++
Sbjct  483  AAIWFWRKKRAQFLRPFQWLFKRIFPSSEV  512



>gb|KHN46311.1| GDP-mannose-dependent alpha-mannosyltransferase [Glycine soja]
Length=441

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II +D
Sbjct  288  AVFTGMLGGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPED  347

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q GKIGYL+ PGDL+DCL KLKPLL D ELRET+G+AAR E+EKYDW+AAT+KIRNE YN
Sbjct  348  QDGKIGYLYTPGDLEDCLSKLKPLLDDKELRETMGEAARLEMEKYDWRAATQKIRNENYN  407

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIE  237
            AAI FWRK+R+Q   P QWL +RIF +PD E
Sbjct  408  AAIWFWRKKRAQLLRPFQWLAQRIFHSPDPE  438



>gb|KJB76912.1| hypothetical protein B456_012G112200 [Gossypium raimondii]
Length=403

 Score =   239 bits (610),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGM QGEELS+AYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II  +
Sbjct  251  AVFTGMFQGEELSEAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPAE  310

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LF PGD++DC+ KL PLL + ELRETIGKAAR+E+EKYDWKAATK IRNEQY 
Sbjct  311  QEGKTGFLFTPGDIEDCMSKLVPLLQNKELRETIGKAAREEMEKYDWKAATKTIRNEQYE  370

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI FWRK+R+++ GPLQWL KR+F +P I  R
Sbjct  371  AAIWFWRKKRAEALGPLQWLTKRLFPSPAINFR  403



>gb|KCW88121.1| hypothetical protein EUGRSUZ_A00516 [Eucalyptus grandis]
Length=422

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYASGDVF+MPSESETLG VVLEAMSSG+PVVAARAGG+P+II  +
Sbjct  270  AVFTGMLQGEELSQAYASGDVFMMPSESETLGLVVLEAMSSGIPVVAARAGGVPDIIPPE  329

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q GK  +LF+PGDLDDC+ KL+PLL + ELRETIGKAAR+E+EKYDW+AAT+KIRNEQYN
Sbjct  330  QDGKTSFLFSPGDLDDCMSKLEPLLQNSELRETIGKAAREEMEKYDWRAATRKIRNEQYN  389

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI FWRK+R+Q   P+QWL KR F +P+   R
Sbjct  390  AAIWFWRKKRAQLLRPIQWLAKRFFPSPEATYR  422



>ref|XP_007026774.1| Sulfoquinovosyldiacylglycerol 2 [Theobroma cacao]
 gb|EOY07276.1| Sulfoquinovosyldiacylglycerol 2 [Theobroma cacao]
Length=518

 Score =   242 bits (618),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II  +
Sbjct  366  AVFTGMLQGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGVPVVGARAGGIPDIIPAE  425

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LFNPGD+DDCL KL+ LL + ELRETIGKAAR+E+EKYDWKAATKKIRNEQYN
Sbjct  426  QEGKTGFLFNPGDVDDCLSKLEALLRNKELRETIGKAAREEMEKYDWKAATKKIRNEQYN  485

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI FWRK+R+Q   PLQWL +R+F + ++  R
Sbjct  486  AAIWFWRKKRAQLLRPLQWLARRLFPSQEVNYR  518



>ref|XP_011019147.1| PREDICTED: uncharacterized protein LOC105121959 [Populus euphratica]
Length=520

 Score =   242 bits (618),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVVAARAGGIP+II  +
Sbjct  371  AVFTGMLGGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVAARAGGIPDIIPPE  430

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q GK G+LFNPGDLDDCL KL+PLL + ELRET+GKAAR ++EKYDWKAATKKIRNEQYN
Sbjct  431  QDGKTGFLFNPGDLDDCLSKLEPLLDNQELRETMGKAARHDMEKYDWKAATKKIRNEQYN  490

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDI  240
            AAI FWRK+R+Q   P+QWL KR+F +P +
Sbjct  491  AAIWFWRKKRAQLLRPIQWLVKRLFPSPQV  520



>ref|XP_006480973.1| PREDICTED: uncharacterized protein LOC102615235 [Citrus sinensis]
Length=526

 Score =   242 bits (618),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV  RAGGIP+II +D
Sbjct  374  AVFTGMLLGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGVRAGGIPDIIPED  433

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q GKIGYLFNPGDLDDCL KL+PLL++ ELRET+G+AAR E+EKYDW+AAT+ IRNEQYN
Sbjct  434  QDGKIGYLFNPGDLDDCLSKLEPLLYNQELRETMGQAARQEMEKYDWRAATRTIRNEQYN  493

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIE  237
            AAI FWRK+R+Q   P+QWL KRIF + ++ 
Sbjct  494  AAIWFWRKKRAQLLRPIQWLAKRIFPSAEVN  524



>ref|XP_006429312.1| hypothetical protein CICLE_v10011473mg [Citrus clementina]
 gb|ESR42552.1| hypothetical protein CICLE_v10011473mg [Citrus clementina]
 gb|KDO53237.1| hypothetical protein CISIN_1g009759mg [Citrus sinensis]
Length=526

 Score =   242 bits (618),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV  RAGGIP+II +D
Sbjct  374  AVFTGMLLGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGVRAGGIPDIIPED  433

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q GKIGYLFNPGDLDDCL KL+PLL++ ELRET+G+AAR E+EKYDW+AAT+ IRNEQYN
Sbjct  434  QDGKIGYLFNPGDLDDCLSKLEPLLYNQELRETMGQAARQEMEKYDWRAATRTIRNEQYN  493

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIE  237
            AAI FWRK+R+Q   P+QWL KRIF + ++ 
Sbjct  494  AAIWFWRKKRAQLLRPIQWLAKRIFPSAEVN  524



>ref|XP_003516943.1| PREDICTED: uncharacterized protein LOC100780899 [Glycine max]
Length=523

 Score =   242 bits (617),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGG+P+II +D
Sbjct  370  AVFTGMLGGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGARAGGVPDIIPED  429

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q GKIGYL+ PGDL+DCL KLKPLL D ELRET+G+AAR E+EKYDW+AAT+KIRNE YN
Sbjct  430  QDGKIGYLYTPGDLEDCLSKLKPLLDDKELRETMGEAARLEMEKYDWRAATQKIRNENYN  489

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIE  237
            AAI FWRK+R+Q   P QWL +RIFQ+PD E
Sbjct  490  AAIWFWRKKRAQLLRPFQWLAQRIFQSPDPE  520



>gb|KHN22725.1| GDP-mannose-dependent alpha-mannosyltransferase [Glycine soja]
Length=266

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVVAA AGGIP+II  D
Sbjct  116  AVFTGMLVGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVAACAGGIPDIIPVD  175

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q GK  YL+NPGD +DCL KL+PLL + ELRET+GKAAR+E+EKYDWK AT+KIRNEQYN
Sbjct  176  QDGKTSYLYNPGDFEDCLSKLRPLLLNKELRETMGKAAREEMEKYDWKEATRKIRNEQYN  235

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDI  240
            AAI FWRK+R+Q   P QWL KR F +P +
Sbjct  236  AAIWFWRKKRAQLLRPFQWLAKRFFPSPQV  265



>emb|CDY40313.1| BnaA10g27550D [Brassica napus]
Length=234

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELS+AYASGDVFVMPSESETLG VVLEAM+SGLPVVAARAGGIP+II +D
Sbjct  82   AVFTGMLQGEELSRAYASGDVFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPED  141

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LF+PGD++DC+ K++ LL D E R+ IGKAAR+E EKYDW+AAT KIRNEQY+
Sbjct  142  QEGKTGFLFSPGDVEDCVTKVRSLLNDSETRDIIGKAAREETEKYDWRAATTKIRNEQYS  201

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTP  246
            AAI FWRK+++Q  GPL WL KR+F  P
Sbjct  202  AAIWFWRKKKAQVLGPLNWLVKRLFPVP  229



>ref|XP_006287534.1| hypothetical protein CARUB_v10000742mg [Capsella rubella]
 gb|EOA20432.1| hypothetical protein CARUB_v10000742mg [Capsella rubella]
Length=514

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQG+ELSQAYASGDVFVMPSESETLG VVLEAM+SGLPVVAARAGGIP+II +D
Sbjct  363  AVFTGMLQGDELSQAYASGDVFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPED  422

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LFNPGD++DC+ KL+ LL D E+RE IGKAAR+E EKYDW+AAT KIRNEQY+
Sbjct  423  QEGKTGFLFNPGDVEDCVTKLRTLLHDSEIREVIGKAAREETEKYDWRAATTKIRNEQYS  482

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIE  237
            AAI FWRK++ Q  GP+ WL KR+F  P++ 
Sbjct  483  AAIWFWRKKKVQVLGPINWLIKRLFPVPEVN  513



>ref|XP_006583630.1| PREDICTED: uncharacterized protein LOC100804237 [Glycine max]
Length=366

 Score =   234 bits (598),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVVAA AGGIP+II  D
Sbjct  216  AVFTGMLVGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVAACAGGIPDIIPVD  275

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q GK  YL+NPGD +DCL KL+PLL + ELRET+GKAAR+E+EKYDWK AT+KIRNEQYN
Sbjct  276  QDGKTSYLYNPGDFEDCLSKLRPLLLNKELRETMGKAAREEMEKYDWKEATRKIRNEQYN  335

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIE  237
            AAI FWRK+R+Q   P QWL KR F +P + 
Sbjct  336  AAIWFWRKKRAQLLRPFQWLAKRFFPSPQVN  366



>gb|KEH28856.1| group 1 family glycosyltransferase [Medicago truncatula]
Length=375

 Score =   235 bits (599),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
             VFTGML GEELSQAYASGDVF+MPSESETLGQVV EA+SSG+PVV ARAGGIP+II++D
Sbjct  225  VVFTGMLSGEELSQAYASGDVFIMPSESETLGQVVSEALSSGIPVVGARAGGIPDIITED  284

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q GKIGYL+ PGDLDDCL KLKPLL D ELRET+GKAAR E+EKYDW+ AT+ IRNE YN
Sbjct  285  QDGKIGYLYTPGDLDDCLSKLKPLLHDIELRETMGKAARIEMEKYDWREATRTIRNENYN  344

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDI  240
             AI FWRK+++Q   P QWL K IF +P++
Sbjct  345  TAIWFWRKKKAQLLLPFQWLTKHIFPSPEV  374



>ref|XP_010553086.1| PREDICTED: uncharacterized protein LOC104823284 [Tarenaya hassleriana]
Length=518

 Score =   239 bits (609),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYASGDVFVMPSESETLG VVLEAMSSGLPVVAARAGGIP+II ++
Sbjct  367  AVFTGMLQGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGLPVVAARAGGIPDIIPEE  426

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LFNPGD++DC+ KLK LL +PE RE +GKAAR+E+EKYDW+AAT+KIRNEQY+
Sbjct  427  QEGKTGFLFNPGDVEDCVSKLKALLDEPEKREIVGKAAREEMEKYDWRAATRKIRNEQYS  486

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDI  240
            AAI FWRK+R+Q   P+ WL KR+F  P++
Sbjct  487  AAIWFWRKKRAQLLRPIHWLVKRLFPAPEV  516



>ref|XP_010490595.1| PREDICTED: uncharacterized protein LOC104768346 [Camelina sativa]
Length=511

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQG+ELSQAYASGDVFVMPSESETLG VVLEAM+SGLPVVAARAGGIP+II +D
Sbjct  360  AVFTGMLQGDELSQAYASGDVFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPED  419

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LFNPGD++DC+ KL+ LL D E RE IGKAAR+E EKYDW+AAT KIRNEQY+
Sbjct  420  QEGKTGFLFNPGDVEDCVTKLRNLLHDSETREIIGKAAREETEKYDWRAATTKIRNEQYS  479

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIE  237
            AAI FWRK++ Q  GP+ WL KR+F  P++ 
Sbjct  480  AAIWFWRKKKVQVLGPINWLVKRLFPVPEVN  510



>ref|XP_010452011.1| PREDICTED: uncharacterized protein LOC104734184 [Camelina sativa]
Length=517

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQG+ELSQAYASGDVFVMPSESETLG VVLEAM+SGLPVVAARAGGIP+II +D
Sbjct  366  AVFTGMLQGDELSQAYASGDVFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPED  425

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LFNPGD++DC+ KL+ LL D E RE IGKAAR+E EKYDW+AAT KIRNEQY+
Sbjct  426  QEGKTGFLFNPGDVEDCVTKLRNLLHDSETREIIGKAAREETEKYDWRAATTKIRNEQYS  485

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIE  237
            AAI FWRK++ Q  GP+ WL KR+F  P++ 
Sbjct  486  AAIWFWRKKKVQVLGPINWLVKRLFPVPEVN  516



>ref|XP_010678109.1| PREDICTED: uncharacterized protein LOC104893676 [Beta vulgaris 
subsp. vulgaris]
Length=503

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYAS DVFVMPSESETLG VVLEAMSSG+PVVA RAGGIP+I+ +D
Sbjct  351  AVFTGMLQGEELSQAYASADVFVMPSESETLGLVVLEAMSSGIPVVAVRAGGIPDIVPED  410

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+L++PGDL DCL KL+PLL D ELRETIGKAAR E+EKYDW+AATK IRNEQYN
Sbjct  411  QEGKTGFLYSPGDLGDCLSKLRPLLHDSELRETIGKAARQEMEKYDWRAATKVIRNEQYN  470

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI FWRK+R+Q   P+QWL     ++P++  R
Sbjct  471  AAIWFWRKKRTQLLRPVQWLVNFFVKSPEVSYR  503



>ref|XP_006398643.1| hypothetical protein EUTSA_v10013276mg [Eutrema salsugineum]
 gb|ESQ40096.1| hypothetical protein EUTSA_v10013276mg [Eutrema salsugineum]
Length=516

 Score =   237 bits (604),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQG+ELSQAYASGDVFVMPSESETLG VVLEAM+SGLPVVAARAGGIP+II +D
Sbjct  365  AVFTGMLQGDELSQAYASGDVFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPED  424

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LFNPGD++DC+ KL+ LL D E RE IGKAAR+E EKYDW+AAT KIRNEQY+
Sbjct  425  QEGKTGFLFNPGDVEDCVTKLRTLLHDSEKREIIGKAAREETEKYDWRAATTKIRNEQYS  484

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDI  240
            AAI FWRK++++  GP+ WL KR+F  P++
Sbjct  485  AAIWFWRKKKAEVLGPVHWLVKRLFPVPEV  514



>ref|XP_002870938.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47197.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=518

 Score =   237 bits (605),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQG+ELSQAYASGDVFVMPSESETLG VVLEAM+SGLPVVAARAGGIP+II +D
Sbjct  367  AVFTGMLQGDELSQAYASGDVFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPED  426

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LFNPGD++DC+ KL+ LL D E RE IGKAAR+E EKYDW+AAT KIRNEQY+
Sbjct  427  QEGKTGFLFNPGDVEDCVTKLRTLLHDRETREIIGKAAREETEKYDWRAATTKIRNEQYS  486

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIE  237
            AAI FWRK++    GP+ WL KR+F  P++ 
Sbjct  487  AAIWFWRKKKVHVLGPINWLIKRLFPVPEVN  517



>ref|XP_008239560.1| PREDICTED: uncharacterized protein LOC103338145 [Prunus mume]
Length=519

 Score =   237 bits (604),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 134/155 (86%), Gaps = 2/155 (1%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II  D
Sbjct  365  AVFTGMLGGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPAD  424

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+L++ GD+DDCLRKL+PLL + ELRETIGKAAR+E+EKYDWKAAT+ IRNEQYN
Sbjct  425  QEGKTGFLYDYGDVDDCLRKLQPLLENKELRETIGKAAREEMEKYDWKAATRVIRNEQYN  484

Query  329  AAISFWRKERSQSPGPLQWLFKRIF--QTPDIENR  231
            AAI FWRK+R+Q   PLQW  KRIF    P+I+ R
Sbjct  485  AAIWFWRKKRAQFLRPLQWFMKRIFPPSPPEIKCR  519



>gb|EYU26645.1| hypothetical protein MIMGU_mgv1a004620mg [Erythranthe guttata]
Length=518

 Score =   237 bits (604),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTG LQGEELSQAYASGDVFVMPSESETLG VVLEAMSSGLPVVAARAGGIP+II ++
Sbjct  365  AVFTGTLQGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGLPVVAARAGGIPDIIPEE  424

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            QQGK GYLFNP D+DDCL KLKPLL++ ELRETIGKAAR E+EKYDW+AAT+KIRNEQY 
Sbjct  425  QQGKTGYLFNPEDIDDCLSKLKPLLYERELRETIGKAARVEMEKYDWRAATRKIRNEQYR  484

Query  329  AAISFWRKERSQSPGPLQWLFKRI  258
             AI FWRK+R +   P QWL +R 
Sbjct  485  DAILFWRKQREEFLKPFQWLIQRF  508



>gb|KDP24481.1| hypothetical protein JCGZ_25045 [Jatropha curcas]
Length=437

 Score =   234 bits (598),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II  +
Sbjct  285  AVFTGMLGGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPPE  344

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q GKIG+L+ PGD+DDCL KL+ LL + ELRET+GKAAR E+EKYDW+AAT+KIRNE YN
Sbjct  345  QDGKIGFLYTPGDIDDCLGKLESLLNNQELRETMGKAARQEMEKYDWRAATRKIRNENYN  404

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI FWRK+R+Q   P+QWL KRIF +P++  R
Sbjct  405  AAIWFWRKKRAQLLRPIQWLVKRIFPSPEVNYR  437



>ref|XP_004302644.1| PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase 
GPI3 subunit [Fragaria vesca subsp. vesca]
Length=505

 Score =   236 bits (603),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 130/149 (87%), Gaps = 1/149 (1%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVF+MPSESETLG VVLEAM+SG+PVVAARAGGIP+II DD
Sbjct  351  AVFTGMLGGEELSQAYASGDVFLMPSESETLGLVVLEAMASGIPVVAARAGGIPDIIPDD  410

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+L+N  DLDDCL KL+PLL + ELRETIGKAAR E EK+DWKAAT+ IRNEQYN
Sbjct  411  QEGKTGFLYNYNDLDDCLSKLQPLLENKELRETIGKAARKETEKFDWKAATRVIRNEQYN  470

Query  329  AAISFWRKERSQSPGPLQWLFKRIF-QTP  246
            AAI FWR+ R+Q   PLQWL KRIF QTP
Sbjct  471  AAIWFWRRRRAQFLRPLQWLMKRIFPQTP  499



>ref|XP_002323560.1| SULFOQUINOVOSYLDIACYLGLYCEROL 2 family protein [Populus trichocarpa]
 gb|EEF05321.1| SULFOQUINOVOSYLDIACYLGLYCEROL 2 family protein [Populus trichocarpa]
Length=429

 Score =   234 bits (596),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II  +
Sbjct  280  AVFTGMLGGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPPE  339

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
              GK G+LFNPGDLDDCL KL+PLL + ELRETIGKAAR + EKYDWKAATKKIRNEQY+
Sbjct  340  LDGKTGFLFNPGDLDDCLSKLEPLLDNQELRETIGKAARQDTEKYDWKAATKKIRNEQYS  399

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDI  240
            AAI FWR+ R+Q   P+QWL KR+F  P++
Sbjct  400  AAIWFWRENRAQLFRPIQWLVKRLFPIPEV  429



>ref|XP_004506782.1| PREDICTED: GDP-mannose-dependent alpha-mannosyltransferase-like 
[Cicer arietinum]
Length=512

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLGQVVLEAMSSG+PVV ARAGGIP+II +D
Sbjct  362  AVFTGMLGGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGIPVVGARAGGIPDIIPED  421

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q GKIGYL+ P DL+DCL KL PLL D ELRET+GK AR E+EKYDW+AAT+ IRNE YN
Sbjct  422  QDGKIGYLYTPRDLEDCLSKLIPLLHDKELRETMGKTARLEMEKYDWRAATRTIRNENYN  481

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDI  240
            AAI FWRK+++Q   P QWL KRIF +P++
Sbjct  482  AAIWFWRKKKAQVLLPFQWLAKRIFPSPEV  511



>ref|XP_003604630.1| Glycogen synthase [Medicago truncatula]
 gb|AES86827.1| group 1 family glycosyltransferase [Medicago truncatula]
Length=510

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
             VFTGML GEELSQAYASGDVF+MPSESETLGQVV EA+SSG+PVV ARAGGIP+II++D
Sbjct  360  VVFTGMLSGEELSQAYASGDVFIMPSESETLGQVVSEALSSGIPVVGARAGGIPDIITED  419

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q GKIGYL+ PGDLDDCL KLKPLL D ELRET+GKAAR E+EKYDW+ AT+ IRNE YN
Sbjct  420  QDGKIGYLYTPGDLDDCLSKLKPLLHDIELRETMGKAARIEMEKYDWREATRTIRNENYN  479

