BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF011E16

Length=741
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008384431.1|  PREDICTED: tubulin alpha-3 chain-like              305   5e-100   
ref|XP_010420792.1|  PREDICTED: tubulin alpha-3 chain-like              299   2e-99    Camelina sativa [gold-of-pleasure]
emb|CAD20821.1|  alpha tubulin                                          302   4e-99    Zea mays [maize]
gb|ABR25510.1|  tubulin alpha-1 chain                                   301   5e-99    Oryza sativa Indica Group [Indian rice]
dbj|BAH20267.1|  AT5G19780                                              302   6e-99    Arabidopsis thaliana [mouse-ear cress]
emb|CAD20820.1|  alpha tubulin                                          299   6e-99    Zea mays [maize]
dbj|BAD94893.1|  tubulin alpha-5 chain-like protein                     298   7e-99    Arabidopsis thaliana [mouse-ear cress]
emb|CAL35827.1|  alpha-2 tubulin                                        300   8e-99    Plantago major [cart-track plant]
ref|XP_001777110.1|  predicted protein                                  304   1e-98    
gb|KJB83378.1|  hypothetical protein B456_013G244600                    304   4e-98    Gossypium raimondii
ref|XP_009413318.1|  PREDICTED: tubulin alpha-3 chain-like              306   4e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004295008.1|  PREDICTED: tubulin alpha-3 chain isoform X1        305   9e-98    Fragaria vesca subsp. vesca
tpg|DAA41189.1|  TPA: alpha tubulin5                                    300   1e-97    
ref|XP_010276368.1|  PREDICTED: tubulin alpha-3 chain-like              305   1e-97    Nelumbo nucifera [Indian lotus]
ref|XP_009375870.1|  PREDICTED: tubulin alpha-3 chain                   305   1e-97    Pyrus x bretschneideri [bai li]
emb|CDP17586.1|  unnamed protein product                                305   1e-97    Coffea canephora [robusta coffee]
tpg|DAA63280.1|  TPA: alpha tubulin6                                    300   1e-97    
ref|XP_011075054.1|  PREDICTED: tubulin alpha-3 chain-like              305   1e-97    Sesamum indicum [beniseed]
ref|XP_008349406.1|  PREDICTED: tubulin alpha-3 chain                   304   1e-97    Malus domestica [apple tree]
ref|XP_011089722.1|  PREDICTED: tubulin alpha-3 chain                   304   1e-97    Sesamum indicum [beniseed]
ref|XP_008351479.1|  PREDICTED: tubulin alpha-3 chain                   304   1e-97    Malus domestica [apple tree]
ref|XP_008813089.1|  PREDICTED: tubulin alpha-3 chain                   304   1e-97    Phoenix dactylifera
ref|XP_010257632.1|  PREDICTED: tubulin alpha-3 chain                   304   1e-97    Nelumbo nucifera [Indian lotus]
gb|AGG37288.1|  alpha-tubulin 6                                         304   1e-97    Salix arbutifolia
ref|XP_011034391.1|  PREDICTED: tubulin alpha-3 chain                   304   2e-97    Populus euphratica
sp|P33624.1|TBA2_ANEPH  RecName: Full=Tubulin alpha-2 chain             301   2e-97    Anemia phyllitidis
gb|EYU23006.1|  hypothetical protein MIMGU_mgv1a006283mg                304   2e-97    Erythranthe guttata [common monkey flower]
gb|AHJ80821.1|  Tua3                                                    302   2e-97    Eragrostis tef [tef]
ref|XP_006858944.1|  hypothetical protein AMTR_s00068p00090790          304   2e-97    Amborella trichopoda
gb|AHZ58481.1|  alpha-tubulin                                           295   2e-97    Syntrichia caninervis
gb|AGD80034.1|  alpha-tubulin 1                                         304   2e-97    Hevea brasiliensis [jebe]
ref|XP_010934670.1|  PREDICTED: tubulin alpha-3 chain-like              304   2e-97    Elaeis guineensis
gb|KCW87067.1|  hypothetical protein EUGRSUZ_B03604                     301   3e-97    Eucalyptus grandis [rose gum]
gb|EYU31677.1|  hypothetical protein MIMGU_mgv1a006281mg                303   3e-97    Erythranthe guttata [common monkey flower]
ref|XP_009353129.1|  PREDICTED: tubulin alpha-3 chain-like              303   3e-97    Pyrus x bretschneideri [bai li]
gb|ACN40824.1|  unknown                                                 303   4e-97    Picea sitchensis
gb|AGG37290.1|  alpha-tubulin 8                                         303   4e-97    Salix arbutifolia
gb|KHG06160.1|  Tubulin alpha-3/alpha-5 chain -like protein             303   4e-97    Gossypium arboreum [tree cotton]
ref|XP_011025144.1|  PREDICTED: tubulin alpha-3 chain                   303   4e-97    Populus euphratica
ref|XP_002325422.1|  Tubulin alpha-1 chain family protein               303   4e-97    Populus trichocarpa [western balsam poplar]
gb|AEG74028.1|  alpha-tubulin                                           303   4e-97    Apopellia endiviifolia (species B)
ref|XP_002303998.1|  alpha-tubulin 2 family protein                     303   4e-97    Populus trichocarpa [western balsam poplar]
ref|XP_011021469.1|  PREDICTED: tubulin alpha-3 chain-like              303   4e-97    Populus euphratica
gb|KHN06388.1|  Tubulin alpha-3 chain                                   302   5e-97    Glycine soja [wild soybean]
ref|XP_006286664.1|  hypothetical protein CARUB_v10002583mg             303   5e-97    Capsella rubella
ref|XP_010112637.1|  Tubulin alpha-3 chain                              303   5e-97    Morus notabilis
ref|XP_001777081.1|  predicted protein                                  303   5e-97    
ref|XP_002285721.1|  PREDICTED: tubulin alpha-3 chain                   303   5e-97    Vitis vinifera
ref|XP_009406530.1|  PREDICTED: tubulin alpha-3 chain-like              303   5e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006445597.1|  hypothetical protein CICLE_v10015224mg             303   5e-97    Citrus clementina [clementine]
ref|XP_008386829.1|  PREDICTED: tubulin alpha-3 chain-like              303   5e-97    Malus domestica [apple tree]
ref|XP_008223650.1|  PREDICTED: tubulin alpha-3 chain-like              303   5e-97    Prunus mume [ume]
gb|AHJ80820.1|  Tua3                                                    301   5e-97    Eragrostis tef [tef]
ref|XP_010673470.1|  PREDICTED: tubulin alpha-3 chain                   303   5e-97    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009400845.1|  PREDICTED: tubulin alpha-3 chain                   303   6e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007205189.1|  hypothetical protein PRUPE_ppa005642mg             303   6e-97    Prunus persica
ref|XP_008804327.1|  PREDICTED: tubulin alpha-1 chain-like              303   6e-97    Phoenix dactylifera
gb|KJB83375.1|  hypothetical protein B456_013G244600                    303   6e-97    Gossypium raimondii
ref|XP_001782790.1|  predicted protein                                  303   6e-97    
gb|KDP39691.1|  hypothetical protein JCGZ_02711                         303   6e-97    Jatropha curcas
gb|AGG37284.1|  alpha-tubulin 2                                         303   6e-97    Salix arbutifolia
gb|ABO47741.1|  alpha-tubulin                                           303   7e-97    Gossypium hirsutum [American cotton]
ref|XP_002319688.1|  Tubulin alpha-1 chain family protein               303   7e-97    Populus trichocarpa [western balsam poplar]
ref|XP_007030078.1|  Tubulin alpha-5                                    303   7e-97    
gb|ABO47735.1|  alpha-tubulin                                           302   7e-97    Gossypium hirsutum [American cotton]
ref|XP_009408459.1|  PREDICTED: tubulin alpha-3 chain-like              302   7e-97    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG06861.1|  Tubulin alpha-6 chain                                   303   7e-97    Gossypium arboreum [tree cotton]
emb|CDY44941.1|  BnaA02g04460D                                          302   8e-97    Brassica napus [oilseed rape]
gb|ABB16994.1|  unknown                                                 303   8e-97    Solanum tuberosum [potatoes]
gb|AGI78243.1|  alpha tubulin 5                                         295   8e-97    Caragana korshinskii
ref|XP_006443441.1|  hypothetical protein CICLE_v10020128mg             302   1e-96    Citrus clementina [clementine]
sp|Q43473.1|TBA1_HORVU  RecName: Full=Tubulin alpha-1 chain             302   1e-96    Hordeum vulgare [barley]
gb|KHG26159.1|  Tubulin alpha-6 chain                                   302   1e-96    Gossypium arboreum [tree cotton]
dbj|BAJ06363.1|  alpha-tubulin                                          302   1e-96    Alopecurus aequalis
gb|KHN47983.1|  Tubulin alpha-3 chain                                   301   1e-96    Glycine soja [wild soybean]
gb|ABD92942.1|  alpha tubulin-1D                                        302   1e-96    Triticum aestivum [Canadian hard winter wheat]
ref|XP_003562846.1|  PREDICTED: tubulin alpha-1 chain                   302   1e-96    Brachypodium distachyon [annual false brome]
ref|XP_004958110.1|  PREDICTED: tubulin alpha-3 chain-like              302   1e-96    Setaria italica
ref|XP_006657877.1|  PREDICTED: tubulin alpha-3 chain-like              302   1e-96    Oryza brachyantha
emb|CAD26891.1|  alpha-tubulin                                          302   1e-96    Miscanthus floridulus
ref|XP_010531152.1|  PREDICTED: tubulin alpha-3 chain                   302   1e-96    Tarenaya hassleriana [spider flower]
emb|CDX88875.1|  BnaA03g07740D                                          302   1e-96    
ref|XP_010923361.1|  PREDICTED: tubulin alpha-3 chain                   302   1e-96    Elaeis guineensis
emb|CAD26886.1|  alpha-tubulin                                          302   1e-96    Miscanthus sinensis
ref|XP_010044940.1|  PREDICTED: tubulin alpha-3 chain                   302   1e-96    Eucalyptus grandis [rose gum]
ref|NP_001105588.1|  tubulin alpha-6 chain                              302   1e-96    Zea mays [maize]
ref|NP_197478.1|  tubulin alpha-3                                       301   1e-96    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001105324.1|  tubulin alpha-5 chain                              301   1e-96    Zea mays [maize]
ref|XP_010535933.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    301   1e-96    Tarenaya hassleriana [spider flower]
emb|CDY42294.1|  BnaC02g09000D                                          301   1e-96    Brassica napus [oilseed rape]
emb|CAD24765.1|  alpha-tubulin                                          301   2e-96    Miscanthus sinensis
ref|XP_009366459.1|  PREDICTED: tubulin alpha-3 chain                   301   2e-96    
ref|XP_002532068.1|  tubulin alpha chain, putative                      301   2e-96    Ricinus communis
sp|O22349.1|TBA3_ELEIN  RecName: Full=Tubulin alpha-3 chain; AltN...    301   2e-96    Eleusine indica [crabgrass]
ref|NP_001242878.1|  uncharacterized protein LOC100806907               301   2e-96    Glycine max [soybeans]
ref|XP_010454260.1|  PREDICTED: tubulin alpha-3 chain-like              301   2e-96    Camelina sativa [gold-of-pleasure]
ref|NP_001060075.1|  Os07g0574800                                       301   2e-96    
gb|AGY80453.1|  tubulin                                                 301   2e-96    Dendrocalamus latiflorus [sweet bamboo]
ref|XP_009120857.1|  PREDICTED: tubulin alpha-3 chain                   301   2e-96    Brassica rapa
ref|XP_004149645.1|  PREDICTED: tubulin alpha-3 chain-like              301   2e-96    Cucumis sativus [cucumbers]
ref|XP_009126389.1|  PREDICTED: tubulin alpha-3 chain-like              301   2e-96    Brassica rapa
ref|NP_001237301.1|  tubulin A                                          301   2e-96    
ref|XP_007159433.1|  hypothetical protein PHAVU_002G237400g             301   2e-96    Phaseolus vulgaris [French bean]
ref|XP_002525416.1|  tubulin alpha chain, putative                      301   2e-96    Ricinus communis
gb|AGG37286.1|  alpha-tubulin 4                                         301   2e-96    Salix arbutifolia
ref|XP_006579487.1|  PREDICTED: tubulin A isoform X1                    301   2e-96    
gb|KJB44614.1|  hypothetical protein B456_007G261000                    301   2e-96    Gossypium raimondii
ref|XP_009389058.1|  PREDICTED: tubulin alpha-3 chain-like              301   2e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009126391.1|  PREDICTED: tubulin alpha-3 chain-like              301   2e-96    Brassica rapa
ref|XP_008449885.1|  PREDICTED: tubulin alpha-3 chain isoform X1        301   2e-96    Cucumis melo [Oriental melon]
gb|AFR42026.1|  alpha-tubulin                                           292   2e-96    Populus trichocarpa [western balsam poplar]
ref|XP_009622332.1|  PREDICTED: tubulin alpha-3 chain                   301   2e-96    Nicotiana tomentosiformis
ref|XP_011048194.1|  PREDICTED: tubulin alpha-6 chain-like              301   3e-96    Populus euphratica
gb|KCW87065.1|  hypothetical protein EUGRSUZ_B03604                     301   3e-96    Eucalyptus grandis [rose gum]
ref|XP_002297631.1|  alpha-tubulin 2 family protein                     301   3e-96    Populus trichocarpa [western balsam poplar]
gb|AFR42049.1|  alpha-tubulin                                           292   3e-96    Populus fremontii
gb|ABR67425.1|  alpha-tubulin 4                                         301   3e-96    Populus tremuloides
gb|AFR42054.1|  alpha-tubulin                                           292   3e-96    Populus fremontii
gb|KJB58759.1|  hypothetical protein B456_009G224800                    297   3e-96    Gossypium raimondii
gb|AFR42035.1|  alpha-tubulin                                           292   3e-96    Populus alba [abele]
gb|AFR42020.1|  alpha-tubulin                                           292   3e-96    Populus trichocarpa [western balsam poplar]
gb|AFR42036.1|  alpha-tubulin                                           292   3e-96    Populus alba [abele]
emb|CAD24768.1|  alpha-tubulin                                          301   4e-96    Miscanthus floridulus
gb|AFR42042.1|  alpha-tubulin                                           291   4e-96    Populus fremontii
ref|XP_004504311.1|  PREDICTED: tubulin alpha-3 chain-like              300   4e-96    Cicer arietinum [garbanzo]
ref|XP_003629736.1|  Alpha-tubulin                                      300   4e-96    Medicago truncatula
gb|AFR42047.1|  alpha-tubulin                                           291   5e-96    Populus fremontii
ref|XP_006433708.1|  hypothetical protein CICLE_v100015522mg            292   5e-96    
ref|XP_008240533.1|  PREDICTED: tubulin alpha-3 chain isoform X1        300   8e-96    Prunus mume [ume]
gb|ABV55994.1|  alpha-tubulin 6                                         300   9e-96    Populus tremuloides
emb|CAD24766.1|  alpha-tubulin                                          300   9e-96    Miscanthus sinensis
gb|AAO63773.2|  alpha-tubulin 2                                         300   9e-96    Populus tremuloides
gb|KDP42087.1|  hypothetical protein JCGZ_01875                         300   9e-96    Jatropha curcas
ref|XP_007204346.1|  hypothetical protein PRUPE_ppa005649mg             300   9e-96    Prunus persica
emb|CAD26887.1|  alpha-tubulin                                          300   1e-95    Miscanthus sinensis
gb|AGV54500.1|  tubulin A                                               299   1e-95    Phaseolus vulgaris [French bean]
gb|ABO47738.1|  alpha-tubulin                                           299   1e-95    Gossypium hirsutum [American cotton]
emb|CDP14299.1|  unnamed protein product                                299   1e-95    Coffea canephora [robusta coffee]
emb|CAD26890.1|  alpha-tubulin                                          299   1e-95    Miscanthus sinensis subsp. condensatus
gb|EYU34085.1|  hypothetical protein MIMGU_mgv1a0196712mg               291   2e-95    Erythranthe guttata [common monkey flower]
gb|AIC33057.1|  tubulin alpha-1 chain                                   299   2e-95    Panax ginseng [Asiatic ginseng]
gb|AAW57309.1|  alpha-tubulin                                           293   2e-95    Ceratopteris richardii
emb|CAB76917.1|  alpha-tubulin 4                                        293   2e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAW57310.1|  alpha-tubulin                                           293   2e-95    Ceratopteris richardii
gb|KIY91712.1|  Tubulin alpha chain                                     292   2e-95    Monoraphidium neglectum
gb|KJB32211.1|  hypothetical protein B456_005G229600                    296   2e-95    Gossypium raimondii
gb|ADD84794.1|  tubulin-like protein                                    289   2e-95    Cenchrus ciliaris [African foxtail grass]
ref|XP_006286795.1|  hypothetical protein CARUB_v10003470mg             298   2e-95    Capsella rubella
