BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF011D19

Length=521
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011086013.1|  PREDICTED: protein trichome birefringence-li...  55.5    3e-06   Sesamum indicum [beniseed]
emb|CBI30668.3|  unnamed protein product                              55.8    3e-06   Vitis vinifera
ref|XP_011096427.1|  PREDICTED: protein trichome birefringence-li...  55.5    3e-06   Sesamum indicum [beniseed]
ref|XP_002274664.1|  PREDICTED: protein trichome birefringence-li...  55.5    3e-06   Vitis vinifera
gb|KHG08135.1|  putative U95                                          55.5    4e-06   Gossypium arboreum [tree cotton]
ref|XP_002525121.1|  conserved hypothetical protein                   52.8    4e-06   
gb|EYU28072.1|  hypothetical protein MIMGU_mgv1a008400mg              55.1    5e-06   Erythranthe guttata [common monkey flower]
ref|XP_002316834.2|  hypothetical protein POPTR_0011s07550g           53.5    8e-06   
ref|XP_010057074.1|  PREDICTED: protein trichome birefringence-li...  54.3    1e-05   Eucalyptus grandis [rose gum]
gb|AFK45250.1|  unknown                                               53.9    1e-05   Lotus japonicus
ref|XP_006449479.1|  hypothetical protein CICLE_v10015687mg           53.9    1e-05   Citrus clementina [clementine]
gb|KDO77821.1|  hypothetical protein CISIN_1g017263mg                 53.9    1e-05   Citrus sinensis [apfelsine]
ref|XP_006362437.1|  PREDICTED: uncharacterized protein LOC102599991  53.9    1e-05   Solanum tuberosum [potatoes]
gb|KDO77822.1|  hypothetical protein CISIN_1g017263mg                 53.9    1e-05   Citrus sinensis [apfelsine]
ref|XP_002522557.1|  conserved hypothetical protein                   53.9    1e-05   Ricinus communis
ref|XP_006467669.1|  PREDICTED: protein YLS7-like                     53.9    1e-05   
gb|KDO77820.1|  hypothetical protein CISIN_1g017263mg                 53.9    1e-05   Citrus sinensis [apfelsine]
emb|CDY37673.1|  BnaA04g19950D                                        51.6    1e-05   Brassica napus [oilseed rape]
gb|AHN91976.1|  TBL1                                                  53.5    1e-05   Citrus sinensis [apfelsine]
gb|AAF88130.1|AC021043_23  Unknown protein                            53.5    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002305083.1|  hypothetical protein POPTR_0004s05420g           53.5    2e-05   
gb|AAC63848.1|  hypothetical protein                                  52.0    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007214171.1|  hypothetical protein PRUPE_ppa019033mg           53.5    2e-05   Prunus persica
ref|NP_564318.1|  protein trichome birefringence-like 38              53.5    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180669.2|  protein TRICHOME BIREFRINGENCE-LIKE 40              52.4    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893546.1|  hypothetical protein ARALYDRAFT_473111           53.5    2e-05   
ref|XP_006305057.1|  hypothetical protein CARUB_v10009422mg           53.1    2e-05   Capsella rubella
gb|KJB46924.1|  hypothetical protein B456_008G001700                  53.5    2e-05   Gossypium raimondii
ref|XP_007221982.1|  hypothetical protein PRUPE_ppa002834mg           53.5    2e-05   Prunus persica
ref|XP_011005473.1|  PREDICTED: protein trichome birefringence-li...  53.1    2e-05   Populus euphratica
ref|XP_003529365.1|  PREDICTED: protein YLS7-like                     53.1    2e-05   Glycine max [soybeans]
ref|XP_009790075.1|  PREDICTED: protein trichome birefringence-li...  53.1    2e-05   Nicotiana sylvestris
ref|XP_009781572.1|  PREDICTED: protein trichome birefringence-li...  53.1    2e-05   Nicotiana sylvestris
ref|XP_008812175.1|  PREDICTED: protein trichome birefringence-li...  53.5    2e-05   Phoenix dactylifera
ref|XP_009599976.1|  PREDICTED: protein trichome birefringence-li...  53.1    2e-05   Nicotiana tomentosiformis
dbj|BAD44658.1|  unnamed protein product                              52.8    3e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAO42294.1|  unknown protein                                       52.8    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001077985.1|  protein TRICHOME BIREFRINGENCE-LIKE 40           52.8    3e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65091.1|  unknown                                               52.8    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007048657.1|  Trichome birefringence-like 6, putative isof...  53.1    3e-05   
gb|KHF98470.1|  Transmembrane protein                                 52.8    3e-05   Gossypium arboreum [tree cotton]
ref|XP_006367779.1|  PREDICTED: uncharacterized protein LOC102593572  52.4    3e-05   
ref|XP_006357865.1|  PREDICTED: uncharacterized protein LOC102596807  53.1    3e-05   Solanum tuberosum [potatoes]
ref|XP_006410551.1|  hypothetical protein EUTSA_v10016785mg           52.8    3e-05   Eutrema salsugineum [saltwater cress]
gb|KHN32337.1|  hypothetical protein glysoja_032520                   52.8    3e-05   Glycine soja [wild soybean]
ref|XP_002881157.1|  hypothetical protein ARALYDRAFT_482040           52.8    3e-05   Arabidopsis lyrata subsp. lyrata
ref|XP_003518885.1|  PREDICTED: protein YLS7-like                     52.8    3e-05   Glycine max [soybeans]
gb|KJB34893.1|  hypothetical protein B456_006G088800                  52.8    3e-05   Gossypium raimondii