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDI  240
             AI FWRK+++Q   P QWL K IF +P++
Sbjct  480  TAIWFWRKKKAQLLLPFQWLTKHIFPSPEV  509



>gb|AAK76635.1| unknown protein [Arabidopsis thaliana]
Length=434

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTG LQG+ELSQAYASGDVFVMPSESETLG VVLEAMSSGLPVVAARAGGIP+II +D
Sbjct  283  AVFTGTLQGDELSQAYASGDVFVMPSESETLGLVVLEAMSSGLPVVAARAGGIPDIIPED  342

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LFNPGD++DC+ KL+ LL D E RE IGKAAR+E EKYDW+AAT KIRNEQY+
Sbjct  343  QEGKTGFLFNPGDVEDCVTKLRTLLHDRETREIIGKAAREETEKYDWRAATTKIRNEQYS  402

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPD  243
            AAI FWRK++    GP+ WL KR+F  P+
Sbjct  403  AAIWFWRKKKVHVLGPINWLIKRLFPVPE  431



>ref|XP_009130666.1| PREDICTED: uncharacterized protein LOC103855432 [Brassica rapa]
Length=525

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYASGDVFVMPSESETLG VVLEAM+SGLPVVAARAGGIP+II ++
Sbjct  373  AVFTGMLQGEELSQAYASGDVFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPEE  432

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LFNPGD++DC+ KL+ LL D E RE IGKAAR+E EKYDW+AAT KIRNEQY 
Sbjct  433  QEGKTGFLFNPGDVEDCVTKLRTLLHDKETREIIGKAAREETEKYDWRAATTKIRNEQYG  492

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTP  246
            AAI FWRK+++Q  GP+ WL KR+F  P
Sbjct  493  AAIWFWRKKKAQVLGPINWLVKRLFPVP  520



>emb|CAB69850.1| putative protein [Arabidopsis thaliana]
Length=470

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTG LQG+ELSQAYASGDVFVMPSESETLG VVLEAMSSGLPVVAARAGGIP+II +D
Sbjct  319  AVFTGTLQGDELSQAYASGDVFVMPSESETLGLVVLEAMSSGLPVVAARAGGIPDIIPED  378

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LFNPGD++DC+ KL+ LL D E RE IGKAAR+E EKYDW+AAT KIRNEQY+
Sbjct  379  QEGKTGFLFNPGDVEDCVTKLRTLLHDRETREIIGKAAREETEKYDWRAATTKIRNEQYS  438

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPD  243
            AAI FWRK++    GP+ WL KR+F  P+
Sbjct  439  AAIWFWRKKKVHVLGPINWLIKRLFPVPE  467



>ref|XP_010424824.1| PREDICTED: uncharacterized protein LOC104709996 [Camelina sativa]
Length=666

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQG+ELSQAYASGDVFVMPSESETLG VVLEAM+SGLPVVAARAGGIP+II +D
Sbjct  515  AVFTGMLQGDELSQAYASGDVFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPED  574

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LFNPGD++DC+ KLK LL D E RE IGKAAR+E EKYDW+AAT KIRNEQY+
Sbjct  575  QEGKTGFLFNPGDVEDCVTKLKNLLHDSETREIIGKAAREETEKYDWRAATTKIRNEQYS  634

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIE  237
            AAI FWRK++ Q  GP+ WL KR+F  P++ 
Sbjct  635  AAIWFWRKKKVQVLGPINWLVKRLFPVPEVN  665



>emb|CDY11210.1| BnaA03g00460D [Brassica napus]
Length=534

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYASGDVFVMPSESETLG VVLEAM+SGLPVVAARAGGIP+II ++
Sbjct  382  AVFTGMLQGEELSQAYASGDVFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPEE  441

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LFNPGD++DC+ KL+ LL D E RE IGKAAR+E EKYDW+AAT KIRNEQY 
Sbjct  442  QEGKTGFLFNPGDVEDCVTKLRTLLHDKETREIIGKAAREETEKYDWRAATTKIRNEQYG  501

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTP  246
            AAI FWRK+++Q  GP+ WL KR+F  P
Sbjct  502  AAIWFWRKKKAQVLGPINWLVKRLFPVP  529



>ref|XP_007205049.1| hypothetical protein PRUPE_ppa004263mg [Prunus persica]
 gb|EMJ06248.1| hypothetical protein PRUPE_ppa004263mg [Prunus persica]
Length=519

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 134/155 (86%), Gaps = 2/155 (1%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II  D
Sbjct  365  AVFTGMLGGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPLD  424

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+L++ GD+DDCLRKL+PLL + ELRETIG+AAR+E+EKYDWKAAT+ IRNEQYN
Sbjct  425  QEGKTGFLYDYGDVDDCLRKLQPLLENKELRETIGQAAREEMEKYDWKAATRVIRNEQYN  484

Query  329  AAISFWRKERSQSPGPLQWLFKRIF--QTPDIENR  231
            AAI FWRK+R+Q   PLQW  KRIF    P+I+ R
Sbjct  485  AAIWFWRKKRAQFLRPLQWFMKRIFPPSPPEIKCR  519



>gb|KHN24299.1| GDP-mannose-dependent alpha-mannosyltransferase [Glycine soja]
Length=437

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVVAARAGGIP+II  D
Sbjct  285  AVFTGMLGGEELSQAYASGDVFVMPSESETLGFVVLEAMSSGIPVVAARAGGIPDIIPAD  344

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q GK  YL++P DL+DCL KL+PLL + ELRET+GKAAR+E+EKYDWKAAT+KIRNEQYN
Sbjct  345  QDGKTSYLYDPRDLEDCLSKLRPLLHNKELRETMGKAAREEMEKYDWKAATRKIRNEQYN  404

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI FWRK+R+Q   P Q L KR F +P +  R
Sbjct  405  AAIWFWRKKRAQLLRPFQRLAKRFFPSPQVNYR  437



>emb|CDY10486.1| BnaCnng03870D [Brassica napus]
Length=417

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYASGDVFVMPSESETLG VVLEAM+SGLPVVAARAGGIP+II +D
Sbjct  267  AVFTGMLQGEELSQAYASGDVFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPED  326

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LF+PGD++DC+ K++ LL D E R+ IGKAAR+E EKYDW+AAT KIRNEQY 
Sbjct  327  QEGKTGFLFSPGDVEDCVTKVRSLLNDSETRDIIGKAAREETEKYDWRAATTKIRNEQYG  386

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPD  243
            AAI FWRK+++Q  GPL WL KR+F  P 
Sbjct  387  AAIWFWRKKKAQVLGPLNWLVKRLFPVPS  415



>ref|XP_008800789.1| PREDICTED: uncharacterized protein LOC103715059 [Phoenix dactylifera]
Length=503

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYASGD+FVMPSESETLG VVLEAMSSG+PVVAARAGGIPEII++D
Sbjct  351  AVFTGMLQGEELSQAYASGDIFVMPSESETLGLVVLEAMSSGIPVVAARAGGIPEIIAED  410

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK  +LF PGDLDDC+ K++ LL   E RE +G+ AR+E+EKYDWKAAT+KIRNE YN
Sbjct  411  QEGKTSFLFTPGDLDDCVNKIESLLSCKEFREAMGRTAREEMEKYDWKAATRKIRNEHYN  470

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIE  237
            AAI FWRK+R+Q   P+QWL +R F++P + 
Sbjct  471  AAIWFWRKKRAQLLRPIQWLVRRFFRSPQVN  501



>ref|XP_003552228.1| PREDICTED: uncharacterized protein LOC100807850 isoform X1 [Glycine 
max]
Length=515

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVVAARAGGIP+II  D
Sbjct  363  AVFTGMLGGEELSQAYASGDVFVMPSESETLGFVVLEAMSSGIPVVAARAGGIPDIIPAD  422

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q GK  YL++PGDL+DCL KL+PLL + ELRET+GKAAR+E+EKYDWKAAT+KIRNEQYN
Sbjct  423  QDGKTSYLYDPGDLEDCLSKLRPLLHNKELRETMGKAAREEMEKYDWKAATRKIRNEQYN  482

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI FWRK+R+Q   P Q L K  F +P +  R
Sbjct  483  AAIWFWRKKRAQLLRPFQRLAKHFFPSPQVNYR  515



>gb|EYU41861.1| hypothetical protein MIMGU_mgv1a004551mg [Erythranthe guttata]
Length=521

 Score =   235 bits (599),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTG L GEELSQAYASGD+FVMPSESETLG VVLEAMSSGL VVAARAGGIP+II +D
Sbjct  368  AVFTGTLHGEELSQAYASGDIFVMPSESETLGFVVLEAMSSGLAVVAARAGGIPDIIPED  427

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
             +GK G+L+NPGDLDDCL KLKPLL D ELRE IG+ AR E+EKYDW+AAT+KIRNEQYN
Sbjct  428  HEGKTGFLYNPGDLDDCLSKLKPLLHDQELREVIGREARVEMEKYDWRAATRKIRNEQYN  487

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTP  246
            AAI FWRK+R+Q   P QW F+R+   P
Sbjct  488  AAIWFWRKKRAQFFRPFQWWFRRVVHAP  515



>ref|XP_006602643.1| PREDICTED: uncharacterized protein LOC100807850 isoform X2 [Glycine 
max]
Length=543

 Score =   235 bits (600),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVVAARAGGIP+II  D
Sbjct  391  AVFTGMLGGEELSQAYASGDVFVMPSESETLGFVVLEAMSSGIPVVAARAGGIPDIIPAD  450

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q GK  YL++PGDL+DCL KL+PLL + ELRET+GKAAR+E+EKYDWKAAT+KIRNEQYN
Sbjct  451  QDGKTSYLYDPGDLEDCLSKLRPLLHNKELRETMGKAAREEMEKYDWKAATRKIRNEQYN  510

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI FWRK+R+Q   P Q L K  F +P +  R
Sbjct  511  AAIWFWRKKRAQLLRPFQRLAKHFFPSPQVNYR  543



>ref|XP_010256624.1| PREDICTED: uncharacterized protein LOC104596978 [Nelumbo nucifera]
Length=509

 Score =   234 bits (597),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTG LQGEELSQAYASGDVFVMPSESETLG VVLEAM+SG+PVVAARAGGIP+II  D
Sbjct  357  AVFTGTLQGEELSQAYASGDVFVMPSESETLGLVVLEAMASGIPVVAARAGGIPDIIPTD  416

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            ++GK G+L+NP D++DCL KL+PLL + ELR+TIG+AAR+E EKY W+AAT+KIRNEQYN
Sbjct  417  KEGKTGFLYNPRDIEDCLSKLEPLLSNQELRKTIGRAAREETEKYGWRAATRKIRNEQYN  476

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIEN  234
            AAI FWRK+R+Q   P  WL +RIF++P++ +
Sbjct  477  AAIWFWRKKRAQLLRPFHWLIRRIFRSPEVNH  508



>gb|KHN31576.1| GDP-mannose-dependent alpha-mannosyltransferase [Glycine soja]
Length=441

 Score =   232 bits (592),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELS+AYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGG+P+II +D
Sbjct  288  AVFTGMLGGEELSEAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGARAGGVPDIIPED  347

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q GKIGYL+ PGDL+DCL KLKPLL D ELRET+G+AAR E+EKYDW+AAT+KIRNE Y 
Sbjct  348  QDGKIGYLYTPGDLEDCLSKLKPLLDDKELRETMGEAARLEMEKYDWRAATRKIRNENYK  407

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIE  237
            AAI FWRK+R+Q   P QWL + IF +PD E
Sbjct  408  AAIWFWRKKRAQLLRPFQWLAQPIFPSPDPE  438



>emb|CDX80782.1| BnaC03g00360D [Brassica napus]
Length=426

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYASGDVFVMPSESETLG VVLEAM+SGLPVVAARAGGIP+II ++
Sbjct  271  AVFTGMLQGEELSQAYASGDVFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPEE  330

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LFNPGD++DC+ KL+ LL D E R+ IGKAAR+E EKYDW+AAT KIRNEQY 
Sbjct  331  QEGKTGFLFNPGDVEDCVTKLRTLLEDSETRDIIGKAAREETEKYDWRAATTKIRNEQYG  390

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTP  246
            AAI FWR+++++  GPL WL KR+F  P
Sbjct  391  AAIWFWRRKKAELLGPLNWLVKRLFPVP  418



>ref|NP_568085.2| sulfoquinovosyldiacylglycerol 2 [Arabidopsis thaliana]
 gb|AAM18913.1|AF454354_1 sulfolipid synthase [Arabidopsis thaliana]
 gb|AAO64198.1| unknown protein [Arabidopsis thaliana]
 gb|AED90311.1| sulfoquinovosyldiacylglycerol 2 [Arabidopsis thaliana]
 gb|AHL38652.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=510

 Score =   234 bits (596),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTG LQG+ELSQAYASGDVFVMPSESETLG VVLEAMSSGLPVVAARAGGIP+II +D
Sbjct  359  AVFTGTLQGDELSQAYASGDVFVMPSESETLGLVVLEAMSSGLPVVAARAGGIPDIIPED  418

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LFNPGD++DC+ KL+ LL D E RE IGKAAR+E EKYDW+AAT KIRNEQY+
Sbjct  419  QEGKTGFLFNPGDVEDCVTKLRTLLHDRETREIIGKAAREETEKYDWRAATTKIRNEQYS  478

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPD  243
            AAI FWRK++    GP+ WL KR+F  P+
Sbjct  479  AAIWFWRKKKVHVLGPINWLIKRLFPVPE  507



>ref|XP_011047421.1| PREDICTED: uncharacterized protein LOC105141768 isoform X3 [Populus 
euphratica]
Length=374

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV  RAGGIP+II  +
Sbjct  225  AVFTGMLGGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGVRAGGIPDIIPPE  284

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
              GK G+LFNPGDLDDCL KLKPLL + ELRETIGKAAR ++EKYDWKAATKKIRNEQY+
Sbjct  285  LDGKTGFLFNPGDLDDCLSKLKPLLDNQELRETIGKAARQDMEKYDWKAATKKIRNEQYS  344

Query  329  AAISFWRKERSQSPGPLQWLFKRIF  255
            AAI FWR+ R+Q   P+QWL  R+F
Sbjct  345  AAIWFWRENRAQLLRPIQWLVSRLF  369



>ref|XP_009358856.1| PREDICTED: uncharacterized protein LOC103949460 [Pyrus x bretschneideri]
Length=514

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 131/155 (85%), Gaps = 2/155 (1%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II  D
Sbjct  360  AVFTGMLGGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPAD  419

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+L++  DLDDCL KL+PLL D  LRETIGKAAR+E+EKYDWKAAT+ IRNEQYN
Sbjct  420  QEGKTGFLYDYNDLDDCLSKLQPLLEDKYLRETIGKAAREEMEKYDWKAATRVIRNEQYN  479

Query  329  AAISFWRKERSQSPGPLQWLFKRIF--QTPDIENR  231
            AAI FWRK+R+Q   PLQW  KRIF   TP I+ R
Sbjct  480  AAIWFWRKKRAQFLRPLQWFMKRIFPPTTPAIKYR  514



>ref|XP_009122830.1| PREDICTED: uncharacterized protein LOC103847496 [Brassica rapa]
Length=539

 Score =   234 bits (596),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYASGDVFVMPSESETLG VVLEAM+SGLPVVAARAGGIP+II +D
Sbjct  387  AVFTGMLQGEELSQAYASGDVFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPED  446

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LF+PGD++DC+ K++ LL D E R+ IGKAAR+E EKYDW+AAT KIRNEQY+
Sbjct  447  QEGKTGFLFSPGDVEDCVTKVRSLLNDSETRDIIGKAAREETEKYDWRAATTKIRNEQYS  506

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTP  246
            AAI FWRK+++Q  GPL WL KR+F  P
Sbjct  507  AAIWFWRKKKAQVLGPLNWLVKRLFPVP  534



>ref|XP_008388188.1| PREDICTED: uncharacterized protein LOC103450599 [Malus domestica]
Length=514

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II  D
Sbjct  360  AVFTGMLGGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPXD  419

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+L++  DLDDCL KL+PLL + +LRETIGKAAR+E+EKYDWKAAT+ IRNEQYN
Sbjct  420  QEGKTGFLYDYNDLDDCLSKLQPLLENKDLRETIGKAAREEMEKYDWKAATRVIRNEQYN  479

Query  329  AAISFWRKERSQSPGPLQWLFKRIF--QTPDIENR  231
            AAI FWRK+R+Q   PLQW  KRIF   TP I+ R
Sbjct  480  AAIWFWRKKRAQFLRPLQWFMKRIFPPTTPAIKYR  514



>ref|XP_007140380.1| hypothetical protein PHAVU_008G106900g [Phaseolus vulgaris]
 gb|ESW12374.1| hypothetical protein PHAVU_008G106900g [Phaseolus vulgaris]
Length=504

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVVAARAGGIP+II  D
Sbjct  354  AVFTGMLGGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVAARAGGIPDIIPAD  413

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q GK  YL+NPGDL+DCL KL+PLL +  LRET+ KAAR+E+EKYDWKAAT+KIRNEQYN
Sbjct  414  QDGKTSYLYNPGDLEDCLSKLRPLLQNKVLRETMAKAAREEMEKYDWKAATQKIRNEQYN  473

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIE  237
            AAI FWRK+R+Q   P QWL KR   +P + 
Sbjct  474  AAIWFWRKKRAQLLRPFQWLSKRFSPSPQVN  504



>ref|XP_010909645.1| PREDICTED: uncharacterized protein LOC105035694 [Elaeis guineensis]
Length=544

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 130/150 (87%), Gaps = 0/150 (0%)
 Frame = -3

Query  686  VFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQ  507
            VFTGMLQGEELSQAYASGD+FVMPSESETLG VVLEAMSSG+PVVAARAGGIP+II +DQ
Sbjct  393  VFTGMLQGEELSQAYASGDIFVMPSESETLGLVVLEAMSSGIPVVAARAGGIPDIIPEDQ  452

Query  506  QGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNA  327
            +GK  +LF PGDLDDC+ K++ LL   E RE +G+AAR+E+EKYDWKAAT+KIRNEQYNA
Sbjct  453  EGKTSFLFTPGDLDDCVNKIERLLSCKEFREAMGRAAREEMEKYDWKAATRKIRNEQYNA  512

Query  326  AISFWRKERSQSPGPLQWLFKRIFQTPDIE  237
            AI FWRK+R+Q   P+QWL +R F++P + 
Sbjct  513  AIWFWRKKRAQLLRPIQWLVRRFFRSPQVN  542



>ref|XP_003520926.1| PREDICTED: uncharacterized protein LOC100803792 [Glycine max]
Length=517

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELS+AYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGG+P+II +D
Sbjct  364  AVFTGMLGGEELSEAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGARAGGVPDIIPED  423

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q GKIGYL+ PGDL+DCL KLKPLL D ELRET+G+AAR E+EKYDW+AAT+KIRNE Y 
Sbjct  424  QDGKIGYLYTPGDLEDCLSKLKPLLDDKELRETMGEAARLEMEKYDWRAATRKIRNENYK  483

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIE  237
            AAI FWRK+R+Q   P QWL + IF +PD E
Sbjct  484  AAIWFWRKKRAQLLRPFQWLAQPIFPSPDPE  514



>emb|CDY40312.1| BnaA10g27560D [Brassica napus]
Length=514

 Score =   232 bits (592),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELS+AYASGDVFVMPSESETLG VVLEAM+SGLPVVAARAGGIP+II +D
Sbjct  364  AVFTGMLQGEELSRAYASGDVFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPED  423

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LF+PGD++DC+ K++ LL D E R+ IGKAAR+E EKYDW+AAT KIRNEQY 
Sbjct  424  QEGKTGFLFSPGDVEDCVTKVRSLLNDSETRDIIGKAAREETEKYDWRAATTKIRNEQYG  483

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPD  243
            AAI FWRK+++Q  GPL WL KR+F  P 
Sbjct  484  AAIWFWRKKKAQVLGPLNWLVKRLFPVPS  512



>ref|XP_011047420.1| PREDICTED: uncharacterized protein LOC105141768 isoform X2 [Populus 
euphratica]
Length=424

 Score =   229 bits (585),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV  RAGGIP+II  +
Sbjct  275  AVFTGMLGGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGVRAGGIPDIIPPE  334

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
              GK G+LFNPGDLDDCL KLKPLL + ELRETIGKAAR ++EKYDWKAATKKIRNEQY+
Sbjct  335  LDGKTGFLFNPGDLDDCLSKLKPLLDNQELRETIGKAARQDMEKYDWKAATKKIRNEQYS  394

Query  329  AAISFWRKERSQSPGPLQWLFKRIF  255
            AAI FWR+ R+Q   P+QWL  R+F
Sbjct  395  AAIWFWRENRAQLLRPIQWLVSRLF  419



