BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF011K06

Length=755
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHN01606.1|  Phosphatidylinositol-4-phosphate 5-kinase 5             106   8e-25   Glycine soja [wild soybean]
gb|KHG03661.1|  Phosphatidylinositol-4-phosphate 5-kinase 8 -like...    111   1e-24   Gossypium arboreum [tree cotton]
ref|XP_003529020.2|  PREDICTED: junctophilin-3-like isoform X1          105   2e-24   Glycine max [soybeans]
gb|KJB40955.1|  hypothetical protein B456_007G084700                    111   2e-24   Gossypium raimondii
ref|XP_010269853.1|  PREDICTED: uncharacterized protein LOC104606391    111   3e-24   Nelumbo nucifera [Indian lotus]
ref|XP_011017407.1|  PREDICTED: uncharacterized protein LOC105120747    109   4e-24   Populus euphratica
gb|KDP28891.1|  hypothetical protein JCGZ_14662                         109   6e-24   Jatropha curcas
gb|KHN31099.1|  Phosphatidylinositol-4-phosphate 5-kinase 5             103   8e-24   Glycine soja [wild soybean]
ref|XP_002301242.2|  hypothetical protein POPTR_0002s14090g             108   2e-23   Populus trichocarpa [western balsam poplar]
ref|XP_010274530.1|  PREDICTED: MORN repeat-containing protein 1        107   3e-23   Nelumbo nucifera [Indian lotus]
ref|XP_009797154.1|  PREDICTED: uncharacterized protein LOC104243632    107   3e-23   Nicotiana sylvestris
ref|XP_009600967.1|  PREDICTED: uncharacterized protein LOC104096313    107   4e-23   Nicotiana tomentosiformis
ref|XP_006464391.1|  PREDICTED: uncharacterized protein LOC102618644    106   1e-22   Citrus sinensis [apfelsine]
ref|XP_006445464.1|  hypothetical protein CICLE_v10019866mg             105   1e-22   Citrus clementina [clementine]
ref|XP_003631483.2|  PREDICTED: uncharacterized protein LOC100854975    105   2e-22   Vitis vinifera
emb|CBI33983.3|  unnamed protein product                                105   3e-22   Vitis vinifera
ref|XP_003521052.1|  PREDICTED: uncharacterized protein LOC100784010    103   5e-22   
ref|XP_007039639.1|  Histone H3 K4-specific methyltransferase SET...    104   5e-22   
ref|XP_007145970.1|  hypothetical protein PHAVU_006G002100g             103   7e-22   Phaseolus vulgaris [French bean]
gb|KDP45993.1|  hypothetical protein JCGZ_11896                         100   1e-21   Jatropha curcas
ref|XP_011085673.1|  PREDICTED: uncharacterized protein LOC105167598    103   1e-21   Sesamum indicum [beniseed]
ref|XP_006583515.1|  PREDICTED: junctophilin-3-like isoform X2        97.1    2e-21   
ref|XP_011031997.1|  PREDICTED: uncharacterized protein LOC105130956    101   3e-21   Populus euphratica
emb|CDP09399.1|  unnamed protein product                                102   3e-21   Coffea canephora [robusta coffee]
ref|XP_010052770.1|  PREDICTED: junctophilin-1-like                   96.7    3e-21   Eucalyptus grandis [rose gum]
ref|XP_007052396.1|  Histone H3 K4-specific methyltransferase SET...    102   4e-21   
ref|XP_011469529.1|  PREDICTED: uncharacterized protein LOC101291877    101   7e-21   Fragaria vesca subsp. vesca
ref|XP_004492216.1|  PREDICTED: uncharacterized protein LOC101512381  99.0    2e-20   Cicer arietinum [garbanzo]
ref|XP_006385583.1|  hypothetical protein POPTR_0003s08310g             100   2e-20   
ref|XP_006385383.1|  phosphatidylinositol-4-phosphate 5-kinase fa...  97.8    3e-20   
emb|CBI16702.3|  unnamed protein product                              96.3    3e-20   Vitis vinifera
ref|XP_008373628.1|  PREDICTED: uncharacterized protein LOC103436951  97.8    4e-20   
gb|EYU40337.1|  hypothetical protein MIMGU_mgv1a004924mg              98.6    5e-20   Erythranthe guttata [common monkey flower]
ref|XP_011032663.1|  PREDICTED: uncharacterized protein LOC105131407  98.2    6e-20   Populus euphratica
gb|KHG21680.1|  Phosphatidylinositol-4-phosphate 5-kinase 8 -like...  98.6    6e-20   Gossypium arboreum [tree cotton]
ref|XP_010661417.1|  PREDICTED: uncharacterized protein LOC100256...  98.2    6e-20   
gb|KJB49282.1|  hypothetical protein B456_008G110800                  98.6    6e-20   Gossypium raimondii
ref|XP_002269500.1|  PREDICTED: uncharacterized protein LOC100256...  98.2    8e-20   Vitis vinifera
ref|XP_007134391.1|  hypothetical protein PHAVU_010G044000g           96.7    1e-19   Phaseolus vulgaris [French bean]
gb|KJB40956.1|  hypothetical protein B456_007G084700                  97.8    1e-19   Gossypium raimondii
gb|KJB25414.1|  hypothetical protein B456_004G190900                  97.8    1e-19   Gossypium raimondii
ref|XP_002872977.1|  hypothetical protein ARALYDRAFT_352825           94.0    2e-19   
gb|KHG25364.1|  Phosphatidylinositol-4-phosphate 5-kinase 5 -like...  97.1    2e-19   Gossypium arboreum [tree cotton]
ref|XP_004245835.1|  PREDICTED: uncharacterized protein LOC101251207  97.1    2e-19   Solanum lycopersicum
ref|XP_007140748.1|  hypothetical protein PHAVU_008G138500g           96.3    2e-19   Phaseolus vulgaris [French bean]
ref|XP_009601948.1|  PREDICTED: uncharacterized protein LOC104097126  96.7    3e-19   Nicotiana tomentosiformis
gb|KEH22491.1|  ICE-like protease p20 domain protein                  95.9    3e-19   Medicago truncatula
ref|XP_006375189.1|  hypothetical protein POPTR_0014s05120g           92.4    3e-19   
ref|XP_010540286.1|  PREDICTED: radial spoke head 10 homolog B-like   94.7    4e-19   Tarenaya hassleriana [spider flower]
ref|XP_010426413.1|  PREDICTED: radial spoke head 1 homolog           92.0    4e-19   
gb|EMS46119.1|  hypothetical protein TRIUR3_14878                     91.3    5e-19   Triticum urartu
ref|XP_002526486.1|  1-phosphatidylinositol-4-phosphate 5-kinase,...  95.9    5e-19   
ref|XP_009593571.1|  PREDICTED: uncharacterized protein LOC104090224  95.9    6e-19   Nicotiana tomentosiformis
ref|XP_009371854.1|  PREDICTED: phosphatidylinositol 4-phosphate ...  94.7    6e-19   Pyrus x bretschneideri [bai li]
ref|XP_009397920.1|  PREDICTED: uncharacterized protein LOC103982660  95.1    8e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006396190.1|  hypothetical protein EUTSA_v10028664mg           94.4    8e-19   Eutrema salsugineum [saltwater cress]
ref|XP_008229489.1|  PREDICTED: uncharacterized protein LOC103328863  94.4    9e-19   
ref|XP_008457162.1|  PREDICTED: uncharacterized protein LOC103496903  95.1    1e-18   Cucumis melo [Oriental melon]
ref|XP_008232333.1|  PREDICTED: uncharacterized protein LOC103331490  94.7    1e-18   Prunus mume [ume]
gb|KFK30579.1|  hypothetical protein AALP_AA6G000100                  94.0    1e-18   Arabis alpina [alpine rockcress]
ref|XP_007217941.1|  hypothetical protein PRUPE_ppa005007mg           94.7    1e-18   Prunus persica
ref|XP_006287531.1|  hypothetical protein CARUB_v10000737mg           94.7    1e-18   
ref|XP_002517506.1|  conserved hypothetical protein                   93.6    1e-18   
ref|XP_004138932.1|  PREDICTED: uncharacterized protein LOC101207479  94.7    1e-18   Cucumis sativus [cucumbers]
ref|XP_004515310.1|  PREDICTED: uncharacterized protein LOC101504469  93.6    2e-18   
ref|XP_007209170.1|  hypothetical protein PRUPE_ppa006178mg           93.6    2e-18   
ref|XP_009759540.1|  PREDICTED: uncharacterized protein LOC104212054  94.4    2e-18   Nicotiana sylvestris
ref|XP_010419521.1|  PREDICTED: uncharacterized protein LOC104705253  92.8    3e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010426436.1|  PREDICTED: uncharacterized protein LOC104711430  92.8    3e-18   Camelina sativa [gold-of-pleasure]
gb|KHG29647.1|  Phosphatidylinositol-4-phosphate 5-kinase 8 -like...  93.6    3e-18   Gossypium arboreum [tree cotton]
gb|KHN01642.1|  Phosphatidylinositol-4-phosphate 5-kinase 5           92.0    3e-18   Glycine soja [wild soybean]
gb|KJB24907.1|  hypothetical protein B456_004G167400                  93.6    3e-18   Gossypium raimondii
ref|XP_010456343.1|  PREDICTED: phosphatidylinositol 4-phosphate ...  92.4    4e-18   Camelina sativa [gold-of-pleasure]
gb|KHN01850.1|  Phosphatidylinositol-4-phosphate 5-kinase 2           91.3    4e-18   Glycine soja [wild soybean]
ref|XP_004169332.1|  PREDICTED: uncharacterized protein LOC101227932  93.2    4e-18   
gb|EMT04339.1|  Phosphatidylinositol-4-phosphate 5-kinase 1           90.9    4e-18   
ref|XP_006345353.1|  PREDICTED: uncharacterized protein LOC102580713  93.2    4e-18   Solanum tuberosum [potatoes]
ref|NP_001131541.1|  hypothetical protein                             89.4    4e-18   Zea mays [maize]
gb|AFW87832.1|  hypothetical protein ZEAMMB73_398803                  90.5    4e-18   
gb|KJB37661.1|  hypothetical protein B456_006G214800                  93.2    4e-18   Gossypium raimondii
ref|XP_009389271.1|  PREDICTED: phosphatidylinositol 4-phosphate ...  92.8    5e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007155725.1|  hypothetical protein PHAVU_003G226200g           93.2    5e-18   Phaseolus vulgaris [French bean]
ref|XP_003549957.1|  PREDICTED: MORN repeat-containing protein 1-...  91.7    7e-18   Glycine max [soybeans]
ref|XP_004248983.1|  PREDICTED: uncharacterized protein LOC101257910  92.0    8e-18   Solanum lycopersicum
emb|CDX76579.1|  BnaA08g08210D                                        91.7    9e-18   
ref|XP_009108293.1|  PREDICTED: uncharacterized protein LOC103833992  91.7    9e-18   Brassica rapa
dbj|BAJ85961.1|  predicted protein                                    92.0    9e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001065416.1|  Os10g0565000                                     91.7    9e-18   
gb|KEH17938.1|  MORN repeat protein                                   91.7    1e-17   Medicago truncatula
ref|NP_001152273.1|  ICE-like protease p20 domain containing protein  91.3    1e-17   Zea mays [maize]
ref|XP_006586203.1|  PREDICTED: phosphatidylinositol 4-phosphate ...  91.3    1e-17   Glycine max [soybeans]
ref|XP_003517913.1|  PREDICTED: phosphatidylinositol 4-phosphate ...  90.9    2e-17   Glycine max [soybeans]
ref|XP_004147244.1|  PREDICTED: uncharacterized protein LOC101208169  90.5    2e-17   Cucumis sativus [cucumbers]
ref|XP_009398482.1|  PREDICTED: uncharacterized protein LOC103983061  91.3    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002879535.1|  hypothetical protein ARALYDRAFT_482483           91.3    2e-17   
gb|ABG66264.1|  ICE-like protease p20 domain containing protein, ...  92.0    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002467471.1|  hypothetical protein SORBIDRAFT_01g028730        90.9    2e-17   Sorghum bicolor [broomcorn]
gb|KFK29388.1|  hypothetical protein AALP_AA7G127000                  90.9    2e-17   Arabis alpina [alpine rockcress]
ref|XP_010692008.1|  PREDICTED: uncharacterized protein LOC104905241  90.9    3e-17   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY67767.1|  BnaCnng56290D                                        90.9    3e-17   Brassica napus [oilseed rape]
gb|ACK37362.1|  MORN                                                  90.9    3e-17   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_009145206.1|  PREDICTED: uncharacterized protein LOC103868899  90.5    3e-17   Brassica rapa
emb|CDY35600.1|  BnaC01g21220D                                        90.5    3e-17   Brassica napus [oilseed rape]
ref|XP_006294081.1|  hypothetical protein CARUB_v10023076mg           90.1    3e-17   
ref|XP_008802516.1|  PREDICTED: uncharacterized protein LOC103716338  90.1    3e-17   
ref|XP_010933554.1|  PREDICTED: uncharacterized protein LOC105053912  90.5    4e-17   Elaeis guineensis
ref|XP_006294082.1|  hypothetical protein CARUB_v10023076mg           90.1    4e-17   Capsella rubella
ref|XP_004986799.1|  PREDICTED: metacaspase-1-like                    90.9    4e-17   
ref|XP_010235005.1|  PREDICTED: phosphatidylinositol 4-phosphate ...  89.7    4e-17   Brachypodium distachyon [annual false brome]
ref|XP_009370933.1|  PREDICTED: uncharacterized protein LOC103960225  90.1    5e-17   
gb|ABG66263.1|  ICE-like protease p20 domain containing protein, ...  90.9    5e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008658075.1|  PREDICTED: hypothetical protein isoform X1       89.4    5e-17   
ref|XP_006410676.1|  hypothetical protein EUTSA_v10017682mg           89.7    6e-17   
ref|XP_009375380.1|  PREDICTED: uncharacterized protein LOC103964...  89.4    7e-17   
emb|CDY43465.1|  BnaC08g10880D                                        89.4    9e-17   Brassica napus [oilseed rape]
ref|XP_004300305.1|  PREDICTED: uncharacterized protein LOC101304099  88.6    1e-16   Fragaria vesca subsp. vesca
ref|XP_008382255.1|  PREDICTED: uncharacterized protein LOC103445065  89.0    1e-16   Malus domestica [apple tree]
ref|XP_008448763.1|  PREDICTED: phosphatidylinositol 4-phosphate ...  88.2    1e-16   Cucumis melo [Oriental melon]
ref|XP_006283553.1|  hypothetical protein CARUB_v10004606mg           89.0    1e-16   Capsella rubella
ref|XP_002870123.1|  predicted protein                                89.0    1e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_010531739.1|  PREDICTED: uncharacterized protein LOC104807969  88.6    1e-16   Tarenaya hassleriana [spider flower]
ref|NP_565799.1|  histone H3 K4-specific methyltransferase SET7/9...  88.6    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010941015.1|  PREDICTED: phosphatidylinositol 4-phosphate ...  88.2    2e-16   
ref|XP_010516688.1|  PREDICTED: uncharacterized protein LOC104792271  88.2    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_006838481.1|  hypothetical protein AMTR_s00002p00155600        87.8    3e-16   Amborella trichopoda
emb|CAB10488.1|  hypothetical protein                                 87.4    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193441.5|  Histone H3 K4-specific methyltransferase SET7/9...  87.8    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010440059.1|  PREDICTED: uncharacterized protein LOC104723390  87.4    4e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010434724.1|  PREDICTED: uncharacterized protein LOC104718641  87.4    4e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010509642.1|  PREDICTED: phosphatidylinositol 4-phosphate ...  87.4    4e-16   Camelina sativa [gold-of-pleasure]
gb|KFK26769.1|  hypothetical protein AALP_AA8G291400                  87.0    4e-16   Arabis alpina [alpine rockcress]
ref|XP_010449670.1|  PREDICTED: uncharacterized protein LOC104731870  87.4    4e-16   Camelina sativa [gold-of-pleasure]
ref|XP_008343830.1|  PREDICTED: uncharacterized protein LOC103406614  87.4    4e-16   
ref|XP_004508974.1|  PREDICTED: uncharacterized protein LOC101502494  86.3    6e-16   Cicer arietinum [garbanzo]
ref|XP_008355543.1|  PREDICTED: uncharacterized protein LOC103419206  86.3    6e-16   
ref|XP_010110542.1|  hypothetical protein L484_023376                 87.0    6e-16   
ref|XP_010540793.1|  PREDICTED: uncharacterized protein LOC104814452  86.7    8e-16   Tarenaya hassleriana [spider flower]
gb|EPS64865.1|  hypothetical protein M569_09914                       84.7    3e-15   Genlisea aurea
ref|XP_010053554.1|  PREDICTED: junctophilin-3                        84.0    4e-15   Eucalyptus grandis [rose gum]
gb|KEH31599.1|  MORN repeat protein                                   83.6    5e-15   Medicago truncatula
ref|XP_007133455.1|  hypothetical protein PHAVU_011G180000g           83.6    6e-15   Phaseolus vulgaris [French bean]
ref|XP_002979292.1|  hypothetical protein SELMODRAFT_177510           80.5    2e-14   
emb|CDP13437.1|  unnamed protein product                              82.8    2e-14   Coffea canephora [robusta coffee]
ref|XP_011093495.1|  PREDICTED: uncharacterized protein LOC105173...  78.6    4e-13   Sesamum indicum [beniseed]
ref|XP_011018672.1|  PREDICTED: uncharacterized protein LOC105121640  75.5    3e-12   Populus euphratica
ref|XP_006586204.1|  PREDICTED: phosphatidylinositol 4-phosphate ...  74.7    5e-12   Glycine max [soybeans]
ref|XP_006414274.1|  hypothetical protein EUTSA_v10024873mg           74.3    9e-12   Eutrema salsugineum [saltwater cress]
ref|XP_004173045.1|  PREDICTED: phosphatidylinositol 4-phosphate ...  70.5    1e-10   
ref|XP_010661418.1|  PREDICTED: uncharacterized protein LOC100256...  68.9    4e-10   Vitis vinifera
gb|KJB24908.1|  hypothetical protein B456_004G167400                  67.8    1e-09   Gossypium raimondii
ref|XP_011093496.1|  PREDICTED: uncharacterized protein LOC105173...  67.8    1e-09   Sesamum indicum [beniseed]
gb|KJB37663.1|  hypothetical protein B456_006G214800                  65.9    5e-09   Gossypium raimondii
gb|KJB37664.1|  hypothetical protein B456_006G214800                  65.9    5e-09   Gossypium raimondii
ref|XP_006421571.1|  hypothetical protein CICLE_v10007199mg           60.8    8e-09   
ref|XP_006442762.1|  hypothetical protein CICLE_v10023356mg           64.3    9e-09   
gb|KCW77868.1|  hypothetical protein EUGRSUZ_D021401                  64.3    2e-08   Eucalyptus grandis [rose gum]
ref|XP_011093494.1|  PREDICTED: uncharacterized protein LOC105173...  63.9    2e-08   
gb|KDO52541.1|  hypothetical protein CISIN_1g037549mg                 59.7    3e-08   Citrus sinensis [apfelsine]
ref|XP_010695457.1|  PREDICTED: junctophilin-2-like                   62.4    7e-08   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB39059.1|  hypothetical protein B456_007G322000                  57.4    2e-07   Gossypium raimondii
ref|XP_010926411.1|  PREDICTED: junctophilin-3-like                   60.5    3e-07   Elaeis guineensis
ref|XP_008782234.1|  PREDICTED: junctophilin-3-like                   60.1    5e-07   Phoenix dactylifera
ref|XP_009760610.1|  PREDICTED: radial spoke head 10 homolog B-like   58.2    2e-06   Nicotiana sylvestris
ref|XP_004250327.1|  PREDICTED: junctophilin-1-like                   58.2    2e-06   Solanum lycopersicum
ref|XP_009410095.1|  PREDICTED: junctophilin-1-like                   58.2    2e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010916591.1|  PREDICTED: phosphatidylinositol 4-phosphate ...  57.8    3e-06   Elaeis guineensis
ref|XP_001768288.1|  predicted protein                                56.2    4e-06   
ref|XP_010272808.1|  PREDICTED: uncharacterized protein LOC104608493  56.6    6e-06   Nelumbo nucifera [Indian lotus]
gb|EYU23900.1|  hypothetical protein MIMGU_mgv1a007045mg              56.6    6e-06   Erythranthe guttata [common monkey flower]
ref|XP_009621153.1|  PREDICTED: radial spoke head 10 homolog B-like   55.1    2e-05   Nicotiana tomentosiformis
gb|EYU22949.1|  hypothetical protein MIMGU_mgv1a006697mg              55.1    2e-05   Erythranthe guttata [common monkey flower]
ref|XP_008797288.1|  PREDICTED: junctophilin-3-like                   54.7    2e-05   Phoenix dactylifera
ref|XP_010664228.1|  PREDICTED: phosphatidylinositol 4-phosphate ...  54.3    4e-05   Vitis vinifera
ref|XP_010943100.1|  PREDICTED: junctophilin-1-like                   53.9    4e-05   Elaeis guineensis
emb|CBI19045.3|  unnamed protein product                              53.9    5e-05   Vitis vinifera
ref|XP_010939392.1|  PREDICTED: radial spoke head 10 homolog B-like   53.9    5e-05   Elaeis guineensis
ref|XP_009796895.1|  PREDICTED: junctophilin-3-like                   53.9    5e-05   Nicotiana sylvestris
ref|XP_010274323.1|  PREDICTED: junctophilin-4-like                   53.5    6e-05   Nelumbo nucifera [Indian lotus]
emb|CDP15806.1|  unnamed protein product                              53.5    6e-05   Coffea canephora [robusta coffee]
ref|XP_011069559.1|  PREDICTED: MORN repeat-containing protein 1-...  53.5    7e-05   Sesamum indicum [beniseed]
ref|XP_002462482.1|  hypothetical protein SORBIDRAFT_02g026440        53.1    8e-05   
ref|XP_010091369.1|  hypothetical protein L484_020171                 53.1    9e-05   Morus notabilis
ref|XP_009609906.1|  PREDICTED: junctophilin-3-like                   52.8    1e-04   Nicotiana tomentosiformis
ref|XP_011074862.1|  PREDICTED: uncharacterized protein LOC105159483  52.8    1e-04   Sesamum indicum [beniseed]
gb|EEC84694.1|  hypothetical protein OsI_31624                        52.8    1e-04   Oryza sativa Indica Group [Indian rice]
ref|NP_001063348.1|  Os09g0453900                                     52.8    1e-04   
gb|KDP32777.1|  hypothetical protein JCGZ_12069                       52.8    1e-04   Jatropha curcas
ref|XP_011027571.1|  PREDICTED: uncharacterized protein LOC105127827  52.4    2e-04   Populus euphratica
ref|XP_002302247.2|  phosphatidylinositol-4-phosphate 5-kinase fa...  52.4    2e-04   
ref|XP_004488906.1|  PREDICTED: junctophilin-3-like                   52.0    2e-04   Cicer arietinum [garbanzo]
ref|XP_006363901.1|  PREDICTED: radial spoke head 10 homolog B-like   51.6    3e-04   Solanum tuberosum [potatoes]
gb|EPS72285.1|  hypothetical protein M569_02471                       51.6    3e-04   Genlisea aurea
ref|XP_008219755.1|  PREDICTED: MORN repeat-containing protein 1      51.6    3e-04   Prunus mume [ume]
ref|XP_002891231.1|  hypothetical protein ARALYDRAFT_891288           51.2    4e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_007222382.1|  hypothetical protein PRUPE_ppa006014mg           51.2    4e-04   Prunus persica
ref|XP_009391367.1|  PREDICTED: radial spoke head 10 homolog B-like   51.2    4e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006845934.1|  hypothetical protein AMTR_s00157p00072470        51.2    4e-04   
gb|AAM65200.1|  phosphatidylinositol-4-phosphate 5-kinase, putative   51.2    4e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010544551.1|  PREDICTED: phosphatidylinositol 4-phosphate ...  51.2    4e-04   Tarenaya hassleriana [spider flower]
ref|NP_173610.1|  Histone H3 K4-specific methyltransferase SET7/9...  50.8    5e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003526619.1|  PREDICTED: MORN repeat-containing protein 1-...  50.8    5e-04   Glycine max [soybeans]
gb|KHN09187.1|  Phosphatidylinositol-4-phosphate 5-kinase 1           50.8    5e-04   Glycine soja [wild soybean]
ref|XP_008444131.1|  PREDICTED: uncharacterized protein LOC103487572  50.8    5e-04   Cucumis melo [Oriental melon]
gb|KJB59199.1|  hypothetical protein B456_009G244300                  50.1    9e-04   Gossypium raimondii
ref|XP_004242021.1|  PREDICTED: radial spoke head 10 homolog B-like   50.1    0.001   Solanum lycopersicum
ref|XP_002513784.1|  conserved hypothetical protein                   50.1    0.001   Ricinus communis