ref|XP_007014666.1|  Tubulin alpha-5                                    298   2e-95    Theobroma cacao [chocolate]
emb|CAD26892.1|  alpha-tubulin                                          298   3e-95    Miscanthus floridulus
emb|CAJ38386.1|  alpha tubulin                                          292   3e-95    Plantago major [cart-track plant]
ref|XP_008464962.1|  PREDICTED: tubulin alpha-3 chain-like              298   3e-95    Cucumis melo [Oriental melon]
ref|XP_004141134.1|  PREDICTED: tubulin alpha-3 chain-like              298   3e-95    Cucumis sativus [cucumbers]
ref|XP_010414865.1|  PREDICTED: tubulin alpha-1 chain                   298   4e-95    Camelina sativa [gold-of-pleasure]
gb|KJB80786.1|  hypothetical protein B456_013G115100                    298   4e-95    Gossypium raimondii
ref|XP_008621874.1|  tubulin alpha                                      292   5e-95    Saprolegnia diclina VS20
ref|XP_003624633.1|  Alpha-tubulin                                      298   5e-95    Medicago truncatula
ref|XP_004252814.1|  PREDICTED: tubulin alpha-2 chain-like              290   6e-95    Solanum lycopersicum
emb|CAD24767.1|  alpha-tubulin                                          298   6e-95    Miscanthus floridulus
ref|XP_002677064.1|  alpha-tubulin                                      289   6e-95    Naegleria gruberi strain NEG-M
ref|XP_004493170.1|  PREDICTED: tubulin alpha-3 chain-like              298   6e-95    
gb|KDO25258.1|  hypothetical protein SPRG_09506                         288   6e-95    Saprolegnia parasitica CBS 223.65
ref|XP_010528739.1|  PREDICTED: tubulin alpha-6 chain-like              297   7e-95    Tarenaya hassleriana [spider flower]
gb|AHJ80819.1|  Tua1                                                    290   8e-95    Eragrostis tef [tef]
gb|AHM93474.1|  alpha-tubulin                                           293   9e-95    Camellia chekiangoleosa
gb|ABD92943.1|  alpha tubulin-1B                                        297   1e-94    Triticum aestivum [Canadian hard winter wheat]
ref|XP_011078787.1|  PREDICTED: tubulin alpha-1 chain-like              297   1e-94    Sesamum indicum [beniseed]
gb|EKF29047.1|  epsilon tubulin, putative                               289   1e-94    Trypanosoma cruzi marinkellei
emb|CBH08953.1|  alpha tubulin, (fragment)                              288   1e-94    Trypanosoma brucei gambiense DAL972
emb|CCD11782.1|  unnamed protein product                                290   2e-94    Trypanosoma congolense IL3000
emb|CAD26893.1|  alpha-tubulin                                          296   2e-94    Miscanthus floridulus
gb|KDO81349.1|  hypothetical protein CISIN_1g013037mg                   293   2e-94    Citrus sinensis [apfelsine]
gb|EKF28172.1|  epsilon tubulin, putative                               290   2e-94    Trypanosoma cruzi marinkellei
gb|AAW57306.1|  alpha-tubulin                                           290   2e-94    Ceratopteris richardii
dbj|BAH19954.1|  AT1G50010                                              290   2e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010693818.1|  PREDICTED: tubulin alpha-3 chain-like              296   2e-94    Beta vulgaris subsp. vulgaris [field beet]
emb|CBH08958.1|  alpha tubulin, (fragment)                              291   2e-94    Trypanosoma brucei gambiense DAL972
dbj|BAF01952.1|  putative tubulin alpha-2/alpha-4 chain                 288   2e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010054663.1|  PREDICTED: tubulin alpha-3 chain-like              296   2e-94    Eucalyptus grandis [rose gum]
ref|XP_002959708.1|  alpha tubulin                                      289   3e-94    Volvox carteri f. nagariensis
ref|XP_006301274.1|  hypothetical protein CARUB_v10021674mg             296   3e-94    Capsella rubella
emb|CAD26888.1|  alpha-tubulin                                          296   3e-94    Miscanthus transmorrisonensis
gb|EYU20672.1|  hypothetical protein MIMGU_mgv1a004180mg                298   3e-94    Erythranthe guttata [common monkey flower]
gb|ABR26150.1|  tubulin alpha-3 chain                                   286   3e-94    Oryza sativa Indica Group [Indian rice]
gb|ABE01246.1|  alpha tubulin                                           295   4e-94    Camellia sinensis [black tea]
gb|KGN48654.1|  hypothetical protein Csa_6G497050                       294   4e-94    Cucumis sativus [cucumbers]
gb|KJB58756.1|  hypothetical protein B456_009G224800                    294   5e-94    Gossypium raimondii
ref|XP_002779346.1|  alpha-tubulin, putative                            286   6e-94    Perkinsus marinus ATCC 50983
emb|CAA52158.1|  alpha tubulin                                          288   6e-94    Zea mays [maize]
gb|KHG20487.1|  Tubulin alpha chain                                     295   7e-94    Gossypium arboreum [tree cotton]
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     295   8e-94    Sesamum indicum [beniseed]
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    295   1e-93    
gb|KHG19627.1|  Tubulin alpha-3/alpha-5 chain -like protein             294   1e-93    Gossypium arboreum [tree cotton]
ref|XP_007161955.1|  hypothetical protein PHAVU_001G111700g             294   1e-93    Phaseolus vulgaris [French bean]
gb|AGV54721.1|  tubulin alpha-3 chain-like protein                      294   1e-93    Phaseolus vulgaris [French bean]
gb|ABR25378.1|  tubulin alpha 3 chain                                   286   1e-93    Oryza sativa Indica Group [Indian rice]
gb|KDO49533.1|  hypothetical protein CISIN_1g013062mg                   293   1e-93    Citrus sinensis [apfelsine]
emb|CAM58978.1|  alpha tubulin 5                                        287   1e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAX96763.1|  Tubulin/FtsZ family, GTPase domain, putative            290   1e-93    Oryza sativa Japonica Group [Japonica rice]
gb|AAW57305.1|  alpha-tubulin                                           289   2e-93    Ceratopteris richardii
gb|EYU37544.1|  hypothetical protein MIMGU_mgv1a007145mg                293   2e-93    Erythranthe guttata [common monkey flower]
gb|AIX10773.1|  alpha tubulin                                           294   2e-93    Panax notoginseng [san-qi]
gb|KJB29387.1|  hypothetical protein B456_005G097800                    294   2e-93    Gossypium raimondii
gb|EPS62716.1|  alpha-tubulin                                           292   2e-93    Genlisea aurea
ref|NP_176654.1|  tubulin alpha-1 chain                                 294   2e-93    Arabidopsis thaliana [mouse-ear cress]
sp|Q38771.1|TBA_AVESA  RecName: Full=Tubulin alpha chain                294   2e-93    Avena sativa [cultivated oat]
ref|XP_007515802.1|  alpha-tubulin                                      293   2e-93    Bathycoccus prasinos
gb|AAD11425.1|  alpha tubulin                                           291   2e-93    Mesembryanthemum crystallinum
gb|ADW83724.1|  alpha-tubulin                                           293   2e-93    Musa acuminata AAA Group [Cavendish banana]
emb|CAB76918.1|  alpha-tubulin 5                                        285   2e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003608582.1|  Tubulin alpha-5 chain                              294   2e-93    Medicago truncatula
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                293   2e-93    Nelumbo nucifera [Indian lotus]
gb|ABK92520.1|  unknown                                                 293   2e-93    Populus trichocarpa [western balsam poplar]
emb|CAN62392.1|  hypothetical protein VITISV_016172                     293   2e-93    Vitis vinifera
gb|AAO46127.1|  alpha-tubulin                                           286   2e-93    Streblomastix strix
ref|XP_009131752.1|  PREDICTED: tubulin alpha-3 chain-like              293   2e-93    Brassica rapa
gb|AEE98361.1|  alpha-tubulin                                           287   2e-93    Deschampsia antarctica
ref|XP_010093625.1|  Tubulin alpha chain                                293   2e-93    Morus notabilis
ref|XP_001764722.1|  predicted protein                                  293   2e-93    
gb|KHN46768.1|  Tubulin alpha-3 chain                                   293   2e-93    Glycine soja [wild soybean]
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             293   2e-93    Selaginella moellendorffii
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         293   2e-93    Jatropha curcas
gb|ACJ60905.1|  alpha tubulin                                           293   2e-93    Betula pendula [white birch]
ref|XP_007032501.1|  Tubulin alpha-2 chain                              293   2e-93    
gb|ACN40181.1|  unknown                                                 293   2e-93    Picea sitchensis
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     293   2e-93    Vitis vinifera
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                293   2e-93    Elaeis guineensis
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 293   2e-93    Populus trichocarpa [western balsam poplar]
gb|ABO47739.1|  alpha-tubulin                                           293   2e-93    Gossypium hirsutum [American cotton]
ref|NP_001289660.1|  tubulin alpha chain-like                           293   2e-93    Eucalyptus grandis [rose gum]
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     293   2e-93    Fragaria vesca subsp. vesca
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     293   2e-93    Pyrus x bretschneideri [bai li]
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        293   2e-93    Cucumis melo [Oriental melon]
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                   293   2e-93    Nelumbo nucifera [Indian lotus]
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        293   3e-93    Glycine max [soybeans]
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                293   3e-93    Phoenix dactylifera
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     293   3e-93    Eucalyptus grandis [rose gum]
gb|AGG37285.1|  alpha-tubulin 3                                         293   3e-93    Salix arbutifolia
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             293   3e-93    Citrus clementina [clementine]
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   293   3e-93    Populus euphratica
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                293   3e-93    Vitis vinifera
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                293   3e-93    Phoenix dactylifera
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     293   3e-93    Phoenix dactylifera
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    293   3e-93    Gossypium hirsutum [American cotton]
gb|ABL61201.1|  alpha-tubulin                                           288   3e-93    Oxymonadida environmental sample
gb|AIX10966.1|  tubulin                                                 293   3e-93    Ornithogalum longebracteatum [sea-onion]
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         293   3e-93    Jatropha curcas
gb|KHN08201.1|  Tubulin alpha chain                                     293   3e-93    Glycine soja [wild soybean]
ref|XP_002510010.1|  tubulin alpha chain, putative                      293   3e-93    Ricinus communis
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    293   3e-93    Citrus sinensis [apfelsine]
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             293   3e-93    Citrus clementina [clementine]
gb|ABX57816.1|  alpha tubulin                                           293   3e-93    Picea wilsonii
gb|AAV92352.1|  alpha tubulin 1                                         293   3e-93    Pseudotsuga menziesii var. menziesii
ref|XP_010104543.1|  Tubulin alpha chain                                293   3e-93    
gb|ETM52928.1|  tubulin alpha chain                                     291   3e-93    Phytophthora parasitica
gb|AAK37831.1|AF182309_1  alpha-tubulin                                 293   3e-93    Euglena gracilis
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             293   3e-93    Prunus persica
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                293   3e-93    Elaeis guineensis
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     293   3e-93    Nelumbo nucifera [Indian lotus]
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     293   3e-93    Vitis vinifera
gb|ABQ59633.1|  alpha-tubulin 3                                         293   3e-93    Populus tremuloides
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          293   3e-93    Malus domestica [apple tree]
ref|XP_002517492.1|  tubulin alpha chain, putative                      293   3e-93    Ricinus communis
ref|XP_002522104.1|  tubulin alpha chain, putative                      293   3e-93    Ricinus communis
gb|ABO47740.1|  alpha-tubulin                                           293   3e-93    Gossypium hirsutum [American cotton]
gb|ETM53002.1|  tubulin alpha chain                                     284   3e-93    Phytophthora parasitica
gb|AFW67749.1|  alpha tubulin4                                          289   3e-93    
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                293   3e-93    Tarenaya hassleriana [spider flower]
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                293   3e-93    Tarenaya hassleriana [spider flower]
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          293   3e-93    Tarenaya hassleriana [spider flower]
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                293   3e-93    Pyrus x bretschneideri [bai li]
gb|AID52921.1|  tubulin alpha chain                                     293   3e-93    Carthamus tinctorius
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              293   3e-93    Cucumis sativus [cucumbers]
gb|ABO47736.1|  alpha-tubulin                                           293   3e-93    Gossypium hirsutum [American cotton]
gb|KJB58757.1|  hypothetical protein B456_009G224800                    291   3e-93    Gossypium raimondii
ref|XP_007018369.1|  Tubulin alpha-2 chain                              293   3e-93    Theobroma cacao [chocolate]
gb|KHG18997.1|  Tubulin alpha chain                                     293   3e-93    Gossypium arboreum [tree cotton]
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                293   3e-93    Nelumbo nucifera [Indian lotus]
sp|P33625.1|TBA_EUGGR  RecName: Full=Tubulin alpha chain                293   3e-93    Euglena gracilis
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             293   3e-93    
ref|XP_007042689.1|  Tubulin alpha-2 chain                              293   3e-93    
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     293   3e-93    
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                293   3e-93    
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                293   3e-93    
ref|XP_003603670.1|  Tubulin alpha-7 chain                              293   3e-93    
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               293   3e-93    
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             293   3e-93    
ref|XP_010099392.1|  Tubulin alpha chain                                293   3e-93    
ref|XP_002886753.1|  alpha-1 tubulin                                    293   3e-93    
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                293   3e-93    
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         293   3e-93    
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             293   3e-93    
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                293   3e-93    
ref|XP_011398411.1|  Tubulin alpha chain                                291   3e-93    
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              293   4e-93    
gb|AAG28536.1|AF199019_1  alpha tubulin                                 284   4e-93    
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   293   4e-93    
gb|AGG37283.1|  alpha-tubulin 1                                         293   4e-93    
gb|AAO46130.1|  alpha-tubulin                                           286   4e-93    
ref|XP_007015700.1|  Tubulin alpha-5, putative                          296   4e-93    
gb|ABL61216.1|  alpha-tubulin                                           288   4e-93    
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             293   5e-93    
gb|AEQ75493.1|  alpha-tubulin                                           292   5e-93    
ref|XP_002324047.2|  hypothetical protein POPTR_0017s11740g             293   5e-93    
gb|AGV54497.1|  tubulin alpha-3 chain-like protein                      293   5e-93    