>ref|XP_008370134.1| PREDICTED: uncharacterized protein LOC103433646, partial [Malus 
domestica]
Length=422

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II  D
Sbjct  268  AVFTGMLGGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPAD  327

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+L++  DLDDCL KL+PLL + ELRETIG+AAR+E+EKYDWKAAT+ IRNEQY+
Sbjct  328  QEGKTGFLYDYNDLDDCLSKLQPLLENKELRETIGRAAREEMEKYDWKAATRVIRNEQYS  387

Query  329  AAISFWRKERSQSPGPLQWLFKRIF--QTPDIENR  231
             AI FWRK+R+Q   PLQW  KRIF   TP+I+ R
Sbjct  388  DAIWFWRKKRAQFLRPLQWFMKRIFPPTTPEIKYR  422



>emb|CDX97820.1| BnaC04g41190D [Brassica napus]
Length=441

 Score =   230 bits (586),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELS+AYASGDVFVMPSESETLG VVLEAM+SGLPVVAARAGGIP+II ++
Sbjct  286  AVFTGMLQGEELSRAYASGDVFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPEE  345

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LFNPGD++DC+ KL+ LL D E R+ IGKAAR+E EKYDW+AAT KIRNEQY 
Sbjct  346  QEGKTGFLFNPGDVEDCVTKLRTLLEDSETRDIIGKAAREETEKYDWRAATTKIRNEQYG  405

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTP  246
            AAI FWR+++++  GPL WL KR+F  P
Sbjct  406  AAIWFWRRKKAELLGPLNWLVKRLFPVP  433



>ref|XP_011047417.1| PREDICTED: uncharacterized protein LOC105141768 isoform X1 [Populus 
euphratica]
 ref|XP_011047418.1| PREDICTED: uncharacterized protein LOC105141768 isoform X1 [Populus 
euphratica]
 ref|XP_011047419.1| PREDICTED: uncharacterized protein LOC105141768 isoform X1 [Populus 
euphratica]
Length=429

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV  RAGGIP+II  +
Sbjct  280  AVFTGMLGGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGVRAGGIPDIIPPE  339

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
              GK G+LFNPGDLDDCL KLKPLL + ELRETIGKAAR ++EKYDWKAATKKIRNEQY+
Sbjct  340  LDGKTGFLFNPGDLDDCLSKLKPLLDNQELRETIGKAARQDMEKYDWKAATKKIRNEQYS  399

Query  329  AAISFWRKERSQSPGPLQWLFKRIF  255
            AAI FWR+ R+Q   P+QWL  R+F
Sbjct  400  AAIWFWRENRAQLLRPIQWLVSRLF  424



>gb|ABA55726.1| sulfoquinovosyldiacylglycerol synthase type 2 [Vigna unguiculata]
Length=523

 Score =   232 bits (591),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II +D
Sbjct  366  AVFTGMLGGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPED  425

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q GKIG+L+ PGDL+DCL KLKPLL D +LRET+G AAR E+EKYDW+AAT+KIRNE YN
Sbjct  426  QDGKIGFLYTPGDLEDCLSKLKPLLDDKDLRETMGIAARLEMEKYDWRAATRKIRNENYN  485

Query  329  AAISFWRKERSQSPGPLQWLFKRIF-QTPDIE  237
            AAI FW K+R+Q   P QWL KRIF  +PD E
Sbjct  486  AAIWFWNKKRAQLLRPFQWLAKRIFPSSPDQE  517



>ref|XP_007133940.1| hypothetical protein PHAVU_010G005100g [Phaseolus vulgaris]
 gb|ESW05934.1| hypothetical protein PHAVU_010G005100g [Phaseolus vulgaris]
Length=529

 Score =   232 bits (591),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            A+FTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II +D
Sbjct  372  AIFTGMLGGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPED  431

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q GKIG+L+ PGDL+DCL KLKPLL D ELRET+G AAR E+EKYDW+AAT+KIRNE YN
Sbjct  432  QDGKIGFLYTPGDLEDCLSKLKPLLEDKELRETMGIAARLEMEKYDWRAATRKIRNENYN  491

Query  329  AAISFWRKERSQSPGPLQWLFKRIF-QTPDIE  237
            AAI FW K+R+Q   P QWL +RIF  +PD E
Sbjct  492  AAIWFWNKKRAQLLRPFQWLAQRIFPSSPDEE  523



>ref|XP_009370203.1| PREDICTED: uncharacterized protein LOC103959579 [Pyrus x bretschneideri]
Length=512

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 131/155 (85%), Gaps = 2/155 (1%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II  D
Sbjct  358  AVFTGMLGGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPAD  417

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+L+N  DLDDCL KL+PLL + ELRETIGKAAR+E+EKYDWKAAT+ IRNEQY+
Sbjct  418  QEGKTGFLYNYNDLDDCLSKLQPLLENKELRETIGKAAREEMEKYDWKAATRVIRNEQYS  477

Query  329  AAISFWRKERSQSPGPLQWLFKRIF--QTPDIENR  231
             AI FWRK+R+Q   PLQW  K IF   TP+I+ R
Sbjct  478  DAIWFWRKKRAQFLRPLQWFMKLIFPPTTPEIKYR  512



>ref|XP_002531354.1| glycosyltransferase, putative [Ricinus communis]
 gb|EEF31038.1| glycosyltransferase, putative [Ricinus communis]
Length=452

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II  +
Sbjct  285  AVFTGMLGGEELSQAYASGDVFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPPE  344

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LFNPGDLDDCL KL+PLL + ELR+T+GKAAR+E+EKYDW+AAT+KIRNEQYN
Sbjct  345  QEGKTGFLFNPGDLDDCLGKLEPLLNNCELRKTMGKAAREEMEKYDWRAATRKIRNEQYN  404

Query  329  AAISFWRKERSQSPGPLQWL  270
            AAI FWRK+R+Q   P+QWL
Sbjct  405  AAIWFWRKKRAQFLRPIQWL  424



>gb|KFK44566.1| hypothetical protein AALP_AA1G274200 [Arabis alpina]
Length=507

 Score =   229 bits (583),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTG L GEELSQAYASGDVFVMPSESETLG VVLEAM+SGLPVVAARAGGIP+II ++
Sbjct  356  AVFTGTLLGEELSQAYASGDVFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPEE  415

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK G+LFNPGD++DC+ KL+ LL D E RE IGKAAR+E EKYDW+AAT KIRNEQY+
Sbjct  416  QEGKTGFLFNPGDIEDCVTKLRTLLHDIETRELIGKAAREETEKYDWRAATTKIRNEQYS  475

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDI  240
             AI FWR+++ Q  GP+ WL KR+F  P++
Sbjct  476  EAIWFWRQKKVQVLGPINWLVKRLFPVPEV  505



>gb|EEC81364.1| hypothetical protein OsI_24561 [Oryza sativa Indica Group]
Length=219

 Score =   218 bits (556),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTG LQGEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVVAARAGGIP+II +D
Sbjct  63   AVFTGTLQGEELSQAYASGDVFVMPSESETLGFVVLEAMSSGVPVVAARAGGIPDIIPED  122

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK  +L+ PGD+DDC+ K++ LL   ELRET+ KAAR E+EK+DW+AAT+KIRNEQY+
Sbjct  123  QEGKTSFLYTPGDVDDCVSKIERLLTCEELRETMRKAARKEMEKFDWRAATRKIRNEQYS  182

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQ  252
            AAI FWRK+R+Q   P+QW+ +R+F+
Sbjct  183  AAIWFWRKKRAQLLRPIQWVSRRLFR  208



>ref|XP_009407545.1| PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase 
GPI3 subunit-like [Musa acuminata subsp. malaccensis]
Length=507

 Score =   226 bits (576),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
             VFTGMLQG ELSQAYASGDVF+MPSESETLG VVLEAMSSG+PVVAARAGGIP+II ++
Sbjct  355  VVFTGMLQGVELSQAYASGDVFMMPSESETLGFVVLEAMSSGVPVVAARAGGIPDIIPEE  414

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK  +LF PGDLDDC+ K++ LL   E RE +GKAAR+E+EKYDW+AAT+KIRNEQYN
Sbjct  415  QEGKTSFLFAPGDLDDCMSKIERLLSCREFREAMGKAAREEMEKYDWRAATRKIRNEQYN  474

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIE  237
            AAI FWRK+R+Q  GPLQ L +R F++P I 
Sbjct  475  AAIWFWRKKRAQLLGPLQRLVRRFFKSPQIN  505



>dbj|BAJ85864.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=499

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTG LQGEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVVAARAGGIP+II +D
Sbjct  341  AVFTGTLQGEELSQAYASGDVFVMPSESETLGFVVLEAMSSGVPVVAARAGGIPDIIPED  400

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK  +L+ PGD+DDC+ K++ LL   ELRET+GKAAR E+EK+ WKAAT+KIRNEQY+
Sbjct  401  QEGKTSFLYTPGDVDDCVGKVERLLSCEELRETMGKAARKEMEKFGWKAATRKIRNEQYS  460

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQT  249
            AAI FWRK+RSQ   PLQW+F+R+F++
Sbjct  461  AAIWFWRKKRSQLLRPLQWVFRRLFRS  487



>gb|ACN26074.1| unknown [Zea mays]
 tpg|DAA59313.1| TPA: hypothetical protein ZEAMMB73_291487 [Zea mays]
Length=188

 Score =   214 bits (545),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  686  VFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQ  507
            VFTG LQGEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II +DQ
Sbjct  31   VFTGTLQGEELSQAYASGDVFVMPSESETLGFVVLEAMSSGVPVVGARAGGIPDIIPEDQ  90

Query  506  QGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNA  327
            +G+  +L+ PGD+DDC+ K+K LL   ELRE +G+AAR E+EK+DW+AAT+KIRNEQY+A
Sbjct  91   EGRTSFLYTPGDVDDCVGKIKRLLSSEELREAMGRAARKEMEKFDWRAATRKIRNEQYSA  150

Query  326  AISFWRKERSQSPGPLQWLFKRIFQT  249
            AI FWRK+R+Q   PLQW+ + + +T
Sbjct  151  AIWFWRKKRAQVLRPLQWVLRLLRRT  176



>ref|XP_003561543.1| PREDICTED: uncharacterized protein LOC100842407 isoform X2 [Brachypodium 
distachyon]
Length=482

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTG LQGEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVVAARAGGIP+II +D
Sbjct  330  AVFTGTLQGEELSQAYASGDVFVMPSESETLGFVVLEAMSSGVPVVAARAGGIPDIIPED  389

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK  +L+ PGD+DDC+ K++ LL   ELR+T+GKAAR E+EK+DWKAAT+KIRNEQY+
Sbjct  390  QEGKTSFLYTPGDVDDCVGKVERLLSSEELRQTMGKAARKEMEKFDWKAATRKIRNEQYS  449

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQ  252
            AAI FWRK+RSQ   P+QWLF+ +F+
Sbjct  450  AAIWFWRKKRSQLLRPVQWLFRGLFR  475



>ref|XP_010228495.1| PREDICTED: uncharacterized protein LOC100842407 isoform X1 [Brachypodium 
distachyon]
Length=507

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTG LQGEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVVAARAGGIP+II +D
Sbjct  355  AVFTGTLQGEELSQAYASGDVFVMPSESETLGFVVLEAMSSGVPVVAARAGGIPDIIPED  414

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK  +L+ PGD+DDC+ K++ LL   ELR+T+GKAAR E+EK+DWKAAT+KIRNEQY+
Sbjct  415  QEGKTSFLYTPGDVDDCVGKVERLLSSEELRQTMGKAARKEMEKFDWKAATRKIRNEQYS  474

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQ  252
            AAI FWRK+RSQ   P+QWLF+ +F+
Sbjct  475  AAIWFWRKKRSQLLRPVQWLFRGLFR  500



>ref|XP_009409491.1| PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase 
GPI3 subunit [Musa acuminata subsp. malaccensis]
Length=438

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELS+AYASGDVF+MPSESETLGQVVLEAMSSG+PVVAARAGGIP+II ++
Sbjct  286  AVFTGMLQGEELSKAYASGDVFLMPSESETLGQVVLEAMSSGIPVVAARAGGIPDIIPEE  345

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
             +G+  +LF PGDLDDCL K+K LL   + R+ +G+AAR+E+EK+DW+AAT+ IR+E YN
Sbjct  346  HEGRTSFLFTPGDLDDCLNKIKHLLACDDFRDAMGRAAREEMEKHDWRAATRIIRDENYN  405

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPD  243
            AAI FWRKER+Q  GP+QW+F+ +  +P+
Sbjct  406  AAIWFWRKERAQLLGPIQWMFRWMLCSPE  434



>gb|EMT15547.1| Putative glycosyltransferase [Aegilops tauschii]
Length=509

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTG LQGEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVVAARAGGIP+II +D
Sbjct  351  AVFTGTLQGEELSQAYASGDVFVMPSESETLGFVVLEAMSSGVPVVAARAGGIPDIIPED  410

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK  +L+ PGD+DDC+ K++ LL   ELRET+GKAAR E+EK+ WKAAT+KIRNEQY 
Sbjct  411  QEGKTSFLYIPGDVDDCVGKVELLLSCEELRETMGKAARKEMEKFGWKAATRKIRNEQYT  470

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQ  252
            AAI FWRK+RSQ   PLQW+F+R+F+
Sbjct  471  AAIWFWRKKRSQLLRPLQWVFRRLFR  496



>gb|ACN35476.1| unknown [Zea mays]
 tpg|DAA59314.1| TPA: hypothetical protein ZEAMMB73_291487 [Zea mays]
Length=278

 Score =   214 bits (546),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  686  VFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQ  507
            VFTG LQGEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II +DQ
Sbjct  121  VFTGTLQGEELSQAYASGDVFVMPSESETLGFVVLEAMSSGVPVVGARAGGIPDIIPEDQ  180

Query  506  QGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNA  327
            +G+  +L+ PGD+DDC+ K+K LL   ELRE +G+AAR E+EK+DW+AAT+KIRNEQY+A
Sbjct  181  EGRTSFLYTPGDVDDCVGKIKRLLSSEELREAMGRAARKEMEKFDWRAATRKIRNEQYSA  240

Query  326  AISFWRKERSQSPGPLQWLFKRIFQT  249
            AI FWRK+R+Q   PLQW+ + + +T
Sbjct  241  AIWFWRKKRAQVLRPLQWVLRLLRRT  266



>ref|NP_001130956.1| uncharacterized protein LOC100192061 precursor [Zea mays]
 gb|ACF79360.1| unknown [Zea mays]
 tpg|DAA59315.1| TPA: hypothetical protein ZEAMMB73_291487 [Zea mays]
Length=317

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
             VFTG LQGEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II +D
Sbjct  159  VVFTGTLQGEELSQAYASGDVFVMPSESETLGFVVLEAMSSGVPVVGARAGGIPDIIPED  218

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+G+  +L+ PGD+DDC+ K+K LL   ELRE +G+AAR E+EK+DW+AAT+KIRNEQY+
Sbjct  219  QEGRTSFLYTPGDVDDCVGKIKRLLSSEELREAMGRAARKEMEKFDWRAATRKIRNEQYS  278

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQT  249
            AAI FWRK+R+Q   PLQW+ + + +T
Sbjct  279  AAIWFWRKKRAQVLRPLQWVLRLLRRT  305



>dbj|BAD31817.1| putative sulfolipid synthase [Oryza sativa Japonica Group]
 dbj|BAE79759.1| putative sulfolipid synthase [Oryza sativa Japonica Group]
 dbj|BAG89787.1| unnamed protein product [Oryza sativa Japonica Group]
Length=479

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTG LQGEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVVAARAGGIP+II +D
Sbjct  323  AVFTGTLQGEELSQAYASGDVFVMPSESETLGFVVLEAMSSGVPVVAARAGGIPDIIPED  382

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK  +L+ PGD+DDC+ K++ LL   ELRET+ KAAR E+EK+DW+AAT+KIRNEQY+
Sbjct  383  QEGKTSFLYTPGDVDDCVSKIERLLTCEELRETMRKAARKEMEKFDWRAATRKIRNEQYS  442

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQ  252
            AAI FWRK+R+Q   P+QW+ +R+F+
Sbjct  443  AAIWFWRKKRAQLLRPIQWVSRRLFR  468



>gb|AFW80016.1| hypothetical protein ZEAMMB73_479455 [Zea mays]
Length=297

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGM+QGEELSQAYASGDVF+MPSESETLGQVVLE+MSSG+PVVAARAGGIP+II +D
Sbjct  142  AVFTGMMQGEELSQAYASGDVFIMPSESETLGQVVLESMSSGVPVVAARAGGIPDIIPED  201

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+G+  +LF PGDLDDCL K++ LL + E RE +G+ AR E+EK DW+AA+K IRNE YN
Sbjct  202  QEGRTSFLFTPGDLDDCLGKVQQLLTNREFRENMGRTARSEMEKCDWRAASKTIRNEFYN  261

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIEN  234
            AAI +WRK+ ++   PLQWL +     P++ +
Sbjct  262  AAIWYWRKKHAELVKPLQWLAQMFLPAPEVRS  293



>ref|XP_006657378.1| PREDICTED: uncharacterized protein LOC102710508 [Oryza brachyantha]
Length=471

 Score =   217 bits (552),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
             VFTG LQGEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVVAARAGGIP+II +D
Sbjct  315  VVFTGTLQGEELSQAYASGDVFVMPSESETLGFVVLEAMSSGVPVVAARAGGIPDIIPED  374

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK  +L+ PGD+DDC+ K++ LL   ELRET+ KAAR E+EK+DW+AAT+KIRNEQY 
Sbjct  375  QEGKTSFLYTPGDVDDCVSKIERLLTCEELRETMRKAARKEMEKFDWRAATRKIRNEQYT  434

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQ  252
            AAI FWRK+R+Q   P+QW+ +R+F+
Sbjct  435  AAIWFWRKKRAQVLRPIQWVARRLFR  460



>ref|XP_002457385.1| hypothetical protein SORBIDRAFT_03g006480 [Sorghum bicolor]
 gb|EES02505.1| hypothetical protein SORBIDRAFT_03g006480 [Sorghum bicolor]
Length=430

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGM+QGEELSQAYASGDVF+MPSESETLGQVVLE+MSSG+PVVAARAGGIP+II +D
Sbjct  275  AVFTGMMQGEELSQAYASGDVFIMPSESETLGQVVLESMSSGVPVVAARAGGIPDIIPED  334

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK  +LF PGDLDDCL K++ LL + E R+ +G+ AR E+EK DW+AA+K IRNE YN
Sbjct  335  QEGKTSFLFTPGDLDDCLSKVQQLLTNREFRDNMGRTARSEMEKCDWQAASKTIRNEFYN  394

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIEN  234
            AAI +WRK+R++   PLQWL +     P++ +
Sbjct  395  AAIWYWRKKRAELVKPLQWLAQMFLPAPEVRS  426



>ref|NP_001041991.1| Os01g0142300 [Oryza sativa Japonica Group]
 dbj|BAD61068.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD61477.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF03905.1| Os01g0142300 [Oryza sativa Japonica Group]
 gb|EEE53847.1| hypothetical protein OsJ_00324 [Oryza sativa Japonica Group]
Length=436

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 127/153 (83%), Gaps = 1/153 (1%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGM+QGEELSQAYASGDVFVMPSESETLGQVVLE+MSSG+PVVAARAGG+P+II +D
Sbjct  281  AVFTGMMQGEELSQAYASGDVFVMPSESETLGQVVLESMSSGVPVVAARAGGVPDIIPED  340

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK  +LF PGDL+DCL K++ LL D E R+ +G  AR E+EK DW+AA+KKIRNE YN
Sbjct  341  QEGKTSFLFTPGDLEDCLGKIQLLLTDKEFRDNMGMTARAEMEKCDWRAASKKIRNEFYN  400

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIENR  231
            AAI +WRK+R++   PLQWL +     P++ NR
Sbjct  401  AAIWYWRKKRAELIKPLQWLAQMFLPAPEV-NR  432



>ref|XP_004987290.1| PREDICTED: uncharacterized protein LOC101765158 [Setaria italica]
Length=486

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTG LQGEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II +D
Sbjct  329  AVFTGTLQGEELSQAYASGDVFVMPSESETLGFVVLEAMSSGVPVVGARAGGIPDIIPED  388

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK  +L+ PGD+DDC+ K++ LL   ELRET+G+AAR E+EK+DW+AAT+KIRNEQY+
Sbjct  389  QEGKTSFLYTPGDVDDCVSKIERLLSCEELRETMGRAARKEMEKFDWRAATRKIRNEQYS  448

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQ  252
            AAI FWRK+R+Q   P+QW+ +++ +
Sbjct  449  AAIWFWRKKRAQLLRPVQWVVRKLVR  474