ref|XP_010665989.1|  PREDICTED: protein trichome birefringence-li...  52.8    3e-05   
ref|XP_008439751.1|  PREDICTED: protein trichome birefringence-li...  52.8    3e-05   Cucumis melo [Oriental melon]
emb|CAN60202.1|  hypothetical protein VITISV_036403                   52.4    3e-05   Vitis vinifera
gb|KJB31199.1|  hypothetical protein B456_005G180600                  52.8    3e-05   Gossypium raimondii
ref|XP_004134666.1|  PREDICTED: uncharacterized protein LOC101216213  52.4    4e-05   Cucumis sativus [cucumbers]
ref|XP_010940155.1|  PREDICTED: protein trichome birefringence-li...  52.8    4e-05   Elaeis guineensis
emb|CDY17220.1|  BnaA05g09680D                                        52.4    4e-05   Brassica napus [oilseed rape]
ref|XP_004234094.1|  PREDICTED: protein trichome birefringence-li...  52.4    4e-05   
ref|XP_002326021.2|  hypothetical protein POPTR_0019s11970g           52.4    4e-05   
ref|XP_009348409.1|  PREDICTED: protein trichome birefringence-li...  52.4    4e-05   Pyrus x bretschneideri [bai li]
ref|XP_010480710.1|  PREDICTED: protein trichome birefringence-li...  52.4    4e-05   Camelina sativa [gold-of-pleasure]
ref|XP_008371453.1|  PREDICTED: protein trichome birefringence-li...  52.4    4e-05   Malus domestica [apple tree]
ref|XP_009143809.1|  PREDICTED: protein trichome birefringence-li...  52.4    5e-05   Brassica rapa
ref|XP_010251171.1|  PREDICTED: protein trichome birefringence-li...  52.4    5e-05   Nelumbo nucifera [Indian lotus]
gb|KJB31198.1|  hypothetical protein B456_005G180600                  52.4    5e-05   Gossypium raimondii
ref|XP_010038289.1|  PREDICTED: protein trichome birefringence-li...  52.4    5e-05   Eucalyptus grandis [rose gum]
ref|XP_010689869.1|  PREDICTED: protein trichome birefringence-li...  52.4    5e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008244482.1|  PREDICTED: protein trichome birefringence-li...  52.0    5e-05   Prunus mume [ume]
ref|XP_010460674.1|  PREDICTED: protein trichome birefringence-li...  52.0    5e-05   Camelina sativa [gold-of-pleasure]
ref|XP_009352799.1|  PREDICTED: protein trichome birefringence-li...  52.0    5e-05   Pyrus x bretschneideri [bai li]
ref|XP_010499424.1|  PREDICTED: protein trichome birefringence-li...  52.0    5e-05   Camelina sativa [gold-of-pleasure]
ref|XP_011460601.1|  PREDICTED: protein trichome birefringence-li...  52.0    5e-05   Fragaria vesca subsp. vesca
ref|XP_004489803.1|  PREDICTED: uncharacterized protein LOC101513224  52.4    5e-05   Cicer arietinum [garbanzo]
ref|XP_007044711.1|  Uncharacterized protein TCM_010432               52.4    5e-05   
ref|XP_006294394.1|  hypothetical protein CARUB_v10023411mg           52.0    5e-05   Capsella rubella
ref|XP_010689872.1|  PREDICTED: protein trichome birefringence-li...  52.0    5e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009123178.1|  PREDICTED: protein trichome birefringence-li...  52.0    6e-05   Brassica rapa
gb|KDP26622.1|  hypothetical protein JCGZ_17780                       52.4    6e-05   Jatropha curcas
ref|XP_010509796.1|  PREDICTED: protein trichome birefringence-li...  52.0    6e-05   Camelina sativa [gold-of-pleasure]
ref|XP_008225213.1|  PREDICTED: protein trichome birefringence-li...  52.0    6e-05   Prunus mume [ume]
ref|XP_008383643.1|  PREDICTED: protein trichome birefringence-li...  52.0    6e-05   
ref|XP_009102887.1|  PREDICTED: protein trichome birefringence-li...  52.0    6e-05   Brassica rapa
emb|CDY64767.1|  BnaCnng44810D                                        52.0    6e-05   Brassica napus [oilseed rape]
ref|NP_565779.1|  trichome birefringence-like 37 protein              52.0    6e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CDX94643.1|  BnaC07g10150D                                        52.0    6e-05   
emb|CDX79555.1|  BnaC03g18910D                                        52.0    6e-05   
gb|KJB69610.1|  hypothetical protein B456_011G033800                  52.0    6e-05   Gossypium raimondii
gb|KHG20284.1|  Enolase                                               52.0    6e-05   Gossypium arboreum [tree cotton]
ref|XP_004485883.1|  PREDICTED: uncharacterized protein LOC101498973  52.0    6e-05   Cicer arietinum [garbanzo]
ref|XP_009141359.1|  PREDICTED: protein trichome birefringence-li...  52.0    6e-05   Brassica rapa
ref|XP_006415616.1|  hypothetical protein EUTSA_v10007896mg           52.0    6e-05   Eutrema salsugineum [saltwater cress]
emb|CDX84658.1|  BnaA03g15720D                                        52.0    6e-05   
ref|XP_009132974.1|  PREDICTED: protein trichome birefringence-li...  52.0    6e-05   Brassica rapa
ref|XP_011045911.1|  PREDICTED: protein trichome birefringence-li...  51.6    6e-05   Populus euphratica
ref|XP_010469399.1|  PREDICTED: protein trichome birefringence-li...  52.0    6e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010413780.1|  PREDICTED: protein trichome birefringence-li...  52.0    6e-05   Camelina sativa [gold-of-pleasure]
ref|XP_009143811.1|  PREDICTED: protein trichome birefringence-li...  52.0    6e-05   Brassica rapa
gb|KFK44758.1|  hypothetical protein AALP_AA1G299000                  51.6    6e-05   Arabis alpina [alpine rockcress]
ref|XP_009783417.1|  PREDICTED: protein trichome birefringence-li...  52.0    6e-05   Nicotiana sylvestris
emb|CDY17219.1|  BnaA05g09690D                                        51.6    6e-05   Brassica napus [oilseed rape]