ref|XP_003554022.1|  PREDICTED: tubulin alpha-6 chain-like              293   5e-93    
gb|AGG37289.1|  alpha-tubulin 7                                         293   5e-93    
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     292   6e-93    
gb|ACK76232.1|  alpha-tubulin                                           292   6e-93    
gb|ABL61224.1|  alpha-tubulin                                           288   6e-93    
gb|ABL61215.1|  alpha-tubulin                                           288   6e-93    
gb|KDO81348.1|  hypothetical protein CISIN_1g013037mg                   292   6e-93    
gb|AEW46684.1|  beta-tubulin                                            292   6e-93    
gb|AAB36609.1|  alpha-tubulin                                           290   6e-93    
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                292   6e-93    
gb|ABL61212.1|  alpha-tubulin                                           288   7e-93    
ref|XP_009409992.1|  PREDICTED: tubulin alpha chain-like                292   7e-93    
ref|XP_007223365.1|  hypothetical protein PRUPE_ppa005617mg             292   7e-93    
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              292   7e-93    
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   292   7e-93    
sp|P33623.1|TBA1_ANEPH  RecName: Full=Tubulin alpha-1 chain             292   7e-93    
gb|ADJ00012.1|  tubulin alpha chain                                     285   7e-93    
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             292   7e-93    
gb|AFW67748.1|  alpha tubulin4                                          289   7e-93    
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     292   8e-93    
gb|AAU10519.1|  alpha tubulin                                           285   8e-93    
ref|XP_005651460.1|  tubulin alpha chain                                292   8e-93    
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   292   8e-93    
ref|XP_005851144.1|  alpha-tubulin                                      292   9e-93    
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        292   9e-93    
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   292   9e-93    
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          292   9e-93    
gb|ABD92937.1|  alpha tubulin-4A                                        292   9e-93    
gb|ABD92936.1|  alpha tubulin-4D                                        292   9e-93    
ref|XP_007047652.1|  Tubulin alpha-2 chain                              293   9e-93    
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    292   1e-92    
dbj|BAJ06364.1|  alpha-tubulin                                          292   1e-92    
ref|XP_005643073.1|  tubulin alpha chain                                292   1e-92    
ref|XP_003558668.1|  PREDICTED: tubulin alpha-2 chain-like              292   1e-92    
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             292   1e-92    
gb|EPY40479.1|  tubulin alpha                                           285   1e-92    
ref|XP_010096739.1|  Tubulin alpha chain                                292   1e-92    
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    292   1e-92    
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like              292   1e-92    
gb|AAB86648.1|  alpha-tubulin                                           292   1e-92    
ref|XP_004150268.1|  PREDICTED: tubulin alpha chain-like                291   1e-92    
gb|KIZ03400.1|  Tubulin alpha chain                                     291   1e-92    
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g             291   1e-92    
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    291   1e-92    
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             291   1e-92    
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     291   1e-92    
gb|KHN42598.1|  Tubulin alpha-2 chain                                   291   1e-92    
gb|AAB86649.1|  alpha-tubulin                                           291   1e-92    
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    291   1e-92    
gb|EYU34660.1|  hypothetical protein MIMGU_mgv1a006269mg                291   1e-92    
gb|KEH43997.1|  tubulin beta-1 chain                                    291   1e-92    
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                291   1e-92    
gb|KJB33191.1|  hypothetical protein B456_006G002500                    282   1e-92    
gb|ABC59068.2|  alpha tubulin 1                                         291   1e-92    
gb|AAX63396.1|  alpha-tubulin                                           291   1e-92    
gb|KDD76276.1|  tubulin/FtsZ GTPase                                     291   2e-92    
gb|EPY33355.1|  tubulin alpha                                           287   2e-92    
ref|WP_039310890.1|  hypothetical protein                               291   2e-92    
gb|ETM53018.1|  tubulin alpha chain                                     285   2e-92    
gb|EPY39349.1|  tubulin alpha                                           286   2e-92    
ref|XP_007143142.1|  hypothetical protein PHAVU_007G047300g             291   2e-92    
ref|XP_009537046.1|  hypothetical protein PHYSODRAFT_340566             287   2e-92    
gb|ABL61202.1|  alpha-tubulin                                           286   2e-92    
ref|XP_008877307.1|  tubulin alpha chain                                288   2e-92    
gb|ABL61219.1|  alpha-tubulin                                           286   2e-92    
dbj|BAG99724.1|  unnamed protein product                                290   2e-92    
gb|ABO47737.1|  alpha-tubulin                                           291   2e-92    
gb|ABF98641.1|  Tubulin alpha-1 chain, putative, expressed              290   2e-92    
ref|NP_001291325.1|  tubulin alpha chain-like                           291   2e-92    
dbj|BAC24800.1|  alpha tubulin                                          291   2e-92    
emb|CDP02221.1|  unnamed protein product                                291   2e-92    
gb|ABL61204.1|  alpha-tubulin                                           286   2e-92    
gb|AAO46128.1|  alpha-tubulin                                           284   3e-92    
ref|XP_002963093.1|  hypothetical protein SELMODRAFT_404672             291   3e-92    
ref|XP_002508010.1|  alpha tubulin 2                                    291   3e-92    
gb|ETW27380.1|  tubulin alpha chain                                     286   3e-92    
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058             291   3e-92    
prf||1503274A  alpha1 tubulin                                           291   3e-92 
gb|KIZ01406.1|  Tubulin alpha-1 chain                                   291   3e-92    
gb|ABL61213.1|  alpha-tubulin                                           286   3e-92    
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     291   3e-92    
emb|CAB66336.1|  alpha-tubulin                                          291   3e-92    
ref|XP_004232226.1|  PREDICTED: tubulin alpha chain-like                290   3e-92    
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g             290   4e-92    
gb|ABQ59634.1|  alpha-tubulin 5                                         290   4e-92    
gb|ETM30643.1|  tubulin alpha chain                                     290   4e-92    
dbj|BAP59012.1|  alpha tubulin                                          290   4e-92    
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             290   4e-92    
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                290   4e-92    
gb|ABL61227.1|  alpha-tubulin                                           286   4e-92    
ref|XP_002782100.1|  Tubulin alpha chain, putative                      286   4e-92    
gb|AFK33477.1|  unknown                                                 287   4e-92    
gb|AHJ80823.1|  Tua1                                                    290   4e-92    
gb|ABL61217.1|  alpha-tubulin                                           286   4e-92    
sp|P28287.1|TBA_OXYGR  RecName: Full=Tubulin alpha chain                290   4e-92    
gb|ETM52951.1|  tubulin alpha chain                                     290   4e-92    
emb|CDO97305.1|  unnamed protein product                                290   4e-92    
ref|XP_009626810.1|  PREDICTED: tubulin alpha chain-like                290   4e-92    
ref|XP_003058621.1|  alpha tubulin                                      290   4e-92    
emb|CDW82295.1|  alpha tubulin                                          290   4e-92    
gb|EJY81124.1|  Alpha tubulin,putative                                  290   4e-92    
gb|ABP65323.1|  alpha tubulin                                           290   4e-92    
gb|ABL61203.1|  alpha-tubulin                                           285   4e-92    
ref|XP_008665337.1|  PREDICTED: tubulin alpha-1 chain-like              290   4e-92    
ref|XP_008665339.1|  PREDICTED: tubulin alpha-2 chain                   290   4e-92    
gb|AHJ80817.1|  Tua1                                                    290   5e-92    
ref|NP_001167663.1|  tubulin alpha-3 chain                              290   5e-92    
sp|O22347.1|TBA1_ELEIN  RecName: Full=Tubulin alpha-1 chain; AltN...    290   5e-92    
gb|AFC88832.1|  putative tubulin alpha-3 chain                          290   5e-92    
tpg|DAA51109.1|  TPA: alpha tubulin                                     290   5e-92    
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                290   5e-92    
dbj|BAJ06362.1|  alpha-tubulin                                          290   5e-92    
ref|XP_003560377.1|  PREDICTED: tubulin alpha-1 chain                   290   5e-92    
ref|XP_004981922.1|  PREDICTED: tubulin alpha-1 chain-like              290   5e-92    
gb|AHJ80815.1|  Tua1                                                    290   5e-92    
ref|XP_002466535.1|  hypothetical protein SORBIDRAFT_01g009570          290   5e-92    
gb|ABL61226.1|  alpha-tubulin                                           285   5e-92    
emb|CDY29334.1|  BnaA05g16010D                                          290   5e-92    
gb|ETP23198.1|  tubulin alpha chain                                     287   5e-92    
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              290   5e-92    
gb|AEF79970.1|  alpha-tubulin protein                                   290   5e-92    
ref|XP_002980240.1|  hypothetical protein SELMODRAFT_419896             289   5e-92    
emb|CAA06619.1|  alpha-tubulin 1                                        290   5e-92    
gb|AAT09063.1|  alpha tubulin 1                                         290   5e-92    
gb|AIA82435.1|  alpha-tubulin-like protein 03                           290   5e-92    
ref|XP_009842456.1|  tubulin alpha chain                                290   5e-92    
gb|AGG37287.1|  alpha-tubulin 5                                         290   5e-92    
sp|Q25563.1|TBA13_NAEGR  RecName: Full=Tubulin alpha-13 chain           290   5e-92    
ref|NP_001275271.1|  alpha-tubulin-like protein                         290   5e-92    
ref|XP_008872990.1|  tubulin alpha chain                                290   5e-92    
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like                290   6e-92    
emb|CEG01594.1|  Tubulin/FtsZ, 2-layer sandwich domain                  290   6e-92    
gb|ETO82054.1|  tubulin alpha chain                                     290   6e-92    
emb|CAD13176.1|  alpha-tubulin                                          290   6e-92    
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   290   6e-92    
emb|CCI41153.1|  unnamed protein product                                290   6e-92    
ref|XP_002904195.1|  alpha-tubulin, putative                            290   6e-92    
ref|XP_008900864.1|  tubulin alpha chain                                290   6e-92    
gb|KJB34154.1|  hypothetical protein B456_006G050600                    282   6e-92    
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain             290   6e-92    
gb|EWC76931.1|  tubulin alpha chain                                     285   6e-92    
gb|ACH68563.1|  alpha-tubulin                                           290   6e-92    
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   290   6e-92    
ref|XP_002904194.1|  alpha-tubulin                                      290   6e-92    
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              290   6e-92    
ref|XP_002675196.1|  alpha-tubulin                                      290   6e-92    
gb|ABO47742.1|  alpha-tubulin                                           290   6e-92    
gb|AIA82433.1|  alpha-tubulin-like protein 01                           290   6e-92    
gb|ABU93324.1|  tubulin alpha subunit                                   290   6e-92    
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                290   6e-92    
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              290   6e-92    
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     290   6e-92    
gb|ABU93321.1|  tubulin alpha subunit                                   290   6e-92    
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     290   6e-92    
ref|XP_007512064.1|  alpha-tubulin                                      290   6e-92    
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like              290   6e-92    
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like              290   6e-92    
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             290   6e-92    
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              290   7e-92    
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     290   7e-92    
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    290   7e-92    
gb|ABB02631.1|  unknown                                                 290   7e-92    
ref|XP_001566612.1|  alpha tubulin                                      283   7e-92    
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             290   7e-92    
emb|CDY66630.1|  BnaCnng51680D                                          289   7e-92    
ref|XP_001770881.1|  predicted protein                                  290   7e-92    
gb|ABL61214.1|  alpha-tubulin                                           285   7e-92    
gb|ABP65320.1|  alpha tubulin                                           290   7e-92    
ref|XP_002904167.1|  cleavage induced tubulin alpha chain               285   8e-92    
ref|XP_002980239.1|  hypothetical protein SELMODRAFT_233509             290   8e-92    
gb|ABV55999.1|  alpha-tubulin 7                                         290   8e-92    
emb|CDJ60085.1|  tubulin alpha chain, putative                          288   8e-92    
gb|EPR58771.1|  alpha tubulin TUBA1                                     289   8e-92    
emb|CAB77671.1|  alpha-tubulin                                          290   9e-92    
gb|ABU93323.1|  tubulin alpha subunit                                   290   9e-92    
ref|XP_006650524.1|  PREDICTED: tubulin alpha-1 chain-like              290   9e-92    
ref|XP_003080933.1|  TBA_CHLVU Tubulin alpha chain (ISS)                290   9e-92    
ref|XP_002951007.1|  alpha tubulin                                      289   1e-91    
ref|XP_001419217.1|  predicted protein                                  289   1e-91    
gb|AAO46126.1|  alpha-tubulin                                           282   1e-91    
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          289   1e-91    
ref|XP_006431130.1|  hypothetical protein CICLE_v10011709mg             289   1e-91    
ref|XP_003558477.1|  PREDICTED: tubulin alpha-2 chain                   289   1e-91    
ref|NP_171974.1|  tubulin alpha-4 chain                                 289   1e-91    
emb|CAA62916.1|  alpha-tubulin                                          289   1e-91    
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                   289   1e-91    
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        289   1e-91    
ref|NP_193232.1|  tubulin alpha-6 chain                                 289   1e-91    
gb|ABL61218.1|  alpha-tubulin                                           284   1e-91    
gb|AAB08791.1|  alpha tubulin                                           289   1e-91    
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    289   1e-91    
ref|NP_001051132.1|  Os03g0726100                                       289   1e-91    
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              289   2e-91    
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain                289   2e-91    
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             289   2e-91    