>gb|EAY72486.1| hypothetical protein OsI_00342 [Oryza sativa Indica Group]
Length=436

 Score =   214 bits (544),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGM+QGEELSQAYASGDVFVMPSESETLGQVVLE+MSSG+PVVAARAGG+P+II +D
Sbjct  281  AVFTGMMQGEELSQAYASGDVFVMPSESETLGQVVLESMSSGVPVVAARAGGVPDIIPED  340

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK  +LF PGDL+DCL K++ LL D E R+ +G  AR E+EK DW+AA+KKIRNE YN
Sbjct  341  QEGKTSFLFTPGDLEDCLGKIQLLLTDKEFRDNMGMTARAEMEKCDWRAASKKIRNEFYN  400

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPD  243
            AAI +WRK+R++   PLQWL +     P+
Sbjct  401  AAIWYWRKKRAELIKPLQWLAQMFLPAPE  429



>ref|XP_004968167.1| PREDICTED: uncharacterized protein LOC101764078 [Setaria italica]
Length=437

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGM+QGEELSQAYASGDVFVMPSESETLGQVVLE+MSSG+PVVAARAGGIP+II +D
Sbjct  282  AVFTGMMQGEELSQAYASGDVFVMPSESETLGQVVLESMSSGVPVVAARAGGIPDIIPED  341

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK  +LF PGDLDDC+ K++ LL + E R+ +G+ AR E+EK DW+AA+K IRNE YN
Sbjct  342  QEGKTSFLFTPGDLDDCVGKVQLLLTNREFRDNMGRTARAEMEKCDWRAASKTIRNEFYN  401

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIEN  234
            AAI +WRK+R++   PLQWL +     P++ +
Sbjct  402  AAIWYWRKKRAELVQPLQWLAQMFLPAPEVRS  433



>ref|XP_008650829.1| PREDICTED: uncharacterized protein LOC100192061 isoform X1 [Zea 
mays]
Length=498

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  686  VFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQ  507
            VFTG LQGEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II +DQ
Sbjct  341  VFTGTLQGEELSQAYASGDVFVMPSESETLGFVVLEAMSSGVPVVGARAGGIPDIIPEDQ  400

Query  506  QGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNA  327
            +G+  +L+ PGD+DDC+ K+K LL   ELRE +G+AAR E+EK+DW+AAT+KIRNEQY+A
Sbjct  401  EGRTSFLYTPGDVDDCVGKIKRLLSSEELREAMGRAARKEMEKFDWRAATRKIRNEQYSA  460

Query  326  AISFWRKERSQSPGPLQWLFKRIFQT  249
            AI FWRK+R+Q   PLQW+ + + +T
Sbjct  461  AIWFWRKKRAQVLRPLQWVLRLLRRT  486



>ref|XP_008650830.1| PREDICTED: uncharacterized protein LOC100192061 isoform X2 [Zea 
mays]
 gb|ACN35313.1| unknown [Zea mays]
 tpg|DAA59317.1| TPA: hypothetical protein ZEAMMB73_291487 [Zea mays]
Length=497

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -3

Query  686  VFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQ  507
            VFTG LQGEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II +DQ
Sbjct  340  VFTGTLQGEELSQAYASGDVFVMPSESETLGFVVLEAMSSGVPVVGARAGGIPDIIPEDQ  399

Query  506  QGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNA  327
            +G+  +L+ PGD+DDC+ K+K LL   ELRE +G+AAR E+EK+DW+AAT+KIRNEQY+A
Sbjct  400  EGRTSFLYTPGDVDDCVGKIKRLLSSEELREAMGRAARKEMEKFDWRAATRKIRNEQYSA  459

Query  326  AISFWRKERSQSPGPLQWLFKRIFQT  249
            AI FWRK+R+Q   PLQW+ + + +T
Sbjct  460  AIWFWRKKRAQVLRPLQWVLRLLRRT  485



>ref|NP_001144658.1| uncharacterized protein LOC100277683 [Zea mays]
 gb|ACG42115.1| hypothetical protein [Zea mays]
Length=437

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGM+QGEELSQAYASGDVF+MPSESETLGQVVLE+MSSG+PVVAARAGGIP+II +D
Sbjct  282  AVFTGMMQGEELSQAYASGDVFIMPSESETLGQVVLESMSSGVPVVAARAGGIPDIIPED  341

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+G+  +LF PGDLDDCL K++ LL + E R+ +G+ AR E+EK DW+AA+K IRNE YN
Sbjct  342  QEGRTSFLFTPGDLDDCLGKVQQLLTNREFRDNMGRTARSEMEKCDWRAASKMIRNEFYN  401

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPDIEN  234
            AAI +WRK+ ++   PLQWL +     P++ +
Sbjct  402  AAIWYWRKKHAELVKPLQWLAQMFLPAPEVRS  433



>gb|EPS57661.1| hypothetical protein M569_17157, partial [Genlisea aurea]
Length=200

 Score =   204 bits (518),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 119/146 (82%), Gaps = 4/146 (3%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGML GEELS+AYASGDVFVMPSESETLG VVLEAMSSGLPVVAARAGGIP+II DD
Sbjct  58   AVFTGMLHGEELSRAYASGDVFVMPSESETLGLVVLEAMSSGLPVVAARAGGIPDIIPDD  117

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            ++GK GYL+ PGD+ DCL KL+PL+ D +LRE IGKAAR +V KYDW+ AT+KIR+E+Y 
Sbjct  118  RRGKTGYLYAPGDVGDCLSKLRPLVGDEKLREAIGKAARADVAKYDWRVATRKIRDEEYG  177

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQ  252
             A+  WR+ R+         F+R+F+
Sbjct  178  GAVWSWRRRRAS----FSRHFRRLFR  199



>ref|XP_002459190.1| hypothetical protein SORBIDRAFT_02g000240 [Sorghum bicolor]
 gb|EER95711.1| hypothetical protein SORBIDRAFT_02g000240 [Sorghum bicolor]
Length=500

 Score =   212 bits (540),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTG LQGEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVV ARAGGIP+II +D
Sbjct  340  AVFTGTLQGEELSQAYASGDVFVMPSESETLGFVVLEAMSSGIPVVGARAGGIPDIIPED  399

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK  +L+ PGD+DDC+ K+  LL   ELRE +G+AAR E+EK+DW+AAT+KIRNEQY+
Sbjct  400  QEGKTSFLYTPGDVDDCVGKIGQLLSSEELREAMGRAARKEMEKFDWRAATRKIRNEQYS  459

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQT  249
            AAI FWRK+R+Q   PLQW  + +  T
Sbjct  460  AAIWFWRKKRAQLLRPLQWALRLLRPT  486



>ref|XP_006643739.1| PREDICTED: uncharacterized protein LOC102711739 [Oryza brachyantha]
Length=437

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGM+QGEELSQAYASGDVFVMPSESETLGQVVLE+MSSG+PVVAARAGGIP+II +D
Sbjct  282  AVFTGMMQGEELSQAYASGDVFVMPSESETLGQVVLESMSSGVPVVAARAGGIPDIIPED  341

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q+GK  +LF PGDL+DC+ K++ LL + E R+ +G  AR E+E+ DW+AA+KKIRNE YN
Sbjct  342  QEGKTSFLFTPGDLEDCVGKIQLLLANKEFRDNMGMTARAEMEQCDWRAASKKIRNEFYN  401

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPD  243
            AAI +WRK+R++   PLQWL +     P+
Sbjct  402  AAIWYWRKKRAELIKPLQWLAQMFLPAPE  430



>ref|XP_002468134.1| hypothetical protein SORBIDRAFT_01g040150 [Sorghum bicolor]
 gb|EER95132.1| hypothetical protein SORBIDRAFT_01g040150 [Sorghum bicolor]
Length=414

 Score =   205 bits (522),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYAS DVF MPSESETLGQVVLE+M+SG+PVVAARAGGIP+II  D
Sbjct  281  AVFTGMLQGEELSQAYASADVFAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKD  340

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            ++GK  +LF PGDLD+C+RK++ LL   +LRETIGKAAR+E+EK DW+AA+KKIRNE Y+
Sbjct  341  KEGKTSFLFTPGDLDECVRKIEQLLNSKDLRETIGKAAREEMEKCDWRAASKKIRNEHYS  400

Query  329  AAISFWRKERSQS  291
             AIS+WRK+  ++
Sbjct  401  TAISYWRKKMGKT  413



>ref|XP_003568443.1| PREDICTED: uncharacterized protein LOC100832140 [Brachypodium 
distachyon]
Length=439

 Score =   206 bits (523),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGM+QGEELSQAYASGD+FVMPSESETLGQVVLE+MSSG+PVVAARAGGIP+II ++
Sbjct  283  AVFTGMMQGEELSQAYASGDIFVMPSESETLGQVVLESMSSGVPVVAARAGGIPDIIPEE  342

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            ++GK  +LF PG+LDDC+ K+K LL D E R+++G+ AR E+EK DW+ A++ IRNE YN
Sbjct  343  EEGKTSFLFTPGNLDDCVGKIKLLLTDREFRDSMGRTARAEMEKCDWRTASRTIRNEFYN  402

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPD  243
             AI +WRK+R++   PLQWL +      D
Sbjct  403  TAIFYWRKKRAELVQPLQWLAQMFLPATD  431



>gb|ACN34235.1| unknown [Zea mays]
 gb|AFW88879.1| glycosyl transferase, group 1 family protein [Zea mays]
Length=414

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYAS DVF MPSESETLGQVVLE+M+SG+PVVAARAGGIP+II  D
Sbjct  281  AVFTGMLQGEELSQAYASADVFAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKD  340

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            ++GK  +LF PGDLD+C+RK++ +L   +LRET+GKAAR+E+EK DW+AA+KKIRNE Y+
Sbjct  341  KEGKTSFLFTPGDLDECVRKIEQVLSSKDLRETVGKAAREEMEKCDWRAASKKIRNEHYS  400

Query  329  AAISFWRKERSQS  291
             AIS+WRK+  +S
Sbjct  401  TAISYWRKKMDKS  413



>gb|ACG31912.1| glycosyl transferase, group 1 family protein [Zea mays]
Length=414

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYAS DVF MPSESETLGQVVLE+M+SG+PVVAARAGGIP+II  D
Sbjct  281  AVFTGMLQGEELSQAYASADVFAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKD  340

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            ++GK  +LF PGDLD+C+RK++ +L   +LRET+GKAAR+E+EK DW+AA+KKIRNE Y+
Sbjct  341  KEGKTSFLFTPGDLDECVRKIEQVLNSKDLRETVGKAAREEMEKCDWRAASKKIRNEHYS  400

Query  329  AAISFWRKERSQS  291
             AIS+WRK+  +S
Sbjct  401  TAISYWRKKMDKS  413



>ref|NP_001150015.1| glycosyl transferase, group 1 family protein [Zea mays]
 gb|ACG37508.1| glycosyl transferase, group 1 family protein [Zea mays]
Length=414

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYAS DVF MPSESETLGQVVLE+M+SG+PVVAARAGGIP+II  D
Sbjct  281  AVFTGMLQGEELSQAYASADVFAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKD  340

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            ++GK  +LF PGDLD+C+RK++ +L   +LRET+GKAAR+E+EK DW+AA+KKIRNE Y+
Sbjct  341  KEGKTSFLFTPGDLDECVRKIEQVLNSKDLRETVGKAAREEMEKCDWRAASKKIRNEHYS  400

Query  329  AAISFWRKERSQS  291
             AIS+WRK+  +S
Sbjct  401  TAISYWRKKMDKS  413



>ref|XP_008653982.1| PREDICTED: uncharacterized protein LOC103634168 [Zea mays]
 tpg|DAA44537.1| TPA: hypothetical protein ZEAMMB73_879639 [Zea mays]
Length=429

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYASGDVF MPSESETLGQVVLE+M+SG+PVVAARAGGIP+II  D
Sbjct  281  AVFTGMLQGEELSQAYASGDVFAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKD  340

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            ++GK  +LF PGDLD+C+RK++ LL   +LRETIG AAR+E+EK DW+ A+KKIRNE Y+
Sbjct  341  KEGKTSFLFTPGDLDECVRKIEQLLSSKDLRETIGMAAREEMEKCDWRTASKKIRNEHYS  400

Query  329  AAISFWRKERSQS  291
             AIS+WRK+  ++
Sbjct  401  TAISYWRKKMGKT  413



>ref|XP_004984689.1| PREDICTED: uncharacterized protein LOC101779471 [Setaria italica]
Length=413

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYAS DVF MPSESETLGQVVLE+M+SG+PVVAARAGGIP+II  D
Sbjct  281  AVFTGMLQGEELSQAYASADVFAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKD  340

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            ++GK  +LF PGDLD+C+RK++ LL   +LRE++GKAAR+E+EK DW+AA++KIRNE Y+
Sbjct  341  KEGKTSFLFTPGDLDECVRKIEQLLKSKDLRESVGKAAREEMEKCDWRAASRKIRNEHYS  400

Query  329  AAISFWRKERSQS  291
             A+S+WRK+  ++
Sbjct  401  TAMSYWRKKMGKT  413



>ref|XP_003558286.1| PREDICTED: uncharacterized protein LOC100846446 [Brachypodium 
distachyon]
Length=420

 Score =   201 bits (510),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYASGDVF MPSESETLGQVVLE+M+SG+PVVAARAGGIP+II  D
Sbjct  287  AVFTGMLQGEELSQAYASGDVFAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKD  346

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            ++GK  +LF PGDLD+C+RK++ LL+  +LRE+IG+AAR+E+E  DW+AA+K IRNE Y+
Sbjct  347  KEGKTSFLFTPGDLDECVRKIEQLLFSKDLRESIGRAAREEMENCDWRAASKTIRNEHYS  406

Query  329  AAISFWRKERSQS  291
             A ++WRK+  ++
Sbjct  407  TATTYWRKKTGKT  419



>gb|EMS60261.1| GDP-mannose-dependent alpha-mannosyltransferase [Triticum urartu]
Length=591

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGM+QGEELSQAYASGDVFVMPSESETLGQVVLE+MSSG+PVVA RAGGIP+II +D
Sbjct  434  AVFTGMMQGEELSQAYASGDVFVMPSESETLGQVVLESMSSGVPVVAVRAGGIPDIIPED  493

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
             +G+  +LF PGDLDDC+ K++ LL D E R  +G+ AR E+EK DW+AA+K IRNE Y+
Sbjct  494  VEGRTSFLFAPGDLDDCVGKIRLLLTDDEFRGEMGRTARAEMEKCDWRAASKTIRNEFYS  553

Query  329  AAISFWRKERSQSPGPLQWL  270
            +AI +WRK++++   PLQWL
Sbjct  554  SAIDYWRKKQAEMVQPLQWL  573



>emb|CDM81044.1| unnamed protein product [Triticum aestivum]
Length=440

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGM+QGEELSQ YASGDVFVMPSESETLGQVVLE+MSSG+PVVA RAGGIP+II  D
Sbjct  283  AVFTGMMQGEELSQVYASGDVFVMPSESETLGQVVLESMSSGVPVVAVRAGGIPDIIPGD  342

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
             +G+  +LF PGDLDDC+ K++ LL D E R  +G+ AR E+EK DW+AA+K IRNE Y+
Sbjct  343  AEGRTSFLFAPGDLDDCVGKIRLLLTDDEFRGDMGRTARAEMEKCDWRAASKTIRNEFYS  402

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPD  243
            +AI +WRK+++    PLQWL +     P+
Sbjct  403  SAIDYWRKKQADIVQPLQWLAQMFMPAPN  431



>gb|EMT15719.1| Putative glycosyltransferase [Aegilops tauschii]
Length=410

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGM+QG ELSQAYASGDVFVMPSESETLGQVVLE+MSSG+PVVA RAGGIP+II +D
Sbjct  254  AVFTGMMQGGELSQAYASGDVFVMPSESETLGQVVLESMSSGVPVVAVRAGGIPDIIPED  313

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
             +G+  +LF PGDLDDC+ K++ LL D E R  +G+ AR  +EK DW+AA+K IRNE Y+
Sbjct  314  VEGRTSFLFAPGDLDDCVGKIRLLLADDEFRGDMGRTARAAMEKCDWRAASKTIRNEFYS  373

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQTPD  243
            +AI +WRK++++   PLQWL +     PD
Sbjct  374  SAIDYWRKKQAEIVQPLQWLAQMFMPAPD  402



>ref|XP_006649799.1| PREDICTED: uncharacterized protein LOC102700221 [Oryza brachyantha]
Length=417

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYASGD+F MPSESETLGQVVLE+M+SG+PVVAARAGGIP+II  D
Sbjct  284  AVFTGMLQGEELSQAYASGDLFAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKD  343

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            ++GK  +LF PGDLD+C+RK++ LL   +L E+IG+AAR+E+EK DW+AA+KKIRNE Y+
Sbjct  344  KEGKTSFLFTPGDLDECVRKIEQLLSSKDLIESIGRAAREEMEKCDWRAASKKIRNEHYS  403

Query  329  AAISFWRKERSQS  291
             A  +WRK+  ++
Sbjct  404  TATIYWRKKMGRT  416



>ref|NP_001049645.1| Os03g0265100 [Oryza sativa Japonica Group]
 gb|AAP06834.1| putative sulfolipid synthase [Oryza sativa Japonica Group]
 gb|ABF95130.1| glycosyl transferase, group 1 family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11559.1| Os03g0265100 [Oryza sativa Japonica Group]
 gb|EAZ26361.1| hypothetical protein OsJ_10243 [Oryza sativa Japonica Group]
 dbj|BAG97169.1| unnamed protein product [Oryza sativa Japonica Group]
Length=415

 Score =   194 bits (494),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYASGD+F MPSESETLGQVVLE+M+SG+PVVAARAGGIP+II  D
Sbjct  282  AVFTGMLQGEELSQAYASGDLFAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKD  341

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            ++GK  +LF PGDLD+C+RK++ LL    LRE+IG+AAR+E+EK DW+AA+K IRNE Y 
Sbjct  342  KEGKTSFLFTPGDLDECVRKIEQLLSSKVLRESIGRAAREEMEKCDWRAASKTIRNEHYC  401

Query  329  AAISFWRKERSQS  291
             A  +WRK+  ++
Sbjct  402  TATLYWRKKMGRT  414



>gb|EAY89357.1| hypothetical protein OsI_10861 [Oryza sativa Indica Group]
Length=415

 Score =   194 bits (494),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYASGD+F MPSESETLGQVVLE+M+SG+PVVAARAGGIP+II  D
Sbjct  282  AVFTGMLQGEELSQAYASGDLFAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKD  341

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            ++GK  +LF PGDLD+C+RK++ LL    LRE+IG+AAR+E+EK DW+AA+K IRNE Y 
Sbjct  342  KEGKTSFLFTPGDLDECVRKIEQLLSSKVLRESIGRAAREEMEKCDWRAASKTIRNEHYC  401

Query  329  AAISFWRKERSQS  291
             A  +WRK+  ++
Sbjct  402  TATLYWRKKMGRT  414



>dbj|BAJ94304.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=358

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYASGDVF MPSESETLGQVVLE+M+SG+PVVAARAGGIP+II  D
Sbjct  225  AVFTGMLQGEELSQAYASGDVFAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKD  284

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            ++GK  +LF PGDLD+C+RK++ LL    LRE++G+AAR+E+E  DW+ A+K IRNE Y 
Sbjct  285  KEGKTSFLFTPGDLDECVRKIEQLLSSKNLRESVGRAAREEMENCDWRTASKTIRNEHYR  344

Query  329  AAISFWRKERSQS  291
             A  +W+K+  ++
Sbjct  345  TATLYWQKKTGRT  357



>dbj|BAJ91585.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=415

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYASGDVF MPSESETLGQVVLE+M+SG+PVVAARAGGIP+II  D
Sbjct  282  AVFTGMLQGEELSQAYASGDVFAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKD  341

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            ++GK  +LF PGDLD+C+RK++ LL    LRE++G+AAR+E+E  DW+ A+K IRNE Y 
Sbjct  342  KEGKTSFLFTPGDLDECVRKIEQLLSSKNLRESVGRAAREEMENCDWRTASKTIRNEHYR  401

Query  329  AAISFWRKERSQS  291
             A  +W+K+  ++
Sbjct  402  TATLYWQKKTGRT  414



>gb|EMS55944.1| GDP-mannose-dependent alpha-mannosyltransferase [Triticum urartu]
Length=493

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -3

Query  638  SGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQGKIGYLFNPGDLDDC  459
            SGDVFVMPSESETLG VVLEAMSSG+PVVAARAGGIP+II +DQ+GK  +L+ PGD+DDC
Sbjct  350  SGDVFVMPSESETLGFVVLEAMSSGVPVVAARAGGIPDIIPEDQEGKTSFLYTPGDVDDC  409