>gb|KHN01606.1| Phosphatidylinositol-4-phosphate 5-kinase 5 [Glycine soja]
Length=133

 Score =   106 bits (264),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNV-SSAPGTRTGSSATDDHSKVLNAVQEAIRAAE  578
            G+RQG G YTFRNGE+QSGHWQNG+L++ S+   T   S    +HS+VLNAVQEA RA E
Sbjct  22   GKRQGLGMYTFRNGETQSGHWQNGVLDIPSTQSATYPVSPVGVNHSRVLNAVQEARRATE  81

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAVA AN+AA AARV AVKAVQNQMHH+ N  ++P+PIV
Sbjct  82   KAYDVAKVDERVNRAVAAANRAANAARVAAVKAVQNQMHHNVNSMSIPIPIV  133



>gb|KHG03661.1| Phosphatidylinositol-4-phosphate 5-kinase 8 -like protein [Gossypium 
arboreum]
Length=500

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 86/111 (77%), Gaps = 1/111 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAP-GTRTGSSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNG+LNV S    T   S     HSKVLNAVQEA RAAE
Sbjct  387  GRRQGLGMYTFRNGEAQSGHWQNGVLNVPSTQNSTYPVSPVAVYHSKVLNAVQEARRAAE  446

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPI  425
            KA DV KVDERV +AVA AN+AA AARV AVKAVQ QMHH NN+ N+P+PI
Sbjct  447  KAYDVAKVDERVNKAVAAANRAANAARVIAVKAVQKQMHHTNNNDNIPIPI  497



>ref|XP_003529020.2| PREDICTED: junctophilin-3-like isoform X1 [Glycine max]
Length=133

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNV-SSAPGTRTGSSATDDHSKVLNAVQEAIRAAE  578
            G+RQG G YTFRNGE+QSGHWQNG+L++ S+   T   S    +HS+VLNAVQEA RA E
Sbjct  22   GKRQGVGMYTFRNGETQSGHWQNGVLDIPSTQSATYPVSPVGVNHSRVLNAVQEARRATE  81

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAVA AN+AA AARV AVKAVQNQMHH+ N  ++P+PIV
Sbjct  82   KAYDVAKVDERVNRAVAAANRAANAARVAAVKAVQNQMHHNVNSMSIPIPIV  133



>gb|KJB40955.1| hypothetical protein B456_007G084700 [Gossypium raimondii]
Length=525

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 86/111 (77%), Gaps = 1/111 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAP-GTRTGSSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNG+LNV S    T   S     HSKVLNAVQEA RAAE
Sbjct  412  GRRQGLGMYTFRNGEAQSGHWQNGVLNVPSTQNSTYPVSPVAVYHSKVLNAVQEARRAAE  471

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPI  425
            KA DV KVDERV +AVA AN+AA AARV AVKAVQ QMHH NN+ N+P+PI
Sbjct  472  KAYDVAKVDERVNKAVAAANRAANAARVIAVKAVQKQMHHTNNNDNIPIPI  522



>ref|XP_010269853.1| PREDICTED: uncharacterized protein LOC104606391 [Nelumbo nucifera]
Length=546

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+QSGHWQNGIL++ S   T  GS    ++SKVLNAVQEA RAAEK
Sbjct  436  GRRQGLGMYTFRNGETQSGHWQNGILDIPSTQNTHPGSPIAVNNSKVLNAVQEARRAAEK  495

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            A +V +VDERV +AVA ANKAA AARV AVKAVQ +MHH+NN  +VP+PIV
Sbjct  496  AYNVARVDERVNKAVAAANKAANAARVAAVKAVQKRMHHNNNKDDVPIPIV  546



>ref|XP_011017407.1| PREDICTED: uncharacterized protein LOC105120747 [Populus euphratica]
Length=479

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGT-RTGSSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNGIL+V S   T    S     HSKVLNAVQEA RAAE
Sbjct  368  GRRQGLGMYTFRNGETQSGHWQNGILDVPSTQNTSHPVSPVAVYHSKVLNAVQEARRAAE  427

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAVA AN+AA AARV AVKAVQ QMHH++N+ N+P+PIV
Sbjct  428  KAYDVTKVDERVNRAVAAANRAANAARVAAVKAVQKQMHHNSNNDNIPIPIV  479



>gb|KDP28891.1| hypothetical protein JCGZ_14662 [Jatropha curcas]
Length=503

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTG-SSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNGIL+V S   T    S     HSKVLNAVQEA RAAE
Sbjct  392  GRRQGLGMYTFRNGETQSGHWQNGILDVPSTQNTSYPVSPVAVYHSKVLNAVQEARRAAE  451

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            +A DV KVDERV RAVA AN+AA AARV AVKAVQ QMHH++N+ N+P+PIV
Sbjct  452  RAYDVAKVDERVNRAVAAANRAANAARVAAVKAVQKQMHHNSNNDNIPIPIV  503



>gb|KHN31099.1| Phosphatidylinositol-4-phosphate 5-kinase 5 [Glycine soja]
Length=133

 Score =   103 bits (257),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 87/112 (78%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATD-DHSKVLNAVQEAIRAAE  578
            G+RQG G YTFRNGE+QSGHWQNG+L++ S   T    S    +HS+VLNAVQEA RAAE
Sbjct  22   GKRQGLGMYTFRNGETQSGHWQNGVLDIPSTQSTTYPVSPVGVNHSRVLNAVQEARRAAE  81

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAVA AN+AA AARV AVKAVQNQM H+ N  ++P+PIV
Sbjct  82   KAYDVAKVDERVNRAVAAANRAANAARVAAVKAVQNQMLHNVNSTSIPIPIV  133



>ref|XP_002301242.2| hypothetical protein POPTR_0002s14090g [Populus trichocarpa]
 gb|EEE80515.2| hypothetical protein POPTR_0002s14090g [Populus trichocarpa]
Length=483

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 87/112 (78%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGT-RTGSSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNGIL+V S   T    S     HSKVLNAVQEA RAAE
Sbjct  372  GRRQGLGMYTFRNGETQSGHWQNGILDVPSTQNTSHPVSPVAVYHSKVLNAVQEARRAAE  431

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAVA AN+AA AARV AVKAVQ QMHH++N+ N+P+P V
Sbjct  432  KAYDVAKVDERVNRAVAAANRAANAARVAAVKAVQKQMHHNSNNDNIPIPFV  483



>ref|XP_010274530.1| PREDICTED: MORN repeat-containing protein 1 [Nelumbo nucifera]
Length=429

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+QSGHWQNGIL++ S   T  GS    +HSKVLNAVQEA RAAEK
Sbjct  320  GRRQGLGMYTFRNGETQSGHWQNGILDIPSTQNTHPGSPVAVNHSKVLNAVQEARRAAEK  379

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            A DV +VDERV RAV  ANKAA AARV AVKAVQ +MHH ++  ++P+PIV
Sbjct  380  AYDVPRVDERVNRAVVAANKAANAARVAAVKAVQKRMHHSSSD-DIPIPIV  429



>ref|XP_009797154.1| PREDICTED: uncharacterized protein LOC104243632 [Nicotiana sylvestris]
Length=500

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            G+RQGFG YTFR GE+QSGHWQNGILNVS++ G   GS +  DHSKVL+AVQEA +A+EK
Sbjct  390  GKRQGFGIYTFRTGETQSGHWQNGILNVSTSLGALPGSPSAVDHSKVLHAVQEARQASEK  449

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            A +V KVDERVKRAV  ANK+ATAARV AVKAVQNQ+HH+ +  + P+ +V
Sbjct  450  AINVTKVDERVKRAVTAANKSATAARVAAVKAVQNQIHHNGDSCHSPLAVV  500



>ref|XP_009600967.1| PREDICTED: uncharacterized protein LOC104096313 [Nicotiana tomentosiformis]
Length=504

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            G+RQGFG YTFR GE+QSGHWQNGILNVS++ G   GS +  DHSKVL+AVQEA +A+EK
Sbjct  394  GKRQGFGIYTFRTGETQSGHWQNGILNVSTSLGALPGSPSAVDHSKVLHAVQEARQASEK  453

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            A +V KVDERVKRAV  ANK+ATAARV AVKAVQNQ+HH+ +  + P+ +V
Sbjct  454  AINVTKVDERVKRAVTAANKSATAARVAAVKAVQNQIHHNRDSCHSPLAVV  504



>ref|XP_006464391.1| PREDICTED: uncharacterized protein LOC102618644 [Citrus sinensis]
 gb|KDO85435.1| hypothetical protein CISIN_1g011127mg [Citrus sinensis]
Length=493

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 86/112 (77%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNV-SSAPGTRTGSSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNGIL++ S+   T   S     HSKVLNAVQEA RAAE
Sbjct  382  GRRQGLGMYTFRNGETQSGHWQNGILDIPSTQTTTHPVSPIAVYHSKVLNAVQEARRAAE  441

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAV  AN+AA AARV AVKAVQ QMHH+N+   +P+PIV
Sbjct  442  KAYDVAKVDERVNRAVTAANRAANAARVAAVKAVQKQMHHNNSKDGIPLPIV  493



>ref|XP_006445464.1| hypothetical protein CICLE_v10019866mg [Citrus clementina]
 gb|ESR58704.1| hypothetical protein CICLE_v10019866mg [Citrus clementina]
Length=493

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 85/112 (76%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPG-TRTGSSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNGIL++ S    T   S     HSKVLNAVQEA RAAE
Sbjct  382  GRRQGLGMYTFRNGETQSGHWQNGILDIPSTQNTTHPVSPIAVYHSKVLNAVQEARRAAE  441

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAV  AN+AA AARV AVKAVQ QMHH+N+   +P+PIV
Sbjct  442  KAYDVAKVDERVNRAVTAANRAANAARVAAVKAVQKQMHHNNSKDGIPLPIV  493



>ref|XP_003631483.2| PREDICTED: uncharacterized protein LOC100854975 [Vitis vinifera]
Length=530

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+QSGHWQNG+L+V S   T   S     HSKVLNAVQEA RAAEK
Sbjct  420  GRRQGLGMYTFRNGEAQSGHWQNGVLDVPSTQNTHPASPFAVSHSKVLNAVQEARRAAEK  479

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            A DV KVDERV +AVA ANKAA AARV AVKAVQ ++HH+++  + P+PIV
Sbjct  480  AFDVSKVDERVNKAVALANKAANAARVAAVKAVQKRVHHNSDSSDTPLPIV  530



>emb|CBI33983.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+QSGHWQNG+L+V S   T   S     HSKVLNAVQEA RAAEK
Sbjct  430  GRRQGLGMYTFRNGEAQSGHWQNGVLDVPSTQNTHPASPFAVSHSKVLNAVQEARRAAEK  489

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            A DV KVDERV +AVA ANKAA AARV AVKAVQ ++HH+++  + P+PIV
Sbjct  490  AFDVSKVDERVNKAVALANKAANAARVAAVKAVQKRVHHNSDSSDTPLPIV  540



>ref|XP_003521052.1| PREDICTED: uncharacterized protein LOC100784010 [Glycine max]
Length=455

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 87/112 (78%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATD-DHSKVLNAVQEAIRAAE  578
            G+RQG G YTFRNGE+QSGHWQNG+L++ S   T    S    +HS+VLNAVQEA RAAE
Sbjct  344  GKRQGLGMYTFRNGETQSGHWQNGVLDIPSTQSTTYPVSPVGVNHSRVLNAVQEARRAAE  403

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAVA AN+AA AARV AVKAVQNQM H+ N  ++P+PIV
Sbjct  404  KAYDVAKVDERVNRAVAAANRAANAARVAAVKAVQNQMLHNVNSTSIPIPIV  455



>ref|XP_007039639.1| Histone H3 K4-specific methyltransferase SET7/9 family protein 
[Theobroma cacao]
 gb|EOY24140.1| Histone H3 K4-specific methyltransferase SET7/9 family protein 
[Theobroma cacao]
Length=542

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQGFGTYTFRNGE+QSGHWQNG+L+V SA  T  GS      S+VLNAVQEA RAAEK
Sbjct  433  GRRQGFGTYTFRNGETQSGHWQNGVLDVHSAQNTHLGSPYAVTQSRVLNAVQEARRAAEK  492

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMHHDN  452
            A D+ K+DERV RAV+ ANKAA AARV AVKAVQ +MHH N
Sbjct  493  AYDIAKIDERVNRAVSAANKAANAARVVAVKAVQKRMHHSN  533



>ref|XP_007145970.1| hypothetical protein PHAVU_006G002100g [Phaseolus vulgaris]
 gb|ESW17964.1| hypothetical protein PHAVU_006G002100g [Phaseolus vulgaris]
Length=457

 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNV-SSAPGTRTGSSATDDHSKVLNAVQEAIRAAE  578
            G+RQG G YTFRNGE+QSGHWQNG+L++ S+   T   S    +HS+VLNAVQEA RAAE
Sbjct  346  GKRQGLGMYTFRNGETQSGHWQNGVLDIPSTQSATYPVSPVGVNHSRVLNAVQEARRAAE  405