>ref|XP_008384431.1| PREDICTED: tubulin alpha-3 chain-like [Malus domestica]
Length=282

 Score =   305 bits (781),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQ+S+PEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  112  AKAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  171

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  172  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  202

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  203  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  262

Query  201  K  199
            K
Sbjct  263  K  263



>ref|XP_010420792.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
Length=183

 Score =   299 bits (766),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 151/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTK
Sbjct  12   AKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTK  71

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  72   RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  102

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  103  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  162

Query  201  K  199
            K
Sbjct  163  K  163



>emb|CAD20821.1| alpha tubulin [Zea mays]
Length=274

 Score =   302 bits (774),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  104  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  163

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  164  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  194

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  195  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  254



>gb|ABR25510.1| tubulin alpha-1 chain [Oryza sativa Indica Group]
Length=255

 Score =   301 bits (772),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  85   KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  144

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  145  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  175

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  176  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  235



>dbj|BAH20267.1| AT5G19780 [Arabidopsis thaliana]
Length=284

 Score =   302 bits (773),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 151/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTK
Sbjct  113  AKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTK  172

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  173  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  203

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  204  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  263

Query  201  K  199
            K
Sbjct  264  K  264



>emb|CAD20820.1| alpha tubulin [Zea mays]
Length=200

 Score =   299 bits (765),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  30   KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  89

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  90   TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  120

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  121  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  180



>dbj|BAD94893.1| tubulin alpha-5 chain-like protein [Arabidopsis thaliana]
Length=183

 Score =   298 bits (763),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 151/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITNAVFEP+SMMAKCDP+HGKYMACCLMYRGDVVPKDVN+AV TIKTK
Sbjct  12   AKAYHEQLSVPEITNAVFEPASMMAKCDPKHGKYMACCLMYRGDVVPKDVNAAVGTIKTK  71

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  72   RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  102

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  103  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  162

Query  201  K  199
            K
Sbjct  163  K  163



>emb|CAL35827.1| alpha-2 tubulin [Plantago major]
Length=249

 Score =   300 bits (769),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 150/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLS+PEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTKR
Sbjct  79   KAYHEQLSIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKR  138

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  139  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  169

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  170  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  229



>ref|XP_001777110.1| predicted protein [Physcomitrella patens]
 gb|EDQ58103.1| predicted protein [Physcomitrella patens]
Length=344

 Score =   304 bits (778),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  175  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  234

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  235  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  265

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  266  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  325



>gb|KJB83378.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=404

 Score =   304 bits (779),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLS+PEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  235  KAYHEQLSIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  294

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  295  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  325

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  326  VQRAVCMISNNTAVAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  385



>ref|XP_009413318.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   306 bits (783),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLAR
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAR  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_004295008.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   305 bits (781),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQ+SVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  279  AKAYHEQISVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>tpg|DAA41189.1| TPA: alpha tubulin5 [Zea mays]
Length=320

 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  150  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  209

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  210  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  240

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  241  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  300



>ref|XP_010276368.1| PREDICTED: tubulin alpha-3 chain-like [Nelumbo nucifera]
Length=450

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLAR
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAR  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_009375870.1| PREDICTED: tubulin alpha-3 chain [Pyrus x bretschneideri]
Length=449

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQ+S+PEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  279  AKAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>emb|CDP17586.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>tpg|DAA63280.1| TPA: alpha tubulin6 [Zea mays]
Length=320

 Score =   300 bits (768),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  150  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  209

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  210  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  240

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  241  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  300



>ref|XP_011075054.1| PREDICTED: tubulin alpha-3 chain-like [Sesamum indicum]
Length=449

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVA+IKTK
Sbjct  279  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVASIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            RVQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  RVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|XP_008349406.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
 ref|XP_008366135.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
 ref|XP_009339175.1| PREDICTED: tubulin alpha-3 chain-like [Pyrus x bretschneideri]
Length=449

 Score =   304 bits (779),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQ+S+PEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  279  AKAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|XP_011089722.1| PREDICTED: tubulin alpha-3 chain [Sesamum indicum]
Length=449

 Score =   304 bits (779),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  279  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|XP_008351479.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
Length=449

 Score =   304 bits (779),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQ+S+PEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  279  AKAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|XP_008813089.1| PREDICTED: tubulin alpha-3 chain [Phoenix dactylifera]
Length=450

 Score =   304 bits (779),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLAR
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAR  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_010257632.1| PREDICTED: tubulin alpha-3 chain [Nelumbo nucifera]
Length=449

 Score =   304 bits (779),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLAR
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAR  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|AGG37288.1| alpha-tubulin 6 [Salix arbutifolia]
Length=449

 Score =   304 bits (779),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNS+VATIKTK
Sbjct  279  AKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSSVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|XP_011034391.1| PREDICTED: tubulin alpha-3 chain [Populus euphratica]
Length=449

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAV+TIKTK
Sbjct  279  AKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVSTIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>sp|P33624.1|TBA2_ANEPH RecName: Full=Tubulin alpha-2 chain, partial [Anemia phyllitidis]
 emb|CAA48928.1| alpha tubulin 2, partial [Anemia phyllitidis]
Length=364

 Score =   301 bits (771),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 151/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  195  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  254

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA
Sbjct  255  RTVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLA  285

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+K AFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  286  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKLAFVHWYVGEGMEEGEFSEAREDLAALE  345

Query  201  K  199
            K
Sbjct  346  K  346



>gb|EYU23006.1| hypothetical protein MIMGU_mgv1a006283mg [Erythranthe guttata]
Length=449

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|AHJ80821.1| Tua3, partial [Eragrostis tef]
Length=401

 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  231  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  290

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  291  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  321

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  322  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  381



>ref|XP_006858944.1| hypothetical protein AMTR_s00068p00090790 [Amborella trichopoda]
 gb|ERN20411.1| hypothetical protein AMTR_s00068p00090790 [Amborella trichopoda]
Length=449

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|AHZ58481.1| alpha-tubulin, partial [Syntrichia caninervis]
Length=200

 Score =   295 bits (755),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  31   KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  90

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  91   TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  121

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  122  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  181



>gb|AGD80034.1| alpha-tubulin 1 [Hevea brasiliensis]
Length=449

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLAR
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAR  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_010934670.1| PREDICTED: tubulin alpha-3 chain-like [Elaeis guineensis]
Length=450

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLAR
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAR  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|KCW87067.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=381

 Score =   301 bits (772),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  212  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  271

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINY+PPTVVPGGDLA+
Sbjct  272  TVQFVDW-----------------------------CPTGFKCGINYEPPTVVPGGDLAK  302

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  303  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  362