Query  458  LRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNAAISFWRKERSQSPGPL  279
            + K++ LL   ELRET+GKAAR E+EK+ WKAAT+KIRNEQY+AAI FWRK+RSQ   PL
Sbjct  410  VGKVELLLSCEELRETMGKAARKEMEKFGWKAATRKIRNEQYSAAIWFWRKKRSQLLRPL  469

Query  278  QWLFKRIFQ  252
            QW+F+R+F+
Sbjct  470  QWVFRRLFR  478



>gb|EMT15626.1| Lipopolysaccharide core biosynthesis glycosyltransferase lpsE 
[Aegilops tauschii]
Length=437

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGM QGEELSQAYASGDVF MPSESETLGQVVLE+M+SG+PVVAARAGGIP+II  D
Sbjct  304  AVFTGMFQGEELSQAYASGDVFAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKD  363

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            ++GK  +LF PGDLD+C+RK++ LL   +LRE++G+AAR+E+E  DW+ A+K IRNE Y+
Sbjct  364  KEGKTSFLFTPGDLDECVRKIEQLLSSKDLRESVGRAAREEMENCDWRTASKTIRNEHYS  423

Query  329  AAISFWRKERSQS  291
             A  +W+K+  ++
Sbjct  424  TATLYWQKKTGRT  436



>ref|XP_002968644.1| UDP-sulfoquinovose: alpha-diacylglycerol-sulfoquinovosyltransferase 
[Selaginella moellendorffii]
 gb|EFJ29760.1| UDP-sulfoquinovose: alpha-diacylglycerol-sulfoquinovosyltransferase 
[Selaginella moellendorffii]
Length=514

 Score =   189 bits (481),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 116/143 (81%), Gaps = 2/143 (1%)
 Frame = -3

Query  686  VFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQ  507
            VFTGMLQGEELSQAYAS DVFVMPSESETLG VVLEAM+SG+PVVAARAGGIP+II +  
Sbjct  359  VFTGMLQGEELSQAYASADVFVMPSESETLGFVVLEAMASGVPVVAARAGGIPDIICEG-  417

Query  506  QGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNA  327
             G+ G+L+ PGDLD+C+ +++ LL   ELR+ IG A R EVEK+DW+A+T+++RNE+Y A
Sbjct  418  -GETGFLYAPGDLDECVNRVRSLLDCEELRQRIGDAGRKEVEKFDWRASTRQVRNEEYGA  476

Query  326  AISFWRKERSQSPGPLQWLFKRI  258
            AI FWRK R Q    L W+ +++
Sbjct  477  AIWFWRKRRQQFLRRLAWVMRKL  499



>ref|XP_001766232.1| predicted protein [Physcomitrella patens]
 gb|EDQ68864.1| predicted protein [Physcomitrella patens]
Length=457

 Score =   188 bits (477),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 112/141 (79%), Gaps = 2/141 (1%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            FTGML GEELSQAYASGD+F+ PSESETLG VVLEAM+SG+PVV ARAGGIP+I+  +Q 
Sbjct  313  FTGMLSGEELSQAYASGDIFITPSESETLGFVVLEAMASGVPVVCARAGGIPDIV--NQD  370

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNAA  324
            G  G+L+ PGD+DDC+ KLK L+  PELR+  G+A R+EVEKYDW+A+TK++RNE+Y+AA
Sbjct  371  GVTGFLYTPGDVDDCVGKLKALIESPELRDRTGRAGREEVEKYDWRASTKQVRNEEYSAA  430

Query  323  ISFWRKERSQSPGPLQWLFKR  261
            I FWR+ + Q        FK 
Sbjct  431  IWFWRRRKQQLASRFSGWFKH  451



>ref|XP_001756850.1| predicted protein [Physcomitrella patens]
 gb|EDQ78447.1| predicted protein [Physcomitrella patens]
Length=472

 Score =   188 bits (477),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 113/141 (80%), Gaps = 2/141 (1%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            FTGML GEELSQAYASGD+F+ PSESETLG VVLEAM+SG+PVV ARAGGIP+I+  +Q 
Sbjct  328  FTGMLTGEELSQAYASGDIFITPSESETLGFVVLEAMASGIPVVCARAGGIPDIV--NQN  385

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNAA  324
            G  GYL+ PGD++DC+ KLK L+  P+LRE IG+A R+EVEKYDW A+T+++RNE+Y+AA
Sbjct  386  GVTGYLYTPGDVEDCVGKLKALIESPDLRERIGRAGREEVEKYDWLASTRQVRNEEYSAA  445

Query  323  ISFWRKERSQSPGPLQWLFKR  261
            I FWR+ + Q        FK+
Sbjct  446  IWFWRRRKQQLANRFSGWFKQ  466



>gb|EEE66415.1| hypothetical protein OsJ_22761 [Oryza sativa Japonica Group]
Length=443

 Score =   177 bits (449),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 109/146 (75%), Gaps = 27/146 (18%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTG LQGEELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVVAARAGGIP+II +D
Sbjct  314  AVFTGTLQGEELSQAYASGDVFVMPSESETLGFVVLEAMSSGVPVVAARAGGIPDIIPED  373

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q                           ELRET+ KAAR E+EK+DW+AAT+KIRNEQY+
Sbjct  374  Q---------------------------ELRETMRKAARKEMEKFDWRAATRKIRNEQYS  406

Query  329  AAISFWRKERSQSPGPLQWLFKRIFQ  252
            AAI FWRK+R+Q   P+QW+ +R+F+
Sbjct  407  AAIWFWRKKRAQLLRPIQWVSRRLFR  432



>ref|XP_005843576.1| hypothetical protein CHLNCDRAFT_33086 [Chlorella variabilis]
 gb|EFN51474.1| hypothetical protein CHLNCDRAFT_33086 [Chlorella variabilis]
Length=413

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 92/118 (78%), Gaps = 2/118 (2%)
 Frame = -3

Query  686  VFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQ  507
            VFTGML GEELS AYAS D+FVMPSE+ETLG VVLEAM+SG+PVVA RAGGIP+I++  +
Sbjct  265  VFTGMLHGEELSTAYASADIFVMPSETETLGFVVLEAMASGVPVVAVRAGGIPDILT--K  322

Query  506  QGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQY  333
            QG+ GYL+  GD+++   ++  L+  PELR  IG AAR+EV  +DW+AAT  + + QY
Sbjct  323  QGETGYLYQSGDVEEAAGQVAQLIEHPELRARIGTAAREEVSLWDWRAATLHLLHVQY  380



>gb|KIZ07633.1| sulfoquinovosyltransferase [Monoraphidium neglectum]
Length=268

 Score =   139 bits (349),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 94/142 (66%), Gaps = 7/142 (5%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F GM++G+ELS+AYAS D+FVMPSE+ETLG VVLEAM+SG+PVVA  AGG+ +I++  Q 
Sbjct  99   FMGMMKGQELSEAYASADIFVMPSETETLGFVVLEAMASGVPVVAVAAGGLTDILT--QP  156

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNAA  324
            GK G L+ PGD   C   ++ L+ DP     +G A R EVE + W AAT+KIR +QY  A
Sbjct  157  GKTGLLYAPGDYAACAGHVRRLVADPAAARELGAAGRSEVELFGWSAATRKIREQQYARA  216

Query  323  ISFWRKERSQSPGPLQWLFKRI  258
            I   R +R        WL  R+
Sbjct  217  IRLARGKRR-----FWWLALRV  233



>ref|XP_001689662.1| sulfolipid synthase [Chlamydomonas reinhardtii]
 gb|EDP09400.1| sulfolipid synthase [Chlamydomonas reinhardtii]
Length=402

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F GML GE+LS AYAS D+FVMPSESETLG VVLEAM+S LPVVA RAGGIP+II+    
Sbjct  248  FLGMLHGEDLSAAYASSDIFVMPSESETLGFVVLEAMASELPVVAVRAGGIPDIITPGDS  307

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQY  333
            G  G+L+ PGD+D     ++ L  D +LR  +G  AR EV K+DW+AAT  + N QY
Sbjct  308  GVTGFLYEPGDVDKAAELIQQLAADAQLRSRVGIRARQEVAKWDWRAATMHLLNVQY  364



>ref|XP_002953985.1| hypothetical protein VOLCADRAFT_82536 [Volvox carteri f. nagariensis]
 gb|EFJ45014.1| hypothetical protein VOLCADRAFT_82536 [Volvox carteri f. nagariensis]
Length=543

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 87/123 (71%), Gaps = 1/123 (1%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIIS-DDQ  507
            F GML GE+LS AYAS D+FVMPSESETLG VVLEAM+S LPVVA RAGGIP+II  +D 
Sbjct  391  FLGMLHGEDLSAAYASADIFVMPSESETLGFVVLEAMASELPVVAVRAGGIPDIICPEDS  450

Query  506  QGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNA  327
             G  G+L+ P D+D     +  L  +PELR  +G  AR EV K+DW+AAT  + N QY  
Sbjct  451  AGVTGFLYEPADVDKASELIGTLAANPELRARVGARARQEVAKWDWRAATMYLLNVQYPI  510

Query  326  AIS  318
            A++
Sbjct  511  AMA  513



>emb|CBJ27894.1| UDP-sulfoquinovose: diacylglycerol alpha-sulfoquinovosyltransferase 
SQD2, C-terminal fragment, family GT4 [Ectocarpus siliculosus]
Length=268

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 88/122 (72%), Gaps = 3/122 (2%)
 Frame = -3

Query  686  VFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQ  507
            V TG++ GE LSQA+AS DVFVMPS+SETLG VVLE+M+SG+PVV A AGGIP++I D  
Sbjct  85   VLTGVMSGEALSQAFASADVFVMPSDSETLGFVVLESMASGVPVVGANAGGIPDLIED--  142

Query  506  QGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNA  327
             GK GYL   GD++    ++K LL D  LR  + KA R+E E++ W+AAT  +RN QY  
Sbjct  143  -GKTGYLVPAGDVEAMSDRVKALLEDKALRGKMSKAGREETERWSWEAATSVLRNVQYQK  201

Query  326  AI  321
            AI
Sbjct  202  AI  203



>ref|XP_005715110.1| unnamed protein product [Chondrus crispus]
 emb|CDF35291.1| unnamed protein product [Chondrus crispus]
Length=474

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 98/144 (68%), Gaps = 8/144 (6%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
             +FTG+L GEELSQA+AS D+FVMPSESETLG VVLE+M+SG+PV+ A AGGIP+II D 
Sbjct  310  TLFTGILHGEELSQAFASADIFVMPSESETLGFVVLESMASGVPVIGANAGGIPDIIDDS  369

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
               + GYLF+ G  ++C  +++ LL D  LRE +G+ AR+E  ++ W+A+    RN  Y 
Sbjct  370  ---RTGYLFSRGSQEECSARIEQLLGDDALRENMGRVAREEALRWSWRASAAATRNVGYG  426

Query  329  AAISFWRKERSQS----PGPLQWL  270
             AIS + K R+      P  L WL
Sbjct  427  RAISNF-KYRAMGGLGLPRSLTWL  449



>ref|WP_013178429.1| glycosyl transferase family 1 [Truepera radiovictrix]
 gb|ADI15064.1| glycosyl transferase group 1 [Truepera radiovictrix DSM 17093]
Length=381

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 89/114 (78%), Gaps = 3/114 (3%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
             VFTG + G+EL+QAYAS DVF  PS++ETLG V +EAM+SG+PVV ARAGGIP++I   
Sbjct  251  TVFTGYMSGDELAQAYASADVFAFPSDTETLGFVAMEAMASGVPVVGARAGGIPDVI---  307

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKI  348
            ++G+ G +F+PGDL D   KL+ LL++PELR  +G+ AR ++E++ W+AAT+ +
Sbjct  308  REGETGLMFSPGDLGDLTEKLRTLLFNPELRRAMGERARQDMERWSWRAATEAL  361



>ref|XP_005705641.1| UDP-sulfoquinovose:DAG sulfoquinovosyltransferase [Galdieria 
sulphuraria]
 gb|EME29121.1| UDP-sulfoquinovose:DAG sulfoquinovosyltransferase [Galdieria 
sulphuraria]
Length=434

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 89/121 (74%), Gaps = 3/121 (2%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            FTG L+G+ELS+A+A GDVFVMPSESET+G VV+EAM+SG+PVV A AGGIP +I   Q 
Sbjct  293  FTGQLRGKELSEAFACGDVFVMPSESETMGFVVMEAMASGVPVVGAAAGGIPHLI---QH  349

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNAA  324
               GYL+NPG++D  +  +K L+ +P LR+ +   AR E E++DW +AT  +RN QY  A
Sbjct  350  QVTGYLYNPGNIDQLIGLVKQLVDNPWLRKDMSIQARKETERWDWYSATAVLRNVQYAQA  409

Query  323  I  321
            I
Sbjct  410  I  410



>ref|WP_010145366.1| glycosyl transferase family 1 [Citricoccus sp. CH26A]
Length=400

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 94/147 (64%), Gaps = 4/147 (3%)
 Frame = -3

Query  686  VFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQ  507
            VFTG + G ELSQAYAS DVF  PS +ETLG V LE+M+SG+PVV ARAGGIP +I D  
Sbjct  256  VFTGYMSGPELSQAYASADVFAFPSTTETLGLVALESMASGVPVVGARAGGIPFVIDD--  313

Query  506  QGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNA  327
              + G+L +P D+D    +L+ LL DP LR  +G+AAR+E E++ W+AAT+ +      A
Sbjct  314  -ARTGFLVDPVDVDGWADRLERLLTDPGLRLRMGRAAREEAERHSWRAATQTLVGFYDQA  372

Query  326  AISFWRKERSQSPGPLQWLFKRIFQTP  246
              + WR  RS   GPL   F R    P
Sbjct  373  IDTHWRDHRSLH-GPLLDRFARPMPRP  398



>ref|XP_005706721.1| sulfoquinovosyltransferase [Galdieria sulphuraria]
 gb|EME30201.1| sulfoquinovosyltransferase [Galdieria sulphuraria]
Length=561

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 88/132 (67%), Gaps = 3/132 (2%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
             +FTG+L G+ELS+A+AS DVFVMPSE+ETLG VVLEAM+SG+PVVA R+GGIP+++   
Sbjct  397  TIFTGILSGQELSEAFASADVFVMPSETETLGFVVLEAMASGVPVVATRSGGIPDLV---  453

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            Q    G L+ PGD+  C   +  L+ DP     +   AR E E +DW+ AT  +RN  Y+
Sbjct  454  QHEITGLLYEPGDMATCALYVSRLIEDPYFARKLSAKARKEAENWDWRTATAVLRNTHYH  513

Query  329  AAISFWRKERSQ  294
             A+  ++  R+ 
Sbjct  514  RAMHHFQNTRAM  525



>ref|XP_005644605.1| UDP-Glycosyltransferase/glycogen phosphorylase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20061.1| UDP-Glycosyltransferase/glycogen phosphorylase [Coccomyxa subellipsoidea 
C-169]
Length=487

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 87/128 (68%), Gaps = 2/128 (2%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            FTGML+GEELS AYAS D+F+MPSE+ETLG V LEAM+SGLPVVA  AGG+ +II+  + 
Sbjct  336  FTGMLRGEELSSAYASADIFMMPSETETLGFVALEAMASGLPVVAVAAGGLVDIIT--KP  393

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNAA  324
            G  G+L+ P D        + L+ D   RE +G+AAR  VEK  W AA ++IR+ QY  A
Sbjct  394  GYAGHLYAPNDYTAATELTRKLVHDVAAREAMGQAARAHVEKLGWMAAVRRIRDHQYQRA  453

Query  323  ISFWRKER  300
            I  +R  +
Sbjct  454  IHTFRAHK  461



>ref|XP_002185276.1| glycosyl transferase, group 1 [Phaeodactylum tricornutum CCAP 
1055/1]
 gb|EEC43145.1| glycosyl transferase, group 1 [Phaeodactylum tricornutum CCAP 
1055/1]
Length=507

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 88/123 (72%), Gaps = 4/123 (3%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
             VFTG L G+ELS A+AS DVFVMPS+SETLG VVLE+M+SG+PVV A AGGIP+II D 
Sbjct  325  TVFTGQLDGDELSSAFASADVFVMPSDSETLGFVVLESMASGVPVVGAAAGGIPDIIDD-  383

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
              GK G+L  PGD+   + +L+ L  + + R  + KAAR E E++ W+AAT  +RN QY 
Sbjct  384  --GKTGFLVPPGDIAGFVSRLESLR-NAKFRTQMAKAARKETERWGWEAATSYLRNVQYE  440

Query  329  AAI  321
             A+
Sbjct  441  KAL  443



>ref|XP_005538341.1| sulfoquinovosyldiacylglycerol biosynthesis protein [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM82305.1| sulfoquinovosyldiacylglycerol biosynthesis protein [Cyanidioschyzon 
merolae strain 10D]
Length=517

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 88/126 (70%), Gaps = 3/126 (2%)
 Frame = -3

Query  686  VFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQ  507
            V TG L G++LS+A+A  DVFVMPSESETLG VVLEAM+SG+PVVA  AGGIP++I    
Sbjct  364  VMTGQLHGDDLSRAFACADVFVMPSESETLGFVVLEAMASGVPVVATAAGGIPDLIV---  420

Query  506  QGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNA  327
             G+ G+L+  G+  +    +  LL D  +R+ +G AAR E E++ W AAT  IRN QYN 
Sbjct  421  HGETGFLYTKGNTSEAATYVCALLGDAVMRKRMGDAARREAERWSWCAATAWIRNVQYNR  480

Query  326  AISFWR  309
            A++ +R
Sbjct  481  AMNNFR  486



>ref|XP_009035363.1| hypothetical protein AURANDRAFT_2613, partial [Aureococcus anophagefferens]
 gb|EGB09356.1| hypothetical protein AURANDRAFT_2613, partial [Aureococcus anophagefferens]
Length=379

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 85/121 (70%), Gaps = 3/121 (2%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G+L+G++LS+AYAS D+F MPS+SETLG VVLEAM+SGLP+VAA AGGIP I+++D+ 
Sbjct  262  FVGVLRGDDLSRAYASADLFTMPSDSETLGFVVLEAMASGLPIVAANAGGIPSIVTNDRN  321

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNAA  324
               G L   GD     +K+  +L D +LR+ +    R + E + WKA+TK +RN  Y AA
Sbjct  322  ---GVLVTAGDTATFAQKVGAILDDADLRDRLTSRGRRDTENWSWKASTKHLRNVHYTAA  378

Query  323  I  321
            I
Sbjct  379  I  379



>gb|EWM27152.1| gdp-mannose-dependent alpha-mannosyltransferase [Nannochloropsis 
gaditana]
Length=505

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 84/129 (65%), Gaps = 3/129 (2%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
             VFTG+L GEELS+A+AS DVF+MPS+SETLG VVLE+M+SG+PVV ARAGG+P +I   
Sbjct  348  TVFTGLLHGEELSKAFASADVFLMPSDSETLGFVVLESMASGVPVVGARAGGLPNVI---  404

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
            + GK G+L   GD      +++ LL D  L   +  A R+E E  DW +A   +RN  Y 
Sbjct  405  EHGKTGFLVPVGDEPAFAARVQQLLGDRGLMRDMMAAGREEAESLDWASAMDHLRNIHYK  464

Query  329  AAISFWRKE  303
             A+   R+ 
Sbjct  465  RAVMIHRRR  473



>ref|WP_040657553.1| glycosyl transferase, partial [Ornithinimicrobium pekingense]
Length=376

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 80/113 (71%), Gaps = 3/113 (3%)
 Frame = -3

Query  686  VFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQ  507
            VFTG L G +L+ AYAS DVF  PS +ETLG V LE+M+SG+PVV A AGGIP +I D  
Sbjct  256  VFTGYLGGSDLAAAYASADVFAFPSTTETLGLVALESMASGVPVVGADAGGIPFVIDD--  313

Query  506  QGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKI  348
             G+ G+L  PGD D    +L+ L+ DP LRE +G AAR++ E++ W+AAT+ +
Sbjct  314  -GRTGFLVPPGDTDALTDRLERLVADPSLRERMGAAAREDAEQHSWRAATEAL  365



>gb|AFA36602.1| putative sulfolipid synthase, partial [Lolium perenne]
Length=170

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTG LQG ELSQAYASGDVFVMPSESETLG VVLEAMSSG+PVVAARAGGIP+II +D
Sbjct  103  AVFTGTLQGGELSQAYASGDVFVMPSESETLGFVVLEAMSSGVPVVAARAGGIPDIIPED  162

Query  509  QQGKIGYL  486
            Q+GK  +L
Sbjct  163  QEGKTSFL  170



>ref|WP_015175196.1| glycosyl transferase group 1 [Oscillatoria nigro-viridis]
 gb|AFZ05874.1| glycosyl transferase group 1 [Oscillatoria nigro-viridis PCC 
7112]
Length=377