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAVA AN+AA AARV +VKAVQNQMHH+ N  ++P+ IV
Sbjct  406  KAYDVAKVDERVNRAVAAANRAANAARVASVKAVQNQMHHNVNSKSIPISIV  457



>gb|KDP45993.1| hypothetical protein JCGZ_11896 [Jatropha curcas]
Length=236

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG GTYTFRNGE+QSGHWQ+GIL+VSS+  T  GS     HSKVLNAVQEA RAAEK
Sbjct  127  GRRQGLGTYTFRNGEAQSGHWQSGILDVSSSENTPPGSPYAVSHSKVLNAVQEARRAAEK  186

Query  574  ANDVVKVDE  548
            ANDV +V++
Sbjct  187  ANDVARVED  195



>ref|XP_011085673.1| PREDICTED: uncharacterized protein LOC105167598 [Sesamum indicum]
Length=513

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 86/112 (77%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNV-SSAPGTRTGSSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNG+L+V S+   T   S    +HSKVLN VQEA RAAE
Sbjct  402  GRRQGLGMYTFRNGETQSGHWQNGVLDVPSTQSNTYPVSPVAVNHSKVLNVVQEARRAAE  461

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA +V KVDERV RAVA AN+AA AARV AVKAVQ QMHH +N   +P+P+V
Sbjct  462  KAYEVTKVDERVNRAVAAANRAANAARVAAVKAVQKQMHHRSNSDEIPIPVV  513



>ref|XP_006583515.1| PREDICTED: junctophilin-3-like isoform X2 [Glycine max]
Length=131

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 86/112 (77%), Gaps = 3/112 (3%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNV-SSAPGTRTGSSATDDHSKVLNAVQEAIRAAE  578
            G+RQG G YTFRNGE+QSGHWQNG+L++ S+   T   S    +HS+VLNA  EA RA E
Sbjct  22   GKRQGVGMYTFRNGETQSGHWQNGVLDIPSTQSATYPVSPVGVNHSRVLNA--EARRATE  79

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAVA AN+AA AARV AVKAVQNQMHH+ N  ++P+PIV
Sbjct  80   KAYDVAKVDERVNRAVAAANRAANAARVAAVKAVQNQMHHNVNSMSIPIPIV  131



>ref|XP_011031997.1| PREDICTED: uncharacterized protein LOC105130956 [Populus euphratica]
Length=425

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTF+NGE+QSGHWQNGIL+VS+A     GS     H KVL+AVQEA R+AEK
Sbjct  316  GRRQGLGMYTFKNGETQSGHWQNGILDVSTAENGNPGSPKATSHPKVLSAVQEARRSAEK  375

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            A DV +++ERV + V +ANKAA AARV AVKAVQ QMHH N+  +VP P V
Sbjct  376  AYDVARIEERVNKTVKSANKAANAARVAAVKAVQRQMHHQNSD-DVPSPFV  425



>emb|CDP09399.1| unnamed protein product [Coffea canephora]
Length=542

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 86/114 (75%), Gaps = 7/114 (6%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDD----HSKVLNAVQEAIR  587
            GRRQG G YTFRNGE+QSGHWQNGIL+V   P T+  S         HSKVLNAVQEA R
Sbjct  431  GRRQGLGMYTFRNGETQSGHWQNGILDV---PSTQNASHPVSPVAVYHSKVLNAVQEARR  487

Query  586  AAEKANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPI  425
            AA+KA DV KVDERV RAVA ANKAA AARV AVKAVQ QMHH +N  ++P+P+
Sbjct  488  AADKAYDVAKVDERVNRAVAAANKAANAARVAAVKAVQKQMHHRSNSDDIPIPV  541



>ref|XP_010052770.1| PREDICTED: junctophilin-1-like [Eucalyptus grandis]
 gb|KCW76841.1| hypothetical protein EUGRSUZ_D01196 [Eucalyptus grandis]
Length=133

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 86/112 (77%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATD-DHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQ GIL++ S   T    S    +HSKVLNAVQEA RAA+
Sbjct  22   GRRQGLGMYTFRNGETQSGHWQKGILDIPSTQSTMYPDSPVAVNHSKVLNAVQEARRAAD  81

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            +A DV KVDERV RAVA AN+AA AARV AVKAVQ Q++  +++ N+P+PIV
Sbjct  82   RAYDVAKVDERVNRAVAAANRAANAARVAAVKAVQKQIYPRSSNDNIPLPIV  133



>ref|XP_007052396.1| Histone H3 K4-specific methyltransferase SET7/9 family protein 
[Theobroma cacao]
 gb|EOX96553.1| Histone H3 K4-specific methyltransferase SET7/9 family protein 
[Theobroma cacao]
Length=529

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 80/103 (78%), Gaps = 1/103 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAP-GTRTGSSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNGIL+V S    T   S     HSKVLNAVQEA RAAE
Sbjct  419  GRRQGLGMYTFRNGETQSGHWQNGILDVPSTQNATYPVSPVAVYHSKVLNAVQEARRAAE  478

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNN  449
            KA DV KVDERV +AVA AN+AA AARV AVKAVQ QMHH+NN
Sbjct  479  KAYDVAKVDERVNKAVAAANRAANAARVIAVKAVQKQMHHNNN  521



>ref|XP_011469529.1| PREDICTED: uncharacterized protein LOC101291877, partial [Fragaria 
vesca subsp. vesca]
Length=511

 Score =   101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 84/112 (75%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTG-SSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+Q+GHWQNG+L+V S   T    S    +HSKVLNAVQEA   AE
Sbjct  400  GRRQGLGMYTFRNGETQAGHWQNGVLDVPSTQNTTIPVSPVAVNHSKVLNAVQEARIVAE  459

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAV  AN+AA AARV AVKAVQ QM H++N  N+P+P+V
Sbjct  460  KAYDVAKVDERVNRAVVAANRAANAARVAAVKAVQKQMQHNSNTNNIPIPVV  511



>ref|XP_004492216.1| PREDICTED: uncharacterized protein LOC101512381, partial [Cicer 
arietinum]
Length=428

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 85/112 (76%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATD-DHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNG+L++ S   T    S    +HSKVLNAVQEA RA E
Sbjct  317  GRRQGLGMYTFRNGETQSGHWQNGVLDIPSTQNTTYPVSPVGVNHSKVLNAVQEARRAGE  376

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA D+ KVDERV RAVA AN+AA AARV AVKAVQ QMHH  N+ + P+P++
Sbjct  377  KAYDLSKVDERVNRAVAAANRAANAARVAAVKAVQKQMHHHVNNESFPIPVM  428



>ref|XP_006385583.1| hypothetical protein POPTR_0003s08310g [Populus trichocarpa]
 gb|ERP63380.1| hypothetical protein POPTR_0003s08310g [Populus trichocarpa]
Length=539

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+QSGHWQNGIL+VS+A     GS     H KV +AVQEA R+AEK
Sbjct  430  GRRQGLGMYTFRNGETQSGHWQNGILDVSTAENGNPGSPKATSHPKVRSAVQEARRSAEK  489

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            A DV +++ERV + V +ANK+A AARV AVKAVQ QMHH N+  +VP P V
Sbjct  490  AYDVARIEERVNKTVKSANKSANAARVAAVKAVQRQMHHHNSD-DVPSPFV  539



>ref|XP_006385383.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Populus 
trichocarpa]
 gb|ERP63180.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Populus 
trichocarpa]
Length=381

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 82/111 (74%), Gaps = 1/111 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+QSGHWQNGIL+VS+    +  S     H KV+NAVQEA RAAEK
Sbjct  272  GRRQGLGMYTFRNGETQSGHWQNGILDVSTVENGKPESPNAISHPKVVNAVQEAKRAAEK  331

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            A D  +++ERV + +A ANKAA AARV AVKAVQ QMHH N+  +VP P V
Sbjct  332  ACDAARIEERVNKTIAYANKAANAARVAAVKAVQRQMHHQNSD-DVPTPFV  381



>emb|CBI16702.3| unnamed protein product [Vitis vinifera]
Length=238

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 86/112 (77%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATD-DHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNGIL++ S   T    S     HSKVLN VQEA RAAE
Sbjct  127  GRRQGLGMYTFRNGETQSGHWQNGILDIPSTQSTTYPVSPIAVYHSKVLNVVQEARRAAE  186

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAVA AN+AA AARV A+KAVQ Q+H ++N+ N+P+P+V
Sbjct  187  KAYDVTKVDERVNRAVAAANRAANAARVAAIKAVQKQIHQNSNNNNIPIPMV  238



>ref|XP_008373628.1| PREDICTED: uncharacterized protein LOC103436951 [Malus domestica]
Length=431

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QG G YTFRNGE+QSGHWQNG+L++ S   T+ GSS   +H+KV NAVQEA RAAE+
Sbjct  330  GRKQGLGMYTFRNGETQSGHWQNGVLDIPSVQNTQPGSSYAANHAKVFNAVQEAQRAAER  389

Query  574  ANDVVKVDE  548
            A +V KVDE
Sbjct  390  AFEVAKVDE  398



>gb|EYU40337.1| hypothetical protein MIMGU_mgv1a004924mg [Erythranthe guttata]
Length=504

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 86/112 (77%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGT-RTGSSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFR+GE+QSGHWQNG+L+V S   T    S    +HSKVLN VQEA RAAE
Sbjct  393  GRRQGLGMYTFRSGETQSGHWQNGVLDVPSTQSTVFPASPVAVNHSKVLNVVQEARRAAE  452

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA +V KVDERV RAVA+AN+AA AARV+AVKAVQ QMH  +N   +P+P+V
Sbjct  453  KAYEVSKVDERVNRAVASANRAANAARVSAVKAVQRQMHRRSNSDEIPIPLV  504



>ref|XP_011032663.1| PREDICTED: uncharacterized protein LOC105131407 [Populus euphratica]
Length=476

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 83/109 (76%), Gaps = 1/109 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTG-SSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNGIL+V S   T    S     HSKVLNAVQEA  A+E
Sbjct  367  GRRQGLGMYTFRNGETQSGHWQNGILDVPSTQNTSYPVSPVAVYHSKVLNAVQEARAASE  426

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPV  431
            KA DV KVDERV RAVA AN+AA AARV AVKAVQ QMH +NN+ N+P+
Sbjct  427  KAYDVAKVDERVNRAVAAANRAANAARVVAVKAVQKQMHRNNNNGNIPI  475



>gb|KHG21680.1| Phosphatidylinositol-4-phosphate 5-kinase 8 -like protein [Gossypium 
arboreum]
Length=517

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 83/112 (74%), Gaps = 4/112 (4%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTG-SSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNGIL+V S   T    S     HSKVLN VQEA RAAE
Sbjct  409  GRRQGLGMYTFRNGETQSGHWQNGILDVPSTQSTSYPVSPVAVYHSKVLNVVQEARRAAE  468

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV +AVA AN+AA AARV AVKAVQ QMHH+N +    +PIV
Sbjct  469  KAYDVAKVDERVNKAVAAANRAANAARVIAVKAVQKQMHHNNGN---SIPIV  517



>ref|XP_010661417.1| PREDICTED: uncharacterized protein LOC100256437 isoform X2 [Vitis 
vinifera]
Length=484

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 86/112 (77%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATD-DHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNGIL++ S   T    S     HSKVLN VQEA RAAE
Sbjct  373  GRRQGLGMYTFRNGETQSGHWQNGILDIPSTQSTTYPVSPIAVYHSKVLNVVQEARRAAE  432

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAVA AN+AA AARV A+KAVQ Q+H ++N+ N+P+P+V
Sbjct  433  KAYDVTKVDERVNRAVAAANRAANAARVAAIKAVQKQIHQNSNNNNIPIPMV  484



>gb|KJB49282.1| hypothetical protein B456_008G110800 [Gossypium raimondii]
Length=515

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 82/112 (73%), Gaps = 4/112 (4%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTG-SSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNGIL+V S   T    S     HSKVLN VQEA RAAE
Sbjct  407  GRRQGLGMYTFRNGETQSGHWQNGILDVPSTQSTSYPVSPVAVYHSKVLNVVQEARRAAE  466

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV +AVA AN+AA AARV AVKAVQ QMHH+N      +PIV
Sbjct  467  KAYDVAKVDERVNKAVAAANRAANAARVIAVKAVQKQMHHNNGD---SIPIV  515



>ref|XP_002269500.1| PREDICTED: uncharacterized protein LOC100256437 isoform X1 [Vitis 
vinifera]
Length=494

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 86/112 (77%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATD-DHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNGIL++ S   T    S     HSKVLN VQEA RAAE
Sbjct  383  GRRQGLGMYTFRNGETQSGHWQNGILDIPSTQSTTYPVSPIAVYHSKVLNVVQEARRAAE  442

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAVA AN+AA AARV A+KAVQ Q+H ++N+ N+P+P+V
Sbjct  443  KAYDVTKVDERVNRAVAAANRAANAARVAAIKAVQKQIHQNSNNNNIPIPMV  494



>ref|XP_007134391.1| hypothetical protein PHAVU_010G044000g [Phaseolus vulgaris]
 gb|ESW06385.1| hypothetical protein PHAVU_010G044000g [Phaseolus vulgaris]
Length=407

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 86/112 (77%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNV-SSAPGTRTGSSATDDHSKVLNAVQEAIRAAE  578
            G+RQG G Y FRNGE+QSGHWQNG++++ S+   T   S     HS+VLN VQEA RAA+
Sbjct  296  GKRQGIGMYIFRNGETQSGHWQNGVIDIPSTQSATFPVSPVGVYHSRVLNVVQEARRAAK  355

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAVA AN+AA AARV +VKAVQNQMH + N+ ++P+PIV
Sbjct  356  KAYDVAKVDERVNRAVAAANRAANAARVASVKAVQNQMHRNINNKSIPIPIV  407



>gb|KJB40956.1| hypothetical protein B456_007G084700 [Gossypium raimondii]
Length=533

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 77/100 (77%), Gaps = 1/100 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAP-GTRTGSSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNG+LNV S    T   S     HSKVLNAVQEA RAAE
Sbjct  412  GRRQGLGMYTFRNGEAQSGHWQNGVLNVPSTQNSTYPVSPVAVYHSKVLNAVQEARRAAE  471

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHH  458
            KA DV KVDERV +AVA AN+AA AARV AVKAVQ QMHH
Sbjct  472  KAYDVAKVDERVNKAVAAANRAANAARVIAVKAVQKQMHH  511



>gb|KJB25414.1| hypothetical protein B456_004G190900 [Gossypium raimondii]
Length=545

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQGFGTYTFRNGE+QSGHWQ+G+LNV S      GS      S+VLNAVQEA RAAEK
Sbjct  436  GRRQGFGTYTFRNGETQSGHWQHGVLNVHSTQSIHLGSPHAVTRSRVLNAVQEAQRAAEK  495

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNN  449
            A  + K+DERV +AV+ ANKAA AARV AVKAVQ +MH DN+
Sbjct  496  AYSIAKIDERVNKAVSAANKAANAARVVAVKAVQKRMHQDNS  537



>ref|XP_002872977.1| hypothetical protein ARALYDRAFT_352825 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49236.1| hypothetical protein ARALYDRAFT_352825 [Arabidopsis lyrata subsp. 
lyrata]
Length=235

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 82/112 (73%), Gaps = 4/112 (4%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTG-SSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHW+NGIL++ S   T    SS   +HSKVLNAVQEA RAAE
Sbjct  127  GRRQGLGMYTFRNGEAQSGHWENGILDIPSTQNTTCSVSSVAVNHSKVLNAVQEARRAAE  186

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAV  AN++A AARV AVKAVQ Q     N  N P+P+V
Sbjct  187  KAYDVDKVDERVNRAVTAANRSANAARVAAVKAVQKQ---SRNMDNFPIPVV  235



>gb|KHG25364.1| Phosphatidylinositol-4-phosphate 5-kinase 5 -like protein [Gossypium 
arboreum]
Length=546

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQGFGTYTFRNGE+QSGHWQ+G+L+V S      GS      S+VLNAVQEA RAAEK
Sbjct  437  GRRQGFGTYTFRNGETQSGHWQHGVLDVHSTQSIHLGSPHDVTRSRVLNAVQEARRAAEK  496

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNN  449
            A  + K+DERV +AV+ ANKAA AARV AVKAVQ ++HHDN+
Sbjct  497  AYSIAKIDERVNKAVSAANKAANAARVVAVKAVQKRLHHDNS  538



>ref|XP_004245835.1| PREDICTED: uncharacterized protein LOC101251207 [Solanum lycopersicum]
Length=523

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            G+RQGFG YTFRNGE+QSGHWQNGILNVSS+ G+  GS +  DHSKVL+AVQEA +AAEK
Sbjct  413  GKRQGFGIYTFRNGETQSGHWQNGILNVSSSLGSLPGSPSAIDHSKVLHAVQEARQAAEK  472

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            A +V  VDER KRAV +ANK+ATAARV AVKAVQNQMH + +  + P+ +V
Sbjct  473  AINVPNVDERAKRAVTSANKSATAARVAAVKAVQNQMHQNGDSCHSPLSVV  523



>ref|XP_007140748.1| hypothetical protein PHAVU_008G138500g [Phaseolus vulgaris]
 gb|ESW12742.1| hypothetical protein PHAVU_008G138500g [Phaseolus vulgaris]
Length=459

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 77/109 (71%), Gaps = 1/109 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATD-DHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QS HWQNG L++ S   T    S     HSKVLNAVQEA RAAE
Sbjct  350  GRRQGLGMYTFRNGETQSAHWQNGFLDIPSTQSTTYPVSPVGVSHSKVLNAVQEARRAAE  409

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPV  431
            KA +V KVDE V RAVA +N+AA AARV AVKA Q QMH  N  F +PV
Sbjct  410  KAYEVAKVDEGVNRAVAASNRAANAARVAAVKAAQKQMHVKNESFAIPV  458



>ref|XP_009601948.1| PREDICTED: uncharacterized protein LOC104097126 [Nicotiana tomentosiformis]
Length=527

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 85/114 (75%), Gaps = 7/114 (6%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDD----HSKVLNAVQEAIR  587
            G+RQG G YTFRNGE+QSGHWQNG+L++   P T+  S         HSKVLNAVQEA R
Sbjct  416  GKRQGLGMYTFRNGETQSGHWQNGVLDI---PSTQNASYPVSPVAVYHSKVLNAVQEARR  472

Query  586  AAEKANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPI  425
            AAE+A DV KVDERV RAVA AN+AA AARV AVKA+Q QMH  +N  ++P+P+
Sbjct  473  AAERAYDVAKVDERVNRAVAAANRAANAARVAAVKAMQKQMHRRSNSDDLPIPM  526



>gb|KEH22491.1| ICE-like protease p20 domain protein [Medicago truncatula]
Length=453