gb|KFK31236.1|  hypothetical protein AALP_AA6G086200                  51.6    7e-05   Arabis alpina [alpine rockcress]
ref|XP_009392183.1|  PREDICTED: protein trichome birefringence-li...  52.0    7e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009587467.1|  PREDICTED: protein trichome birefringence-like   52.0    7e-05   Nicotiana tomentosiformis
ref|XP_006356414.1|  PREDICTED: uncharacterized protein LOC102583109  52.0    7e-05   Solanum tuberosum [potatoes]
ref|XP_004232960.1|  PREDICTED: protein trichome birefringence-li...  51.6    7e-05   Solanum lycopersicum
ref|XP_010469762.1|  PREDICTED: protein trichome birefringence-li...  51.6    7e-05   Camelina sativa [gold-of-pleasure]
ref|XP_002515280.1|  conserved hypothetical protein                   52.0    7e-05   Ricinus communis
ref|XP_010414182.1|  PREDICTED: protein trichome birefringence-li...  51.6    7e-05   Camelina sativa [gold-of-pleasure]
ref|XP_006294476.1|  hypothetical protein CARUB_v10023492mg           51.6    7e-05   Capsella rubella
ref|XP_009593638.1|  PREDICTED: protein trichome birefringence-li...  51.6    7e-05   Nicotiana tomentosiformis
ref|XP_010540499.1|  PREDICTED: protein trichome birefringence-li...  51.6    7e-05   Tarenaya hassleriana [spider flower]
ref|XP_003593751.1|  hypothetical protein MTR_2g015720                51.6    7e-05   
ref|XP_003593750.1|  hypothetical protein MTR_2g015720                51.6    7e-05   Medicago truncatula
ref|XP_010510241.1|  PREDICTED: protein trichome birefringence-li...  51.6    7e-05   Camelina sativa [gold-of-pleasure]
emb|CDP13190.1|  unnamed protein product                              52.0    7e-05   Coffea canephora [robusta coffee]
ref|XP_010052546.1|  PREDICTED: protein trichome birefringence-li...  51.6    7e-05   Eucalyptus grandis [rose gum]
gb|KEH16599.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...  51.6    8e-05   Medicago truncatula
ref|XP_009786368.1|  PREDICTED: protein trichome birefringence-li...  51.6    8e-05   Nicotiana sylvestris
ref|XP_011002530.1|  PREDICTED: protein trichome birefringence-li...  51.6    9e-05   Populus euphratica
ref|XP_008221854.1|  PREDICTED: protein trichome birefringence-li...  51.6    9e-05   Prunus mume [ume]
ref|XP_009599983.1|  PREDICTED: protein trichome birefringence-li...  51.2    9e-05   Nicotiana tomentosiformis
ref|XP_010665988.1|  PREDICTED: protein trichome birefringence-li...  51.2    9e-05   
ref|XP_002525401.1|  conserved hypothetical protein                   51.6    9e-05   Ricinus communis
ref|XP_010686317.1|  PREDICTED: protein trichome birefringence-li...  51.2    9e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009591829.1|  PREDICTED: protein trichome birefringence-li...  51.6    9e-05   Nicotiana tomentosiformis
emb|CCI55362.1|  PH01B035L11.7                                        51.6    1e-04   Phyllostachys edulis [kikko-chiku]
ref|XP_007145701.1|  hypothetical protein PHAVU_007G261000g           51.6    1e-04   Phaseolus vulgaris [French bean]
ref|XP_011002532.1|  PREDICTED: protein trichome birefringence-li...  51.2    1e-04   Populus euphratica
emb|CDY19065.1|  BnaA04g18050D                                        50.4    1e-04   Brassica napus [oilseed rape]
ref|XP_002528306.1|  hypothetical protein RCOM_0838230                48.5    1e-04   
ref|XP_006492340.1|  PREDICTED: protein YLS7-like                     51.2    1e-04   Citrus sinensis [apfelsine]
gb|KDO54062.1|  hypothetical protein CISIN_1g036968mg                 51.2    1e-04   Citrus sinensis [apfelsine]
ref|XP_007025417.1|  Trichome birefringence-like 37 isoform 1         51.2    1e-04   
ref|XP_002325581.2|  hypothetical protein POPTR_0019s11990g           51.2    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_006480514.1|  PREDICTED: protein YLS7-like                     50.8    1e-04   Citrus sinensis [apfelsine]
gb|EPS62153.1|  hypothetical protein M569_12640                       47.8    1e-04   Genlisea aurea
gb|KDP41035.1|  hypothetical protein JCGZ_03567                       50.8    1e-04   Jatropha curcas
ref|XP_006410237.1|  hypothetical protein EUTSA_v10016834mg           50.8    1e-04   Eutrema salsugineum [saltwater cress]
ref|XP_004509571.1|  PREDICTED: uncharacterized protein LOC101508086  51.2    1e-04   Cicer arietinum [garbanzo]
ref|XP_004161492.1|  PREDICTED: uncharacterized protein LOC101228487  51.2    1e-04   
ref|XP_004136561.1|  PREDICTED: uncharacterized protein LOC101220024  51.2    1e-04   Cucumis sativus [cucumbers]
ref|XP_010689958.1|  PREDICTED: protein trichome birefringence-li...  50.8    1e-04   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY30832.1|  BnaC05g22080D                                        50.8    1e-04   Brassica napus [oilseed rape]
ref|XP_002973496.1|  hypothetical protein SELMODRAFT_53072            50.8    1e-04   
ref|XP_006469127.1|  PREDICTED: protein YLS7-like                     50.8    1e-04   
ref|XP_006597476.1|  PREDICTED: protein YLS7-like                     50.8    1e-04   Glycine max [soybeans]
ref|XP_007148060.1|  hypothetical protein PHAVU_006G177100g           50.8    1e-04   Phaseolus vulgaris [French bean]
gb|EMS67231.1|  hypothetical protein TRIUR3_03922                     48.1    2e-04   Triticum urartu
gb|KDP21076.1|  hypothetical protein JCGZ_21547                       50.4    2e-04   Jatropha curcas
emb|CDP10159.1|  unnamed protein product                              50.8    2e-04   Coffea canephora [robusta coffee]