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 86/123 (70%), Gaps = 5/123 (4%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L+G+EL++AYAS D F+ PS +ETLG V+LEAM++G PVVAAR+GGIP+I++D   
Sbjct  252  FVGYLKGQELARAYASADAFIFPSRTETLGLVLLEAMAAGTPVVAARSGGIPDIVTD---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNAA  324
            G  GYLF+P D +  L   + L  +PE RET+ + AR E E++ W AA  ++  ++Y  +
Sbjct  309  GVNGYLFDPADEEGALAATQRLFANPEERETLRQNARKEAERWGWAAAAAQL--QRYYQS  366

Query  323  ISF  315
            + F
Sbjct  367  VVF  369



>gb|AGF71936.1| glycogen synthase [Corynebacterium halotolerans YIM 70093 = DSM 
44683]
Length=375

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 85/126 (67%), Gaps = 4/126 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            FTG L G EL++A+ASGDVFV PS +ETLG V LE+M+SG+PVV ARAGGIP +I D   
Sbjct  253  FTGYLSGPELAEAFASGDVFVFPSTTETLGLVALESMASGVPVVGARAGGIPFVIDD---  309

Query  503  GKIGYLFNPGDLDDC-LRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNA  327
            G  G+L +P D D    ++L  LL D +LR  +G AAR E E++ W+A+T+ +     +A
Sbjct  310  GVTGHLVDPADGDGIWAQRLATLLTDRQLRTGVGAAARVEAERHSWRASTETLVEAYEHA  369

Query  326  AISFWR  309
             ++  R
Sbjct  370  IVAHHR  375



>ref|WP_027004308.1| glycosyl transferase [Corynebacterium halotolerans]
Length=379

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 85/126 (67%), Gaps = 4/126 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            FTG L G EL++A+ASGDVFV PS +ETLG V LE+M+SG+PVV ARAGGIP +I D   
Sbjct  257  FTGYLSGPELAEAFASGDVFVFPSTTETLGLVALESMASGVPVVGARAGGIPFVIDD---  313

Query  503  GKIGYLFNPGDLDDC-LRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNA  327
            G  G+L +P D D    ++L  LL D +LR  +G AAR E E++ W+A+T+ +     +A
Sbjct  314  GVTGHLVDPADGDGIWAQRLATLLTDRQLRTGVGAAARVEAERHSWRASTETLVEAYEHA  373

Query  326  AISFWR  309
             ++  R
Sbjct  374  IVAHHR  379



>ref|WP_017288576.1| glycosyl transferase [Leptolyngbya boryana]
Length=375

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 79/114 (69%), Gaps = 3/114 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ A+AS D FV PS +ETLG V+LEAM++G PVVAAR+GGIP+I+ D   
Sbjct  252  FVGYLAGQELASAFASSDAFVFPSRTETLGLVLLEAMAAGCPVVAARSGGIPDIVED---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  GYLF+P D +  +   + LL   E RE I + AR E E++ W +ATK+++N
Sbjct  309  GVNGYLFDPTDENGAIVATRSLLAQTETREMIRQNARHEAERWSWSSATKQLQN  362



>ref|WP_006633738.1| glycosyl transferase [Microcoleus vaginatus]
 gb|EGK86746.1| glycosyl transferase group 1 [Microcoleus vaginatus FGP-2]
Length=377

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 84/123 (68%), Gaps = 5/123 (4%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L+G+EL+ AYAS D F+ PS +ETLG V+LEAM++G PVVAAR+GGIP+I++D   
Sbjct  252  FVGYLKGQELATAYASADAFIFPSRTETLGLVLLEAMAAGTPVVAARSGGIPDIVTD---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNAA  324
            G  GYLF+P D +  L   K L  +PE RET+   AR E E++ W AA  ++  ++Y  +
Sbjct  309  GVNGYLFDPADEEGSLVATKRLFANPEERETLRHNARREAERWGWAAAAAQL--QRYYQS  366

Query  323  ISF  315
            + F
Sbjct  367  VVF  369



>ref|WP_017292828.1| glycosyl transferase [Geminocystis herdmanii]
Length=377

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL  AYAS D F+ PS +ETLG V+LEAM++G PVVAAR GGIP+I++D   
Sbjct  252  FVGYLHGQELGSAYASADAFIFPSSTETLGLVLLEAMAAGCPVVAARRGGIPDIVTD---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  GY+FNP D    +   + LL   E RE + + AR E EK+ W +AT ++RN
Sbjct  309  GVNGYMFNPDDAQGAIEATRRLLAHKEEREQLRQNARLEAEKWGWSSATAQLRN  362



>ref|WP_019501737.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=379

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 85/128 (66%), Gaps = 7/128 (5%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G LQGEEL+ A+AS DVF+ PS +ETLG V+LEAM++G PVVAAR+GGIP+I++D   
Sbjct  253  FVGYLQGEELASAFASSDVFLFPSRTETLGLVLLEAMAAGCPVVAARSGGIPDIVTD---  309

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNAA  324
            G  GYLF P D D  L   + LL +P       + AR E EK+ W AAT +++ + Y+AA
Sbjct  310  GINGYLFEPDDPDGLLHATQRLLENP---VQFKQCARQEAEKWSWAAATVQLQ-QYYDAA  365

Query  323  ISFWRKER  300
            I   R  +
Sbjct  366  IVACRDRK  373



>ref|WP_012596832.1| glycosyl transferase [Cyanothece sp. PCC 8801]
 gb|ACK67574.1| glycosyl transferase group 1 [Cyanothece sp. PCC 8801]
Length=377

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 78/114 (68%), Gaps = 3/114 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G LQG EL+ A+AS D F+ PS +ETLG V+LEAM++G PVVAA +GGIP+I++D   
Sbjct  252  FVGYLQGLELASAFASSDAFIFPSRTETLGLVLLEAMAAGCPVVAANSGGIPDIVTD---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  GYLF+P D D  +   K LL   E RE + + AR E E++ W AAT ++RN
Sbjct  309  GVNGYLFDPADPDGAIVATKRLLAAKEEREKLRENARLEAERWSWSAATSQLRN  362



>ref|WP_036477227.1| glycosyl transferase [Myxosarcina sp. GI1]
Length=377

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 78/114 (68%), Gaps = 3/114 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G LQG EL+ AYAS D F+ PS +ETLG V+LEAM++G PVVAA +GGIP+I++D   
Sbjct  252  FVGYLQGLELASAYASADAFIFPSRTETLGLVLLEAMAAGCPVVAANSGGIPDIVTD---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  GYLF P D    ++  K LL   ++RE + + AR E E++ W AAT+ ++N
Sbjct  309  GVNGYLFEPDDPQGAIKATKALLEATDIREQLRQNARSEAERWGWAAATRHLQN  362



>ref|WP_011243256.1| MULTISPECIES: glycosyl transferase [Synechococcus]
 gb|AAF14309.1| SqdX [Synechococcus elongatus PCC 7942]
 dbj|BAD79134.1| sulfolipid sulfoquinovosyldiacylglycerol biosynthesis protein 
[Synechococcus elongatus PCC 6301]
 gb|ABB56611.1| sulfolipid sulfoquinovosyldiacylglycerol biosynthesis protein 
[Synechococcus elongatus PCC 7942]
 gb|AJD56350.1| glycosyl transferase [Synechococcus sp. UTEX 2973]
Length=377

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 80/114 (70%), Gaps = 3/114 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L GE+L  AYAS D FV PS +ETLG V+LEAM++G PVVAA +GGIP+I+SD   
Sbjct  252  FIGYLHGEQLGAAYASADAFVFPSRTETLGLVLLEAMAAGCPVVAANSGGIPDIVSD---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G+LF+P D    +  ++ LL +P  RE + +AAR E E++ W AAT+++++
Sbjct  309  GINGFLFDPEDEQGAIAAIQRLLANPAEREILRQAARQEAERWSWNAATRQLQD  362



>ref|WP_015784192.1| glycosyl transferase [Cyanothece sp. PCC 8802]
 gb|ACV01369.1| glycosyl transferase group 1 [Cyanothece sp. PCC 8802]
Length=377

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 78/114 (68%), Gaps = 3/114 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G LQG EL+ A+AS D F+ PS +ETLG V+LEAM++G PVVAA +GGIP+I++D   
Sbjct  252  FVGYLQGLELASAFASSDAFIFPSRTETLGLVLLEAMAAGCPVVAANSGGIPDIVTD---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  GYLF+P D D  +   K LL   E RE + + AR E E++ W AAT ++RN
Sbjct  309  GVNGYLFDPADPDGAIVATKRLLAAKEEREKLRENARLEAERWSWSAATSQLRN  362



>ref|WP_018021886.1| hypothetical protein [Corynebacterium doosanense]
 gb|AIT60598.1| glycosyl transferase [Corynebacterium doosanense CAU 212 = DSM 
45436]
Length=379

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 81/121 (67%), Gaps = 4/121 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            FTG L G +L+ A+ASGDVF  PS +ETLG V LE+ +SG+P V ARAGGIP +I D   
Sbjct  257  FTGYLSGTDLAAAFASGDVFAFPSTTETLGLVALESFASGVPAVGARAGGIPFVIDD---  313

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNAA  324
            G+ GYL +P D +    +L  +L D  LR  +GKAAR+E E + W+AAT+++    Y+ A
Sbjct  314  GETGYLVDPEDYNTWAERLSAVLLDEGLRRRMGKAARNEAESHGWRAATERL-VRYYDLA  372

Query  323  I  321
            I
Sbjct  373  I  373



>ref|XP_002295162.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED87466.1| predicted protein, partial [Thalassiosira pseudonana CCMP1335]
Length=366

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 79/115 (69%), Gaps = 4/115 (3%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
             VFTG L G+ELS A+AS DVF+MPS+SETLG VVLE+M+SG+PV+   AGGIP++I D+
Sbjct  256  TVFTGQLSGDELSSAFASADVFMMPSDSETLGFVVLESMASGVPVIGCAAGGIPDLIRDN  315

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIR  345
                 G+L  PGD +  L   K ++ D E R  +G  AR E EK+ W+AAT  +R
Sbjct  316  DT---GFLVQPGDTEGYLNCAKTMM-DTEFRTEMGVRARVEAEKWGWEAATSVLR  366



>ref|WP_015184883.1| glycosyltransferase [Microcoleus sp. PCC 7113]
 gb|AFZ20750.1| glycosyltransferase [Microcoleus sp. PCC 7113]
Length=377

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 82/121 (68%), Gaps = 4/121 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL  A+AS D FV PS +ETLG V+LEAM++G PVVAAR+GGIP+I++D   
Sbjct  252  FVGYLTGKELGAAFASSDAFVFPSRTETLGLVLLEAMAAGCPVVAARSGGIPDIVTD---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNAA  324
            G  GYLF+P D    +   + LL   E RET+ + AR E E++ W AAT++++N  Y A 
Sbjct  309  GVNGYLFDPADEQGAITATQRLLERQEERETLRQNARAEAERWGWAAATRQLQN-YYRAV  367

Query  323  I  321
            +
Sbjct  368  V  368



>tpg|DAA44536.1| TPA: hypothetical protein ZEAMMB73_879639 [Zea mays]
Length=404

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 67/91 (74%), Gaps = 18/91 (20%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            AVFTGMLQGEELSQAYASGDVF MPSESETLGQVVLE+M+SG+PVVAARAGGIP+II  D
Sbjct  281  AVFTGMLQGEELSQAYASGDVFAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKD  340

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELR  417
            ++G                  KPL W PE R
Sbjct  341  KEG------------------KPLEWLPEKR  353



>ref|WP_026936851.1| glycosyl transferase [Gulosibacter molinativorax]
Length=413

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 91/147 (62%), Gaps = 6/147 (4%)
 Frame = -3

Query  686  VFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQ  507
            VFTG + G+ L+ A+AS DVF  PS +ETLG V LE+M+S +PVVAARAGGIP  ++   
Sbjct  254  VFTGYMSGDALASAFASADVFAFPSTTETLGLVALESMASQVPVVAARAGGIPFAVT---  310

Query  506  QGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNA  327
            +G+ G+LF+P   D+    L+ LL+D ELR  +G  AR E E+  W++AT+K+ +    A
Sbjct  311  EGRSGFLFDPKSEDEFTEGLEKLLFDDELRIAMGAEARREAEESSWRSATEKLVSFYEEA  370

Query  326  AISFWRKERSQSPGPLQWLFKRIFQTP  246
                W +  S S   L+    R+F  P
Sbjct  371  IDRHWARAHSLSTYSLRM---RLFGKP  394



>ref|WP_023066667.1| glycosyl transferases group 1 family protein [Lyngbya aestuarii]
 gb|ERT07174.1| glycosyl transferases group 1 family protein [Lyngbya aestuarii 
BL J]
Length=377

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 83/122 (68%), Gaps = 4/122 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L+G+EL+ AYA  D F+ PS +ETLG V+LEAM++G PVVAAR+GGIP+I++D   
Sbjct  252  FVGYLRGQELADAYACADAFIFPSRTETLGLVLLEAMAAGTPVVAARSGGIPDIVTD---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNAA  324
            G  GYLF+P D D  +   + LL     RET+ + AR E E++ W AAT+++R   Y+  
Sbjct  309  GGNGYLFDPADEDGAISATQRLLSHQLERETLRQNARLEAERWGWAAATQQLRR-YYSTV  367

Query  323  IS  318
            +S
Sbjct  368  LS  369



>ref|WP_010147154.1| glycosyl transferase group 1 protein, partial [Serinicoccus profundi]
Length=276

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 86/147 (59%), Gaps = 5/147 (3%)
 Frame = -3

Query  686  VFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQ  507
            VFTG L GE+L+ AYAS D F  PS +ETLG V LE+M+S +PVV ARAGGIP +I D  
Sbjct  134  VFTGYLAGEDLASAYASADAFAFPSTTETLGLVALESMASEVPVVGARAGGIPFVIED--  191

Query  506  QGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNA  327
             G  G+L  PGD      +L+ LL +P L++ +G AAR +   + W+A+T+ +  E Y  
Sbjct  192  -GVTGFLVEPGDTTGYADRLRRLLLEPGLKQRMGAAARADALTHSWRASTESL-VESYEL  249

Query  326  AISFWRKERSQSPGPLQWLFKRIFQTP  246
            A+      R   P PL+    R    P
Sbjct  250  AVE-RHAGRRPVPKPLRARAHRDLPPP  275



>ref|WP_019157421.1| hypothetical protein [Brevibacterium senegalense]
Length=399

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 80/129 (62%), Gaps = 3/129 (2%)
 Frame = -3

Query  686  VFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQ  507
            VFTG + GEEL+ AYAS D+FV PS +ETLG V LE+M+SG+PVV ARAGGIP  + D  
Sbjct  253  VFTGYMAGEELAAAYASADLFVFPSTTETLGLVALESMASGVPVVGARAGGIPFAVRD--  310

Query  506  QGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNA  327
             G  G L  PG +DD   ++  +L DP+LR  +     +E +K+ W+AAT+ +      A
Sbjct  311  -GVGGLLHEPGSVDDLQTQVLRVLEDPQLRARLSAGGLEETQKHGWRAATESLVGAYEEA  369

Query  326  AISFWRKER  300
               +W   R
Sbjct  370  IERYWSDHR  378



>ref|WP_011610261.1| glycosyl transferase [Trichodesmium erythraeum]
 gb|ABG49865.1| glycosyl transferase, group 1 [Trichodesmium erythraeum IMS101]
Length=377

 Score =   113 bits (282),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 79/114 (69%), Gaps = 3/114 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L+G++L+ AYAS D F+ PS +ETLG V+LEAM++G PVVAA +GGIP+I+++   
Sbjct  252  FVGYLRGQKLASAYASADAFIFPSRTETLGLVLLEAMAAGTPVVAANSGGIPDIVTN---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  GYLF+P D    +   + L    E RET+ K AR E E++ W AAT+++RN
Sbjct  309  GINGYLFDPDDEKGAITATQKLFAHSEERETLRKNARAEAERWGWSAATQQLRN  362



>ref|WP_011316987.1| glycosyl transferase [Anabaena variabilis]
 gb|ABA19716.1| Glycosyl transferase, group 1 [Anabaena variabilis ATCC 29413]
Length=378

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 80/115 (70%), Gaps = 4/115 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G EL  A+AS D F+ PS +ETLG V+LEAM++G PVVAAR+GGIP+I++D   
Sbjct  252  FVGYLTGRELGAAFASADAFIFPSRTETLGLVLLEAMAAGCPVVAARSGGIPDIVTD---  308

Query  503  GKIGYLFNP-GDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  GYLFNP  D+ D +     LL + + R+TI + AR E E++ W AAT+++++
Sbjct  309  GVNGYLFNPKADIQDAINATVRLLENAQERDTIRQNARREAERWGWAAATRQLQD  363



>ref|WP_009786934.1| glycosyl transferase [Lyngbya sp. PCC 8106]
 gb|EAW34534.1| Glycosyl transferase, group 1 [Lyngbya sp. PCC 8106]
Length=377

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 84/122 (69%), Gaps = 4/122 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L+G+EL+ AYA  D F+ PS +ETLG V+LEAM++G PVVAAR+GGIP+I++D   
Sbjct  252  FVGYLRGQELADAYACADAFIFPSRTETLGLVLLEAMAAGTPVVAARSGGIPDIVTD---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNAA  324
            G  GYLF+P D +  +   + LL     RET+ + AR E E++ W AAT+++R   Y+A 
Sbjct  309  GVNGYLFDPTDENGAISATQRLLSHQLERETLRQNARLEAERWGWAAATQQLRR-YYSAV  367

Query  323  IS  318
            +S
Sbjct  368  LS  369



>ref|WP_015223063.1| group 1 glycosyl transferase [Cyanobacterium stanieri]
 gb|AFZ47747.1| glycosyl transferase group 1 [Cyanobacterium stanieri PCC 7202]
Length=378

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 78/114 (68%), Gaps = 3/114 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL +AYAS D F+ PS +ETLG V+LEAM++G PVVAAR GGIP+I++D   
Sbjct  252  FVGYLHGKELGEAYASADAFIFPSSTETLGLVLLEAMAAGCPVVAARRGGIPDIVTD---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  GY+F P D    +   + LL   + RET+ + AR E EK+ W AAT++++N
Sbjct  309  GVNGYMFEPDDPQGAIAATQRLLAQKDERETLRQNARLEAEKWGWAAATRQLQN  362



>ref|WP_015956855.1| glycosyl transferase [Cyanothece sp. PCC 7424]
 gb|ACK73273.1| glycosyl transferase group 1 [Cyanothece sp. PCC 7424]
Length=377

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 78/114 (68%), Gaps = 3/114 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G LQG EL+ AYAS D F+ PS +ETLG V+LEAM++G PVVAA +GGIP+I++D   
Sbjct  252  FIGYLQGLELASAYASADAFIFPSRTETLGLVLLEAMAAGCPVVAAASGGIPDIVTD---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  GYLF+P D D  +   + LL   + RE +   AR E E++ W AAT++++N
Sbjct  309  GVNGYLFDPADADGAITATQRLLEATQEREKLRHNARLEAERWGWAAATRQLQN  362



>ref|WP_011056273.1| glycosyl transferase [Thermosynechococcus elongatus]
 ref|NP_681208.1| sulfolipid sulfoquinovosyldiacylglycerol biosynthesis protein 
[Thermosynechococcus elongatus BP-1]
 dbj|BAC07970.1| sulfolipid sulfoquinovosyldiacylglycerol biosynthesis protein 
[Thermosynechococcus elongatus BP-1]
Length=379

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 83/121 (69%), Gaps = 5/121 (4%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L+GE L+ A+AS DVF+ PS +ETLG V+LEAM++G PVVAA +GGIP+I++D   
Sbjct  252  FVGYLRGERLAGAFASADVFIFPSRTETLGLVLLEAMAAGCPVVAANSGGIPDIVTD---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNAA  324
            G  G+LF+P D    +   + L   P+ RET+ + AR E E++ W AAT+++  EQY  +
Sbjct  309  GVNGFLFDPADPTGAITACQRLFDSPDDRETLRQNARQEAERWSWAAATQQL--EQYYRS  366

Query  323  I  321
            +
Sbjct  367  V  367



>ref|WP_028782924.1| glycosyl transferase [Thalassobacillus devorans]
Length=387

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 87/134 (65%), Gaps = 5/134 (4%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
              FTG L GEELSQA+ASGD F+ PS +ETLG V+LEAM+SGLPV+AA++G   E + D 
Sbjct  250  TTFTGFLYGEELSQAFASGDAFIFPSVTETLGLVILEAMASGLPVIAAKSGPTMEQVED-  308