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 84/112 (75%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATD-DHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNG+L++ S   T    S    +HSKVL AVQEA RAAE
Sbjct  342  GRRQGLGMYTFRNGETQSGHWQNGVLDIPSTQNTTYPVSPVGVNHSKVLTAVQEARRAAE  401

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA +V KV+ERV RAV+ AN+AA AARV AVKAVQ QMHH  N+   P+P++
Sbjct  402  KAYNVSKVEERVNRAVSAANRAANAARVAAVKAVQKQMHHHVNNEGFPIPVM  453



>ref|XP_006375189.1| hypothetical protein POPTR_0014s05120g [Populus trichocarpa]
 gb|ERP52986.1| hypothetical protein POPTR_0014s05120g [Populus trichocarpa]
Length=168

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 82/109 (75%), Gaps = 1/109 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTG-SSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNGI +V S   T    S     HSKVLNAVQEA  A+E
Sbjct  59   GRRQGLGMYTFRNGETQSGHWQNGIHDVPSTQNTSYPVSPVAVYHSKVLNAVQEARTASE  118

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPV  431
            +A DV KVDERV RAVA AN+AA AARV AVKAVQ QMH +NN+ ++P+
Sbjct  119  EAYDVAKVDERVNRAVAAANRAANAARVAAVKAVQKQMHRNNNNGSIPI  167



>ref|XP_010540286.1| PREDICTED: radial spoke head 10 homolog B-like, partial [Tarenaya 
hassleriana]
Length=386

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 80/112 (71%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTG-SSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNGIL+V S   T    S    +HSKVLNAVQEA RAAE
Sbjct  275  GRRQGLGLYTFRNGETQSGHWQNGILDVPSTQNTTCPVSPVAVNHSKVLNAVQEARRAAE  334

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA D+ KVDERV RAVA AN+AA AARV  VKA Q Q+H   N  N P  +V
Sbjct  335  KAYDIGKVDERVSRAVAAANRAANAARVAGVKAAQKQIHPSRNIDNFPFHVV  386



>ref|XP_010426413.1| PREDICTED: radial spoke head 1 homolog, partial [Camelina sativa]
Length=178

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 79/112 (71%), Gaps = 4/112 (4%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTG-SSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNGIL++ S   T    S    +HSKVLNAVQEA RAAE
Sbjct  70   GRRQGLGMYTFRNGETQSGHWQNGILDIPSTQNTTFPISPVAVNHSKVLNAVQEARRAAE  129

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAVA AN AA AARV A KA Q Q     N  N P+P+V
Sbjct  130  KAYDVDKVDERVNRAVAAANTAANAARVAAFKAAQKQ---SKNMDNFPIPVV  178



>gb|EMS46119.1| hypothetical protein TRIUR3_14878 [Triticum urartu]
Length=147

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q+GHWQNG+L+  S      GS+   +HSKVLNAVQEA RA EK
Sbjct  49   GRRQGLGMYTFRNGETQAGHWQNGVLDTLSTQNIVPGSAIAVNHSKVLNAVQEARRATEK  108

Query  574  ANDVVKVDE  548
            A DV +VD+
Sbjct  109  AYDVPRVDD  117



>ref|XP_002526486.1| 1-phosphatidylinositol-4-phosphate 5-kinase, putative [Ricinus 
communis]
 gb|EEF35877.1| 1-phosphatidylinositol-4-phosphate 5-kinase, putative [Ricinus 
communis]
Length=517

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 87/112 (78%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTG-SSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNGIL+V S   T    S     HSKVLNAVQEA RAAE
Sbjct  406  GRRQGLGMYTFRNGETQSGHWQNGILDVPSTQNTTYPVSPVAVYHSKVLNAVQEARRAAE  465

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            +A DV KVDERV RAVA AN+AA AARV AVKAV  QM+H+NN+ N+P+PIV
Sbjct  466  RAYDVAKVDERVNRAVAAANRAANAARVAAVKAVHKQMNHNNNNDNIPIPIV  517



>ref|XP_009593571.1| PREDICTED: uncharacterized protein LOC104090224 [Nicotiana tomentosiformis]
Length=514

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 82/109 (75%), Gaps = 1/109 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTG-SSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNG+L++ S   T    S     HSKVLNAVQEA RAA+
Sbjct  404  GRRQGLGMYTFRNGETQSGHWQNGVLDIPSTHNTSYSVSPVAVYHSKVLNAVQEARRAAK  463

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPV  431
            +A DV KVDERV RAVA AN+AA AARV AVKAVQ QMHH  N  ++P+
Sbjct  464  RAYDVTKVDERVNRAVAAANRAANAARVAAVKAVQKQMHHRRNSDDLPM  512



>ref|XP_009371854.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Pyrus 
x bretschneideri]
Length=427

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 56/69 (81%), Gaps = 4/69 (6%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QG G YTFRNGE+QSGHWQNG+L++++ P    GSS   +H+KVLNAVQEA RAAE+
Sbjct  330  GRKQGLGMYTFRNGETQSGHWQNGVLDINNQP----GSSYAANHAKVLNAVQEAQRAAER  385

Query  574  ANDVVKVDE  548
            A +V KVDE
Sbjct  386  AYEVAKVDE  394



>ref|XP_009397920.1| PREDICTED: uncharacterized protein LOC103982660 [Musa acuminata 
subsp. malaccensis]
Length=477

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+QSGHWQNGIL   S      GSS   +HSKVLNAVQEA RA+EK
Sbjct  373  GRRQGLGMYTFRNGETQSGHWQNGILETLSTQSINLGSSIAVNHSKVLNAVQEARRASEK  432

Query  574  ANDVVKVDE  548
            A DV +VD+
Sbjct  433  AYDVPRVDD  441



>ref|XP_006396190.1| hypothetical protein EUTSA_v10028664mg [Eutrema salsugineum]
 gb|ESQ37643.1| hypothetical protein EUTSA_v10028664mg [Eutrema salsugineum]
Length=441

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTG-SSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNGIL++ S   T    S    +HSKVLNAVQEA RAAE
Sbjct  333  GRRQGLGMYTFRNGETQSGHWQNGILDIPSTQNTTCPVSPVAVNHSKVLNAVQEARRAAE  392

Query  577  KANDVVKVDE  548
            KA DV KVDE
Sbjct  393  KAYDVDKVDE  402



>ref|XP_008229489.1| PREDICTED: uncharacterized protein LOC103328863 [Prunus mume]
Length=423

 Score = 94.4 bits (233),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QG G YTFR+GE+QSGHWQNG+L++ S   T  GS    +H++VLNAVQEA RAAE+
Sbjct  322  GRKQGLGMYTFRSGETQSGHWQNGVLDIPSVQNTHPGSPRAVNHARVLNAVQEAQRAAER  381

Query  574  ANDVVKVDE  548
            A +V KVDE
Sbjct  382  AYEVAKVDE  390



>ref|XP_008457162.1| PREDICTED: uncharacterized protein LOC103496903 [Cucumis melo]
Length=512

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 83/112 (74%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAP-GTRTGSSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YT+RNGE+QSGHWQNG+L+V S    T   S     HSKVLNAVQEA RAAE
Sbjct  401  GRRQGLGMYTYRNGETQSGHWQNGVLDVPSTQNSTYPVSPVAVYHSKVLNAVQEARRAAE  460

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAVA AN+AA AARV A+KAVQ QM    N+ N+PV +V
Sbjct  461  KAYDVGKVDERVNRAVAAANRAANAARVAAIKAVQKQMQRGRNNDNMPVTVV  512



>ref|XP_008232333.1| PREDICTED: uncharacterized protein LOC103331490 [Prunus mume]
Length=481

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 83/112 (74%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAP-GTRTGSSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFR GE+Q+GHWQNG+L+V S    T   S    +HSKVLNAVQEA   AE
Sbjct  370  GRRQGLGMYTFRTGETQAGHWQNGVLDVPSTQNATYPVSPVAVNHSKVLNAVQEARIVAE  429

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAV  AN+AA AARV AVKAVQ QM H+++  ++P+PI+
Sbjct  430  KAYDVAKVDERVNRAVTAANRAANAARVAAVKAVQKQMQHNSSSDSIPIPIL  481



>gb|KFK30579.1| hypothetical protein AALP_AA6G000100 [Arabis alpina]
Length=413

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 81/112 (72%), Gaps = 4/112 (4%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTG-SSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNGIL++ S   T    S    +HSKVLNAVQEA RAAE
Sbjct  305  GRRQGLGMYTFRNGETQSGHWQNGILDIPSTQNTTCPVSPVAVNHSKVLNAVQEARRAAE  364

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAVA AN+AA AAR+ AVKA Q Q     N  N P+P+V
Sbjct  365  KAYDVDKVDERVNRAVAAANRAANAARLVAVKAAQKQ---SRNMDNFPIPVV  413



>ref|XP_007217941.1| hypothetical protein PRUPE_ppa005007mg [Prunus persica]
 gb|EMJ19140.1| hypothetical protein PRUPE_ppa005007mg [Prunus persica]
Length=482

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 83/112 (74%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAP-GTRTGSSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFR GE+Q+GHWQNG+L+V S    T   S    +HSKVLNAVQEA   AE
Sbjct  371  GRRQGLGMYTFRTGETQAGHWQNGVLDVPSTQNATYPVSPVAVNHSKVLNAVQEARIVAE  430

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAV  AN+AA AARV AVKAVQ QM H+++  ++P+PI+
Sbjct  431  KAYDVAKVDERVNRAVTAANRAANAARVAAVKAVQKQMQHNSSSDSIPIPIL  482



>ref|XP_006287531.1| hypothetical protein CARUB_v10000737mg [Capsella rubella]
 gb|EOA20429.1| hypothetical protein CARUB_v10000737mg [Capsella rubella]
Length=514

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTG-SSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNGIL++ S   T    S    +HSKVLNAVQEA RAAE
Sbjct  406  GRRQGLGMYTFRNGETQSGHWQNGILDIPSTQNTTCPISPVAVNHSKVLNAVQEARRAAE  465

Query  577  KANDVVKVDE  548
            KA DV KVDE
Sbjct  466  KAYDVDKVDE  475



>ref|XP_002517506.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45048.1| conserved hypothetical protein [Ricinus communis]
Length=403

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 81/111 (73%), Gaps = 1/111 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+QSGHWQNG+L+V     + + S     HSKVLNAVQEA RAAEK
Sbjct  294  GRRQGLGMYTFRNGEAQSGHWQNGVLDVPVLQDSLSKSLYAVSHSKVLNAVQEARRAAEK  353

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            A  V KVD+R+ + VA ANKAA A+RV AVKAVQ QM+H++N    P P V
Sbjct  354  AYGVAKVDDRINKTVAAANKAANASRVAAVKAVQVQMYHNSND-GAPTPFV  403



>ref|XP_004138932.1| PREDICTED: uncharacterized protein LOC101207479 [Cucumis sativus]
 gb|KGN61426.1| hypothetical protein Csa_2G120920 [Cucumis sativus]
Length=509

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 83/112 (74%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAP-GTRTGSSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YT+RNGE+QSGHWQNG+L++ S    T   S     HSKVLNAVQEA RAAE
Sbjct  398  GRRQGLGMYTYRNGETQSGHWQNGVLDIPSTQNSTYPVSPVAVYHSKVLNAVQEARRAAE  457

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAVA AN+AA AARV A+KAVQ QM    N+ N+PV +V
Sbjct  458  KAYDVGKVDERVNRAVAAANRAANAARVAAIKAVQKQMQRGRNNDNMPVTVV  509



>ref|XP_004515310.1| PREDICTED: uncharacterized protein LOC101504469 [Cicer arietinum]
Length=431

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 84/112 (75%), Gaps = 2/112 (2%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAP-GTRTGSSATDDHSKVLNAVQEAIRAAE  578
            G+RQG G YTFRNGE+QSGHWQNG L+V S    T   S    +HS+VLN VQEA RAAE
Sbjct  321  GKRQGLGMYTFRNGETQSGHWQNGGLDVPSTQNATYPVSPVGVNHSRVLNVVQEARRAAE  380

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAV+ AN+AA AAR+ AVKAVQ +MHH NN  N+P+ ++
Sbjct  381  KAYDVAKVDERVNRAVSAANRAANAARLAAVKAVQKEMHHANND-NIPISVL  431



>ref|XP_007209170.1| hypothetical protein PRUPE_ppa006178mg [Prunus persica]
 gb|EMJ10369.1| hypothetical protein PRUPE_ppa006178mg [Prunus persica]
Length=423

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QG G YTFR+GE+QSGHWQNG+L + S   T  GS    +H++VLNAVQEA RAAE+
Sbjct  322  GRKQGLGMYTFRSGETQSGHWQNGVLGIPSVQNTHPGSPRAVNHARVLNAVQEAQRAAER  381

Query  574  ANDVVKVDE  548
            A +V KVDE
Sbjct  382  AYEVAKVDE  390



>ref|XP_009759540.1| PREDICTED: uncharacterized protein LOC104212054 [Nicotiana sylvestris]
Length=523

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 83/114 (73%), Gaps = 7/114 (6%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDD----HSKVLNAVQEAIR  587
            G+RQG G YTFRNGE+Q GHWQNG+L++   P T+  S         HSKVLN VQEA R
Sbjct  412  GKRQGLGMYTFRNGETQCGHWQNGVLDI---PSTQNASYPVSPVAVYHSKVLNGVQEARR  468

Query  586  AAEKANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPI  425
            AAE+A DV KVDERV RAVA AN+AA AARV AVKA+Q QMH  +N  ++P+P+
Sbjct  469  AAERAYDVAKVDERVGRAVAAANRAANAARVAAVKAMQKQMHRRSNSDDLPIPV  522



>ref|XP_010419521.1| PREDICTED: uncharacterized protein LOC104705253 [Camelina sativa]
Length=425

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 79/112 (71%), Gaps = 4/112 (4%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTG-SSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNGIL++ S   T    S    +HSKVLNAVQEA RAAE
Sbjct  317  GRRQGLGMYTFRNGETQSGHWQNGILDIPSTQNTTFPISPVAVNHSKVLNAVQEARRAAE  376

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAVA AN AA AARV A KA Q Q     N  N P+P+V
Sbjct  377  KAYDVDKVDERVNRAVAAANTAANAARVAAFKAAQKQ---SKNMDNFPIPVV  425



>ref|XP_010426436.1| PREDICTED: uncharacterized protein LOC104711430 [Camelina sativa]
Length=425

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 79/112 (71%), Gaps = 4/112 (4%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTG-SSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNGIL++ S   T    S    +HSKVLNAVQEA RAAE
Sbjct  317  GRRQGLGMYTFRNGETQSGHWQNGILDIPSTQNTTFPISPVAVNHSKVLNAVQEARRAAE  376

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAVA AN AA AARV A KA Q Q     N  N P+P+V
Sbjct  377  KAYDVDKVDERVNRAVAAANTAANAARVAAFKAAQKQ---SKNMDNFPIPVV  425



>gb|KHG29647.1| Phosphatidylinositol-4-phosphate 5-kinase 8 -like protein [Gossypium 
arboreum]
Length=509

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 80/106 (75%), Gaps = 7/106 (7%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDD----HSKVLNAVQEAIR  587
            GRRQG G YTFR+GE+QSGHWQNGIL+V   P TR  +         HSKVLNAVQEA R
Sbjct  402  GRRQGLGMYTFRSGETQSGHWQNGILDV---PSTRNNTYPVSPVAVYHSKVLNAVQEARR  458

Query  586  AAEKANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNN  449
            AAEKA DV KVDERV +AVA+AN AA AARV AVKAVQ QM H++N
Sbjct  459  AAEKAYDVAKVDERVNKAVASANGAANAARVIAVKAVQKQMDHNHN  504



>gb|KHN01642.1| Phosphatidylinositol-4-phosphate 5-kinase 5 [Glycine soja]
Length=365

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q GHWQNGIL+      + TGS    DH+KV NAVQ+A  AAEK
Sbjct  261  GRRQGLGMYTFRNGETQCGHWQNGILDDPKRHNSPTGSPCAVDHAKVFNAVQDAHSAAEK  320

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNN  449
            A ++ KVD+ V + VA ANKAA  AR  AVKAVQN+MHH+N+
Sbjct  321  AYNMAKVDDGVNKVVAVANKAANTARDAAVKAVQNRMHHNNS  362



>gb|KJB24907.1| hypothetical protein B456_004G167400 [Gossypium raimondii]
Length=509

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 80/103 (78%), Gaps = 1/103 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAP-GTRTGSSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFR+GE+QSGHWQNGIL+V S    T   S     HSKVLNAVQEA RAAE
Sbjct  402  GRRQGLGMYTFRSGETQSGHWQNGILDVPSTRNNTYPVSPVAVYHSKVLNAVQEARRAAE  461

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNN  449
            KA DV KVDERV +AVA+AN+AA AARV AVKAVQ QM H++N
Sbjct  462  KAYDVAKVDERVNKAVASANRAANAARVIAVKAVQKQMDHNHN  504



>ref|XP_010456343.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 9-like [Camelina 
sativa]
Length=417

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 79/112 (71%), Gaps = 4/112 (4%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAP-GTRTGSSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNGIL++ S    T   S    +HSKVLNAVQEA RAAE
Sbjct  309  GRRQGLGMYTFRNGETQSGHWQNGILDIPSTQNSTFPISPVAVNHSKVLNAVQEARRAAE  368

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAVA AN AA AAR+ A KA Q Q     N  N P+P+V
Sbjct  369  KAYDVDKVDERVNRAVAAANTAANAARLAAFKAAQKQ---SKNMDNFPIPVV  417



>gb|KHN01850.1| Phosphatidylinositol-4-phosphate 5-kinase 2 [Glycine soja]
Length=281

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 84/113 (74%), Gaps = 8/113 (7%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDD----HSKVLNAVQEAIR  587
            GRRQG G YTFRNGE+QSGHWQNG+L++   P TR  +S        +SKVLNAVQEA R
Sbjct  171  GRRQGLGMYTFRNGETQSGHWQNGVLDI---PSTRNTTSPVSPVGVYYSKVLNAVQEARR  227

Query  586  AAEKANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNH-FNVPV  431
            AAEKA D+ KVDE V RAVA +N+AA AARV AVKAVQ Q +H N+  F++PV
Sbjct  228  AAEKAYDMAKVDEGVNRAVAASNRAANAARVAAVKAVQKQNYHVNSESFSIPV  280



>ref|XP_004169332.1| PREDICTED: uncharacterized protein LOC101227932 [Cucumis sativus]
Length=509

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 83/112 (74%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAP-GTRTGSSATDDHSKVLNAVQEAIRAAE  578
            G+RQG G YT+RNGE+QSGHWQNG+L++ S    T   S     HSKVLNAVQEA RAAE
Sbjct  398  GKRQGLGMYTYRNGETQSGHWQNGVLDIPSTQNSTYPVSPVAVYHSKVLNAVQEARRAAE  457