>gb|EYU31677.1| hypothetical protein MIMGU_mgv1a006281mg [Erythranthe guttata]
Length=449

 Score =   303 bits (777),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 151/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTK
Sbjct  279  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|XP_009353129.1| PREDICTED: tubulin alpha-3 chain-like [Pyrus x bretschneideri]
Length=449

 Score =   303 bits (777),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEIT++VFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  279  AKAYHEQLSVPEITSSVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>gb|ACN40824.1| unknown [Picea sitchensis]
Length=449

 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|AGG37290.1| alpha-tubulin 8 [Salix arbutifolia]
Length=449

 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQ+SVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAV+TIKTK
Sbjct  279  AKAYHEQISVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVSTIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>gb|KHG06160.1| Tubulin alpha-3/alpha-5 chain -like protein [Gossypium arboreum]
Length=449

 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_011025144.1| PREDICTED: tubulin alpha-3 chain [Populus euphratica]
Length=450

 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_002325422.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
 gb|EEE99803.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
Length=449

 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQ+SVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAV+TIKTK
Sbjct  279  AKAYHEQISVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVSTIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>gb|AEG74028.1| alpha-tubulin [Pellia endiviifolia (species B)]
 gb|AEG74032.1| alpha-tubulin [Pellia endiviifolia (species B)]
Length=448

 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_002303998.1| alpha-tubulin 2 family protein [Populus trichocarpa]
 gb|EEE78977.1| alpha-tubulin 2 family protein [Populus trichocarpa]
Length=450

 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_011021469.1| PREDICTED: tubulin alpha-3 chain-like [Populus euphratica]
Length=449

 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQ+SVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAV+TIKTK
Sbjct  279  AKAYHEQISVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVSTIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>gb|KHN06388.1| Tubulin alpha-3 chain [Glycine soja]
Length=421

 Score =   302 bits (773),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  251  AKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  310

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA
Sbjct  311  RTVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLA  341

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  342  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  401

Query  201  K  199
            K
Sbjct  402  K  402



>ref|XP_006286664.1| hypothetical protein CARUB_v10002583mg [Capsella rubella]
 ref|XP_010493056.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 ref|XP_010493058.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 gb|EOA19562.1| hypothetical protein CARUB_v10002583mg [Capsella rubella]
Length=450

 Score =   303 bits (776),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 151/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTK
Sbjct  279  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|XP_010112637.1| Tubulin alpha-3 chain [Morus notabilis]
 gb|EXC34492.1| Tubulin alpha-3 chain [Morus notabilis]
Length=449

 Score =   303 bits (776),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 150/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_001777081.1| predicted protein [Physcomitrella patens]
 gb|EDQ58074.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   303 bits (776),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_002285721.1| PREDICTED: tubulin alpha-3 chain [Vitis vinifera]
Length=449

 Score =   303 bits (776),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_009406530.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   303 bits (776),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_006445597.1| hypothetical protein CICLE_v10015224mg [Citrus clementina]
 ref|XP_006488930.1| PREDICTED: tubulin alpha-1 chain-like isoform X1 [Citrus sinensis]
 gb|ESR58837.1| hypothetical protein CICLE_v10015224mg [Citrus clementina]
 gb|KDO54446.1| hypothetical protein CISIN_1g013113mg [Citrus sinensis]
Length=449

 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_008386829.1| PREDICTED: tubulin alpha-3 chain-like [Malus domestica]
Length=449

 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKA+HEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  279  AKAFHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|XP_008223650.1| PREDICTED: tubulin alpha-3 chain-like [Prunus mume]
Length=450

 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQ+S+PEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|AHJ80820.1| Tua3, partial [Eragrostis tef]
Length=400

 Score =   301 bits (771),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPE+TNAVFEPSSMMAKCDPRHGKYMACCLMYRGDV+PKDVN+AVATIKTKR
Sbjct  230  KAYHEQLSVPEVTNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVIPKDVNAAVATIKTKR  289

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  290  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  320

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  321  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  380



>ref|XP_010673470.1| PREDICTED: tubulin alpha-3 chain [Beta vulgaris subsp. vulgaris]
Length=449

 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLS+PEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_009400845.1| PREDICTED: tubulin alpha-3 chain [Musa acuminata subsp. malaccensis]
Length=450

 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_007205189.1| hypothetical protein PRUPE_ppa005642mg [Prunus persica]
 gb|EMJ06388.1| hypothetical protein PRUPE_ppa005642mg [Prunus persica]
Length=450

 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQ+S+PEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_008804327.1| PREDICTED: tubulin alpha-1 chain-like [Phoenix dactylifera]
Length=450

 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|KJB83375.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=449

 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLS+PEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_001782790.1| predicted protein [Physcomitrella patens]
 ref|XP_001782813.1| predicted protein [Physcomitrella patens]
 dbj|BAC24799.1| alpha tubulin [Physcomitrella patens]
 gb|EDQ52367.1| predicted protein [Physcomitrella patens]
 gb|EDQ52390.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|KDP39691.1| hypothetical protein JCGZ_02711 [Jatropha curcas]
Length=449

 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  279  AKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>gb|AGG37284.1| alpha-tubulin 2 [Salix arbutifolia]
Length=450

 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLS+PEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|ABO47741.1| alpha-tubulin [Gossypium hirsutum]
Length=449

 Score =   303 bits (775),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_002319688.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
 gb|EEE95611.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
Length=449

 Score =   303 bits (775),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK
Sbjct  279  AKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRID+KFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDYKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|XP_007030078.1| Tubulin alpha-5 [Theobroma cacao]
 gb|EOY10580.1| Tubulin alpha-5 [Theobroma cacao]
Length=482

 Score =   303 bits (777),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  312  AKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  371

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RT+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  372  RTIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  402

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  403  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  462

Query  201  K  199
            K
Sbjct  463  K  463



>gb|ABO47735.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG06862.1| Tubulin alpha-6 chain [Gossypium arboreum]
 gb|KJB66054.1| hypothetical protein B456_010G125700 [Gossypium raimondii]
 gb|KJB66055.1| hypothetical protein B456_010G125700 [Gossypium raimondii]
Length=449

 Score =   302 bits (774),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_009408459.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=450

 Score =   302 bits (774),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|KHG06861.1| Tubulin alpha-6 chain [Gossypium arboreum]
Length=460

 Score =   303 bits (775),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  291  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  350

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  351  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  381

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  382  VQRAVCMISNNTAVAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  441



>emb|CDY44941.1| BnaA02g04460D [Brassica napus]
 emb|CDY44942.1| BnaA02g04470D [Brassica napus]
Length=450

 Score =   302 bits (774),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 151/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLS+PEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTK
Sbjct  279  AKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>gb|ABB16994.1| unknown [Solanum tuberosum]
Length=467

 Score =   303 bits (775),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  298  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  357

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  358  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  388

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  389  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  448



>gb|AGI78243.1| alpha tubulin 5, partial [Caragana korshinskii]
Length=240

 Score =   295 bits (755),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 148/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQ+S+PEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV+ IKTKR
Sbjct  90   KAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVSNIKTKR  149

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  150  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  180

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            V RAVC+ISNNTAVAEVFSRID KFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  181  VMRAVCMISNNTAVAEVFSRIDQKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  240



>ref|XP_006443441.1| hypothetical protein CICLE_v10020128mg [Citrus clementina]
 ref|XP_006479124.1| PREDICTED: tubulin alpha-3 chain-like [Citrus sinensis]
 gb|ESR56681.1| hypothetical protein CICLE_v10020128mg [Citrus clementina]
Length=449

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 151/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQ+SVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  279  AKAYHEQISVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNTAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            R VQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RAVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            RVQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  RVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>sp|Q43473.1|TBA1_HORVU RecName: Full=Tubulin alpha-1 chain [Hordeum vulgare]
 emb|CAA67942.1| alpha-tubulin 1 [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|KHG26159.1| Tubulin alpha-6 chain [Gossypium arboreum]
Length=449

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  279  AKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            RVQRAVC+ISNNT+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  RVQRAVCMISNNTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>dbj|BAJ06363.1| alpha-tubulin [Alopecurus aequalis]
Length=450

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|KHN47983.1| Tubulin alpha-3 chain [Glycine soja]
Length=423

 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  252  AKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  311

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA
Sbjct  312  RTVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLA  342

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  343  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  402

Query  201  K  199
            K
Sbjct  403  K  403



>gb|ABD92942.1| alpha tubulin-1D [Triticum aestivum]
 gb|ABD92944.1| alpha tubulin-1A [Triticum aestivum]
 gb|EMS54563.1| Tubulin alpha-1 chain [Triticum urartu]
 gb|EMT26472.1| Tubulin alpha-1 chain [Aegilops tauschii]
Length=450

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_003562846.1| PREDICTED: tubulin alpha-1 chain [Brachypodium distachyon]
Length=450

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_004958110.1| PREDICTED: tubulin alpha-3 chain-like [Setaria italica]
Length=450

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_006657877.1| PREDICTED: tubulin alpha-3 chain-like [Oryza brachyantha]
Length=450

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>emb|CAD26891.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_010531152.1| PREDICTED: tubulin alpha-3 chain [Tarenaya hassleriana]
Length=449

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 151/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTK
Sbjct  279  AKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>emb|CDX88875.1| BnaA03g07740D [Brassica napus]
 emb|CDX70890.1| BnaC03g09740D [Brassica napus]
Length=450

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 151/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTK
Sbjct  279  AKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|XP_010923361.1| PREDICTED: tubulin alpha-3 chain [Elaeis guineensis]
Length=450

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>emb|CAD26886.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_010044940.1| PREDICTED: tubulin alpha-3 chain [Eucalyptus grandis]
 gb|KCW87066.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=449

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINY+PPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYEPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|NP_001105588.1| tubulin alpha-6 chain [Zea mays]
 sp|P33627.1|TBA6_MAIZE RecName: Full=Tubulin alpha-6 chain; AltName: Full=Alpha-6-tubulin 
[Zea mays]
 emb|CAA44863.1| alpha-tubulin #6 [Zea mays]
 gb|ACN35801.1| unknown [Zea mays]
 gb|AFE82989.1| tubulin alpha-5 [Saccharum hybrid cultivar]
 tpg|DAA63282.1| TPA: alpha tubulin6 [Zea mays]
Length=450

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|NP_197478.1| tubulin alpha-3 [Arabidopsis thaliana]
 ref|NP_197479.1| tubulin alpha-5 [Arabidopsis thaliana]
 ref|XP_002871906.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002873963.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006400538.1| hypothetical protein EUTSA_v10013521mg [Eutrema salsugineum]
 ref|XP_006400540.1| hypothetical protein EUTSA_v10013523mg [Eutrema salsugineum]
 ref|XP_010420793.1| PREDICTED: tubulin alpha-3 chain [Camelina sativa]
 sp|Q56WH1.2|TBA3_ARATH RecName: Full=Tubulin alpha-3 chain [Arabidopsis thaliana]
 sp|B9DHQ0.2|TBA5_ARATH RecName: Full=Tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAK32888.1|AF367301_1 AT5g19770/T29J13_190 [Arabidopsis thaliana]
 gb|AAA32888.1| alpha-tubulin [Arabidopsis thaliana]
 gb|AAA32891.1| alpha-5 tubulin [Arabidopsis thaliana]
 gb|AAK64169.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAL38340.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85097.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN31860.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN31861.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN28834.1| At5g19770/T29J13_190 [Arabidopsis thaliana]
 gb|AAN65084.1| unknown protein [Arabidopsis thaliana]
 gb|EFH48165.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50222.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 gb|AED92747.1| tubulin alpha-3 [Arabidopsis thaliana]
 gb|AED92748.1| tubulin alpha-5 [Arabidopsis thaliana]
 gb|ESQ41991.1| hypothetical protein EUTSA_v10013521mg [Eutrema salsugineum]
 gb|ESQ41993.1| hypothetical protein EUTSA_v10013523mg [Eutrema salsugineum]
 gb|KFK26213.1| tubulin alpha-3 alpha-5 chain [Arabis alpina]
 gb|KFK26214.1| hypothetical protein AALP_AA8G217400 [Arabis alpina]
Length=450

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 151/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTK
Sbjct  279  AKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|NP_001105324.1| tubulin alpha-5 chain [Zea mays]
 sp|Q02245.1|TBA5_MAIZE RecName: Full=Tubulin alpha-5 chain; AltName: Full=Alpha-5-tubulin 
[Zea mays]
 emb|CAA44862.1| alpha-tubulin #5 [Zea mays]
 gb|AAA33437.1| alpha-tubulin [Zea mays]
 gb|AAA16225.1| alpha-tubulin [Zea mays]
 emb|CAD20822.1| alpha tubulin [Zea mays]
 tpg|DAA41190.1| TPA: alpha tubulin5 [Zea mays]
Length=450

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_010535933.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Tarenaya hassleriana]
Length=449