ref|XP_010672635.1|  PREDICTED: protein trichome birefringence-li...  50.8    2e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006849537.1|  hypothetical protein AMTR_s00024p00162030        50.8    2e-04   
gb|KDO63330.1|  hypothetical protein CISIN_1g043893mg                 50.8    2e-04   Citrus sinensis [apfelsine]
ref|XP_009132768.1|  PREDICTED: protein trichome birefringence-li...  50.4    2e-04   Brassica rapa
emb|CDY23962.1|  BnaC03g17290D                                        50.4    2e-04   Brassica napus [oilseed rape]
ref|XP_008449392.1|  PREDICTED: protein trichome birefringence-li...  50.4    2e-04   Cucumis melo [Oriental melon]
ref|XP_010553609.1|  PREDICTED: protein trichome birefringence-li...  50.8    2e-04   Tarenaya hassleriana [spider flower]
ref|XP_007029023.1|  Emb:CAB82953.1, putative                         50.8    2e-04   
ref|XP_006351351.1|  PREDICTED: uncharacterized protein LOC102598...  50.8    2e-04   Solanum tuberosum [potatoes]
ref|XP_008363351.1|  PREDICTED: protein trichome birefringence-li...  50.8    2e-04   
ref|XP_009141436.1|  PREDICTED: protein trichome birefringence-li...  50.4    2e-04   
gb|KJB76673.1|  hypothetical protein B456_012G100000                  50.8    2e-04   Gossypium raimondii
ref|XP_010549391.1|  PREDICTED: protein trichome birefringence-li...  50.4    2e-04   Tarenaya hassleriana [spider flower]
ref|XP_007147753.1|  hypothetical protein PHAVU_006G152100g           50.4    2e-04   Phaseolus vulgaris [French bean]
ref|XP_008352661.1|  PREDICTED: protein trichome birefringence-li...  50.4    2e-04   
gb|KEH20203.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...  50.4    2e-04   Medicago truncatula
ref|XP_006852457.1|  hypothetical protein AMTR_s00021p00115070        50.4    2e-04   Amborella trichopoda
ref|XP_006575299.1|  PREDICTED: uncharacterized protein LOC102666330  47.8    2e-04   
ref|XP_004140241.1|  PREDICTED: uncharacterized protein LOC101217736  50.4    2e-04   Cucumis sativus [cucumbers]
ref|XP_006585942.1|  PREDICTED: protein YLS7-like                     50.4    2e-04   Glycine max [soybeans]
ref|XP_007204980.1|  hypothetical protein PRUPE_ppa003027mg           50.4    2e-04   Prunus persica
ref|XP_010099368.1|  hypothetical protein L484_004794                 50.1    2e-04   Morus notabilis
gb|KDP28262.1|  hypothetical protein JCGZ_14033                       50.4    2e-04   Jatropha curcas
ref|XP_009763711.1|  PREDICTED: protein trichome birefringence-li...  50.4    2e-04   Nicotiana sylvestris
gb|AFK42564.1|  unknown                                               47.4    2e-04   Lotus japonicus
ref|XP_006351352.1|  PREDICTED: uncharacterized protein LOC102598...  50.4    2e-04   Solanum tuberosum [potatoes]
gb|ADD54603.1|  conserved hypothetical protein                        47.0    2e-04   Linum usitatissimum
ref|XP_009354322.1|  PREDICTED: protein trichome birefringence-li...  50.1    2e-04   
ref|XP_010087235.1|  hypothetical protein L484_009744                 50.4    2e-04   Morus notabilis
ref|XP_007201163.1|  hypothetical protein PRUPE_ppa004056mg           50.4    2e-04   Prunus persica
dbj|BAE98654.1|  hypothetical protein                                 50.1    2e-04   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA64249.1|  TPA: putative DUF231 domain containing family pr...  47.8    2e-04   
gb|AFK37265.1|  unknown                                               47.8    2e-04   Lotus japonicus
ref|XP_008229347.1|  PREDICTED: protein trichome birefringence-like   50.4    2e-04   
ref|XP_010917266.1|  PREDICTED: protein trichome birefringence        50.4    2e-04   Elaeis guineensis
ref|XP_004493599.1|  PREDICTED: uncharacterized protein LOC101511851  50.4    2e-04   Cicer arietinum [garbanzo]
ref|XP_006362212.1|  PREDICTED: uncharacterized protein LOC102599885  50.4    2e-04   Solanum tuberosum [potatoes]
ref|XP_003560398.1|  PREDICTED: protein trichome birefringence-li...  50.1    2e-04   Brachypodium distachyon [annual false brome]
ref|XP_004249181.1|  PREDICTED: protein trichome birefringence        50.4    2e-04   Solanum lycopersicum
ref|XP_009610815.1|  PREDICTED: protein trichome birefringence-li...  50.1    2e-04   Nicotiana tomentosiformis
ref|XP_004488993.1|  PREDICTED: uncharacterized protein LOC101512583  50.1    3e-04   Cicer arietinum [garbanzo]
ref|XP_003625280.1|  hypothetical protein MTR_7g093450                50.1    3e-04   Medicago truncatula
ref|XP_007200128.1|  hypothetical protein PRUPE_ppa017879mg           50.1    3e-04   Prunus persica
ref|XP_010665993.1|  PREDICTED: protein trichome birefringence-li...  50.1    3e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006841061.1|  hypothetical protein AMTR_s00085p00172090        50.1    3e-04   Amborella trichopoda
ref|XP_004243820.1|  PREDICTED: protein trichome birefringence-li...  50.1    3e-04   Solanum lycopersicum
ref|XP_009783309.1|  PREDICTED: protein trichome birefringence-like   50.1    3e-04   Nicotiana sylvestris
ref|XP_008783904.1|  PREDICTED: protein trichome birefringence-li...  50.1    3e-04   Phoenix dactylifera
ref|XP_010093461.1|  hypothetical protein L484_017522                 50.1    3e-04   
ref|XP_010323758.1|  PREDICTED: protein trichome birefringence-li...  50.1    3e-04   
ref|XP_008799800.1|  PREDICTED: protein trichome birefringence-li...  50.1    3e-04   Phoenix dactylifera