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAVA AN+AA AARV A+KAVQ QM    N+ N+PV +V
Sbjct  458  KAYDVGKVDERVNRAVAAANRAANAARVAAIKAVQKQMQRGRNNDNMPVTVV  509



>gb|EMT04339.1| Phosphatidylinositol-4-phosphate 5-kinase 1 [Aegilops tauschii]
Length=257

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q+GHWQNG+L+  S      GS+   +HSKVLNAVQEA RA EK
Sbjct  149  GRRQGLGMYTFRNGETQAGHWQNGVLDTLSTQNIVPGSAIAVNHSKVLNAVQEARRATEK  208

Query  574  ANDVVKVDE  548
            A DV +VD+
Sbjct  209  AYDVPRVDD  217



>ref|XP_006345353.1| PREDICTED: uncharacterized protein LOC102580713 [Solanum tuberosum]
Length=482

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 78/103 (76%), Gaps = 7/103 (7%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDD----HSKVLNAVQEAIR  587
            GRRQG G YTFRNGE+QSGHWQNG+L++   P T+  S         HSKVLNAVQEA R
Sbjct  371  GRRQGLGMYTFRNGETQSGHWQNGVLDI---PSTQNNSYPVSPVAVYHSKVLNAVQEARR  427

Query  586  AAEKANDVVKVDErvkravatankaataarvtavkaVQNQMHH  458
            AAE+A DV KVDERV RAV+ ANKAA AARV AVKAVQ QMHH
Sbjct  428  AAERAYDVAKVDERVNRAVSAANKAANAARVAAVKAVQKQMHH  470



>ref|NP_001131541.1| hypothetical protein [Zea mays]
 gb|ACF79985.1| unknown [Zea mays]
 gb|AFW87830.1| hypothetical protein ZEAMMB73_398803 [Zea mays]
Length=171

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G Y+FRNGE+Q+GHWQNG+L+         GS    +HSKVLNAVQEA RAAEK
Sbjct  63   GRRQGLGMYSFRNGETQAGHWQNGVLDTLCTQNFIPGSPIAVNHSKVLNAVQEARRAAEK  122

Query  574  ANDVVKVDE  548
            A D+ +VD+
Sbjct  123  AYDIPRVDD  131



>gb|AFW87832.1| hypothetical protein ZEAMMB73_398803 [Zea mays]
Length=236

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G Y+FRNGE+Q+GHWQNG+L+         GS    +HSKVLNAVQEA RAAEK
Sbjct  128  GRRQGLGMYSFRNGETQAGHWQNGVLDTLCTQNFIPGSPIAVNHSKVLNAVQEARRAAEK  187

Query  574  ANDVVKVDE  548
            A D+ +VD+
Sbjct  188  AYDIPRVDD  196



>gb|KJB37661.1| hypothetical protein B456_006G214800 [Gossypium raimondii]
Length=520

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 81/110 (74%), Gaps = 10/110 (9%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQGFGTYTFRNGE+QSGHWQNG L+V SA  TR          +VL AVQEA RAAEK
Sbjct  420  GRRQGFGTYTFRNGEAQSGHWQNGALDVLSAQNTR---------PRVLQAVQEAWRAAEK  470

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPI  425
            A DV K+D+RV +AV+ ANKAA AARV AVKAVQ QMHH N+   +P  I
Sbjct  471  ARDVAKIDKRVHKAVSAANKAANAARVVAVKAVQKQMHHHNSE-EIPTVI  519



>ref|XP_009389271.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 5-like [Musa 
acuminata subsp. malaccensis]
Length=478

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+QSGHWQNG+L+  S       S    +HSKVLNAVQEA RAAEK
Sbjct  370  GRRQGLGMYTFRNGETQSGHWQNGVLDTLSTQSINLASPVAVNHSKVLNAVQEARRAAEK  429

Query  574  ANDVVKVDE  548
            A DV +VD+
Sbjct  430  AYDVPRVDD  438



>ref|XP_007155725.1| hypothetical protein PHAVU_003G226200g [Phaseolus vulgaris]
 gb|ESW27719.1| hypothetical protein PHAVU_003G226200g [Phaseolus vulgaris]
Length=548

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q GHWQNGIL+        TGS    DH+KV NAVQ+A  AAEK
Sbjct  443  GRRQGLGMYTFRNGETQCGHWQNGILDDPKGHNNPTGSPCDVDHAKVSNAVQDAHSAAEK  502

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNN  449
            A  +VKVD+R+ + +A ANKAA A RV AVKAVQN+MHH+NN
Sbjct  503  AYSMVKVDDRMNKVIAAANKAANAGRVAAVKAVQNRMHHNNN  544



>ref|XP_003549957.1| PREDICTED: MORN repeat-containing protein 1-like [Glycine max]
Length=433

 Score = 91.7 bits (226),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q GHWQNGIL+      + TGS    DH+KV NAVQ+A  AAEK
Sbjct  329  GRRQGLGMYTFRNGETQCGHWQNGILDDPKRHNSPTGSPCAVDHAKVFNAVQDAHSAAEK  388

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNN  449
            A ++ KVD+ V + VA ANKAA  AR  AVKAVQN+MHH+N+
Sbjct  389  AYNMAKVDDGVNKVVAAANKAANTARDAAVKAVQNRMHHNNS  430



>ref|XP_004248983.1| PREDICTED: uncharacterized protein LOC101257910 [Solanum lycopersicum]
Length=489

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 78/103 (76%), Gaps = 7/103 (7%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDD----HSKVLNAVQEAIR  587
            GRRQG G YTFRNGE+QSGHWQNG+L++   P T+  S         HSKVLNAVQEA R
Sbjct  378  GRRQGLGMYTFRNGETQSGHWQNGVLDI---PSTQNNSYHVSPVAVYHSKVLNAVQEARR  434

Query  586  AAEKANDVVKVDErvkravatankaataarvtavkaVQNQMHH  458
            AAE+A DV KVDERV RAV+ ANKAA AARV AVKAVQ QMHH
Sbjct  435  AAERAYDVAKVDERVNRAVSAANKAANAARVAAVKAVQKQMHH  477



>emb|CDX76579.1| BnaA08g08210D [Brassica napus]
Length=446

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q+GHW +G+L+  +   TR GSS +  HSKVL+ VQ+A +AAEK
Sbjct  340  GRRQGLGMYTFRNGETQAGHWDDGVLSCPTEQSTRPGSSFSISHSKVLDTVQQARKAAEK  399

Query  574  ANDVVKVDE  548
            A++VVKV+E
Sbjct  400  AHEVVKVEE  408



>ref|XP_009108293.1| PREDICTED: uncharacterized protein LOC103833992 [Brassica rapa]
Length=449

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q+GHW +G+L+  +   TR GSS +  HSKVL+ VQ+A +AAEK
Sbjct  343  GRRQGLGMYTFRNGETQAGHWDDGVLSCPTEQSTRPGSSFSISHSKVLDTVQQARKAAEK  402

Query  574  ANDVVKVDE  548
            A++VVKV+E
Sbjct  403  AHEVVKVEE  411



>dbj|BAJ85961.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08171.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q+GHWQNG+L+  S      GS+   +HSKVLNAVQEA RA EK
Sbjct  361  GRRQGLGMYTFRNGETQAGHWQNGVLDTLSTQNIVPGSAIAVNHSKVLNAVQEARRATEK  420

Query  574  ANDVVKVDE  548
            A DV +VD+
Sbjct  421  AYDVPRVDD  429



>ref|NP_001065416.1| Os10g0565000 [Oryza sativa Japonica Group]
 gb|AAG60194.1|AC084763_14 putative phosphatidylinositol-4-phosphate 5-kinase [Oryza sativa 
Japonica Group]
 gb|AAP55050.1| ICE-like protease p20 domain containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27253.1| Os10g0565000 [Oryza sativa Japonica Group]
Length=467

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q+GHWQNG+L+  S      GS    +HSKVLNAVQEA RAAE+
Sbjct  359  GRRQGLGMYTFRNGETQAGHWQNGVLDTLSTQNIIPGSPIAVNHSKVLNAVQEARRAAER  418

Query  574  ANDVVKVDE  548
            A DV +VD+
Sbjct  419  AYDVPRVDD  427



>gb|KEH17938.1| MORN repeat protein [Medicago truncatula]
Length=458

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 83/112 (74%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAP-GTRTGSSATDDHSKVLNAVQEAIRAAE  578
            G+R G G YTFRNGE+QSGHW+NG+L++ S    T   S    +HS+VLN VQEA RAAE
Sbjct  347  GKRHGLGMYTFRNGETQSGHWRNGVLDIPSTQNATYPVSPVGVNHSRVLNTVQEARRAAE  406

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV R+V+ AN+AA AARV AVKAVQN+MHH  N  +  +P++
Sbjct  407  KAYDVAKVDERVNRSVSAANRAANAARVAAVKAVQNEMHHHVNEESFRIPVL  458



>ref|NP_001152273.1| ICE-like protease p20 domain containing protein [Zea mays]
 gb|ACG46734.1| ICE-like protease p20 domain containing protein [Zea mays]
 tpg|DAA46348.1| TPA: ICE-like protease p20 domain containing protein [Zea mays]
Length=454

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G Y+FRNGE+Q+GHWQNG+L+  S      GS    +HSKVLNAVQEA RAAEK
Sbjct  346  GRRQGLGMYSFRNGETQAGHWQNGVLDTLSTQNFIPGSPIAVNHSKVLNAVQEARRAAEK  405

Query  574  ANDVVKVDE  548
            A D+ +VD+
Sbjct  406  AYDIPRVDD  414



>ref|XP_006586203.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 5-like isoform 
X1 [Glycine max]
Length=452

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 54/73 (74%), Gaps = 7/73 (10%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDD----HSKVLNAVQEAIR  587
            GRRQG G YTFRNGE+QSGHWQNG+L++   P TR  +S        +SKVLNAVQEA R
Sbjct  342  GRRQGLGMYTFRNGETQSGHWQNGVLDI---PSTRNTTSPVSPVGVYYSKVLNAVQEARR  398

Query  586  AAEKANDVVKVDE  548
            AAEKA D+ KVDE
Sbjct  399  AAEKAYDMAKVDE  411



>ref|XP_003517913.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 4-like [Glycine 
max]
Length=453

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 83/110 (75%), Gaps = 2/110 (2%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATD-DHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+QSGHWQNG+L++ S   T +  S     HSKVLNAVQEA +AAE
Sbjct  343  GRRQGLGMYTFRNGETQSGHWQNGVLDILSTQNTTSPVSPVGVYHSKVLNAVQEARQAAE  402

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNH-FNVPV  431
            KA D+ KVDE V RAVA +N+AA AARV AVKAVQ Q +H N+  F++PV
Sbjct  403  KAYDMAKVDEGVNRAVAASNRAANAARVAAVKAVQKQNYHVNSESFSIPV  452



>ref|XP_004147244.1| PREDICTED: uncharacterized protein LOC101208169 [Cucumis sativus]
 gb|KGN55811.1| hypothetical protein Csa_3G017050 [Cucumis sativus]
Length=422

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            G RQG G YTFRNGE+QSGHWQNG+L+V S   +  GSS    H+KVL AVQEA RAAEK
Sbjct  313  GNRQGLGVYTFRNGETQSGHWQNGVLDVPSLETSHPGSSYAVSHAKVLAAVQEARRAAEK  372

Query  574  ANDVVKVDE  548
            A D  +VDE
Sbjct  373  AFDAGRVDE  381



>ref|XP_009398482.1| PREDICTED: uncharacterized protein LOC103983061 [Musa acuminata 
subsp. malaccensis]
Length=495

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            G+RQG G YTFRNGE+QSGHWQNG+L   S   T  GS    +HSKVLNAVQEA RAAE 
Sbjct  387  GKRQGLGMYTFRNGETQSGHWQNGLLETLSTQSTNPGSPIAVNHSKVLNAVQEARRAAET  446

Query  574  ANDVVKVDE  548
            A D  KVD+
Sbjct  447  AYDAPKVDD  455



>ref|XP_002879535.1| hypothetical protein ARALYDRAFT_482483 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55794.1| hypothetical protein ARALYDRAFT_482483 [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q+GHW++GIL+ ++    R GSS T  HSKV++AV++A +AAEK
Sbjct  377  GRRQGLGMYTFRNGETQAGHWEDGILSCATEQTIRPGSSFTISHSKVVDAVEKARKAAEK  436

Query  574  ANDVVKVDE  548
            A++VVKV+E
Sbjct  437  AHEVVKVEE  445



>gb|ABG66264.1| ICE-like protease p20 domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=685

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q+GHWQNG+L+  S      GS    +HSKVLNAVQEA RAAE+
Sbjct  299  GRRQGLGMYTFRNGETQAGHWQNGVLDTLSTQNIIPGSPIAVNHSKVLNAVQEARRAAER  358

Query  574  ANDVVKVDE  548
            A DV +VD+
Sbjct  359  AYDVPRVDD  367



>ref|XP_002467471.1| hypothetical protein SORBIDRAFT_01g028730 [Sorghum bicolor]
 gb|EER94469.1| hypothetical protein SORBIDRAFT_01g028730 [Sorghum bicolor]
Length=455

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G Y+FRNGE+Q+GHWQNG+L+  S      GS    +HSKVLNAVQEA RAAEK
Sbjct  347  GRRQGLGMYSFRNGETQAGHWQNGVLDTLSTQNFVPGSPIAVNHSKVLNAVQEARRAAEK  406

Query  574  ANDVVKVDE  548
            A D+ +VD+
Sbjct  407  AYDIPRVDD  415



>gb|KFK29388.1| hypothetical protein AALP_AA7G127000 [Arabis alpina]
Length=473

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG GTYTFRNGE+++G W++G+L+ +S P    GSS T  HSKV++AV++A +AAEK
Sbjct  365  GRRQGLGTYTFRNGETEAGQWEDGVLSCASEPAVHPGSSFTISHSKVVDAVEKARKAAEK  424

Query  574  ANDVVKVDE  548
            A +VVKV+E
Sbjct  425  AREVVKVEE  433



>ref|XP_010692008.1| PREDICTED: uncharacterized protein LOC104905241 [Beta vulgaris 
subsp. vulgaris]
Length=541

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 51/70 (73%), Gaps = 1/70 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTG-SSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+Q+GHW NGIL+V S        S    +HSKVLNAVQEA RAAE
Sbjct  429  GRRQGLGMYTFRNGETQAGHWHNGILDVPSTQNAACPVSPVAVNHSKVLNAVQEARRAAE  488

Query  577  KANDVVKVDE  548
            KA DV KVDE
Sbjct  489  KAYDVAKVDE  498



>emb|CDY67767.1| BnaCnng56290D [Brassica napus]
Length=503

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q+GHW+NG+L+  +   TR  SS +  HSKVL+ VQ+A +AAEK
Sbjct  396  GRRQGLGMYTFRNGETQAGHWENGVLSCPTEQTTRPDSSFSISHSKVLDTVQQARKAAEK  455

Query  574  ANDVVKVDE  548
            A +VVKV+E
Sbjct  456  AREVVKVEE  464



>gb|ACK37362.1| MORN [Brassica rapa subsp. pekinensis]
Length=502

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q+GHW+NG+L+  +   TR  SS +  HSKVL+ VQ+A +AAEK
Sbjct  395  GRRQGLGMYTFRNGETQAGHWENGVLSCPTEQTTRPDSSFSISHSKVLDTVQQARKAAEK  454

Query  574  ANDVVKVDE  548
            A +VVKV+E
Sbjct  455  AREVVKVEE  463



>ref|XP_009145206.1| PREDICTED: uncharacterized protein LOC103868899 [Brassica rapa]
Length=502

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q+GHW+NG+L+  +   TR  SS +  HSKVL+ VQ+A +AAEK
Sbjct  395  GRRQGLGMYTFRNGETQAGHWENGVLSCPTEQTTRPDSSFSISHSKVLDTVQQARKAAEK  454

Query  574  ANDVVKVDE  548
            A +VVKV+E
Sbjct  455  AREVVKVEE  463



>emb|CDY35600.1| BnaC01g21220D [Brassica napus]
Length=496

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q+GHW+NG+L+  +   TR  SS +  HSKVL+ VQ+A +AAEK
Sbjct  389  GRRQGLGMYTFRNGETQAGHWENGVLSCPTEQTTRPDSSFSISHSKVLDTVQQARKAAEK  448

Query  574  ANDVVKVDE  548
            A +VVKV+E
Sbjct  449  AREVVKVEE  457



>ref|XP_006294081.1| hypothetical protein CARUB_v10023076mg [Capsella rubella]
 gb|EOA26979.1| hypothetical protein CARUB_v10023076mg [Capsella rubella]
Length=474

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFR GE+Q+GHW++GIL+ +S    R GSS T  HSKV++ V++A +AAEK
Sbjct  366  GRRQGLGMYTFRTGETQAGHWEDGILSCASEQTIRPGSSFTISHSKVVDTVEQARKAAEK  425

Query  574  ANDVVKVDE  548
            A+DVVKV+E
Sbjct  426  AHDVVKVEE  434



>ref|XP_008802516.1| PREDICTED: uncharacterized protein LOC103716338 [Phoenix dactylifera]
Length=464

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+QSGHWQNG+L++ S      GSS   +HSKVLN VQEA RAA K
Sbjct  348  GRRQGLGMYTFRNGETQSGHWQNGVLDIFSTQNILPGSSIAVNHSKVLNTVQEARRAAGK  407

Query  574  ANDVVKVDE  548
            A DV  VD+
Sbjct  408  AFDVPWVDD  416



>ref|XP_010933554.1| PREDICTED: uncharacterized protein LOC105053912 [Elaeis guineensis]
Length=504

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 84/111 (76%), Gaps = 2/111 (2%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+QSGHWQNG+L+  S   +   S    +HS++LNAVQEA RAAEK
Sbjct  396  GRRQGLGMYTFRNGETQSGHWQNGVLDTLSTQNSVPISPIAVNHSRILNAVQEARRAAEK  455

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            A DV +VD+RV +AVA ANKAA AARV AVKAVQ ++   NN  ++P+PIV
Sbjct  456  AYDVPRVDDRVNKAVAAANKAANAARVAAVKAVQKRI--PNNGDDIPIPIV  504



>ref|XP_006294082.1| hypothetical protein CARUB_v10023076mg [Capsella rubella]
 gb|EOA26980.1| hypothetical protein CARUB_v10023076mg [Capsella rubella]
Length=496

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFR GE+Q+GHW++GIL+ +S    R GSS T  HSKV++ V++A +AAEK
Sbjct  388  GRRQGLGMYTFRTGETQAGHWEDGILSCASEQTIRPGSSFTISHSKVVDTVEQARKAAEK  447

Query  574  ANDVVKVDE  548
            A+DVVKV+E
Sbjct  448  AHDVVKVEE  456



>ref|XP_004986799.1| PREDICTED: metacaspase-1-like, partial [Setaria italica]
Length=678