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 151/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTK
Sbjct  279  AKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>emb|CDY42294.1| BnaC02g09000D [Brassica napus]
 emb|CDY42295.1| BnaC02g09010D [Brassica napus]
Length=450

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 151/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTK
Sbjct  279  AKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>emb|CAD24765.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_009366459.1| PREDICTED: tubulin alpha-3 chain [Pyrus x bretschneideri]
Length=449

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKA+HEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKT+
Sbjct  279  AKAFHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTR  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|XP_002532068.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF30323.1| tubulin alpha chain, putative [Ricinus communis]
Length=449

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>sp|O22349.1|TBA3_ELEIN RecName: Full=Tubulin alpha-3 chain; AltName: Full=Alpha-3-tubulin 
[Eleusine indica]
 gb|AAC05719.1| alpha-tubulin 3 [Eleusine indica]
Length=450

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|NP_001242878.1| uncharacterized protein LOC100806907 [Glycine max]
 gb|ACU18050.1| unknown [Glycine max]
Length=450

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  279  AKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|XP_010454260.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 ref|XP_010454262.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
Length=450

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 151/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTK
Sbjct  279  AKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|NP_001060075.1| Os07g0574800 [Oryza sativa Japonica Group]
 sp|P28752.1|TBA1_ORYSJ RecName: Full=Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 emb|CAA77988.1| alpha 1 tubulin [Oryza sativa Japonica Group]
 emb|CAA62918.1| alfa-tubulin [Oryza sativa Japonica Group]
 dbj|BAC83168.1| Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 dbj|BAD30236.1| Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 gb|ABG78594.1| alpha-tubulin [Oryza sativa Japonica Group]
 dbj|BAF21989.1| Os07g0574800 [Oryza sativa Japonica Group]
 gb|EAZ04436.1| hypothetical protein OsI_26583 [Oryza sativa Indica Group]
 gb|EAZ40391.1| hypothetical protein OsJ_24840 [Oryza sativa Japonica Group]
 dbj|BAG90561.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91280.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97017.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGH17548.1| alpha tubulin [Oryza sativa]
Length=450

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|AGY80453.1| tubulin [Dendrocalamus latiflorus]
Length=450

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_009120857.1| PREDICTED: tubulin alpha-3 chain [Brassica rapa]
 emb|CDX92501.1| BnaA10g15400D [Brassica napus]
 emb|CDX92502.1| BnaA10g15410D [Brassica napus]
Length=450

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 151/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLS+PEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTK
Sbjct  279  AKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|XP_004149645.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 ref|XP_004164931.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 gb|KGN54025.1| hypothetical protein Csa_4G268090 [Cucumis sativus]
Length=449

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 150/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA 
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAL  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_009126389.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 151/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLS+PEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTK
Sbjct  279  AKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|NP_001237301.1| tubulin A [Glycine max]
 gb|AAX86047.1| tubulin A [Glycine max]
Length=450

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  279  AKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|XP_007159433.1| hypothetical protein PHAVU_002G237400g [Phaseolus vulgaris]
 gb|ESW31427.1| hypothetical protein PHAVU_002G237400g [Phaseolus vulgaris]
Length=449

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  279  AKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|XP_002525416.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF36906.1| tubulin alpha chain, putative [Ricinus communis]
Length=449

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKA+HEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  279  AKAFHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>gb|AGG37286.1| alpha-tubulin 4 [Salix arbutifolia]
Length=450

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLS+PEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIK+KR
Sbjct  280  KAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKSKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_006579487.1| PREDICTED: tubulin A isoform X1 [Glycine max]
Length=449

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  279  AKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>gb|KJB44614.1| hypothetical protein B456_007G261000 [Gossypium raimondii]
Length=449

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGD+VPKDVN+AVATIKTK
Sbjct  279  AKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDIVPKDVNAAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            RVQRAVC+ISNNT+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  RVQRAVCMISNNTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|XP_009389058.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=450

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_009126391.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 151/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLS+PEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTK
Sbjct  279  AKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|XP_008449885.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Cucumis melo]
Length=449

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 150/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA 
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAL  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|AFR42026.1| alpha-tubulin, partial [Populus trichocarpa]
Length=196

 Score =   292 bits (748),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  41   KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  100

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  101  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  131

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  132  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  191



>ref|XP_009622332.1| PREDICTED: tubulin alpha-3 chain [Nicotiana tomentosiformis]
 ref|XP_009766182.1| PREDICTED: tubulin alpha-3 chain [Nicotiana sylvestris]
Length=449

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KA+HEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAFHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_011048194.1| PREDICTED: tubulin alpha-6 chain-like [Populus euphratica]
Length=450

 Score =   301 bits (771),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLS+PEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIK+KR
Sbjct  280  KAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKSKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|KCW87065.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=458

 Score =   301 bits (771),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  289  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  348

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINY+PPTVVPGGDLA+
Sbjct  349  TVQFVDW-----------------------------CPTGFKCGINYEPPTVVPGGDLAK  379

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  380  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  439



>ref|XP_002297631.1| alpha-tubulin 2 family protein [Populus trichocarpa]
 gb|ABK92439.1| unknown [Populus trichocarpa]
 gb|EEE82436.1| alpha-tubulin 2 family protein [Populus trichocarpa]
Length=450

 Score =   301 bits (771),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLS+PEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIK+KR
Sbjct  280  KAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKSKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|AFR42049.1| alpha-tubulin, partial [Populus fremontii]
Length=197

 Score =   292 bits (748),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  41   KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  100

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  101  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  131

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  132  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  191



>gb|ABR67425.1| alpha-tubulin 4 [Populus tremuloides]
Length=450

 Score =   301 bits (771),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLS+PEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIK+KR
Sbjct  280  KAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKSKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|AFR42054.1| alpha-tubulin, partial [Populus fremontii]
Length=196

 Score =   292 bits (747),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  40   KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  99

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  100  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  130

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  131  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  190



>gb|KJB58759.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=340

 Score =   297 bits (761),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  170  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  229

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  230  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  260

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  261  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  320



>gb|AFR42035.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42040.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42044.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42052.1| alpha-tubulin, partial [Populus fremontii]
Length=196

 Score =   292 bits (747),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  40   KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  99

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  100  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  130

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  131  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  190



>gb|AFR42020.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42021.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42022.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42023.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42024.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42025.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42027.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42028.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42029.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42030.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42031.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42032.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42033.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42034.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42037.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42038.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42039.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42041.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42045.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42046.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42048.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42056.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42057.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42058.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42059.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42060.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42061.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42062.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42063.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42064.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42065.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42066.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42067.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42068.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42069.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42070.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42071.1| alpha-tubulin, partial [Populus nigra]
Length=197

 Score =   292 bits (747),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  41   KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  100

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  101  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  131

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  132  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  191



>gb|AFR42036.1| alpha-tubulin, partial [Populus alba]
Length=195

 Score =   292 bits (747),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  39   KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  98

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  99   TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  129

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  130  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  189



>emb|CAD24768.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   301 bits (770),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHG+YMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGRYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|AFR42042.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42043.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42050.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42051.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42053.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42055.1| alpha-tubulin, partial [Populus fremontii]
Length=194

 Score =   291 bits (746),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  38   KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  97

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  98   TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  128

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  129  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  188



>ref|XP_004504311.1| PREDICTED: tubulin alpha-3 chain-like [Cicer arietinum]
Length=449

 Score =   300 bits (769),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 151/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTK
Sbjct  279  AKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|XP_003629736.1| Alpha-tubulin [Medicago truncatula]
 gb|AET04212.1| tubulin beta-1 chain [Medicago truncatula]
Length=449

 Score =   300 bits (769),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 151/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTK
Sbjct  279  AKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>gb|AFR42047.1| alpha-tubulin, partial [Populus fremontii]
Length=194

 Score =   291 bits (746),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  38   KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  97

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  98   TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  128

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  129  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  188



>ref|XP_006433708.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
 gb|ESR46948.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
Length=218

 Score =   292 bits (748),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KA+HEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  47   KAFHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  106

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  107  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  137

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  138  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  197



>ref|XP_008240533.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Prunus mume]
Length=449

 Score =   300 bits (767),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN++VATIKTK
Sbjct  279  AKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNASVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINY+PP+VVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYEPPSVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>gb|ABV55994.1| alpha-tubulin 6 [Populus tremuloides]
Length=449

 Score =   300 bits (767),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 151/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLS PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK
Sbjct  279  AKAYHEQLSGPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRID+KFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDYKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>emb|CAD24766.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   300 bits (767),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 150/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIK KR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKAKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|AAO63773.2| alpha-tubulin 2 [Populus tremuloides]
Length=450

 Score =   300 bits (767),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 150/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAY EQLSVPEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYREQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|KDP42087.1| hypothetical protein JCGZ_01875 [Jatropha curcas]
Length=450

 Score =   300 bits (767),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQ+S+PEITNAVFEPS+MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQISIPEITNAVFEPSNMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPP+VVPGGDLAR
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAR  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_007204346.1| hypothetical protein PRUPE_ppa005649mg [Prunus persica]
 gb|EMJ05545.1| hypothetical protein PRUPE_ppa005649mg [Prunus persica]
Length=449

 Score =   300 bits (767),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN++VATIKTK
Sbjct  279  AKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNASVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINY+PP+VVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYEPPSVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>emb|CAD26887.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|AGV54500.1| tubulin A [Phaseolus vulgaris]
Length=449

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 152/181 (84%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  279  AKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>gb|ABO47738.1| alpha-tubulin [Gossypium hirsutum]
 gb|KJB40985.1| hypothetical protein B456_007G086400 [Gossypium raimondii]
Length=449

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 150/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQ+SVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQISVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP VVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPAVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>emb|CDP14299.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 151/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITN+VFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVA+IKTK
Sbjct  279  AKAYHEQLSVPEITNSVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVASIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVP GDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPCGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>emb|CAD26890.1| alpha-tubulin [Miscanthus sinensis subsp. condensatus]
Length=450

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|EYU34085.1| hypothetical protein MIMGU_mgv1a0196712mg, partial [Erythranthe 
guttata]
Length=217

 Score =   291 bits (745),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 147/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN  FEPSSMM KCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  47   KAYHEQLSVSEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  106

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  107  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  137

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  138  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  197



>gb|AIC33057.1| tubulin alpha-1 chain [Panax ginseng]
Length=449

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQ PTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQAPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAV EVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVVEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|AAW57309.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=266

 Score =   293 bits (749),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  95   KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  154

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  155  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  185

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRID+KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  186  VQRAVCMISNSTSVAEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  245



>emb|CAB76917.1| alpha-tubulin 4 [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   293 bits (751),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 148/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  118  KAYHEQLSVSEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  177

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  178  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  208

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+V EVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  209  VQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  268



>gb|AAW57310.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57311.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57313.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=267

 Score =   293 bits (749),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  96   KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  155

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  156  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  186

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRID+KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  187  VQRAVCMISNSTSVAEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  246



>gb|KIY91712.1| Tubulin alpha chain [Monoraphidium neglectum]
Length=249

 Score =   292 bits (747),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN++VATIKTKR
Sbjct  78   KAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNASVATIKTKR  137

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  138  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  168

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+TAVAEVFSR+DHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  169  VQRAVCMISNSTAVAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  228



>gb|KJB32211.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=361

 Score =   296 bits (757),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  191  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  250

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  251  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  281

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  282  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  341



>gb|ADD84794.1| tubulin-like protein [Cenchrus ciliaris]
Length=184

 Score =   289 bits (740),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 148/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  13   KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  72

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  73   TIQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  103

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+V EVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  104  VQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  163



>ref|XP_006286795.1| hypothetical protein CARUB_v10003470mg [Capsella rubella]
 gb|EOA19693.1| hypothetical protein CARUB_v10003470mg [Capsella rubella]
Length=450

 Score =   298 bits (764),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 150/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLS+PEIT+AVFEP SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTK
Sbjct  279  AKAYHEQLSIPEITSAVFEPGSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RT+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|XP_007014666.1| Tubulin alpha-5 [Theobroma cacao]
 gb|EOY32285.1| Tubulin alpha-5 [Theobroma cacao]
Length=449

 Score =   298 bits (764),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KA+HEQLSVPEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV+TIKTKR
Sbjct  280  KAFHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVSTIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>emb|CAD26892.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 150/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKD N+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDDNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>emb|CAJ38386.1| alpha tubulin [Plantago major]
Length=270

 Score =   292 bits (748),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 147/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN  FEPSSMM KCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  100  KAYHEQLSVAEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  159

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  160  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  190

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  191  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  250



>ref|XP_008464962.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis melo]
Length=449

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 151/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITNAVF+PSSMM KCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  279  AKAYHEQLSVPEITNAVFDPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISN+TAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNSTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|XP_004141134.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 gb|KGN59749.1| Tubulin alpha-3 chain [Cucumis sativus]
Length=449