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
              G+ G LF   D D  +R ++  + DPEL E +   AR+E EK+ W+  +++I +  Y 
Sbjct  309  --GRTGLLFENEDTDSLIRAIEK-IEDPELHEQLSVNARNEAEKFSWQKPSEQILDFYYQ  365

Query  329  AAISFWRKERSQSP  288
              +  ++K + ++P
Sbjct  366  -TLKVFQKNQVKAP  378



>ref|WP_026793415.1| MULTISPECIES: glycosyl transferase [Planktothrix]
Length=377

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 81/114 (71%), Gaps = 3/114 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L+G++L+ AYAS D F+ PS +ETLG V+LEAM++G PVVAAR+GGIP+I++D   
Sbjct  252  FVGYLRGKDLATAYASADAFIFPSRTETLGLVLLEAMAAGTPVVAARSGGIPDIVTD---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  GYLF+P   D  +   + L  +P+ RE + + AR E E++ W AAT+++R+
Sbjct  309  GVNGYLFDPLQEDGAITATQRLFANPQEREILRQNARLEAERWGWAAATQQLRS  362



>ref|WP_017655891.1| glycosyl transferase [Microchaete sp. PCC 7126]
Length=377

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 86/127 (68%), Gaps = 9/127 (7%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G EL+ A+AS DVF+ PS +ETLG V+LEAM++G PVVAAR+GGIP+I++D   
Sbjct  252  FVGYLTGRELASAFASADVFIFPSRTETLGLVLLEAMAAGCPVVAARSGGIPDIVTD---  308

Query  503  GKIGYLFNPGD---LDD--CLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNE  339
            G  GYLF PG+   + D   ++ +  LL   +   T+ + AR E EK+ W AAT++++N 
Sbjct  309  GVNGYLFEPGEQLSMSDSGAIKAVMNLLQHQQKHHTMRENARLEAEKWGWAAATQQLQN-  367

Query  338  QYNAAIS  318
             Y+ AIS
Sbjct  368  YYHKAIS  374



>ref|WP_024125070.1| sulfoquinovosyldiacylglycerol biosynthesis protein SqdX [Thermosynechococcus 
sp. NK55a]
 gb|AHB88679.1| sulfoquinovosyldiacylglycerol biosynthesis protein SqdX [Thermosynechococcus 
sp. NK55a]
Length=379

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 82/121 (68%), Gaps = 5/121 (4%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L+GE L+ A+AS DVFV PS +ETLG V+LEAM++G PVVAA +GGIP+I++D   
Sbjct  252  FVGYLRGERLAGAFASADVFVFPSRTETLGLVLLEAMAAGCPVVAANSGGIPDIVTD---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNAA  324
            G  G+LF+P D    +   + L   P  RET+ + AR E E++ W AAT+++  EQY  +
Sbjct  309  GVNGFLFDPADPTGAITACQRLFDSPGDRETLRQNARQEAERWSWAAATQQL--EQYYQS  366

Query  323  I  321
            +
Sbjct  367  V  367



>ref|WP_015230997.1| glycosyltransferase [Dactylococcopsis salina]
 gb|AFZ52023.1| glycosyltransferase [Dactylococcopsis salina PCC 8305]
Length=377

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 78/114 (68%), Gaps = 3/114 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L+GE L  AYAS D F+ PS +ETLG V+LEAM++G PVVAAR+GGIP+I++D   
Sbjct  252  FVGYLEGETLGAAYASADAFIFPSRTETLGLVLLEAMAAGCPVVAARSGGIPDIVTD---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G+ GYLF+P D    +   K LL     RE + + AR E E++ W AAT+++R+
Sbjct  309  GENGYLFDPKDPKGAVTATKRLLETQSERELLREKARQEAERWGWGAATQQLRD  362



>ref|WP_015133176.1| group 1 glycosyl transferase [Leptolyngbya sp. PCC 7376]
 gb|AFY37402.1| glycosyl transferase group 1 [Leptolyngbya sp. PCC 7376]
Length=378

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 79/113 (70%), Gaps = 3/113 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G LQG EL+ A+AS D FV PS +ETLG V+LEAM++G PVVAA +GGIP+I++D   
Sbjct  252  FVGYLQGLELASAFASSDAFVFPSRTETLGLVLLEAMAAGCPVVAANSGGIPDIVTD---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIR  345
            G+ G++F+P D D  ++  + LL   E RE +   AR E EK+ W AAT+++R
Sbjct  309  GENGFMFDPADPDGAVKATQRLLAATEEREAMRVNARLEAEKWGWAAATQQLR  361



>ref|WP_024289317.1| glycosyl transferase [Microbacterium sp. KROCY2]
Length=408

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 82/133 (62%), Gaps = 3/133 (2%)
 Frame = -3

Query  686  VFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQ  507
            VFTG + G EL+QAYAS DVF  PS SETLG V LEA +SG+PVV ARAGGIP +I    
Sbjct  252  VFTGYMSGLELAQAYASADVFAFPSRSETLGLVALEAFASGVPVVGARAGGIPFVID---  308

Query  506  QGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNA  327
            +G  G+L  PGD D     L+ LL DP+ R  + +AARDE  K+ W+A+T+ + +    A
Sbjct  309  EGVTGHLVEPGDADQLTEALRGLLEDPQRRARMAQAARDEALKHSWRASTEALVDFYTEA  368

Query  326  AISFWRKERSQSP  288
                WR      P
Sbjct  369  IERHWRDHVPAGP  381



>ref|WP_006215756.1| Glycosyltransferase [Kocuria palustris]
 gb|EME35563.1| Glycosyltransferase [Kocuria palustris PEL]
Length=408

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 82/133 (62%), Gaps = 3/133 (2%)
 Frame = -3

Query  686  VFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQ  507
            VFTG + G EL+QAYAS DVF  PS SETLG V LEA +SG+PVV ARAGGIP +I    
Sbjct  252  VFTGYMSGLELAQAYASADVFAFPSRSETLGLVALEAFASGVPVVGARAGGIPFVI---D  308

Query  506  QGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNA  327
            +G  G+L  PGD D     L+ LL DP+ R  + +AARDE  K+ W+A+T+ + +    A
Sbjct  309  EGVTGHLVEPGDADQLTEALRGLLEDPQRRARMAQAARDEALKHSWRASTEALVDFYTEA  368

Query  326  AISFWRKERSQSP  288
                WR      P
Sbjct  369  IERHWRDHVPAGP  381



>ref|WP_035923791.1| glycosyl transferase [Kocuria polaris]
 gb|KHD99131.1| glycosyl transferase [Kocuria polaris]
Length=385

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 82/135 (61%), Gaps = 7/135 (5%)
 Frame = -3

Query  686  VFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQ  507
            VF G L GEEL+ AYAS DV   PS +ETLG V LE+++SG+PVV ARAGGIP  ++D  
Sbjct  253  VFPGRLVGEELAAAYASADVLAFPSTTETLGLVALESLASGVPVVGARAGGIPFAVAD--  310

Query  506  QGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNA  327
             G+ G L  PGD D     L  LL D  LR  +G A R E E   W+AAT+ +    Y+ 
Sbjct  311  -GRTGLLVPPGDADALTAGLARLLDDAALRARMGAAGRAEAEGLGWRAATEFL-VACYDE  368

Query  326  AISFWRKERSQSPGP  282
            A+   R+ RS+ P P
Sbjct  369  AV---RRHRSRRPAP  380



>ref|WP_025943510.1| glycosyl transferase [Prochlorococcus sp. scB241_526B19]
Length=379

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 80/118 (68%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+ELS AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  253  FVGYLSGDELSSAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  309

Query  503  GKIGYLFNPGDLDD----CLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+     +   K +L D E RE + K AR+E EK+DW  AT +++N
Sbjct  310  GINGCLYDPEEKDNGETSLIEATKKILEDKEKREVMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_007356158.1| MULTISPECIES: glycosyl transferase [Kamptonema]
 emb|CBN56954.1| glycosyl transferase, group 1 [ [[Oscillatoria] sp. PCC 6506]
Length=377

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 77/113 (68%), Gaps = 3/113 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L+G EL+ AYA  D F+ PS +ETLG V+LEAM++G PVVAAR+GGIP+I++D   
Sbjct  252  FAGYLRGRELASAYACADAFIFPSRTETLGLVLLEAMAAGTPVVAARSGGIPDIVTD---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIR  345
            G  GYLF+P D +  +   + L   P+  ET+ + AR E E++ W AAT ++R
Sbjct  309  GVNGYLFDPADEEGAIAATQRLFAQPQEGETLRQNARIEAERWGWAAATHQLR  361



>ref|WP_015225187.1| group 1 glycosyl transferase [Halothece sp. PCC 7418]
 gb|AFZ43310.1| glycosyl transferase group 1 [Halothece sp. PCC 7418]
Length=377

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 77/114 (68%), Gaps = 3/114 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L+GE L  AYAS D F+ PS +ETLG V+LEAM++G PVVAAR+GGIP+I++D   
Sbjct  252  FVGYLEGETLGAAYASADAFIFPSRTETLGLVLLEAMAAGCPVVAARSGGIPDIVTD---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  GYLF+P D +  +   K LL     RE + + AR E E + W AAT+++R+
Sbjct  309  GVNGYLFDPHDPEGAVTATKRLLETQSERELLREKARQEAECWGWSAATQQLRD  362



>ref|XP_003083256.1| sulfolipid synthase (ISS), partial [Ostreococcus tauri]
Length=573

 Score =   112 bits (280),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 90/130 (69%), Gaps = 3/130 (2%)
 Frame = -3

Query  686  VFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQ  507
            VFTGM+ G++LS AYAS DVFVMPS SETLG VV+E+M+S +PVVA  AGG+ +I++  +
Sbjct  333  VFTGMITGDDLSAAYASLDVFVMPSPSETLGFVVMESMASSVPVVAVAAGGLLDILT--K  390

Query  506  QGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNA  327
             G +G L+   D D   + +  LL D   R+ +G+A+R +VEK+ W ++ + +R+ QY  
Sbjct  391  PGDVGLLYPEYDYDAAAKHVTMLLEDDVERKRMGEASRKDVEKWGWMSSNRNLRDNQYTK  450

Query  326  AIS-FWRKER  300
             ++ F+R +R
Sbjct  451  GLARFFRLQR  460



>ref|XP_001421416.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 ref|XP_001421447.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO99709.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO99740.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=456

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 84/123 (68%), Gaps = 2/123 (2%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
             VFTGM+ G++LS AYAS DVFVMPS SETLG VV+E+M+SG+PVVA  AGG+ +I+++ 
Sbjct  336  TVFTGMITGDDLSAAYASLDVFVMPSPSETLGFVVMESMASGVPVVAVAAGGLLDILTN-  394

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
              G +G L+   D D     +K LL +   R+ +G A+R +VEK+ W ++ + +R  QY+
Sbjct  395  -PGDVGLLYPEYDYDKAAEHVKMLLENDSERQRMGAASRADVEKWGWMSSNRNLRENQYS  453

Query  329  AAI  321
              +
Sbjct  454  KGL  456



>ref|WP_015220908.1| group 1 glycosyl transferase [Cyanobacterium aponinum]
 gb|AFZ55189.1| glycosyl transferase group 1 [Cyanobacterium aponinum PCC 10605]
Length=376

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 75/114 (66%), Gaps = 3/114 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G++L  AYAS D F+ PS +ETLG V+LEAM++G PVVAAR GGIP+I++D   
Sbjct  252  FVGYLHGQDLGSAYASADAFIFPSSTETLGLVLLEAMAAGCPVVAARRGGIPDIVTD---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  GYLF P D    +   + LL   + RE + + AR E EK+ W +AT ++RN
Sbjct  309  GVNGYLFEPDDPQGAIAATQKLLAKTDEREQLRQNARKEAEKWGWASATTQLRN  362



>emb|CEG01736.1| Glycosyl transferase, family 1 [Ostreococcus tauri]
Length=756

 Score =   113 bits (282),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 59/130 (45%), Positives = 90/130 (69%), Gaps = 3/130 (2%)
 Frame = -3

Query  686  VFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQ  507
            VFTGM+ G++LS AYAS DVFVMPS SETLG VV+E+M+S +PVVA  AGG+ +I++  +
Sbjct  336  VFTGMITGDDLSAAYASLDVFVMPSPSETLGFVVMESMASSVPVVAVAAGGLLDILT--K  393

Query  506  QGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNA  327
             G +G L+   D D   + +  LL D   R+ +G+A+R +VEK+ W ++ + +R+ QY  
Sbjct  394  PGDVGLLYPEYDYDAAAKHVTMLLEDDVERKRMGEASRKDVEKWGWMSSNRNLRDNQYTK  453

Query  326  AIS-FWRKER  300
             ++ F+R +R
Sbjct  454  GLARFFRLQR  463



>ref|XP_003057606.1| glycosyltransferase family 4 protein [Micromonas pusilla CCMP1545]
 gb|EEH57557.1| glycosyltransferase family 4 protein [Micromonas pusilla CCMP1545]
Length=769

 Score =   113 bits (282),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 62/132 (47%), Positives = 90/132 (68%), Gaps = 4/132 (3%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            A FTGM+ G++L+ AYAS DVFVMPSESETLG VV+EAM+SG+PVVA RAGG+ +I+++ 
Sbjct  359  AHFTGMITGDDLAAAYASLDVFVMPSESETLGFVVMEAMASGVPVVAVRAGGLQDILTNT  418

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
             +  +G L+  GD D+  R    LL D        ++ RD VE++ W A+  K+R+ QY 
Sbjct  419  PE--VGQLYPSGDYDEAARLTTELLVDDAEMARQRRSCRDAVEEWGWMASNTKLRDLQY-  475

Query  329  AAISFWRKERSQ  294
             A ++ R +R++
Sbjct  476  -ARAYRRHKRNE  486



>ref|WP_010996422.1| glycosyl transferase [Nostoc sp. PCC 7120]
 dbj|BAB73964.1| sulfolipid sulfoquinovosyldiacylglycerol biosynthesis protein 
[Nostoc sp. PCC 7120]
Length=378

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 79/115 (69%), Gaps = 4/115 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G EL  A+AS D F+ PS +ETLG V+LEAM++G PVVAAR+GGIP+I++D   
Sbjct  252  FVGYLTGRELGSAFASADAFIFPSRTETLGLVLLEAMAAGCPVVAARSGGIPDIVTD---  308

Query  503  GKIGYLFNP-GDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  GYLFNP  D+ D +     LL + + R+TI + AR E E + W +AT+++++
Sbjct  309  GVNGYLFNPKADIQDAINATVRLLENAQERDTIRQNARREAEGWGWASATRQLQD  363



>ref|XP_009034698.1| hypothetical protein AURANDRAFT_52616 [Aureococcus anophagefferens]
 gb|EGB11152.1| hypothetical protein AURANDRAFT_52616 [Aureococcus anophagefferens]
Length=432

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 85/122 (70%), Gaps = 3/122 (2%)
 Frame = -3

Query  686  VFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQ  507
            VFTG+L+G+ELS A+AS DVF+MPS+SETLG VVLE+M+SG+PVV  RAGGIP +I D  
Sbjct  306  VFTGLLRGDELSAAFASADVFLMPSDSETLGFVVLESMASGVPVVGCRAGGIPNLIDD--  363

Query  506  QGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNA  327
             G  G L   GD+ +     + LL D   R+ +G AAR E E++DW ++ + +R + Y A
Sbjct  364  -GATGRLHAVGDVAEIAELTRGLLDDAPKRDAMGAAARAEAERWDWASSGETLRADSYGA  422

Query  326  AI  321
            AI
Sbjct  423  AI  424



>ref|WP_015124487.1| glycosyltransferase [Synechococcus sp. PCC 6312]
 gb|AFY60944.1| glycosyltransferase [Synechococcus sp. PCC 6312]
Length=379

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 77/114 (68%), Gaps = 3/114 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L GE L+QA+A  D FV PS +ETLG V+LEAM++G PVVAAR+GGIP+I+ D   
Sbjct  252  FAGYLTGEPLAQAFAVADAFVFPSRTETLGLVLLEAMAAGCPVVAARSGGIPDIVQD---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  GYLF P D    +   + LL  P  +E + + AR E E++ W+AAT+++++
Sbjct  309  GVNGYLFEPTDPAGAMTATQKLLAQPSEKEALRQNARYEAERWSWQAATQQLQS  362



>ref|WP_012629991.1| glycosyl transferase [Cyanothece sp. PCC 7425]
 gb|ACL46949.1| glycosyl transferase group 1 [Cyanothece sp. PCC 7425]
Length=376

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 79/124 (64%), Gaps = 3/124 (2%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
              F G + G EL+ A+AS D F+ PS +ETLG V+LEAM++G PVVAAR+GGIP+I+ D 
Sbjct  250  TCFAGYMTGRELATAFASADAFIFPSRTETLGLVLLEAMAAGCPVVAARSGGIPDIVQD-  308

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYN  330
              G  GYLF+P D    +   + LL +   RET+ + AR E E++ W AAT+++     N
Sbjct  309  --GVNGYLFDPTDEQGSIVATQKLLRNQSERETLRQNARKEAERWGWAAATQQLETYYQN  366

Query  329  AAIS  318
              +S
Sbjct  367  VLLS  370



>ref|WP_017719528.1| glycosyl transferase [Oscillatoria sp. PCC 10802]
Length=377

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 78/116 (67%), Gaps = 3/116 (3%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            A F G +QG EL+ AYAS D F+ PS +ETLG V+LEAM++G PVVAAR+GGIP+I++D 
Sbjct  250  AHFAGYMQGLELASAYASADAFIFPSRTETLGLVLLEAMAAGCPVVAARSGGIPDIVTD-  308

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
              G  G LF+P D     +    LL   + RET+ + AR E E++ W AAT+++R 
Sbjct  309  --GVNGCLFDPADDAGARKATLRLLQHRQERETLRQNARQEAERWGWAAATRQLRR  362



>ref|WP_008314395.1| glycosyltransferase [Leptolyngbya sp. PCC 6406]
Length=377

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 79/113 (70%), Gaps = 3/113 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L GEEL+ AYAS DVFV PS +ETLG V+LEAM++G PVVAA +GGIP+I+++   
Sbjct  252  FVGYLAGEELASAYASADVFVFPSRTETLGLVLLEAMAAGCPVVAANSGGIPDIVTN---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIR  345
            G+ GY+F+P D +  +   + +     LRET+   AR E E++ W+ AT++++
Sbjct  309  GENGYMFDPQDENGAIAATQRIFATDALRETLRLNARAEAERWGWRGATQQLQ  361



>ref|WP_025928974.1| glycosyl transferase [Prochlorococcus sp. scB243_495G23]
Length=377

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 83/118 (70%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A+ GGIP+IISD   
Sbjct  253  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGAKKGGIPDIISD---  309

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+ ++ L    K +L + + RE + K AR+E EK+DW  AT +++N
Sbjct  310  GINGCLYDPDEKDNGVQSLIEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>gb|KGF85728.1| Glycosyltransferase [Prochlorococcus marinus str. GP2]
Length=373

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 83/123 (67%), Gaps = 7/123 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  249  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  305

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQ  336
            G  G L++P + D+ ++ L    K +L + + RE + K AR+E EK+DW  AT +++N  
Sbjct  306  GINGCLYDPDEKDNGVQSLIEATKKILENEDQREVMRKEARNEAEKWDWNQATLQLQNYY  365

Query  335  YNA  327
             N 
Sbjct  366  SNT  368



>ref|WP_006196765.1| glycosyl transferase [Nodularia spumigena]
 gb|EAW45108.1| sulfolipid sulfoquinovosyldiacylglycerol biosynthesis protein 
[Nodularia spumigena CCY9414]
 gb|AHJ30703.1| Glycosyltransferase [Nodularia spumigena CCY9414]
Length=378

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 77/115 (67%), Gaps = 4/115 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL  A+AS D F+ PS +ETLG V+LEAM++G PVVAAR+GGIP+I++D   
Sbjct  252  FVGYLTGQELGSAFASADAFIFPSRTETLGLVLLEAMAAGCPVVAARSGGIPDIVTD---  308

Query  503  GKIGYLFNP-GDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  GYLF+P  D+ D +     LL   + RE I + AR E E + W AAT ++++
Sbjct  309  GVNGYLFDPTADIQDAIHATVRLLQHKQEREVIRQNARSEAENWGWSAATCQLQD  363



>ref|WP_040944057.1| glycosyl transferase, partial [Prochloron didemni]
Length=139

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 79/121 (65%), Gaps = 4/121 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G EL+ AYAS D F+ PS +ETLG V+LEAM++G PVVAA +GGI +I++D   
Sbjct  14   FVGYLHGLELASAYASADAFIFPSRTETLGLVLLEAMAAGCPVVAAASGGIVDIVTD---  70