ref|XP_002448144.1|  hypothetical protein SORBIDRAFT_06g022030        50.1    3e-04   Sorghum bicolor [broomcorn]
ref|XP_010493164.1|  PREDICTED: protein trichome birefringence-li...  50.1    3e-04   Camelina sativa [gold-of-pleasure]
gb|KJB16333.1|  hypothetical protein B456_002G223800                  50.1    3e-04   Gossypium raimondii
gb|KDP24643.1|  hypothetical protein JCGZ_25559                       50.1    3e-04   Jatropha curcas
gb|KFK26286.1|  hypothetical protein AALP_AA8G228100                  50.1    3e-04   Arabis alpina [alpine rockcress]
ref|XP_007162340.1|  hypothetical protein PHAVU_001G143600g           50.1    3e-04   Phaseolus vulgaris [French bean]
ref|XP_006348848.1|  PREDICTED: uncharacterized protein LOC102594004  49.7    3e-04   Solanum tuberosum [potatoes]
ref|XP_002871948.1|  hypothetical protein ARALYDRAFT_488963           50.1    3e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_007011182.1|  Uncharacterized protein isoform 1                50.1    3e-04   
ref|XP_010454365.1|  PREDICTED: protein trichome birefringence-li...  50.1    3e-04   Camelina sativa [gold-of-pleasure]
ref|XP_008444354.1|  PREDICTED: protein trichome birefringence-li...  50.1    3e-04   Cucumis melo [Oriental melon]
ref|XP_008361466.1|  PREDICTED: protein trichome birefringence-li...  50.1    3e-04   
ref|XP_010265940.1|  PREDICTED: protein trichome birefringence-like   50.1    3e-04   Nelumbo nucifera [Indian lotus]
gb|AAM64322.1|  unknown                                               49.7    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009380702.1|  PREDICTED: protein trichome birefringence-li...  49.7    3e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010671195.1|  PREDICTED: protein trichome birefringence-li...  49.7    3e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009757308.1|  PREDICTED: protein trichome birefringence-like   50.1    3e-04   Nicotiana sylvestris
ref|XP_004296154.1|  PREDICTED: protein trichome birefringence-li...  49.7    3e-04   Fragaria vesca subsp. vesca
gb|EMT18980.1|  hypothetical protein F775_19154                       47.4    3e-04   
ref|XP_007050058.1|  Trichome birefringence-like 39                   49.7    3e-04   
ref|XP_009611858.1|  PREDICTED: protein trichome birefringence-like   50.1    3e-04   Nicotiana tomentosiformis
gb|KDP31784.1|  hypothetical protein JCGZ_12245                       49.7    3e-04   Jatropha curcas
ref|XP_006379631.1|  hypothetical protein POPTR_0008s070201g          47.4    3e-04   
ref|XP_008663376.1|  PREDICTED: protein trichome birefringence-li...  50.1    3e-04   
ref|XP_002265658.2|  PREDICTED: protein trichome birefringence-li...  49.7    3e-04   Vitis vinifera
ref|XP_004143065.1|  PREDICTED: uncharacterized protein LOC101210768  49.7    3e-04   Cucumis sativus [cucumbers]
gb|KEH38564.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...  49.7    3e-04   Medicago truncatula
ref|NP_197559.1|  protein trichome birefringence-like 5               49.7    3e-04   Arabidopsis thaliana [mouse-ear cress]
gb|EYU43352.1|  hypothetical protein MIMGU_mgv1a017695mg              49.7    3e-04   Erythranthe guttata [common monkey flower]
ref|XP_004243016.1|  PREDICTED: protein trichome birefringence-li...  49.7    3e-04   Solanum lycopersicum
ref|XP_010070349.1|  PREDICTED: protein trichome birefringence-li...  49.7    3e-04   Eucalyptus grandis [rose gum]
gb|KCW89619.1|  hypothetical protein EUGRSUZ_A01902                   49.7    3e-04   Eucalyptus grandis [rose gum]
ref|XP_007207689.1|  hypothetical protein PRUPE_ppa023743mg           49.7    3e-04   
ref|XP_004249290.1|  PREDICTED: protein trichome birefringence-like   49.7    4e-04   Solanum lycopersicum
ref|XP_008342804.1|  PREDICTED: protein trichome birefringence-li...  49.7    4e-04   
ref|XP_003607565.1|  hypothetical protein MTR_4g079700                49.7    4e-04   Medicago truncatula
ref|XP_008389689.1|  PREDICTED: protein trichome birefringence-li...  49.7    4e-04   Malus domestica [apple tree]
ref|XP_007211478.1|  hypothetical protein PRUPE_ppa007592mg           49.3    4e-04   Prunus persica
emb|CDP15911.1|  unnamed protein product                              49.3    4e-04   Coffea canephora [robusta coffee]
ref|XP_002280022.1|  PREDICTED: protein trichome birefringence        49.7    4e-04   Vitis vinifera
ref|XP_009604045.1|  PREDICTED: protein trichome birefringence-like   49.7    4e-04   Nicotiana tomentosiformis
ref|XP_004502134.1|  PREDICTED: uncharacterized protein LOC101510392  49.7    4e-04   Cicer arietinum [garbanzo]
ref|XP_010257492.1|  PREDICTED: protein trichome birefringence        49.7    4e-04   Nelumbo nucifera [Indian lotus]
ref|XP_009391441.1|  PREDICTED: protein trichome birefringence-like   49.7    4e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010100425.1|  hypothetical protein L484_027736                 49.7    4e-04   
ref|XP_010538205.1|  PREDICTED: protein trichome birefringence-li...  49.3    4e-04   
ref|XP_002882764.1|  predicted protein                                49.7    4e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_002282459.1|  PREDICTED: protein trichome birefringence-li...  49.3    4e-04   Vitis vinifera
ref|XP_010227191.1|  PREDICTED: protein trichome birefringence-li...  49.7    4e-04   Brachypodium distachyon [annual false brome]
ref|XP_002276383.1|  PREDICTED: protein trichome birefringence-li...  49.3    4e-04   Vitis vinifera