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G Y+FRNGE+Q+GHWQNG+L+  S      GS    +HSKVLNAVQEA RAAEK
Sbjct  218  GRRQGLGMYSFRNGETQAGHWQNGVLDTLSTQNFIPGSPIAVNHSKVLNAVQEARRAAEK  277

Query  574  ANDVVKVDE  548
            A D+ +VD+
Sbjct  278  AYDIPRVDD  286



>ref|XP_010235005.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 4 [Brachypodium 
distachyon]
Length=465

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q+GHWQNG+L+  S      GS    +HSKVLNAVQEA RA E+
Sbjct  357  GRRQGLGMYTFRNGETQAGHWQNGVLDTLSTQNFIPGSPIAVNHSKVLNAVQEARRATER  416

Query  574  ANDVVKVDE  548
            A DV +VD+
Sbjct  417  AYDVPRVDD  425



>ref|XP_009370933.1| PREDICTED: uncharacterized protein LOC103960225 [Pyrus x bretschneideri]
Length=480

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 82/112 (73%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAP-GTRTGSSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+Q+GHWQNGIL+V S    T   S    +HSKVL AVQEA   +E
Sbjct  369  GRRQGLGMYTFRNGETQAGHWQNGILDVPSTQNATSPVSPIAVNHSKVLYAVQEARIVSE  428

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAV  AN+AA AARV+AVKAVQ QM H+ +  ++P+ IV
Sbjct  429  KAYDVAKVDERVNRAVTAANRAANAARVSAVKAVQKQMQHNTSSDHMPIQIV  480



>gb|ABG66263.1| ICE-like protease p20 domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=776

 Score = 90.9 bits (224),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 44/69 (64%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q+GHWQNG+L+  S      GS    +HSKVLNAVQEA RAAE+
Sbjct  299  GRRQGLGMYTFRNGETQAGHWQNGVLDTLSTQNIIPGSPIAVNHSKVLNAVQEARRAAER  358

Query  574  ANDVVKVDE  548
            A DV +VD+
Sbjct  359  AYDVPRVDD  367



>ref|XP_008658075.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW87831.1| hypothetical protein ZEAMMB73_398803 [Zea mays]
Length=454

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G Y+FRNGE+Q+GHWQNG+L+         GS    +HSKVLNAVQEA RAAEK
Sbjct  346  GRRQGLGMYSFRNGETQAGHWQNGVLDTLCTQNFIPGSPIAVNHSKVLNAVQEARRAAEK  405

Query  574  ANDVVKVDE  548
            A D+ +VD+
Sbjct  406  AYDIPRVDD  414



>ref|XP_006410676.1| hypothetical protein EUTSA_v10017682mg, partial [Eutrema salsugineum]
 gb|ESQ52129.1| hypothetical protein EUTSA_v10017682mg, partial [Eutrema salsugineum]
Length=491

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q+GHW++G+L+ +S    R GSS T  HS+V++AV +A +AAEK
Sbjct  418  GRRQGLGMYTFRNGETQAGHWEDGVLSCASEQTIRPGSSFTISHSRVIDAVDQARKAAEK  477

Query  574  ANDVVKVDE  548
            A +VVKV+E
Sbjct  478  AREVVKVEE  486



>ref|XP_009375380.1| PREDICTED: uncharacterized protein LOC103964205 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009375381.1| PREDICTED: uncharacterized protein LOC103964205 isoform X2 [Pyrus 
x bretschneideri]
Length=487

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 82/112 (73%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAP-GTRTGSSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YTFRNGE+Q+GHWQNG+L+V S        S    +HSKVLNAVQEA   +E
Sbjct  376  GRRQGLGMYTFRNGETQAGHWQNGVLDVPSTQNAIYPVSPVAVNHSKVLNAVQEARIVSE  435

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAV  AN+AA AARV AVKAVQ QM H+++  ++P+ IV
Sbjct  436  KAYDVAKVDERVNRAVTAANRAANAARVAAVKAVQKQMQHNSSSDHMPIQIV  487



>emb|CDY43465.1| BnaC08g10880D [Brassica napus]
Length=494

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q+GHW +G+L+  +   TR GSS +  HSKVL+ VQ+A +AAEK
Sbjct  360  GRRQGLGMYTFRNGETQAGHWDDGVLSCPTEQTTRPGSSFSISHSKVLDTVQQARKAAEK  419

Query  574  ANDVVKVDE  548
            A++ VKV+E
Sbjct  420  AHEAVKVEE  428



>ref|XP_004300305.1| PREDICTED: uncharacterized protein LOC101304099 [Fragaria vesca 
subsp. vesca]
Length=431

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QG GTYTFRNGE+QSGHWQNG+++  S   ++ GS    +H+KVLNAVQ+A RAAE+
Sbjct  322  GRKQGLGTYTFRNGETQSGHWQNGVID-PSMQNSQPGSPYAVNHAKVLNAVQDARRAAER  380

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            A +V KVDERVKR +ATANKAA AARV AVKAVQ Q+H  N+    P  +V
Sbjct  381  AYEVAKVDERVKRTIATANKAANAARVAAVKAVQKQIHQYNSDGTSPSQLV  431



>ref|XP_008382255.1| PREDICTED: uncharacterized protein LOC103445065 [Malus domestica]
Length=485

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 84/115 (73%), Gaps = 7/115 (6%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTG----SSATDDHSKVLNAVQEAIR  587
            GRRQG G YTFRNGE+Q+GHWQNG+L+V   P T+      S    +HSKVLNAVQEA  
Sbjct  374  GRRQGLGMYTFRNGETQAGHWQNGVLDV---PSTQNANFPVSPVAVNHSKVLNAVQEARI  430

Query  586  AAEKANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
             +EKA DV KVDERV RAV  AN+AA AARV AVKAVQ QM H+++  ++P+ IV
Sbjct  431  VSEKAYDVAKVDERVNRAVTAANRAANAARVAAVKAVQKQMQHNSSSDHMPIQIV  485



>ref|XP_008448763.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like [Cucumis 
melo]
Length=422

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            G RQG G YTFRNGE+QSGHWQNG+L+V S   +  GSS    H+KVL AVQEA RAAEK
Sbjct  313  GNRQGLGVYTFRNGETQSGHWQNGVLDVPSLEISHPGSSYAVSHAKVLAAVQEARRAAEK  372

Query  574  ANDVVKVDE  548
            A +  +VDE
Sbjct  373  AFNAGRVDE  381



>ref|XP_006283553.1| hypothetical protein CARUB_v10004606mg [Capsella rubella]
 gb|EOA16451.1| hypothetical protein CARUB_v10004606mg [Capsella rubella]
Length=513

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q+GHW++G+L+  +   TR  SS +  HSKVL+ VQ+A +AAEK
Sbjct  407  GRRQGLGMYTFRNGETQAGHWEDGVLSCPTEQTTRPDSSFSISHSKVLDTVQQARKAAEK  466

Query  574  ANDVVKVDE  548
            A +VVKV+E
Sbjct  467  AREVVKVEE  475



>ref|XP_002870123.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46382.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=512

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q+GHW++G+L+  +   TR  SS +  HSKVL+ VQ+A +AAEK
Sbjct  406  GRRQGLGMYTFRNGETQAGHWEDGVLSCPTEQTTRPDSSFSISHSKVLDTVQQARKAAEK  465

Query  574  ANDVVKVDE  548
            A +VVKV+E
Sbjct  466  AREVVKVEE  474



>ref|XP_010531739.1| PREDICTED: uncharacterized protein LOC104807969 [Tarenaya hassleriana]
Length=514

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q+GHW+NG+L+      TR GSS    H+KVL+ VQ+A +AAE+
Sbjct  405  GRRQGLGMYTFRNGETQAGHWENGVLSCPCEQTTRPGSSFYISHTKVLDTVQKARKAAER  464

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNN  449
            A +V +VDERVKRAV  AN+AATAARV +VKAVQ+Q+ HD++
Sbjct  465  AKEVGQVDERVKRAVMAANRAATAARVASVKAVQSQVFHDSS  506



>ref|NP_565799.1| histone H3 K4-specific methyltransferase SET7/9-like protein 
[Arabidopsis thaliana]
 gb|AAC61819.1| expressed protein [Arabidopsis thaliana]
 gb|AAL24213.1| At2g35170/T4C15.16 [Arabidopsis thaliana]
 gb|AAL90973.1| At2g35170/T4C15.16 [Arabidopsis thaliana]
 gb|AEC09076.1| histone H3 K4-specific methyltransferase SET7/9-like protein 
[Arabidopsis thaliana]
Length=484

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNG++Q+GHW++G+L+  +    R GSS T  HSKV++AV++A +AAEK
Sbjct  376  GRRQGLGMYTFRNGDTQAGHWEDGVLSCPTEQTIRPGSSFTISHSKVVDAVEQARKAAEK  435

Query  574  ANDVVKVDE  548
            A++VVKV+E
Sbjct  436  AHEVVKVEE  444



>ref|XP_010941015.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 5-like [Elaeis 
guineensis]
Length=465

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRR+G G YTFRNGE+QSGHWQNG+L++ S   T  GSS   +HSKVLN VQEA  AA K
Sbjct  349  GRREGLGMYTFRNGETQSGHWQNGVLDIFSTQNTLPGSSIAVNHSKVLNTVQEARTAAGK  408

Query  574  ANDVVKVDE  548
            A DV  VD+
Sbjct  409  AFDVPWVDD  417



>ref|XP_010516688.1| PREDICTED: uncharacterized protein LOC104792271 [Camelina sativa]
Length=485

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFR GE+Q+GHW++GIL+ +S    R GSS T  HSKV++ V++A +AAEK
Sbjct  377  GRRQGLGMYTFRTGETQAGHWEDGILSCASEQTIRPGSSFTISHSKVVDTVEQARKAAEK  436

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNN  449
            A++VVK++ER+KR V  AN+AA AARV AVKA Q Q  H NN
Sbjct  437  AHEVVKLEERIKRVVMAANRAANAARVAAVKAFQAQTFHRNN  478



>ref|XP_006838481.1| hypothetical protein AMTR_s00002p00155600 [Amborella trichopoda]
 gb|ERN01050.1| hypothetical protein AMTR_s00002p00155600 [Amborella trichopoda]
Length=496

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QG G YTFRNGE+QSGHWQNG L+  S   T  GS    +HSKVLNAVQEA  AAE+
Sbjct  381  GRKQGLGMYTFRNGETQSGHWQNGSLDTLSTQNTLPGSPIAINHSKVLNAVQEARWAAER  440

Query  574  ANDVVKVDE  548
            A +V  VDE
Sbjct  441  ALEVPPVDE  449



>emb|CAB10488.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB80979.1| hypothetical protein [Arabidopsis thaliana]
Length=471

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q+GHW++G+LN  +   TR  SS +  HSKV++ VQ+A +AA+K
Sbjct  365  GRRQGLGMYTFRNGETQAGHWEDGVLNCPTEQTTRPDSSFSISHSKVVDTVQQARKAAKK  424

Query  574  ANDVVKVDE  548
            A +VVKV+E
Sbjct  425  AREVVKVEE  433



>ref|NP_193441.5| Histone H3 K4-specific methyltransferase SET7/9 family protein 
[Arabidopsis thaliana]
 gb|AAM78092.1| AT4g17080/dl4570w [Arabidopsis thaliana]
 gb|AAO23593.1| At4g17080/dl4570w [Arabidopsis thaliana]
 gb|AEE83846.1| Histone H3 K4-specific methyltransferase SET7/9 family protein 
[Arabidopsis thaliana]
Length=513

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q+GHW++G+LN  +   TR  SS +  HSKV++ VQ+A +AA+K
Sbjct  407  GRRQGLGMYTFRNGETQAGHWEDGVLNCPTEQTTRPDSSFSISHSKVVDTVQQARKAAKK  466

Query  574  ANDVVKVDE  548
            A +VVKV+E
Sbjct  467  AREVVKVEE  475



>ref|XP_010440059.1| PREDICTED: uncharacterized protein LOC104723390 [Camelina sativa]
Length=515

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q+GHW++G+L+  +   TR  SS +  HSKVL+ VQ+A +AA+K
Sbjct  409  GRRQGLGMYTFRNGETQAGHWEDGVLSCPTEQTTRPDSSFSISHSKVLDTVQQARKAADK  468

Query  574  ANDVVKVDE  548
            A +VVKV+E
Sbjct  469  AREVVKVEE  477



>ref|XP_010434724.1| PREDICTED: uncharacterized protein LOC104718641 [Camelina sativa]
Length=517

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q+GHW++G+L+  +   TR  SS +  HSKVL+ VQ+A +AA+K
Sbjct  411  GRRQGLGMYTFRNGETQAGHWEDGVLSCPTEQTTRPDSSFSISHSKVLDTVQQARKAADK  470

Query  574  ANDVVKVDE  548
            A +VVKV+E
Sbjct  471  AREVVKVEE  479



>ref|XP_010509642.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 5-like isoform 
X1 [Camelina sativa]
 ref|XP_010509643.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 5-like isoform 
X2 [Camelina sativa]
 ref|XP_010509644.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 5-like isoform 
X3 [Camelina sativa]
 ref|XP_010509645.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 5-like isoform 
X4 [Camelina sativa]
Length=473

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFR GE+Q+GHW++GIL+ +S    R GSS T  HSKV++ V++A +AAE+
Sbjct  366  GRRQGLGMYTFRTGETQAGHWEDGILSCASEQTIRPGSSFTISHSKVVDTVEQARKAAER  425

Query  574  ANDVVKVDE  548
            A +VVKV+E
Sbjct  426  AKEVVKVEE  434



>gb|KFK26769.1| hypothetical protein AALP_AA8G291400 [Arabis alpina]
Length=465

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q+GHW++G+L+  +   TR  SS +  HSKVL+ VQ+A +AA+K
Sbjct  360  GRRQGLGMYTFRNGETQAGHWEDGVLSCPTEQTTRPDSSFSISHSKVLDTVQQARKAAKK  419

Query  574  ANDVVKVDE  548
            A +VVKV+E
Sbjct  420  AREVVKVEE  428



>ref|XP_010449670.1| PREDICTED: uncharacterized protein LOC104731870 [Camelina sativa]
Length=510

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q+GHW++G+L+  +   TR  SS +  HSKVL+ VQ+A +AA+K
Sbjct  404  GRRQGLGMYTFRNGETQAGHWEDGVLSCPTEQTTRPDSSFSISHSKVLDTVQQARKAADK  463

Query  574  ANDVVKVDE  548
            A +VVKV+E
Sbjct  464  AREVVKVEE  472



>ref|XP_008343830.1| PREDICTED: uncharacterized protein LOC103406614 [Malus domestica]
Length=488

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 81/112 (72%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAP-GTRTGSSATDDHSKVLNAVQEAIRAAE  578
            GRRQG G YT+RNGE+Q+GHWQNG+L+V S    T   S    +HSKVL AVQEA   +E
Sbjct  377  GRRQGLGMYTYRNGETQAGHWQNGVLDVPSTQNATSPVSPIAVNHSKVLYAVQEARIVSE  436

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            KA DV KVDERV RAV  AN+AA AARV AVKAVQ QM H+ +  ++P+ IV
Sbjct  437  KAYDVAKVDERVNRAVTAANRAANAARVXAVKAVQKQMQHNTSSDHMPIQIV  488



>ref|XP_004508974.1| PREDICTED: uncharacterized protein LOC101502494 [Cicer arietinum]
Length=423

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q GHWQNG L+      +  GS    DH+KVL AVQ+A  AAEK
Sbjct  318  GRRQGLGMYTFRNGETQYGHWQNGFLDNPKKQDSLVGSPCDVDHAKVLKAVQDAHCAAEK  377

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNN  449
            A  + K++E V + V  +NKAA AARV AVKAVQN MHH+NN
Sbjct  378  AYSMSKMEEMVNKVVTASNKAANAARVAAVKAVQNTMHHNNN  419



>ref|XP_008355543.1| PREDICTED: uncharacterized protein LOC103419206 [Malus domestica]
Length=428

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QGFG YTFRNGE+QSGHWQNG+L++  A  T+ GSS + +H+KVLNAVQEA RAAE+
Sbjct  329  GRKQGFGMYTFRNGETQSGHWQNGVLDIPXAQNTQPGSSYSANHAKVLNAVQEAQRAAER  388

Query  574  ANDVVKVDE  548
            A +  KV+E
Sbjct  389  AYEAAKVEE  397



>ref|XP_010110542.1| hypothetical protein L484_023376 [Morus notabilis]
 gb|EXC26760.1| hypothetical protein L484_023376 [Morus notabilis]
Length=644

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+QSGHWQNG L+  S       S    +H++VLNAVQEA +AAE+
Sbjct  350  GRRQGLGMYTFRNGETQSGHWQNGFLDGPSMQNPHPESPRAVNHARVLNAVQEARKAAER  409

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMHHDN  452
            A ++  +DERV +AVA ANKAA AARV AVKAVQ+QMH DN
Sbjct  410  AQNIALLDERVNKAVAAANKAANAARVAAVKAVQDQMHRDN  450



>ref|XP_010540793.1| PREDICTED: uncharacterized protein LOC104814452 [Tarenaya hassleriana]
Length=529

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE Q+GHW+NG+L+  S   TR GSS    H+KVL+A Q+A +A EK
Sbjct  424  GRRQGLGMYTFRNGEMQAGHWENGVLSCPSEQTTRPGSSFYISHTKVLDAAQKARKAGEK  483

Query  574  ANDVVKVDE  548
            A +V KV+E
Sbjct  484  AEEVGKVEE  492



>gb|EPS64865.1| hypothetical protein M569_09914, partial [Genlisea aurea]
Length=483

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 75/103 (73%), Gaps = 1/103 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTG-SSATDDHSKVLNAVQEAIRAAE  578
            G+RQG G Y+FRNGE+QSGHWQ G+L+V S   T    S    +HSKVLN VQEA RAA 
Sbjct  379  GKRQGLGMYSFRNGETQSGHWQAGVLDVPSTQTTAIPVSPVAVNHSKVLNVVQEARRAAA  438

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNN  449
            KA +V K+DERV RAVA AN++A  ARV AVKAVQ QMH  +N
Sbjct  439  KAYEVTKLDERVNRAVAAANRSANGARVAAVKAVQKQMHQQHN  481



>ref|XP_010053554.1| PREDICTED: junctophilin-3 [Eucalyptus grandis]
 gb|KCW77867.1| hypothetical protein EUGRSUZ_D021401 [Eucalyptus grandis]
Length=431

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 86/112 (77%), Gaps = 1/112 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTG-SSATDDHSKVLNAVQEAIRAAE  578
            G RQGFG Y+FR+GE+Q GHW  G+L+   +P    G +S+++ HSKVLNAVQEA RA+E
Sbjct  318  GIRQGFGMYSFRSGETQCGHWHKGVLDPPGSPSFAGGPNSSSNMHSKVLNAVQEARRASE  377