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNAA  324
            G+ GYLF+P +    +   + LL   E RE + + AR E E++ W AAT +++ E Y + 
Sbjct  71   GENGYLFDPLEPQSIITATQRLLAAKEEREILRQNARQEAERWSWSAATGQLQ-EYYKSV  129

Query  323  I  321
            +
Sbjct  130  V  130



>ref|WP_032525173.1| glycosyl transferase [Prochlorococcus marinus]
Length=377

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 83/123 (67%), Gaps = 7/123 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  253  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  309

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQ  336
            G  G L++P + D+ ++ L    K +L + + RE + K AR+E EK+DW  AT +++N  
Sbjct  310  GINGCLYDPDEKDNGVQSLIEATKKILENEDQREVMRKEARNEAEKWDWNQATLQLQNYY  369

Query  335  YNA  327
             N 
Sbjct  370  SNT  372



>ref|WP_035371326.1| glycosyl transferase family 1 [Acetobacter papayae]
Length=377

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 73/116 (63%), Gaps = 3/116 (3%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
             +FTG LQGEEL++AYASGD+FV PS++ET G V LEAM++GLP V A A G   ++ D 
Sbjct  254  TIFTGTLQGEELARAYASGDIFVFPSDTETFGNVTLEAMAAGLPCVCASAPGSQSLVVD-  312

Query  509  QQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
              G+ G+L  P D D     +K LL DPELR  +G AAR+    + W    + + N
Sbjct  313  --GETGFLATPRDADSFTTYVKRLLEDPELRHRMGLAARERSLSFSWSVPMEMLLN  366



>ref|WP_040933043.1| glycosyl transferase, partial [Prochloron didemni]
Length=128

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 79/121 (65%), Gaps = 4/121 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G EL+ AYAS D F+ PS +ETLG V+LEAM++G PVVAA +GGI +I++D   
Sbjct  3    FVGYLHGLELASAYASADAFIFPSRTETLGLVLLEAMAAGCPVVAAASGGIVDIVTD---  59

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNAA  324
            G+ GYLF+P +    +   + LL   E RE + + AR E E++ W AAT +++ E Y + 
Sbjct  60   GENGYLFDPLEPQSIITATQRLLAAKEEREILRQNARQEAERWSWSAATGQLQ-EYYKSV  118

Query  323  I  321
            +
Sbjct  119  V  119



>ref|WP_025976056.1| glycosyl transferase, partial [Prochlorococcus sp. scB243_495N3]
Length=290

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 81/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  166  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  222

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+ ++ L    K +L + + RE + K AR E EK+DW  AT +++N
Sbjct  223  GINGCLYDPDEKDNGVQSLIEATKKILENEDKREIMRKEARKEAEKWDWNQATLQLQN  280



>ref|WP_015170725.1| group 1 glycosyl transferase [Geitlerinema sp. PCC 7407]
 gb|AFY65157.1| glycosyl transferase group 1 [Geitlerinema sp. PCC 7407]
Length=376

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 78/113 (69%), Gaps = 3/113 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L GEELS AYAS D FV PS +ETLG V+LEAM++G PVVAA +GGI +I+ D   
Sbjct  252  FVGYLMGEELSTAYASADAFVFPSSTETLGLVLLEAMAAGCPVVAAGSGGITDIVED---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIR  345
            G  G+LF+P D    +   + LL   E+RET+ + AR E E++ W+AAT++++
Sbjct  309  GVNGFLFDPRDERGAIAATQRLLASTEIRETLRQNARREAERWGWEAATRQLQ  361



>ref|WP_032522712.1| glycosyl transferase [Prochlorococcus marinus]
 gb|KGF94991.1| Glycosyltransferase [Prochlorococcus marinus str. MIT 9201]
Length=379

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 81/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  253  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  309

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+  R L    K +L + + RE + K AR+E EK+DW  AT +++N
Sbjct  310  GINGCLYDPDEKDNGERSLIEATKKILENEDKREVMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_006101106.1| glycosyl transferase [Coleofasciculus chthonoplastes]
 gb|EDX75396.1| glycosyl transferase, group 1 family protein [Coleofasciculus 
chthonoplastes PCC 7420]
Length=377

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 80/125 (64%), Gaps = 5/125 (4%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L GE L  A+AS D F+ PS +ETLG V+LEAM++G PVVAAR+GGIP+I++D   
Sbjct  252  FVGYLTGEALGSAFASADAFIFPSRTETLGLVLLEAMAAGCPVVAARSGGIPDIVTD---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNAA  324
            G  GYLF+P D    +   + L  +   RET+ + AR E E++ W AAT+++  +QY   
Sbjct  309  GVNGYLFDPKDEQGAIAATQRLFQEQTERETLRENARAEAERWSWSAATRQL--QQYYQG  366

Query  323  ISFWR  309
            +   R
Sbjct  367  VVLSR  371



>ref|WP_025927153.1| glycosyl transferase [Prochlorococcus sp. scB241_528J8]
Length=377

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 82/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  253  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  309

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+ ++ L    K +L + + RE + K AR+E EK+DW  AT +++N
Sbjct  310  GINGCLYDPDEKDNGIQSLIEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_022608621.1| glycosyltransferase [Rubidibacter lacunae]
 gb|ERN40475.1| glycosyltransferase [Rubidibacter lacunae KORDI 51-2]
Length=377

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 78/114 (68%), Gaps = 3/114 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L+GE L+ AYAS D F+ PS +ETLG V+LEAM++G PVVAA +GGIP+I++D   
Sbjct  252  FVGYLRGEALASAYASADAFIFPSRTETLGLVLLEAMAAGCPVVAAASGGIPDIVTD---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  GYLF P D D  +R  + LL     RE + + AR E E++ W AAT+++++
Sbjct  309  GVNGYLFAPDDPDGAVRATQCLLDARTEREQLRQNARREAERWSWAAATQQLQD  362



>ref|XP_007514956.1| SqdX [Bathycoccus prasinos]
 emb|CCO15196.1| SqdX [Bathycoccus prasinos]
Length=865

 Score =   112 bits (279),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 63/143 (44%), Positives = 89/143 (62%), Gaps = 6/143 (4%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            FTGML GE+L+ AYA  DVFVMPSESETLG VV+EAM+SG+PVVA  AGG+ +I++ +  
Sbjct  404  FTGMLTGEDLAMAYAGLDVFVMPSESETLGFVVMEAMASGVPVVAVAAGGLLDIMT-NCA  462

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNAA  324
            G  G L+  GD        + LL D +      +A+ + V ++ W ++ KK+RN QY  A
Sbjct  463  GNAGELYPSGDYAKAGELTRSLLTDKQKLARYSQASLEYVSQWSWMSSNKKLRNRQYFKA  522

Query  323  I-SFWR----KERSQSPGPLQWL  270
            +   W+    KER++     QW+
Sbjct  523  VRRHWKANFGKERAKKIKVRQWM  545



>ref|WP_019494764.1| glycosyl transferase [Calothrix sp. PCC 7103]
Length=378

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 82/129 (64%), Gaps = 12/129 (9%)
 Frame = -3

Query  689  AVFTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDD  510
            A F G L G EL  A+AS D FV PS +ETLG V+LEAM++G PVVAAR+GGIP+I++D 
Sbjct  250  AFFVGYLTGVELGSAFASADAFVFPSRTETLGLVLLEAMAAGCPVVAARSGGIPDIVTD-  308

Query  509  QQGKIGYLFNPGDLD-DCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQY  333
              G  GYLF+P   D   +     LL + + RETI + AR E EK+ W AAT +++    
Sbjct  309  --GVNGYLFDPNTSDAGAIAATIRLLSEKQERETIRQNARSEAEKWGWAAATSQLQ----  362

Query  332  NAAISFWRK  306
                S++RK
Sbjct  363  ----SYYRK  367



>ref|WP_025980084.1| MULTISPECIES: glycosyl transferase [Prochlorococcus]
Length=377

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 82/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  253  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  309

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+ ++ L    K +L + + RE + K AR+E EK+DW  AT +++N
Sbjct  310  GINGCLYDPDEKDNGVQSLIEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_025939760.1| glycosyl transferase [Prochlorococcus sp. scB245a_520B18]
Length=377

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 82/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  253  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  309

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+ ++ L    K +L + + RE + K AR+E EK+DW  AT +++N
Sbjct  310  GINGCLYDPDEKDNGVQSLIEATKKILRNEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_025923704.1| glycosyl transferase [Prochlorococcus sp. scB243_495D8]
Length=377

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 82/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  253  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  309

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+ ++ L    K +L + + RE + K AR+E EK+DW  AT +++N
Sbjct  310  GINGCLYDPDEKDNGVQSLIKATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_025971371.1| glycosyl transferase [Prochlorococcus sp. scB245a_521N5]
Length=377

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 82/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  253  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  309

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+ ++ L    K +L + + RE + K AR+E EK+DW  AT +++N
Sbjct  310  GINGCLYDPDEKDNGVQSLIEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_025961606.1| glycosyl transferase [Prochlorococcus sp. scB245a_519L21]
Length=377

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 82/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  253  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  309

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+ ++ L    K +L + + RE + K AR+E EK+DW  AT +++N
Sbjct  310  GINGCLYDPDEKDNGVQSLIEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_044106990.1| glycosyl transferase [cyanobacterium endosymbiont of Epithemia 
turgida]
 dbj|BAP18177.1| sulfolipid sulfoquinovosyldiacylglycerol biosynthesis protein 
[cyanobacterium endosymbiont of Epithemia turgida isolate EtSB 
Lake Yunoko]
Length=377

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G LQG EL+ A+AS D F+ PS +ETLG V+LEAM++G PVVA  +GGIP+I++D   
Sbjct  252  FVGYLQGLELATAFASSDAFIFPSRTETLGLVLLEAMAAGCPVVAVNSGGIPDIVTD---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  GYLF P D D  +   + LL   E RE +   AR E E++ W AAT+++R+
Sbjct  309  GVNGYLFEPADADGAIVATQRLLAAKEDREKLRGNARLEAERWGWGAATRQLRD  362



>ref|WP_025927759.1| MULTISPECIES: glycosyl transferase [Prochlorococcus]
Length=377

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 82/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  253  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  309

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+ ++ L    K +L + + RE + K AR+E EK+DW  AT +++N
Sbjct  310  GINGCLYDPDEKDNGVQSLIEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_025882496.1| glycosyl transferase [Prochlorococcus sp. scB241_527E14]
Length=377

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 82/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  253  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  309

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+ ++ L    K +L + + RE + K AR+E EK+DW  AT +++N
Sbjct  310  GINGCLYDPDEKDNGVQSLIEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_025965084.1| glycosyl transferase [Prochlorococcus sp. scB243_498P15]
Length=377

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 82/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  253  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  309

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+ ++ L    K +L + + RE + K AR+E EK+DW  AT +++N
Sbjct  310  GINGCLYDPDEKDNGVQSLIEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_025938801.1| glycosyl transferase [Prochlorococcus sp. scB245a_519A13]
Length=377

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 82/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  253  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  309

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+ ++ L    K +L + + RE + K AR+E EK+DW  AT +++N
Sbjct  310  GINGCLYDPDEKDNGVQSLIEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_025913940.1| MULTISPECIES: glycosyl transferase [Prochlorococcus]
Length=377

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 82/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  253  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  309

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+ ++ L    K +L + + RE + K AR+E EK+DW  AT +++N
Sbjct  310  GINGCLYDPDEKDNGVQSLIEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_025967336.1| glycosyl transferase [Prochlorococcus sp. scB243_498P3]
Length=377

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 82/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  253  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  309

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+ ++ L    K +L + + RE + K AR+E EK+DW  AT +++N
Sbjct  310  GINGCLYDPDEKDNGVQSLIEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_025925654.1| MULTISPECIES: glycosyl transferase [Prochlorococcus]
Length=377

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 82/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  253  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  309

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+ ++ L    K +L + + RE + K AR+E EK+DW  AT +++N
Sbjct  310  GINGCLYDPDEKDNGVQSLIEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_025947613.1| glycosyl transferase [Prochlorococcus sp. scB241_528N8]
Length=377

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 82/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  253  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  309

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+ ++ L    K +L + + RE + K AR+E EK+DW  AT +++N
Sbjct  310  GINGCLYDPDEKDNGVQSLIEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_025945509.1| glycosyl transferase [Prochlorococcus sp. scB241_528N17]
Length=377

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 82/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  253  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  309

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+ ++ L    K +L + + RE + K AR+E EK+DW  AT +++N
Sbjct  310  GINGCLYDPDEKDNGVQSLIEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>gb|ABO18479.1| SqdX [Prochlorococcus marinus str. MIT 9301]
 gb|KGG08614.1| Glycosyltransferase [Prochlorococcus marinus str. SB]
Length=373

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 82/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  249  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  305

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+ ++ L    K +L + + RE + K AR+E EK+DW  AT +++N
Sbjct  306  GINGCLYDPDEKDNGVQSLIEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  363



>ref|WP_025958086.1| glycosyl transferase, partial [Prochlorococcus sp. scB245a_518J7]
Length=308

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 81/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  184  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  240

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+ ++ L    K +L +   RE + K AR+E EK+DW  AT +++N
Sbjct  241  GINGCLYDPDEKDNGVQSLIEATKKILENEGKREIMRKEARNEAEKWDWNQATLQLQN  298



>ref|WP_025893675.1| glycosyl transferase [Prochlorococcus sp. scB241_527N11]
Length=377

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 82/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  253  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  309

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+ ++ L    K +L + + RE + K AR+E EK+DW  AT +++N
Sbjct  310  GINGCLYDPDEKDNGVQSLIEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_025968880.1| glycosyl transferase [Prochlorococcus sp. scB245a_519D13]
Length=377

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 82/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  253  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANRGGIPDIISD---  309

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+ ++ L    K +L + + RE + K AR+E EK+DW  AT +++N
Sbjct  310  GINGCLYDPDEKDNGVQSLIEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_042851210.1| glycosyl transferase [Prochlorococcus sp. MIT 0604]
 gb|AIQ96041.1| Glycosyltransferase [Prochlorococcus sp. MIT 0604]
Length=377

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 82/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  253  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  309

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+ ++ L    K +L + + RE + K AR+E EK+DW  AT +++N
Sbjct  310  GINGCLYDPDEKDNGVQSLIEATKRILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_011819276.1| glycosyl transferase [Prochlorococcus marinus]
 gb|ABM71158.1| SqdX [Prochlorococcus marinus str. AS9601]
Length=377

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 81/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  253  FIGYLSGNELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  309

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+ ++ L    K +L + + RE + K AR+E EK+DW  AT +++N
Sbjct  310  GINGCLYDPDEKDNGVQSLIEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_015113812.1| group 1 glycosyl transferase [Nostoc sp. PCC 7107]
 gb|AFY43601.1| glycosyl transferase group 1 [Nostoc sp. PCC 7107]
Length=378

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 79/115 (69%), Gaps = 4/115 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G EL  A+AS D F+ PS +ETLG V+LEAM++G PVVAAR+GGIP+I++D   
Sbjct  252  FVGYLMGRELGSAFASADAFIFPSRTETLGLVLLEAMAAGCPVVAARSGGIPDIVTD---  308

Query  503  GKIGYLFNP-GDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  GYLF+P  D+ D +     LL + + R+ I + AR E EK+ W +AT+++++
Sbjct  309  GINGYLFDPKADIQDAISATIRLLENQQERDIIRQNARKEAEKWGWASATRQLQD  363



>ref|WP_042156569.1| glycosyl transferase [Planktothrix agardhii]
 gb|KEI69010.1| Glycosyl transferase group 1 [Planktothrix agardhii NIVA-CYA 
126/8]
Length=377

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 78/113 (69%), Gaps = 3/113 (3%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L+G++L+ AYAS D F+ PS +ETLG V+LEAM++G PVVAAR+GGIP+I++D   
Sbjct  252  FVGYLRGKDLATAYASADAFIFPSRTETLGLVLLEAMAAGTPVVAARSGGIPDIVTD---  308

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIR  345
            G  GYLF+P   D  +   + L  + + RE + + AR E E + W AAT+++R
Sbjct  309  GVNGYLFDPRQEDGAITATQRLFDNSQEREILRQNARKEAESWGWAAATQQLR  361



>gb|KIZ02980.1| sulfoquinovosyltransferase [Monoraphidium neglectum]
Length=430

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 84/122 (69%), Gaps = 2/122 (2%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            FTG LQG +LS+A+AS D F+MPSE+ETLG VVLEAM+SGLPVVA  AGG+ +++S  + 
Sbjct  259  FTGTLQGRDLSEAFASADAFLMPSETETLGFVVLEAMASGLPVVAVAAGGLTDVVS--RP  316

Query  503  GKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNEQYNAA  324
            G+ G L+ PG+   C    + L+ D   R  +G AAR E +++ W AAT+ +R +QY  A
Sbjct  317  GENGLLYPPGNYATCAAHARRLIADVAARRAMGAAARREAQRFGWAAATRHLREQQYARA  376

Query  323  IS  318
            + 
Sbjct  377  VC  378



>ref|WP_025974177.1| glycosyl transferase [Prochlorococcus sp. scB241_529B19]
Length=377

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 81/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  253  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  309

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+ ++ L    K +L + + RE + K AR E EK+DW  AT +++N
Sbjct  310  GINGCLYDPDEKDNGVQSLIEATKKILENEDKREIMRKEARTEAEKWDWNQATLQLQN  367



>ref|WP_025921690.1| glycosyl transferase [Prochlorococcus sp. scB241_526N5]
Length=377

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 81/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  253  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  309

Query  503  GKIGYLFNPGDLDDCLRKL----KPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D  ++ L    K +L + + RE + K AR+E EK+DW  AT +++N
Sbjct  310  GINGCLYDPDEKDKGVQSLIEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_032513539.1| glycosyl transferase [Prochlorococcus marinus]
Length=377

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 81/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  253  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  309

Query  503  GKIGYLFNPGDLDD----CLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+     ++  K +L + + RE + K AR+E EK+DW  AT +++N
Sbjct  310  GINGCLYDPDEKDNGEQSLIQATKKILENEDKREVMRKEARNEAEKWDWNQATLQLQN  367



>ref|XP_001699258.1| sulfolipid synthase [Chlamydomonas reinhardtii]
 gb|EDO98898.1| sulfolipid synthase, partial [Chlamydomonas reinhardtii]
Length=395

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 81/133 (61%), Gaps = 5/133 (4%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEII-----  519
            F GML+G+ELS AYAS DVFVMPSE+ETLG VVLEAM+SGLPVVA  AGG+ +I+     
Sbjct  258  FMGMLRGDELSAAYASADVFVMPSETETLGFVVLEAMASGLPVVAVAAGGLKDILAPAAA  317

Query  518  SDDQQGKIGYLFNPGDLDDCLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRNE  339
            S    G      +        + +  L   PELR ++G AAR EVE+Y W  AT+ +R E
Sbjct  318  SASSPGGSSSAADLAAAAAAAQLVAALAASPELRASVGAAARAEVERYGWGEATRVLREE  377

Query  338  QYNAAISFWRKER  300
            QY  AI      R
Sbjct  378  QYKRAIHVHASRR  390



>gb|KGF92154.1| Glycosyltransferase [Prochlorococcus marinus str. MIT 9107]
 gb|KGF92284.1| Glycosyltransferase [Prochlorococcus marinus str. MIT 9116]
 gb|KGF94363.1| Glycosyltransferase [Prochlorococcus marinus str. MIT 9123]
Length=373

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 81/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  249  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  305

Query  503  GKIGYLFNPGDLDD----CLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+     ++  K +L + + RE + K AR+E EK+DW  AT +++N
Sbjct  306  GINGCLYDPDEKDNGEQSLIQATKKILENEDKREVMRKEARNEAEKWDWNQATLQLQN  363



>gb|ABE11344.1| SqdX [uncultured Prochlorococcus marinus clone HOT0M-10E12]
Length=377

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 80/118 (68%), Gaps = 7/118 (6%)
 Frame = -3

Query  683  FTGMLQGEELSQAYASGDVFVMPSESETLGQVVLEAMSSGLPVVAARAGGIPEIISDDQQ  504
            F G L G+EL+ AYASGD+F+ PS +ETLG V+LEAM++G PV+ A  GGIP+IISD   
Sbjct  253  FIGYLSGDELASAYASGDIFLFPSSTETLGLVLLEAMAAGCPVIGANKGGIPDIISD---  309

Query  503  GKIGYLFNPGDLDD----CLRKLKPLLWDPELRETIGKAARDEVEKYDWKAATKKIRN  342
            G  G L++P + D+     +   K +L + + RE + K AR+E EK+DW  AT +++N
Sbjct  310  GVNGCLYDPDEKDNGEQSLIEATKKILENEDKREVMRKKARNEAEKWDWNQATLQLQN  367



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520