gb|KCW59798.1|  hypothetical protein EUGRSUZ_H02546                   49.3    4e-04   Eucalyptus grandis [rose gum]
emb|CAN61015.1|  hypothetical protein VITISV_036741                   49.3    4e-04   Vitis vinifera
ref|XP_006366198.1|  PREDICTED: uncharacterized protein LOC102583...  49.7    4e-04   Solanum tuberosum [potatoes]
gb|KDO77819.1|  hypothetical protein CISIN_1g017263mg                 49.3    4e-04   Citrus sinensis [apfelsine]
ref|XP_009386636.1|  PREDICTED: protein trichome birefringence-li...  49.3    4e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004298485.1|  PREDICTED: protein trichome birefringence-li...  49.7    4e-04   Fragaria vesca subsp. vesca
emb|CBI22044.3|  unnamed protein product                              49.7    4e-04   Vitis vinifera
ref|XP_009386635.1|  PREDICTED: protein trichome birefringence-li...  49.3    4e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010557124.1|  PREDICTED: protein trichome birefringence-li...  49.3    4e-04   Tarenaya hassleriana [spider flower]
gb|ADE76095.1|  unknown                                               49.3    4e-04   Picea sitchensis
emb|CBI21958.3|  unnamed protein product                              48.9    4e-04   Vitis vinifera
ref|XP_008229144.1|  PREDICTED: protein trichome birefringence-li...  49.3    4e-04   
ref|XP_009376704.1|  PREDICTED: protein trichome birefringence-li...  49.3    5e-04   Pyrus x bretschneideri [bai li]
ref|XP_008791924.1|  PREDICTED: protein trichome birefringence-li...  49.7    5e-04   
ref|XP_006594557.1|  PREDICTED: protein YLS7-like isoform X2          49.3    5e-04   Glycine max [soybeans]
ref|XP_010654124.1|  PREDICTED: protein trichome birefringence-li...  49.3    5e-04   Vitis vinifera
ref|XP_008360191.1|  PREDICTED: protein trichome birefringence-li...  49.3    5e-04   
gb|KHN08449.1|  hypothetical protein glysoja_014214                   49.3    5e-04   Glycine soja [wild soybean]
ref|XP_004228795.2|  PREDICTED: protein trichome birefringence-like   49.3    5e-04   
ref|XP_010915618.1|  PREDICTED: protein trichome birefringence-li...  49.3    5e-04   Elaeis guineensis
gb|KHN11944.1|  hypothetical protein glysoja_019917                   48.9    5e-04   Glycine soja [wild soybean]
gb|KJB16587.1|  hypothetical protein B456_002G2380001                 46.6    5e-04   Gossypium raimondii
ref|XP_009414351.1|  PREDICTED: protein trichome birefringence-li...  49.3    5e-04   
ref|XP_003563753.1|  PREDICTED: protein trichome birefringence-li...  49.3    5e-04   Brachypodium distachyon [annual false brome]
ref|XP_008783903.1|  PREDICTED: protein trichome birefringence-li...  48.9    5e-04   Phoenix dactylifera
ref|XP_009795954.1|  PREDICTED: protein trichome birefringence-li...  49.3    5e-04   Nicotiana sylvestris
gb|KHG20627.1|  CAS1 domain-containing 1                              49.3    5e-04   Gossypium arboreum [tree cotton]
ref|XP_010272740.1|  PREDICTED: protein trichome birefringence-li...  48.9    5e-04   Nelumbo nucifera [Indian lotus]
emb|CBI28569.3|  unnamed protein product                              48.9    5e-04   Vitis vinifera
ref|XP_004497886.1|  PREDICTED: uncharacterized protein LOC101512080  49.3    5e-04   Cicer arietinum [garbanzo]
ref|XP_003542986.1|  PREDICTED: protein YLS7-like isoform X1          48.9    5e-04   
emb|CDY05000.1|  BnaAnng01820D                                        49.3    5e-04   
ref|XP_009125778.1|  PREDICTED: protein trichome birefringence-like   49.3    5e-04   
ref|XP_002525125.1|  conserved hypothetical protein                   48.9    5e-04   
ref|XP_006378226.1|  hypothetical protein POPTR_0010s05310g           49.3    5e-04   
ref|XP_010681621.1|  PREDICTED: protein PMR5-like                     48.9    6e-04   
ref|XP_009604954.1|  PREDICTED: protein trichome birefringence-li...  49.3    6e-04   
ref|XP_011045285.1|  PREDICTED: protein trichome birefringence-li...  49.3    6e-04   
ref|XP_010026659.1|  PREDICTED: protein trichome birefringence-li...  48.9    6e-04   
ref|XP_002975529.1|  hypothetical protein SELMODRAFT_52381            48.9    6e-04   
gb|KJB15004.1|  hypothetical protein B456_002G154200                  49.3    6e-04   
ref|XP_008443074.1|  PREDICTED: protein trichome birefringence-li...  48.9    6e-04   
ref|XP_004149051.1|  PREDICTED: uncharacterized protein LOC101203509  48.9    6e-04   
ref|XP_003613189.1|  hypothetical protein MTR_5g033800                48.9    6e-04   
ref|XP_011037956.1|  PREDICTED: protein trichome birefringence-like   48.9    6e-04   
ref|XP_004152223.1|  PREDICTED: uncharacterized protein LOC101220002  48.9    6e-04   
ref|XP_004238644.1|  PREDICTED: protein trichome birefringence-li...  48.9    6e-04   
ref|XP_008342760.1|  PREDICTED: protein trichome birefringence-li...  48.5    6e-04   
ref|XP_002279857.1|  PREDICTED: protein trichome birefringence-li...  48.9    6e-04   
ref|XP_007157368.1|  hypothetical protein PHAVU_002G064300g           48.9    6e-04   
gb|EAY87710.1|  hypothetical protein OsI_09124                        48.9    6e-04   
ref|XP_008466999.1|  PREDICTED: protein trichome birefringence-li...  48.1    6e-04   
ref|XP_009364158.1|  PREDICTED: protein trichome birefringence-li...  48.9    7e-04   
dbj|BAD16880.1|  hypothetical protein                                 48.9    7e-04   
ref|XP_010052537.1|  PREDICTED: protein trichome birefringence-li...  48.9    7e-04   