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 151/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITNAVF+PSSMM KCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  279  AKAYHEQLSVPEITNAVFDPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISN+TAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNSTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|XP_010414865.1| PREDICTED: tubulin alpha-1 chain [Camelina sativa]
Length=450

 Score =   298 bits (763),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 150/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQ SVPEIT +VFEPS+MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  279  AKAYHEQFSVPEITTSVFEPSNMMAKCDPRHGKYMACCLMYRGDVVPKDVNTAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RT+QFVDW                             CPTGFKCGINYQPP+VVPGGDLA
Sbjct  339  RTIQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>gb|KJB80786.1| hypothetical protein B456_013G115100 [Gossypium raimondii]
Length=449

 Score =   298 bits (763),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 151/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQ+SVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  279  AKAYHEQISVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            R VQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RAVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVF+RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFARIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|XP_008621874.1| tubulin alpha, partial [Saprolegnia diclina VS20]
 gb|EQC24696.1| tubulin alpha, partial [Saprolegnia diclina VS20]
Length=273

 Score =   292 bits (747),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 147/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEP+SMMAKCDPRHGKYMA CLMYRGDVVPKDVN+AVATIKTKR
Sbjct  100  KAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMAACLMYRGDVVPKDVNAAVATIKTKR  159

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLAR
Sbjct  160  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAR  190

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN +A+AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  191  VQRAVCMISNTSAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  250



>ref|XP_003624633.1| Alpha-tubulin [Medicago truncatula]
 gb|ABK28851.1| alpha-tubulin [Medicago truncatula]
 gb|ABN08980.1| Tubulin/FtsZ, C-terminal [Medicago truncatula]
 gb|AES80851.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   298 bits (762),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 150/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQ+SVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV+ IKTK
Sbjct  279  AKAYHEQISVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVSNIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +V RAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVMRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|XP_004252814.1| PREDICTED: tubulin alpha-2 chain-like [Solanum lycopersicum]
Length=227

 Score =   290 bits (742),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 148/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVN+AVATIKTKR
Sbjct  56   KAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKR  115

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  116  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  146

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQ+AVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  147  VQKAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  206



>emb|CAD24767.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   298 bits (762),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 151/180 (84%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRG+VVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGNVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_002677064.1| alpha-tubulin [Naegleria gruberi]
 gb|EFC44320.1| alpha-tubulin [Naegleria gruberi]
Length=195

 Score =   289 bits (739),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 148/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  22   KAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  81

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                              PTGFKCGINYQPPTVVPGGDLA+
Sbjct  82   TIQFVDW-----------------------------SPTGFKCGINYQPPTVVPGGDLAK  112

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+TA+AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  113  VQRAVCMISNSTAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  172



>ref|XP_004493170.1| PREDICTED: tubulin alpha-3 chain-like [Cicer arietinum]
Length=450

 Score =   298 bits (762),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 150/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQ+SVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV+ IKTK
Sbjct  279  AKAYHEQISVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVSNIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RT+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +V RAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVMRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>gb|KDO25258.1| hypothetical protein SPRG_09506 [Saprolegnia parasitica CBS 223.65]
Length=186

 Score =   288 bits (738),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 146/180 (81%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEP+SMMAKCDPRHGKYMA CLMYRGDVVPKDVN+AVATIKTKR
Sbjct  13   KAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMAACLMYRGDVVPKDVNAAVATIKTKR  72

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLAR
Sbjct  73   TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAR  103

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN +A+AEVFSRIDHKFDLMY+KRAF HWYVGEGMEEGEFSEAREDLAALEK
Sbjct  104  VQRAVCMISNTSAIAEVFSRIDHKFDLMYAKRAFAHWYVGEGMEEGEFSEAREDLAALEK  163



>ref|XP_010528739.1| PREDICTED: tubulin alpha-6 chain-like [Tarenaya hassleriana]
Length=450

 Score =   297 bits (761),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 151/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKA+HEQLSVPEIT +VFEPS+MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVA+IKTK
Sbjct  279  AKAFHEQLSVPEITTSVFEPSNMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVASIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>gb|AHJ80819.1| Tua1, partial [Eragrostis tef]
Length=243

 Score =   290 bits (742),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 148/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  72   KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  131

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  132  TIQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  162

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+V EVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  163  VQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  222



>gb|AHM93474.1| alpha-tubulin, partial [Camellia chekiangoleosa]
Length=327

 Score =   293 bits (750),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 148/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMM KCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  157  KAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  216

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  217  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  247

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  248  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  307



>gb|ABD92943.1| alpha tubulin-1B [Triticum aestivum]
Length=450

 Score =   297 bits (760),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGI YQPP+VVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGIKYQPPSVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVF RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFLRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_011078787.1| PREDICTED: tubulin alpha-1 chain-like [Sesamum indicum]
Length=451

 Score =   297 bits (760),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 149/181 (82%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEIT AVFEPSSMMAKCDPRHGKYMACCLMYRGDV PKDVN+AVATIKTK
Sbjct  279  AKAYHEQLSVPEITTAVFEPSSMMAKCDPRHGKYMACCLMYRGDVAPKDVNTAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            R VQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RAVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            RV+RAVC+ISNNTAVAEVFSRIDHKFD+MY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  RVKRAVCMISNNTAVAEVFSRIDHKFDVMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>gb|EKF29047.1| epsilon tubulin, putative, partial [Trypanosoma cruzi marinkellei]
Length=240

 Score =   289 bits (740),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 148/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EI+NAVFEP+SMM KCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  69   KAYHEQLSVSEISNAVFEPASMMTKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  128

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                              PTGFKCGINYQPPTVVPGGDLA+
Sbjct  129  TIQFVDW-----------------------------SPTGFKCGINYQPPTVVPGGDLAK  159

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+I+N+TA+AEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  160  VQRAVCMIANSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  219



>emb|CBH08953.1| alpha tubulin, (fragment), partial [Trypanosoma brucei gambiense 
DAL972]
Length=190

 Score =   288 bits (736),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 148/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EI+NAVFEP+SMM KCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  19   KAYHEQLSVSEISNAVFEPASMMTKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  78

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                              PTGFKCGINYQPPTVVPGGDLA+
Sbjct  79   TIQFVDW-----------------------------SPTGFKCGINYQPPTVVPGGDLAK  109

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+I+N+TA+AEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  110  VQRAVCMIANSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  169



>emb|CCD11782.1| unnamed protein product [Trypanosoma congolense IL3000]
Length=257

 Score =   290 bits (742),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 148/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EI+NAVFEP+SMM KCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  86   KAYHEQLSVSEISNAVFEPASMMTKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  145

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                              PTGFKCGINYQPPTVVPGGDLA+
Sbjct  146  TIQFVDW-----------------------------SPTGFKCGINYQPPTVVPGGDLAK  176

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+I+N+TA+AEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  177  VQRAVCMIANSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  236



>emb|CAD26893.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 150/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAA EK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAAHEK  430



>gb|KDO81349.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=355

 Score =   293 bits (751),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KA+HEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  184  KAFHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  243

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  244  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  274

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  275  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  334



>gb|EKF28172.1| epsilon tubulin, putative [Trypanosoma cruzi marinkellei]
Length=249

 Score =   290 bits (741),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 148/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EI+NAVFEP+SMM KCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  78   KAYHEQLSVSEISNAVFEPASMMTKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  137

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                              PTGFKCGINYQPPTVVPGGDLA+
Sbjct  138  TIQFVDW-----------------------------SPTGFKCGINYQPPTVVPGGDLAK  168

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+I+N+TA+AEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  169  VQRAVCMIANSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  228



>gb|AAW57306.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57308.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=257

 Score =   290 bits (741),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEP+SMMAKCDPRHGKYMACC+MYRGDVVPKDVN++VATIKTKR
Sbjct  86   KAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCMMYRGDVVPKDVNASVATIKTKR  145

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  146  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  176

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T++AEVFSR+DHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  177  VQRAVCMISNSTSIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  236



>dbj|BAH19954.1| AT1G50010 [Arabidopsis thaliana]
Length=248

 Score =   290 bits (741),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 148/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KA+HEQLSV EITN+ FEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTKR
Sbjct  78   KAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKR  137

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  138  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  168

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  169  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  228



>ref|XP_010693818.1| PREDICTED: tubulin alpha-3 chain-like [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 148/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEIT AVFEPSSMMAKCDPRHGKYMA CLMYRGDVVPKDVN+AV TIKTKR
Sbjct  280  KAYHEQLSVPEITTAVFEPSSMMAKCDPRHGKYMASCLMYRGDVVPKDVNAAVGTIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>emb|CBH08958.1| alpha tubulin, (fragment) [Trypanosoma brucei gambiense DAL972]
Length=303

 Score =   291 bits (745),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 148/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EI+NAVFEP+SMM KCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  132  KAYHEQLSVSEISNAVFEPASMMTKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  191

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                              PTGFKCGINYQPPTVVPGGDLA+
Sbjct  192  TIQFVDW-----------------------------SPTGFKCGINYQPPTVVPGGDLAK  222

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+I+N+TA+AEVF+RIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  223  VQRAVCMIANSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  282



>dbj|BAF01952.1| putative tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=202

 Score =   288 bits (736),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 148/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KA+HEQLSV EITN+ FEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTKR
Sbjct  32   KAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKR  91

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  92   TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  122

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  123  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  182



>ref|XP_010054663.1| PREDICTED: tubulin alpha-3 chain-like [Eucalyptus grandis]
 gb|KCW89881.1| hypothetical protein EUGRSUZ_A02108 [Eucalyptus grandis]
Length=450

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 150/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEIT+AVFEPS+MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  279  AKAYHEQLSVPEITSAVFEPSNMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPP+VVP GDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPSVVPSGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAV EVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|XP_002959708.1| alpha tubulin [Volvox carteri f. nagariensis]
 gb|EFJ39226.1| alpha tubulin [Volvox carteri f. nagariensis]
Length=255

 Score =   289 bits (740),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 147/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITNA FEP+SMM KCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  84   KAYHEQLSVAEITNAAFEPASMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  143

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  144  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  174

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+TA+ E+FSR+DHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  175  VQRAVCMISNSTAIGEIFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  234



>ref|XP_006301274.1| hypothetical protein CARUB_v10021674mg [Capsella rubella]
 gb|EOA34172.1| hypothetical protein CARUB_v10021674mg [Capsella rubella]
Length=450

 Score =   296 bits (757),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 149/181 (82%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQ SVPEIT +VFEPS+MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVA IKTK
Sbjct  279  AKAYHEQFSVPEITTSVFEPSNMMAKCDPRHGKYMACCLMYRGDVVPKDVNTAVANIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RT+QFVDW                             CPTGFKCGINYQPP+VVPGGDLA
Sbjct  339  RTIQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>emb|CAD26888.1| alpha-tubulin [Miscanthus transmorrisonensis]
Length=450

 Score =   296 bits (757),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 150/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCL+YRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLIYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                              PTGFKCGINYQPP+VVPGGDLA+
Sbjct  340  TVQFVDW-----------------------------RPTGFKCGINYQPPSVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|EYU20672.1| hypothetical protein MIMGU_mgv1a004180mg [Erythranthe guttata]
Length=540

 Score =   298 bits (764),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 151/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKA+HEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  370  AKAFHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  429

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RT+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  430  RTIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  460

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            RVQRAVC+ISNNTAV EVFSRI+HKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  461  RVQRAVCMISNNTAVVEVFSRINHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  520

Query  201  K  199
            K
Sbjct  521  K  521



>gb|ABR26150.1| tubulin alpha-3 chain [Oryza sativa Indica Group]
Length=186

 Score =   286 bits (733),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 147/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  15   KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  74

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  75   TIQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  105

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+V EVFSRID KFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  106  VQRAVCMISNSTSVVEVFSRIDIKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  165



>gb|ABE01246.1| alpha tubulin [Camellia sinensis]
Length=449

 Score =   295 bits (756),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 149/181 (82%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITN+VFEPS+MMAKCDPRHGKYMACCLMYRGDVVPK VN+AV TIKTK
Sbjct  279  AKAYHEQLSVPEITNSVFEPSNMMAKCDPRHGKYMACCLMYRGDVVPKGVNAAVGTIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNT VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTLVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>gb|KGN48654.1| hypothetical protein Csa_6G497050 [Cucumis sativus]
Length=415

 Score =   294 bits (753),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  245  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  304

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  305  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  335

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  336  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  395



>gb|KJB58756.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=415

 Score =   294 bits (753),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  245  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  304

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  305  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  335

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  336  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  395



>ref|XP_002779346.1| alpha-tubulin, putative [Perkinsus marinus ATCC 50983]
 gb|EER11141.1| alpha-tubulin, putative [Perkinsus marinus ATCC 50983]
Length=186