Query  577  KANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            +A++V KVDERV RA+A ANK+A AARV AVKAVQNQ++ D+   +  +P++
Sbjct  378  RAHEVGKVDERVNRAIAFANKSANAARVAAVKAVQNQVYQDHTPGDRALPVL  429



>gb|KEH31599.1| MORN repeat protein [Medicago truncatula]
Length=425

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 69/102 (68%), Gaps = 0/102 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q GHWQNGIL+      +  GS    DH+KV  AVQ+A  AAEK
Sbjct  322  GRRQGLGMYTFRNGETQCGHWQNGILDNPKKQDSHIGSPCAVDHAKVFKAVQDAHCAAEK  381

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNN  449
            A  + K DE V +  A ANKAA AARV AVKAVQN MH D N
Sbjct  382  AYGMSKKDEMVNKVAAAANKAANAARVAAVKAVQNSMHRDYN  423



>ref|XP_007133455.1| hypothetical protein PHAVU_011G180000g [Phaseolus vulgaris]
 gb|ESW05449.1| hypothetical protein PHAVU_011G180000g [Phaseolus vulgaris]
Length=446

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q GHWQNGIL+      +  GS    D++KV NAVQ+A  AAEK
Sbjct  341  GRRQGLGIYTFRNGETQCGHWQNGILDDPKRHNSPNGSPCDVDYAKVSNAVQDAHSAAEK  400

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNN  449
            A ++ KV++R+   VA ANKAA  ARV AVKA QN+MHH+ N
Sbjct  401  AYNMAKVEDRMNTVVAAANKAANTARVAAVKAEQNRMHHNYN  442



>ref|XP_002979292.1| hypothetical protein SELMODRAFT_177510, partial [Selaginella 
moellendorffii]
 gb|EFJ19700.1| hypothetical protein SELMODRAFT_177510, partial [Selaginella 
moellendorffii]
Length=279

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QG G YTFRNGE+Q+GHW  G L V S      GSS    H+KVLN VQEA RA +K
Sbjct  206  GRKQGLGLYTFRNGETQAGHWNCGALEVPSTLNPAPGSSTAVSHAKVLNVVQEARRAGKK  265

Query  574  ANDVVKVDE  548
            A DV +VD+
Sbjct  266  ALDVPRVDD  274



>emb|CDP13437.1| unnamed protein product [Coffea canephora]
Length=554

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQ  599
            GRRQGFGTYTFRNGE+QSGHW+NGILN SS  G  +GSS   D+SKVL+AVQ
Sbjct  441  GRRQGFGTYTFRNGETQSGHWENGILNASSIQGILSGSSVALDNSKVLHAVQ  492



>ref|XP_011093495.1| PREDICTED: uncharacterized protein LOC105173454 isoform X2 [Sesamum 
indicum]
Length=499

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTG-SSATDDHSKVLNAVQEAIRAAE  578
            GRRQG GTYTFRNG++QSGHWQNG L+V S   T    S    +H KVL+ VQEA + AE
Sbjct  396  GRRQGLGTYTFRNGDTQSGHWQNGSLDVPSTQSTTYPVSRIAVNHYKVLDIVQEAQQVAE  455

Query  577  KANDVVKVDE  548
            KA    K+DE
Sbjct  456  KAQAATKLDE  465



>ref|XP_011018672.1| PREDICTED: uncharacterized protein LOC105121640 [Populus euphratica]
Length=539

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 79/111 (71%), Gaps = 1/111 (1%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+QSGHWQNGIL+VS+       S     H KV+NAVQEA RAA K
Sbjct  430  GRRQGLGMYTFRNGETQSGHWQNGILDVSTVENGNPESPNAISHPKVVNAVQEAKRAAAK  489

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPVPIV  422
            A D  +++ERV + +A ANKAA AARV AVKAVQ QMHH N+  +V  P V
Sbjct  490  ACDAARIEERVNKTIAHANKAANAARVAAVKAVQRQMHHQNSD-DVATPFV  539



>ref|XP_006586204.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 5-like isoform 
X2 [Glycine max]
Length=446

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 47/69 (68%), Gaps = 5/69 (7%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+QSGHWQNG+L++   P TR  +S         +  +EA RAAEK
Sbjct  342  GRRQGLGMYTFRNGETQSGHWQNGVLDI---PSTRNTTSPVSPVGVYYS--KEARRAAEK  396

Query  574  ANDVVKVDE  548
            A D+ KVDE
Sbjct  397  AYDMAKVDE  405



>ref|XP_006414274.1| hypothetical protein EUTSA_v10024873mg [Eutrema salsugineum]
 gb|ESQ55727.1| hypothetical protein EUTSA_v10024873mg [Eutrema salsugineum]
Length=537

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G YTFRNGE+Q+GHW++G+L+  +   TR  SS T  HSKVL+ VQ+A +AAEK
Sbjct  430  GRRQGLGMYTFRNGETQAGHWEDGVLSCPTEQTTRPDSSFTISHSKVLDTVQQARKAAEK  489

Query  574  ANDVVKVDE  548
            A  V KV+E
Sbjct  490  ARAVGKVEE  498



>ref|XP_004173045.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like, 
partial [Cucumis sativus]
Length=364

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQ  599
            G RQG G YTFRNGE+QSGHWQNG+L+V S   +  GSS    H+KVL AVQ
Sbjct  313  GNRQGLGVYTFRNGETQSGHWQNGVLDVPSLETSHPGSSYAVSHAKVLAAVQ  364



>ref|XP_010661418.1| PREDICTED: uncharacterized protein LOC100256437 isoform X3 [Vitis 
vinifera]
Length=452

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATD-DHSKVLNAVQEAI  590
            GRRQG G YTFRNGE+QSGHWQNGIL++ S   T    S     HSKVLN VQ  I
Sbjct  383  GRRQGLGMYTFRNGETQSGHWQNGILDIPSTQSTTYPVSPIAVYHSKVLNVVQWKI  438



>gb|KJB24908.1| hypothetical protein B456_004G167400 [Gossypium raimondii]
Length=485

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 39/56 (70%), Gaps = 7/56 (13%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDD----HSKVLNAVQ  599
            GRRQG G YTFR+GE+QSGHWQNGIL+V   P TR  +         HSKVLNAVQ
Sbjct  402  GRRQGLGMYTFRSGETQSGHWQNGILDV---PSTRNNTYPVSPVAVYHSKVLNAVQ  454



>ref|XP_011093496.1| PREDICTED: uncharacterized protein LOC105173454 isoform X3 [Sesamum 
indicum]
Length=493

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 46/70 (66%), Gaps = 7/70 (10%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKV-LNAVQEAIRAAE  578
            GRRQG GTYTFRNG++QSGHWQNG L+V S        S T   S++ +N  +EA + AE
Sbjct  396  GRRQGLGTYTFRNGDTQSGHWQNGSLDVPST------QSTTYPVSRIAVNHYKEAQQVAE  449

Query  577  KANDVVKVDE  548
            KA    K+DE
Sbjct  450  KAQAATKLDE  459



>gb|KJB37663.1| hypothetical protein B456_006G214800 [Gossypium raimondii]
Length=467

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 37/52 (71%), Gaps = 9/52 (17%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQ  599
            GRRQGFGTYTFRNGE+QSGHWQNG L+V SA  TR          +VL AVQ
Sbjct  420  GRRQGFGTYTFRNGEAQSGHWQNGALDVLSAQNTRP---------RVLQAVQ  462



>gb|KJB37664.1| hypothetical protein B456_006G214800 [Gossypium raimondii]
Length=466

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 37/52 (71%), Gaps = 9/52 (17%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQ  599
            GRRQGFGTYTFRNGE+QSGHWQNG L+V SA  TR          +VL AVQ
Sbjct  420  GRRQGFGTYTFRNGEAQSGHWQNGALDVLSAQNTRP---------RVLQAVQ  462



>ref|XP_006421571.1| hypothetical protein CICLE_v10007199mg [Citrus clementina]
 gb|ESR34811.1| hypothetical protein CICLE_v10007199mg [Citrus clementina]
Length=77

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPG-TRTGSSATDDHSKVLNAVQEA  593
            G RQG G Y FRNGE+QSGH QNG+L++ SA   T   SS    H KVLN VQEA
Sbjct  22   GIRQGLGMYRFRNGETQSGHRQNGLLDIPSAQNTTHLISSIAIYHYKVLNVVQEA  76



>ref|XP_006442762.1| hypothetical protein CICLE_v10023356mg, partial [Citrus clementina]
 gb|ESR56002.1| hypothetical protein CICLE_v10023356mg, partial [Citrus clementina]
Length=293

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 68/115 (59%), Gaps = 11/115 (10%)
 Frame = -2

Query  742  GFGTYTFRNGESQSGHW----------QNGILNVSSAPGT-RTGSSATDDHSKVLNAVQE  596
            GF  Y F NG    G W          QNGI+++ S   T    S     HSKVLNA+ E
Sbjct  176  GFSVYCFANGHWYGGVWHEGVRQGLGMQNGIIDIPSTQNTTHPVSPIAVYHSKVLNAMHE  235

Query  595  AIRAAEKANDVVKVDErvkravatankaataarvtavkaVQNQMHHDNNHFNVPV  431
            A +AAEKANDV ++DE+V RAVA AN A  AARV   KAVQ QMHH NN  ++P+
Sbjct  236  ARQAAEKANDVARIDEKVNRAVAAANNAINAARVAVFKAVQKQMHHSNNKDSIPL  290



>gb|KCW77868.1| hypothetical protein EUGRSUZ_D021401 [Eucalyptus grandis]
Length=411

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGS-SATDDHSKVLNAVQE  596
            G RQGFG Y+FR+GE+Q GHW  G+L+   +P    G  S+++ HSKVLNAVQE
Sbjct  318  GIRQGFGMYSFRSGETQCGHWHKGVLDPPGSPSFAGGPNSSSNMHSKVLNAVQE  371



>ref|XP_011093494.1| PREDICTED: uncharacterized protein LOC105173454 isoform X1 [Sesamum 
indicum]
Length=526

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 48/97 (49%), Gaps = 28/97 (29%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTG-SSATDDHSKVLNAV--------  602
            GRRQG GTYTFRNG++QSGHWQNG L+V S   T    S    +H KVL+ V        
Sbjct  396  GRRQGLGTYTFRNGDTQSGHWQNGSLDVPSTQSTTYPVSRIAVNHYKVLDIVQACSYIYI  455

Query  601  -------------------QEAIRAAEKANDVVKVDE  548
                               QEA + AEKA    K+DE
Sbjct  456  TVFCKIHLWLMSKKFSFNFQEAQQVAEKAQAATKLDE  492



>gb|KDO52541.1| hypothetical protein CISIN_1g037549mg [Citrus sinensis]
Length=102

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = -2

Query  748  RQGFGTYTFRNGESQSGHWQNGILNVSSAPG-TRTGSSATDDHSKVLNAVQ  599
            RQG G YTFRNGE+QSGH QNG+L++ SA   T   SS    H KVLN VQ
Sbjct  24   RQGLGMYTFRNGETQSGHRQNGLLDIPSAQNTTHLISSIAIYHYKVLNVVQ  74



>ref|XP_010695457.1| PREDICTED: junctophilin-2-like [Beta vulgaris subsp. vulgaris]
Length=392

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G Y+FR  E+QSG+WQNG L  +S     + S      SKV  A+Q+A +A+E+
Sbjct  283  GRRQGLGVYSFRQWEAQSGYWQNGQLVKASCQTQLSESHFAVYSSKVSTAIQKARQASER  342

Query  574  ANDVVKVDE  548
            A++V KVD+
Sbjct  343  AHNVKKVDD  351



>gb|KJB39059.1| hypothetical protein B456_007G322000 [Gossypium raimondii]
Length=91

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 39/69 (57%), Gaps = 11/69 (16%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDD----HSKVLNAVQEAIR  587
            GRRQG G YTFR+GE+Q GHWQNGIL+V   P TR  +          SKVLN      +
Sbjct  22   GRRQGLGMYTFRSGETQFGHWQNGILDV---PSTRNNTYPISPVAVYRSKVLNVA----K  74

Query  586  AAEKANDVV  560
              E+ N  V
Sbjct  75   VDERVNKAV  83



>ref|XP_010926411.1| PREDICTED: junctophilin-3-like [Elaeis guineensis]
 ref|XP_010926412.1| PREDICTED: junctophilin-3-like [Elaeis guineensis]
Length=393

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 40/69 (58%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQGFGTY FRN E +SG W  G+L +   P              V  A+Q AI+AAE 
Sbjct  298  GRRQGFGTYAFRNSEMRSGEWDCGVLKIPLLP----------SDPLVRRAIQAAIKAAES  347

Query  574  ANDVVKVDE  548
            AN++ ++D+
Sbjct  348  ANNLPRLDD  356



>ref|XP_008782234.1| PREDICTED: junctophilin-3-like [Phoenix dactylifera]
Length=391

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 40/69 (58%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQGFGTYTFRNGE +SG W  G+L     P   +          V  A+Q A +AAE 
Sbjct  296  GRRQGFGTYTFRNGEMRSGEWDCGVLKTPLLPSDLS----------VQRAIQAARKAAEN  345

Query  574  ANDVVKVDE  548
            AN + +VD+
Sbjct  346  ANLLPRVDD  354



>ref|XP_009760610.1| PREDICTED: radial spoke head 10 homolog B-like [Nicotiana sylvestris]
Length=414

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 67/107 (63%), Gaps = 13/107 (12%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QG+G YTFRNGE++ G W +G L     P T            VL AVQ A +AAE 
Sbjct  318  GRKQGYGMYTFRNGETRCGEWDSGNLKTPLPPLT----------DAVLRAVQAARKAAEN  367

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQM---HHDNNHF  443
            A  + +VDE+V +AV  AN+AATAARV A+KAVQNQM     D NH+
Sbjct  368  AIKLRRVDEQVNKAVMAANRAATAARVAAIKAVQNQMDGKFCDTNHY  414



>ref|XP_004250327.1| PREDICTED: junctophilin-1-like [Solanum lycopersicum]
Length=428

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 40/69 (58%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QGFG YTFRNG+++ G W +G L   S P T            VL AVQ A +AAE 
Sbjct  333  GRKQGFGMYTFRNGDTRCGEWDSGNLKTPSPPLT----------DAVLRAVQAARKAAEN  382

Query  574  ANDVVKVDE  548
            A  + +VDE
Sbjct  383  AIKLRRVDE  391



>ref|XP_009410095.1| PREDICTED: junctophilin-1-like [Musa acuminata subsp. malaccensis]
Length=388

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 67/98 (68%), Gaps = 10/98 (10%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            G++QGFG YTFR+GE++SG+W  G+LN S  P              V  AVQ A +AAEK
Sbjct  293  GKKQGFGLYTFRSGETRSGNWDCGVLNNSLPPSD----------PAVQGAVQAARKAAEK  342

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMH  461
            A  + +VD++V RAV  AN+AATAARV A+KAVQNQMH
Sbjct  343  AVLIPQVDDQVTRAVTAANRAATAARVAAIKAVQNQMH  380



>ref|XP_010916591.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 5-like [Elaeis 
guineensis]
Length=390

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 38/69 (55%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            G RQGFGTYTFRNGE +SG W  G+L +S  P              V  AVQ A +AAE 
Sbjct  287  GWRQGFGTYTFRNGEMRSGEWDCGVLKISLPP----------SDPAVQRAVQAARKAAEN  336

Query  574  ANDVVKVDE  548
               + +VDE
Sbjct  337  VIILARVDE  345



>ref|XP_001768288.1| predicted protein [Physcomitrella patens]
 gb|EDQ66902.1| predicted protein, partial [Physcomitrella patens]
Length=241

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRA  584
            GR+QG G YTFRNG++ +GHW  G L   S   + + S+   +H KVLNAVQ  +  
Sbjct  152  GRKQGLGIYTFRNGDTHAGHWHLGTLESRSTQVSNSSSAVATNHFKVLNAVQVLLHC  208



>ref|XP_010272808.1| PREDICTED: uncharacterized protein LOC104608493 [Nelumbo nucifera]
Length=414

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 39/69 (57%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQGFG YTFRNG+++ G W  G+L     P +            VL AVQ A + AE 
Sbjct  319  GRRQGFGMYTFRNGDARCGEWDAGVLKSPQPPLS----------DGVLRAVQAARKVAEN  368

Query  574  ANDVVKVDE  548
            A ++ +VDE
Sbjct  369  AINLPRVDE  377



>gb|EYU23900.1| hypothetical protein MIMGU_mgv1a007045mg [Erythranthe guttata]
Length=422

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 39/69 (57%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QG+G YTFRNGE++ G W NG L +S  P T            +L AVQ A   AE 
Sbjct  327  GRKQGYGMYTFRNGETRFGEWDNGNLKISLPPLT----------DAILRAVQAARNTAEN  376

Query  574  ANDVVKVDE  548
            A  + +VDE
Sbjct  377  AIRLRRVDE  385



>ref|XP_009621153.1| PREDICTED: radial spoke head 10 homolog B-like [Nicotiana tomentosiformis]
Length=414

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 39/69 (57%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QG+G YTFRNG+++ G W +  LN    P T            VL AVQ A +AAE 
Sbjct  318  GRKQGYGMYTFRNGDTRCGEWDSANLNTPLPPLTHA----------VLRAVQAARKAAEN  367

Query  574  ANDVVKVDE  548
            A  + +VDE
Sbjct  368  AIKLRRVDE  376



>gb|EYU22949.1| hypothetical protein MIMGU_mgv1a006697mg [Erythranthe guttata]
Length=434

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 39/69 (57%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QG+G YTFRNGES+ G W +G +     P T +          VL AVQ A + AE 
Sbjct  339  GRKQGYGMYTFRNGESKCGEWDDGNIKTRLPPLTDS----------VLRAVQAARKTAEN  388

Query  574  ANDVVKVDE  548
            A  + +VDE
Sbjct  389  AIHLRRVDE  397



>ref|XP_008797288.1| PREDICTED: junctophilin-3-like [Phoenix dactylifera]
 ref|XP_008797289.1| PREDICTED: junctophilin-3-like [Phoenix dactylifera]
Length=401

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 40/69 (58%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            G++QGFG YTFRNG+++SG W  G+L +   P  +           V  AVQ A +AAE 
Sbjct  306  GKKQGFGMYTFRNGDTRSGEWDCGVLKIRLPPSDQG----------VQRAVQAARKAAEN  355

Query  574  ANDVVKVDE  548
            A  + +VDE
Sbjct  356  AILIPRVDE  364



>ref|XP_010664228.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 5 [Vitis 
vinifera]
Length=421

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 38/69 (55%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QG+G Y+FRNG+++ G W +G L     P T            VL AVQ A R AE 
Sbjct  325  GRKQGYGMYSFRNGDTRCGEWDSGTLKNPLPPLT----------DAVLRAVQAARRTAEN  374