ref|XP_008381177.1|  PREDICTED: protein trichome birefringence-li...  48.5    7e-04   
ref|XP_011003951.1|  PREDICTED: protein PMR5-like                     48.9    7e-04   
ref|XP_002313988.1|  hypothetical protein POPTR_0009s07700g           48.9    7e-04   
gb|ABK24209.1|  unknown                                               46.6    7e-04   
emb|CDY16546.1|  BnaC09g37270D                                        48.9    7e-04   
ref|XP_010535816.1|  PREDICTED: protein trichome birefringence-li...  48.9    7e-04   
ref|XP_008649021.1|  PREDICTED: protein trichome birefringence-li...  48.9    7e-04   
ref|XP_009357163.1|  PREDICTED: protein trichome birefringence-li...  48.5    7e-04   
ref|XP_009593637.1|  PREDICTED: protein trichome birefringence-li...  48.5    7e-04   
ref|XP_004243406.1|  PREDICTED: protein trichome birefringence-li...  48.5    7e-04   
ref|XP_003545134.1|  PREDICTED: protein YLS7-like                     48.5    7e-04   
ref|XP_009120795.1|  PREDICTED: protein trichome birefringence-li...  48.9    7e-04   
ref|XP_008392028.1|  PREDICTED: protein trichome birefringence-li...  46.2    7e-04   
ref|XP_004229386.1|  PREDICTED: protein trichome birefringence-li...  48.9    7e-04   
ref|XP_009354272.1|  PREDICTED: protein trichome birefringence-li...  48.5    7e-04   
ref|XP_006348847.1|  PREDICTED: uncharacterized protein LOC102593679  48.5    7e-04   
ref|XP_006349183.1|  PREDICTED: uncharacterized protein LOC102598625  48.9    7e-04   
ref|XP_010665991.1|  PREDICTED: protein trichome birefringence-li...  48.5    7e-04   
ref|XP_006850739.1|  hypothetical protein AMTR_s00025p00057340        48.5    8e-04   
ref|XP_002311838.2|  hypothetical protein POPTR_0008s20840g           48.5    8e-04   
ref|XP_002285609.1|  PREDICTED: protein trichome birefringence-li...  48.5    8e-04   
emb|CDX92451.1|  BnaA10g14900D                                        48.5    8e-04   
ref|XP_009370960.1|  PREDICTED: protein trichome birefringence-li...  48.5    8e-04   
ref|XP_006376352.1|  hypothetical protein POPTR_0013s12290g           48.5    8e-04   
ref|XP_003608140.1|  hypothetical protein MTR_4g088030                48.1    8e-04   
ref|XP_008381569.1|  PREDICTED: protein trichome birefringence-li...  48.5    8e-04   
emb|CAN82331.1|  hypothetical protein VITISV_007322                   48.5    8e-04   
ref|XP_010044971.1|  PREDICTED: protein trichome birefringence-li...  48.5    8e-04   
ref|XP_007142244.1|  hypothetical protein PHAVU_008G264500g           48.5    8e-04   
ref|XP_011010750.1|  PREDICTED: protein trichome birefringence-li...  48.5    8e-04   
emb|CDX97859.1|  BnaC04g40800D                                        48.5    8e-04   
ref|XP_007048659.1|  Trichome birefringence-like 6, putative          48.5    8e-04   
ref|XP_009354247.1|  PREDICTED: protein trichome birefringence-li...  48.5    8e-04   
ref|XP_010233574.1|  PREDICTED: protein trichome birefringence-li...  48.5    8e-04   
emb|CDP18746.1|  unnamed protein product                              47.8    8e-04   
ref|XP_006410052.1|  hypothetical protein EUTSA_v10016701mg           48.5    8e-04   
ref|XP_010052993.1|  PREDICTED: protein trichome birefringence-li...  48.5    8e-04   
ref|XP_009417662.1|  PREDICTED: protein trichome birefringence-like   48.5    8e-04   
ref|XP_008381176.1|  PREDICTED: protein trichome birefringence-li...  48.5    8e-04   
emb|CDP03007.1|  unnamed protein product                              48.5    8e-04   
ref|XP_002276891.2|  PREDICTED: protein trichome birefringence-li...  48.5    8e-04   
ref|XP_010665981.1|  PREDICTED: protein trichome birefringence-like   48.5    8e-04   
gb|KDP31782.1|  hypothetical protein JCGZ_12243                       48.5    8e-04   
gb|KHN12076.1|  hypothetical protein glysoja_049116                   45.4    9e-04   
gb|KJB68384.1|  hypothetical protein B456_010G242200                  48.5    9e-04   
emb|CBW30214.1|  Conserved hypothetical protein                       48.5    9e-04   
gb|KHN05228.1|  hypothetical protein glysoja_042846                   46.2    9e-04   
ref|XP_006446764.1|  hypothetical protein CICLE_v10017800mg           48.5    9e-04   
ref|XP_010259297.1|  PREDICTED: protein trichome birefringence-li...  48.5    9e-04   
dbj|BAK02998.1|  predicted protein                                    48.5    9e-04   
gb|KDO63324.1|  hypothetical protein CISIN_1g017063mg                 48.5    0.001   
gb|EYU17992.1|  hypothetical protein MIMGU_mgv1a025478mg              48.5    0.001   
ref|XP_002886589.1|  hypothetical protein ARALYDRAFT_475253           48.5    0.001   
ref|XP_007146400.1|  hypothetical protein PHAVU_006G037200g           48.1    0.001   
ref|XP_002963582.1|  hypothetical protein SELMODRAFT_64159            48.1    0.001   
ref|XP_002981501.1|  hypothetical protein SELMODRAFT_54079            48.1    0.001   
ref|XP_006287593.1|  hypothetical protein CARUB_v10000803mg           48.5    0.001   
emb|CDX76633.1|  BnaC08g32190D                                        48.5    0.001   
ref|XP_010665974.1|  PREDICTED: protein trichome birefringence-li...  48.1    0.001   
ref|XP_009375160.1|  PREDICTED: protein trichome birefringence-like   48.5    0.001   
gb|KJB33252.1|  hypothetical protein B456_006G004100                  48.1    0.001   
ref|XP_007132902.1|  hypothetical protein PHAVU_011G1346000g          44.7    0.001   