 Score =   286 bits (731),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 147/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+VFEP+SMM KCDPRHGKYMACC+MYRGDVVPKDVN+AVATIKTKR
Sbjct  13   KAYHEQLSVAEITNSVFEPASMMVKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKR  72

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                              PTGFKCGINYQPPTVVPGGDLA+
Sbjct  73   TIQFVDW-----------------------------SPTGFKCGINYQPPTVVPGGDLAK  103

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            V RAVC+ISN+TAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  104  VMRAVCMISNSTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  163



>emb|CAA52158.1| alpha tubulin [Zea mays]
Length=256

 Score =   288 bits (738),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 147/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  85   KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  144

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  145  TIQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  175

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+V EVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDL ALEK
Sbjct  176  VQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLRALEK  235



>gb|KHG20487.1| Tubulin alpha chain [Gossypium arboreum]
Length=451

 Score =   295 bits (754),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 149/181 (82%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSV EITN  FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  279  AKAYHEQLSVAEITNTAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RT+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|XP_011088040.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   295 bits (754),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLAR
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAR  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_006581474.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
Length=452

 Score =   295 bits (754),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLAR
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAR  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|KHG19627.1| Tubulin alpha-3/alpha-5 chain -like protein [Gossypium arboreum]
Length=449

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 149/181 (82%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHE +SVPEIT+ VFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  279  AKAYHEHISVPEITSVVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            R VQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RAVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVF+RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFARIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|XP_007161955.1| hypothetical protein PHAVU_001G111700g [Phaseolus vulgaris]
 gb|ESW33949.1| hypothetical protein PHAVU_001G111700g [Phaseolus vulgaris]
Length=448

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 150/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN++V+ IK K
Sbjct  279  AKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNASVSNIKAK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRID+KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>gb|AGV54721.1| tubulin alpha-3 chain-like protein [Phaseolus vulgaris]
Length=448

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 150/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN++V+ IK K
Sbjct  279  AKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNASVSNIKAK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRID+KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>gb|ABR25378.1| tubulin alpha 3 chain [Oryza sativa Indica Group]
Length=207

 Score =   286 bits (731),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 147/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  36   KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  95

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  96   TIQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  126

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+V EVFSRID KFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  127  VQRAVCMISNSTSVVEVFSRIDIKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  186



>gb|KDO49533.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=431

 Score =   293 bits (751),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  261  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  320

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  321  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  351

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  352  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  411



>emb|CAM58978.1| alpha tubulin 5 [Hordeum vulgare subsp. vulgare]
Length=247

 Score =   287 bits (734),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 147/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KA+HEQ SVPEITN VFEPSS+MAKCDPRHGKYMACCLMYRGDVVPKDVNSAV +IKTKR
Sbjct  78   KAFHEQHSVPEITNTVFEPSSVMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVHSIKTKR  137

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  138  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  168

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            V+RAVC+ISNNTAVAEVFSRID KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  169  VRRAVCMISNNTAVAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  228



>gb|AAX96763.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|ABA92354.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
Length=346

 Score =   290 bits (743),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 147/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  175  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  234

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  235  TIQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  265

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+V EVFSRID KFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  266  VQRAVCMISNSTSVVEVFSRIDIKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  325



>gb|AAW57305.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=306

 Score =   289 bits (740),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 147/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  136  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  195

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  196  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  226

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRA+C+ISN+T+VAEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  227  VQRAICMISNSTSVAEVFSRIDFKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEK  286



>gb|EYU37544.1| hypothetical protein MIMGU_mgv1a007145mg [Erythranthe guttata]
Length=417

 Score =   293 bits (750),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  246  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  305

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  306  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  336

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  337  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  396



>gb|AIX10773.1| alpha tubulin [Panax notoginseng]
Length=451

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|KJB29387.1| hypothetical protein B456_005G097800 [Gossypium raimondii]
Length=451

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 148/181 (82%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSV EITN  FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTK
Sbjct  279  AKAYHEQLSVAEITNTAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RT+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
             VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  EVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>gb|EPS62716.1| alpha-tubulin, partial [Genlisea aurea]
Length=404

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 147/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN  FEPSSMM KCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  234  KAYHEQLSVAEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  293

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  294  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  324

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  325  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  384



>ref|NP_176654.1| tubulin alpha-1 chain [Arabidopsis thaliana]
 sp|P11139.1|TBA1_ARATH RecName: Full=Tubulin alpha-1 chain [Arabidopsis thaliana]
 gb|AAD38249.1|AC006193_5 alpha1 tubulin [Arabidopsis thaliana]
 gb|AAA32880.1| alpha-1-tubulin [Arabidopsis thaliana]
 gb|AAL24085.1| putative alpha-tubulin protein [Arabidopsis thaliana]
 gb|AAM14311.1| putative alpha-tubulin protein [Arabidopsis thaliana]
 gb|AEE34279.1| tubulin alpha-1 chain [Arabidopsis thaliana]
Length=450

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 148/181 (82%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQ SVPEIT +VFEPS+MMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVA IK K
Sbjct  279  AKAYHEQFSVPEITTSVFEPSNMMAKCDPRHGKYMACCLMYRGDVVPKDVNTAVAAIKAK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RT+QFVDW                             CPTGFKCGINYQPP+VVPGGDLA
Sbjct  339  RTIQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>sp|Q38771.1|TBA_AVESA RecName: Full=Tubulin alpha chain [Avena sativa]
 emb|CAA66075.1| alpha-tubulin [Avena sativa]
Length=447

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 148/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV TIKTKR
Sbjct  280  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVVTIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVD                              CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  340  TVQFVD-----------------------------XCPTGFKCGINYQPPSVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLA LEK
Sbjct  371  VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAXLEK  430



>ref|XP_007515802.1| alpha-tubulin [Bathycoccus prasinos]
 emb|CCO14681.1| alpha-tubulin [Bathycoccus prasinos]
Length=415

 Score =   293 bits (749),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVA+IKTKR
Sbjct  245  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVASIKTKR  304

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  305  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  335

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+TA+AEVFSR+DHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  336  VQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  395



>gb|AAD11425.1| alpha tubulin [Mesembryanthemum crystallinum]
Length=366

 Score =   291 bits (745),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 148/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EIT + FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  195  KAYHEQLSVAEITTSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  254

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  255  TIQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  285

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  286  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  345



>gb|ADW83724.1| alpha-tubulin [Musa acuminata AAA Group]
Length=423

 Score =   293 bits (749),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  252  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  311

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPP+VVPGGDLA+
Sbjct  312  TIQFVDW-----------------------------CPTGFKCGINYQPPSVVPGGDLAK  342

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  343  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  402



>emb|CAB76918.1| alpha-tubulin 5 [Hordeum vulgare subsp. vulgare]
Length=192

 Score =   285 bits (728),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 147/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KA+HEQ SVPEITN VFEPSS+MAKCDPRHGKYMACCLMYRGDVVPKDVNSAV +IKTKR
Sbjct  23   KAFHEQHSVPEITNTVFEPSSVMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVHSIKTKR  82

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  83   TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  113

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            V+RAVC+ISNNTAVAEVFSRID KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  114  VRRAVCMISNNTAVAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  173



>ref|XP_003608582.1| Tubulin alpha-5 chain [Medicago truncatula]
 gb|AES90779.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_010245599.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=451

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|ABK92520.1| unknown [Populus trichocarpa]
Length=451

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>emb|CAN62392.1| hypothetical protein VITISV_016172 [Vitis vinifera]
Length=435

 Score =   293 bits (750),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  265  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  324

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  325  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  355

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  356  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  415



>gb|AAO46127.1| alpha-tubulin [Streblomastix strix]
 gb|AAO46129.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   286 bits (733),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 148/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEP++MMAKCDPRHGKYMACC+MYRGDVVPKDVN+AVATIKTKR
Sbjct  79   KAYHEQLSVAEITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKR  138

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFK GINYQPPTVVPGGDLA+
Sbjct  139  TIQFVDW-----------------------------CPTGFKVGINYQPPTVVPGGDLAK  169

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+TA+AEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  170  VQRAVCMISNSTAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  229



>ref|XP_009131752.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 148/181 (82%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEITNAVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV   + K
Sbjct  279  AKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGLSRLK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>gb|AEE98361.1| alpha-tubulin [Deschampsia antarctica]
Length=254

 Score =   287 bits (734),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 148/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KA+HEQ SVPEITN+VFEPSS+MAKCDPRHGKYMACCLMYRGDVVPKDVN+AV +IKTKR
Sbjct  85   KAFHEQHSVPEITNSVFEPSSVMAKCDPRHGKYMACCLMYRGDVVPKDVNTAVHSIKTKR  144

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            TVQFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  145  TVQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  175

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            V+RAVC+ISNNTAVAEVFSRID KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  176  VRRAVCMISNNTAVAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  235



>ref|XP_010093625.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB54386.1| Tubulin alpha chain [Morus notabilis]
Length=451

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_001764722.1| predicted protein [Physcomitrella patens]
 gb|EDQ70421.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|KHN46768.1| Tubulin alpha-3 chain [Glycine soja]
Length=443

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 150/181 (83%), Gaps = 29/181 (16%)
 Frame = -1

Query  741  AKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTK  562
            AKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AV+ IKTK
Sbjct  279  AKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVSNIKTK  338

Query  561  RTVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLA  382
            RTVQFVDW                             CPTGFKCGINYQPPTVVP GDLA
Sbjct  339  RTVQFVDW-----------------------------CPTGFKCGINYQPPTVVPAGDLA  369

Query  381  RVQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  202
            +VQRAVC+ISNNTAVAEVF+RID+KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMISNNTAVAEVFARIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  201  K  199
            K
Sbjct  430  K  430



>ref|XP_002981542.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
 gb|EFJ17357.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
Length=449

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|ACJ60905.1| alpha tubulin [Betula pendula]
Length=450

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_007032501.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY03427.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|ACN40181.1| unknown [Picea sitchensis]
 gb|ACN40840.1| unknown [Picea sitchensis]
Length=450

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_002283198.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
 ref|XP_006827169.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
 ref|XP_010939541.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
 gb|ERM94406.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
Length=450

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_010943272.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_002298794.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
 gb|EEE83599.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
Length=451

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|ABO47739.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG18532.1| Tubulin alpha-2 chain [Gossypium arboreum]
Length=450

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|NP_001289660.1| tubulin alpha chain-like [Eucalyptus grandis]
 gb|ABS50670.1| alpha-tubulin [Eucalyptus grandis]
Length=451

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_011457777.1| PREDICTED: tubulin alpha chain [Fragaria vesca subsp. vesca]
Length=450

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_009335354.1| PREDICTED: tubulin alpha chain [Pyrus x bretschneideri]
Length=450

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_008455054.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Cucumis melo]
Length=451

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_010242419.1| PREDICTED: tubulin alpha-1 chain [Nelumbo nucifera]
Length=451

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_003522731.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Glycine max]
Length=452

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_008804464.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=450

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_010065856.1| PREDICTED: tubulin alpha chain [Eucalyptus grandis]
 gb|KCW63554.1| hypothetical protein EUGRSUZ_G01186 [Eucalyptus grandis]
Length=450

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_003635553.2| PREDICTED: tubulin alpha chain-like [Vitis vinifera]
Length=451

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_008787760.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=451

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVSEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_008787237.1| PREDICTED: tubulin alpha chain [Phoenix dactylifera]
 ref|XP_010941981.1| PREDICTED: tubulin alpha chain [Elaeis guineensis]
Length=451

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYTKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|ABL61201.1| alpha-tubulin [Oxymonadida environmental sample]
Length=299

 Score =   288 bits (737),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 148/180 (82%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEP++MMAKCDPRHGKYMACC+MYRGDVVPKDVN+AVATIKTKR
Sbjct  128  KAYHEQLSVAEITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKR  187

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  188  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  218

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+TA+AEVFSRID KFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  219  VQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  278



>gb|AIX10966.1| tubulin [Ornithogalum saundersiae]
Length=451

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>gb|KHN08201.1| Tubulin alpha chain [Glycine soja]
Length=457

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  285  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  344

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  345  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  375

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  376  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  435



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 149/180 (83%), Gaps = 29/180 (16%)
 Frame = -1

Query  738  KAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKTKR  559
            KAYHEQLSV EITN+ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKTKR
Sbjct  280  KAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  339

Query  558  TVQFVDW*VYILF*MNLTVTEPLNLRCHVN*YGLFRCPTGFKCGINYQPPTVVPGGDLAR  379
            T+QFVDW                             CPTGFKCGINYQPPTVVPGGDLA+
Sbjct  340  TIQFVDW-----------------------------CPTGFKCGINYQPPTVVPGGDLAK  370

Query  378  VQRAVCVISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEK  199
            VQRAVC+ISN+T+VAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEK
Sbjct  371  VQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK  430



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1347639082210