Query  574  ANDVVKVDE  548
            A  V +VDE
Sbjct  375  AIHVPRVDE  383



>ref|XP_010943100.1| PREDICTED: junctophilin-1-like [Elaeis guineensis]
Length=403

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 40/69 (58%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            G++QGFG YTFRNG+++SG W  GIL     P  +T          +  A+Q A +AAE 
Sbjct  308  GKKQGFGIYTFRNGDTRSGGWGCGILKSPLPPSDQT----------IQQALQAARKAAED  357

Query  574  ANDVVKVDE  548
            A  V +VDE
Sbjct  358  AILVPRVDE  366



>emb|CBI19045.3| unnamed protein product [Vitis vinifera]
Length=376

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 38/69 (55%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QG+G Y+FRNG+++ G W +G L     P T            VL AVQ A R AE 
Sbjct  280  GRKQGYGMYSFRNGDTRCGEWDSGTLKNPLPPLT----------DAVLRAVQAARRTAEN  329

Query  574  ANDVVKVDE  548
            A  V +VDE
Sbjct  330  AIHVPRVDE  338



>ref|XP_010939392.1| PREDICTED: radial spoke head 10 homolog B-like [Elaeis guineensis]
 ref|XP_010939393.1| PREDICTED: radial spoke head 10 homolog B-like [Elaeis guineensis]
Length=401

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 39/69 (57%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            G++QGFG Y FRNG+++SG W  G+L +   P  +           V  AVQ A +AAE 
Sbjct  306  GKKQGFGMYAFRNGDTRSGEWDCGVLKIRLPPSDQA----------VQRAVQSARKAAEN  355

Query  574  ANDVVKVDE  548
            A  + +VDE
Sbjct  356  AILIPRVDE  364



>ref|XP_009796895.1| PREDICTED: junctophilin-3-like [Nicotiana sylvestris]
Length=415

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 67/98 (68%), Gaps = 10/98 (10%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QG+G YTFRNG+S+ G W +G LN +  P        TD    VL AVQ A +AAE 
Sbjct  318  GRKQGYGMYTFRNGDSRCGEWASGNLN-TPLP------QLTD---AVLLAVQAARKAAEN  367

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMH  461
            A ++ +VD +V +AV  AN+AATAARV A+KAVQNQMH
Sbjct  368  AINIRRVDGQVNKAVMAANRAATAARVAAIKAVQNQMH  405



>ref|XP_010274323.1| PREDICTED: junctophilin-4-like [Nelumbo nucifera]
Length=418

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QGFG YTFRNG+++ G W +G+L     P              VL AVQ A +AA  
Sbjct  323  GRKQGFGMYTFRNGDARCGEWDSGVLKNPQLPLI----------DGVLRAVQAARKAAGN  372

Query  574  ANDVVKVDE  548
            A ++ +VDE
Sbjct  373  AINLPRVDE  381



>emb|CDP15806.1| unnamed protein product [Coffea canephora]
Length=435

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 38/69 (55%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QGFG YTFRNG+++ G W  G L   S P         D+   VL AVQ A R AEK
Sbjct  340  GRKQGFGMYTFRNGDTKCGEWDLGNLKNPSPP--------LDE--AVLRAVQAARRTAEK  389

Query  574  ANDVVKVDE  548
            A     VDE
Sbjct  390  AIHFRGVDE  398



>ref|XP_011069559.1| PREDICTED: MORN repeat-containing protein 1-like [Sesamum indicum]
Length=439

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 37/69 (54%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QG+G YTFRNGE++ G W  G L     P T            VL AVQ A + AE 
Sbjct  344  GRKQGYGMYTFRNGETRCGEWDGGNLRTRLPPLT----------DAVLRAVQAARKTAEN  393

Query  574  ANDVVKVDE  548
            A  + +VDE
Sbjct  394  AIHLRRVDE  402



>ref|XP_002462482.1| hypothetical protein SORBIDRAFT_02g026440 [Sorghum bicolor]
 gb|EER99003.1| hypothetical protein SORBIDRAFT_02g026440 [Sorghum bicolor]
Length=360

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 38/69 (55%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            G++QGFG YTFRNG+ +SG W +G L     P   +          V  AVQ A RA+E 
Sbjct  265  GKKQGFGMYTFRNGDKRSGDWDSGTLRTPLPPADPS----------VQRAVQAAQRASEN  314

Query  574  ANDVVKVDE  548
            A  + +VDE
Sbjct  315  AFRLPRVDE  323



>ref|XP_010091369.1| hypothetical protein L484_020171 [Morus notabilis]
 gb|EXB44359.1| hypothetical protein L484_020171 [Morus notabilis]
Length=430

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 39/69 (57%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QG+G YTFR+G+++ G W  G L  S  P T            VL AVQ A R AE 
Sbjct  331  GRKQGYGMYTFRSGDTRCGEWDGGSLKHSLPPLT----------DAVLRAVQAARRTAEN  380

Query  574  ANDVVKVDE  548
            A ++ +VDE
Sbjct  381  AINLHRVDE  389



>ref|XP_009609906.1| PREDICTED: junctophilin-3-like [Nicotiana tomentosiformis]
Length=415

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 66/98 (67%), Gaps = 10/98 (10%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QG+G YTFRNG+S+ G W +G LN +  P        TD    VL AVQ A +AAE 
Sbjct  318  GRKQGYGMYTFRNGDSRCGEWASGNLN-TPLP------QLTD---AVLQAVQAARKAAEN  367

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMH  461
            A ++ + D +V +AV  AN+AATAARV A+KAVQNQMH
Sbjct  368  AINIRRADGQVNKAVMAANRAATAARVAAIKAVQNQMH  405



>ref|XP_011074862.1| PREDICTED: uncharacterized protein LOC105159483 [Sesamum indicum]
Length=429

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 37/69 (54%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QG+G YTFRNGE + G W  G L     P T            VL AVQ A + AE 
Sbjct  334  GRKQGYGMYTFRNGEMRCGEWDGGNLLTPLPPLT----------DAVLRAVQAARQTAEN  383

Query  574  ANDVVKVDE  548
            A+ + +VDE
Sbjct  384  ASHLRRVDE  392



>gb|EEC84694.1| hypothetical protein OsI_31624 [Oryza sativa Indica Group]
Length=517

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 39/69 (57%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            G++QGFG YTFRNG+ +SG W +G L    +P        TD    V  AVQ A  AAE 
Sbjct  422  GKKQGFGMYTFRNGDKRSGDWDSGTLKTPLSP--------TD--PSVQRAVQAAQLAAEN  471

Query  574  ANDVVKVDE  548
            A  + +VDE
Sbjct  472  AFHLPRVDE  480



>ref|NP_001063348.1| Os09g0453900 [Oryza sativa Japonica Group]
 dbj|BAD38030.1| 1-phosphatidylinositol-4-phosphate 5-kinase-like protein [Oryza 
sativa Japonica Group]
 dbj|BAF25262.1| Os09g0453900 [Oryza sativa Japonica Group]
 dbj|BAH00082.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE69840.1| hypothetical protein OsJ_29607 [Oryza sativa Japonica Group]
Length=418

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 39/69 (57%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            G++QGFG YTFRNG+ +SG W +G L    +P        TD    V  AVQ A  AAE 
Sbjct  323  GKKQGFGMYTFRNGDKRSGDWDSGTLKTPLSP--------TD--PSVQRAVQAAQLAAEN  372

Query  574  ANDVVKVDE  548
            A  + +VDE
Sbjct  373  AFHLPRVDE  381



>gb|KDP32777.1| hypothetical protein JCGZ_12069 [Jatropha curcas]
Length=441

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 38/69 (55%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QG+G YTFRNG+++ G W  G L    AP T            VL A+Q A + AE 
Sbjct  346  GRKQGYGMYTFRNGDAKCGEWDVGTLKTPLAPLT----------DAVLRAIQAARKTAES  395

Query  574  ANDVVKVDE  548
            A  + +VD+
Sbjct  396  AIRLRRVDD  404



>ref|XP_011027571.1| PREDICTED: uncharacterized protein LOC105127827 [Populus euphratica]
Length=440

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 37/69 (54%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QG+G YTFR G+++ G W  G L  S  P T            VL AVQ A R AE 
Sbjct  345  GRKQGYGMYTFRGGDTRCGEWDVGNLRTSLPPVT----------DPVLRAVQSARRTAEN  394

Query  574  ANDVVKVDE  548
            A  + +VDE
Sbjct  395  AIHLRRVDE  403



>ref|XP_002302247.2| phosphatidylinositol-4-phosphate 5-kinase family protein [Populus 
trichocarpa]
 gb|EEE81520.2| phosphatidylinositol-4-phosphate 5-kinase family protein [Populus 
trichocarpa]
Length=426

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 37/69 (54%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QG+G YTFR G+++ G W  G L  S  P T            VL AVQ A R AE 
Sbjct  331  GRKQGYGMYTFRGGDTRCGEWDVGNLRTSLPPIT----------DPVLRAVQSARRTAEN  380

Query  574  ANDVVKVDE  548
            A  + +VDE
Sbjct  381  AIHLRRVDE  389



>ref|XP_004488906.1| PREDICTED: junctophilin-3-like [Cicer arietinum]
Length=426

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 37/69 (54%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG+G YTFRNG+ + G W  G L  S  P T            VL AVQ A R AE 
Sbjct  331  GRRQGYGVYTFRNGDRKCGEWDGGNLKHSLPPVTHA----------VLQAVQAARRTAEN  380

Query  574  ANDVVKVDE  548
            A ++ + D+
Sbjct  381  AINLPRNDD  389



>ref|XP_006363901.1| PREDICTED: radial spoke head 10 homolog B-like [Solanum tuberosum]
Length=419

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 64/98 (65%), Gaps = 10/98 (10%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QG+G Y FRNG+++ G W +G LN    P T            VL  VQ + +AAE 
Sbjct  326  GRKQGYGMYKFRNGDTRCGEWASGNLNTPLPPLTDV----------VLRVVQASRKAAEN  375

Query  574  ANDVVKVDErvkravatankaataarvtavkaVQNQMH  461
            A ++ +VD++V RAV  AN+AATAARV A+KAVQN+MH
Sbjct  376  AINIRRVDDQVNRAVIAANRAATAARVAAIKAVQNRMH  413



>gb|EPS72285.1| hypothetical protein M569_02471 [Genlisea aurea]
Length=440

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 36/69 (52%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QGFG Y+FRNG+ + G W  G L V   P +            VL AVQ A  AAE 
Sbjct  337  GRKQGFGMYSFRNGDRRCGEWDGGDLKVPLPPPSHP----------VLKAVQSARTAAEN  386

Query  574  ANDVVKVDE  548
            A  +  V+E
Sbjct  387  AAKLGSVEE  395



>ref|XP_008219755.1| PREDICTED: MORN repeat-containing protein 1 [Prunus mume]
Length=432

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 40/69 (58%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QG+G YTFRNG+++ G W  G L    AP T            V+ AV+ A ++AE 
Sbjct  337  GRKQGYGVYTFRNGDTRCGMWDGGTLKHPLAPLT----------DAVVRAVKAAGKSAEN  386

Query  574  ANDVVKVDE  548
            A ++ +VDE
Sbjct  387  AVNLRRVDE  395



>ref|XP_002891231.1| hypothetical protein ARALYDRAFT_891288 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67490.1| hypothetical protein ARALYDRAFT_891288 [Arabidopsis lyrata subsp. 
lyrata]
Length=405

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 38/69 (55%), Gaps = 9/69 (13%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QG+G YTFRN  ++ G W +G L    AP   TGS        +L AVQ A   AEK
Sbjct  304  GRKQGYGMYTFRNSVTKCGEWDSGHLKTPVAP-PLTGS--------ILKAVQAARERAEK  354

Query  574  ANDVVKVDE  548
            A    +VDE
Sbjct  355  AIKQRRVDE  363



>ref|XP_007222382.1| hypothetical protein PRUPE_ppa006014mg [Prunus persica]
 gb|EMJ23581.1| hypothetical protein PRUPE_ppa006014mg [Prunus persica]
Length=432

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 39/69 (57%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QG+G YTFRNG+++ G W  G L     P T            V+ AV+ A +AAE 
Sbjct  337  GRKQGYGVYTFRNGDTRCGMWDGGTLKHPLVPLT----------DAVVRAVKAAGKAAEN  386

Query  574  ANDVVKVDE  548
            A ++ +VDE
Sbjct  387  AVNLRRVDE  395



>ref|XP_009391367.1| PREDICTED: radial spoke head 10 homolog B-like [Musa acuminata 
subsp. malaccensis]
Length=387

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 63/102 (62%), Gaps = 18/102 (18%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            G++QGFG YTFRNGE++ G W +G+L     P                 AVQ A++AA K
Sbjct  292  GKKQGFGMYTFRNGEARCGDWASGVLKTPLPPSD--------------PAVQHAVQAARK  337

Query  574  AND----VVKVDErvkravatankaataarvtavkaVQNQMH  461
            A D    V +VD +V +AV  AN+AATAARV A+KAVQNQ+H
Sbjct  338  AADDSVLVPRVDAQVNKAVTNANRAATAARVAAIKAVQNQIH  379



>ref|XP_006845934.1| hypothetical protein AMTR_s00157p00072470 [Amborella trichopoda]
 gb|ERN07609.1| hypothetical protein AMTR_s00157p00072470 [Amborella trichopoda]
Length=417

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 40/69 (58%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            G++QGFG Y+FR+G+++SG W NG L       +            V NAVQEA + AEK
Sbjct  322  GKKQGFGVYSFRSGDTRSGEWDNGALKNPHPSASLV----------VSNAVQEARKTAEK  371

Query  574  ANDVVKVDE  548
            A  V +V++
Sbjct  372  AFSVPRVED  380



>gb|AAM65200.1| phosphatidylinositol-4-phosphate 5-kinase, putative [Arabidopsis 
thaliana]
Length=417

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 41/69 (59%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QGFG Y+FRNG+++SG W +G+L V+S P T            V  AVQ A   A K
Sbjct  324  GRKQGFGAYSFRNGDAKSGEWDSGVL-VTSLPLT---------SEPVSRAVQAARETANK  373

Query  574  ANDVVKVDE  548
            A +  +VDE
Sbjct  374  AVNRRRVDE  382



>ref|XP_010544551.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 5-like [Tarenaya 
hassleriana]
Length=441

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 37/69 (54%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QG+G YTFRNG ++ G W  G L +   P              VL AVQ A +  +K
Sbjct  347  GRKQGYGMYTFRNGVTKCGEWDAGNLKIPLPPLA----------GPVLRAVQAARKTGDK  396

Query  574  ANDVVKVDE  548
            A ++ +VDE
Sbjct  397  AMNLWRVDE  405



>ref|NP_173610.1| Histone H3 K4-specific methyltransferase SET7/9 family protein 
[Arabidopsis thaliana]
 gb|AAF16539.1|AC013482_13 T26F17.15 [Arabidopsis thaliana]
 gb|AAK44100.1|AF370285_1 putative phosphatidylinositol-4-phosphate 5-kinase [Arabidopsis 
thaliana]
 gb|AAN12886.1| putative phosphatidylinositol-4-phosphate 5-kinase [Arabidopsis 
thaliana]
 gb|AEE30172.1| Histone H3 K4-specific methyltransferase SET7/9 family protein 
[Arabidopsis thaliana]
Length=417

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 41/69 (59%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QGFG Y+FRNG+++SG W +G+L V+S P T            V  AVQ A   A K
Sbjct  324  GRKQGFGAYSFRNGDAKSGEWDSGVL-VTSLPLT---------SEPVSRAVQAARETANK  373

Query  574  ANDVVKVDE  548
            A +  +VDE
Sbjct  374  AVNRRRVDE  382



>ref|XP_003526619.1| PREDICTED: MORN repeat-containing protein 1-like [Glycine max]
Length=430

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 38/69 (55%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G+YTFRNG+ + G W  G L  S  P +            VL AVQ A + AE 
Sbjct  335  GRRQGIGSYTFRNGDRRCGEWDAGTLKQSLPPLSDV----------VLRAVQAARKTAEN  384

Query  574  ANDVVKVDE  548
            A ++ +VD+
Sbjct  385  AINLKRVDD  393



>gb|KHN09187.1| Phosphatidylinositol-4-phosphate 5-kinase 1 [Glycine soja]
Length=321

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 38/69 (55%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GRRQG G+YTFRNG+ + G W  G L  S  P +            VL AVQ A + AE 
Sbjct  226  GRRQGIGSYTFRNGDRRCGEWDAGTLKQSLPPLSDV----------VLRAVQAARKTAEN  275

Query  574  ANDVVKVDE  548
            A ++ +VD+
Sbjct  276  AINLKRVDD  284



>ref|XP_008444131.1| PREDICTED: uncharacterized protein LOC103487572 [Cucumis melo]
Length=430

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 39/69 (57%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            G+RQG+GTYTFRN E++ G W  G L    +P   T          VL AVQ + +AA  
Sbjct  335  GQRQGYGTYTFRNSEAKCGEWDGGSLKHPLSPLNDT----------VLQAVQASRKAARN  384

Query  574  ANDVVKVDE  548
            A ++ ++DE
Sbjct  385  AINLPRLDE  393



>gb|KJB59199.1| hypothetical protein B456_009G244300 [Gossypium raimondii]
Length=436

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 39/69 (57%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            G++QG+G YTFR+G+++ G W +G L  S  P T            +L AVQ A +AA  
Sbjct  341  GQKQGYGMYTFRSGDTKCGEWDSGTLKTSLPPLT----------DAILRAVQAARKAAGN  390

Query  574  ANDVVKVDE  548
            A  + +VDE
Sbjct  391  AIKLRRVDE  399



>ref|XP_004242021.1| PREDICTED: radial spoke head 10 homolog B-like [Solanum lycopersicum]
Length=421

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 39/69 (57%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            GR+QG+G Y F+NG+++ G W +G LN    P T            VL  VQ + +AAE 
Sbjct  326  GRKQGYGMYKFKNGDTRCGEWASGNLNTPLPPLTDV----------VLRVVQASRKAAEN  375

Query  574  ANDVVKVDE  548
            A ++ +VD+
Sbjct  376  AINIRRVDD  384



>ref|XP_002513784.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48367.1| conserved hypothetical protein [Ricinus communis]
Length=443

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 35/69 (51%), Gaps = 10/69 (14%)
 Frame = -2

Query  754  GRRQGFGTYTFRNGESQSGHWQNGILNVSSAPGTRTGSSATDDHSKVLNAVQEAIRAAEK  575
            G RQG+G YTFRN +++ G W  GIL  S  P T            VL  VQ A + AE 
Sbjct  348  GLRQGYGMYTFRNSDAKCGEWDGGILRTSLPPLT----------DAVLRVVQAARKTAES  397

Query  574  ANDVVKVDE  548
            A    +VD+
Sbjct  398  AIHFRRVDD  406



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401010927050