>ref|XP_011086013.1| PREDICTED: protein trichome birefringence-like 38 [Sesamum indicum]
Length=354

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  516  GRDSSDVDCSHWCLPGLPDTWNHLLYASV  430
            GRD S +DCSHWCLPGLPDTWN LLYA++
Sbjct  325  GRDHSGLDCSHWCLPGLPDTWNQLLYAAL  353



>emb|CBI30668.3| unnamed protein product [Vitis vinifera]
Length=377

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  516  GRDSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            G D + +DCSHWCLPGLPDTWN LLYA++ M
Sbjct  345  GEDRTGMDCSHWCLPGLPDTWNQLLYAALVM  375



>ref|XP_011096427.1| PREDICTED: protein trichome birefringence-like 38 [Sesamum indicum]
Length=409

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            D S VDCSHWCLPGLPDTWN LLYA++ M
Sbjct  381  DHSGVDCSHWCLPGLPDTWNQLLYAALVM  409



>ref|XP_002274664.1| PREDICTED: protein trichome birefringence-like 38 [Vitis vinifera]
Length=409

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  516  GRDSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            G D + +DCSHWCLPGLPDTWN LLYA++ M
Sbjct  377  GEDRTGMDCSHWCLPGLPDTWNQLLYAALVM  407



>gb|KHG08135.1| putative U95 [Gossypium arboreum]
Length=514

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM*G  418
            VDCSHWCLPG+PDTWNHLLYAS+ + G
Sbjct  476  VDCSHWCLPGVPDTWNHLLYASMVLEG  502



>ref|XP_002525121.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37248.1| conserved hypothetical protein [Ricinus communis]
Length=135

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -3

Query  507  SSDVDCSHWCLPGLPDTWNHLLYASV  430
             S +DCSHWCLPGLPDTWN LLYA++
Sbjct  98   ESHIDCSHWCLPGLPDTWNKLLYAAI  123



>gb|EYU28072.1| hypothetical protein MIMGU_mgv1a008400mg [Erythranthe guttata]
Length=375

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            D S VDCSHWCLPGLPDTWN LLYA++ M
Sbjct  347  DHSGVDCSHWCLPGLPDTWNQLLYAALVM  375



>ref|XP_002316834.2| hypothetical protein POPTR_0011s07550g [Populus trichocarpa]
 gb|EEE97446.2| hypothetical protein POPTR_0011s07550g [Populus trichocarpa]
Length=224

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            D S  DCSHWCLPGLPDTWN LLYA++ M
Sbjct  196  DGSGTDCSHWCLPGLPDTWNQLLYAALIM  224



>ref|XP_010057074.1| PREDICTED: protein trichome birefringence-like 38 [Eucalyptus 
grandis]
 gb|KCW74075.1| hypothetical protein EUGRSUZ_E02713 [Eucalyptus grandis]
Length=373

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            D S  DCSHWCLPGLPDTWN LLYA++ M
Sbjct  345  DHSGTDCSHWCLPGLPDTWNQLLYAAIVM  373



>gb|AFK45250.1| unknown [Lotus japonicus]
Length=361

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -3

Query  516  GRDSSDVDCSHWCLPGLPDTWNHLLYASVT  427
            G D S  DCSHWCLPGLPDTWN LLYA++T
Sbjct  330  GEDHSGNDCSHWCLPGLPDTWNQLLYAALT  359



>ref|XP_006449479.1| hypothetical protein CICLE_v10015687mg [Citrus clementina]
 gb|ESR62719.1| hypothetical protein CICLE_v10015687mg [Citrus clementina]
Length=366

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            + S  DCSHWCLPGLPDTWN LLYA++TM
Sbjct  338  EHSGTDCSHWCLPGLPDTWNQLLYAALTM  366



>gb|KDO77821.1| hypothetical protein CISIN_1g017263mg [Citrus sinensis]
Length=374

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  504  SDVDCSHWCLPGLPDTWNHLLYASVTM  424
            S  DCSHWCLPGLPDTWN LLYA++TM
Sbjct  348  SGTDCSHWCLPGLPDTWNQLLYAALTM  374



>ref|XP_006362437.1| PREDICTED: uncharacterized protein LOC102599991 [Solanum tuberosum]
Length=370

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            D   VDCSHWCLPGLPDTWN LLYAS+ M
Sbjct  342  DHPGVDCSHWCLPGLPDTWNQLLYASLIM  370



>gb|KDO77822.1| hypothetical protein CISIN_1g017263mg [Citrus sinensis]
Length=368

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  504  SDVDCSHWCLPGLPDTWNHLLYASVTM  424
            S  DCSHWCLPGLPDTWN LLYA++TM
Sbjct  342  SGTDCSHWCLPGLPDTWNQLLYAALTM  368



>ref|XP_002522557.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39857.1| conserved hypothetical protein [Ricinus communis]
Length=370

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            D S  DCSHWCLPGLPDTWN LLYA++ M
Sbjct  342  DGSGTDCSHWCLPGLPDTWNQLLYAALVM  370



>ref|XP_006467669.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=366

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  504  SDVDCSHWCLPGLPDTWNHLLYASVTM  424
            S  DCSHWCLPGLPDTWN LLYA++TM
Sbjct  340  SGTDCSHWCLPGLPDTWNQLLYAALTM  366



>gb|KDO77820.1| hypothetical protein CISIN_1g017263mg [Citrus sinensis]
Length=366

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  504  SDVDCSHWCLPGLPDTWNHLLYASVTM  424
            S  DCSHWCLPGLPDTWN LLYA++TM
Sbjct  340  SGTDCSHWCLPGLPDTWNQLLYAALTM  366



>emb|CDY37673.1| BnaA04g19950D [Brassica napus]
Length=135

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPGLPDTWN LLYA+++M
Sbjct  112  DCSHWCLPGLPDTWNQLLYAALSM  135



>gb|AHN91976.1| TBL1 [Citrus sinensis]
Length=366

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  504  SDVDCSHWCLPGLPDTWNHLLYASVTM  424
            S  DCSHWCLPGLPDTWN LLYA++TM
Sbjct  340  SGTDCSHWCLPGLPDTWNQLLYAALTM  366



>gb|AAF88130.1|AC021043_23 Unknown protein [Arabidopsis thaliana]
Length=368

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
             DCSHWCLPGLPDTWN LLYA++TM
Sbjct  344  TDCSHWCLPGLPDTWNQLLYAALTM  368



>ref|XP_002305083.1| hypothetical protein POPTR_0004s05420g [Populus trichocarpa]
 gb|EEE85594.1| hypothetical protein POPTR_0004s05420g [Populus trichocarpa]
Length=411

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            D S  DCSHWCLPGLPDTWN LLYA++ M
Sbjct  383  DGSGTDCSHWCLPGLPDTWNQLLYAALIM  411



>gb|AAC63848.1| hypothetical protein [Arabidopsis thaliana]
Length=169

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -3

Query  507  SSDVDCSHWCLPGLPDTWNHLLYASVT  427
            S D+DCSHWCLPGLPDTWN LLY+S+T
Sbjct  142  SKDLDCSHWCLPGLPDTWNLLLYSSLT  168



>ref|XP_007214171.1| hypothetical protein PRUPE_ppa019033mg [Prunus persica]
 gb|EMJ15370.1| hypothetical protein PRUPE_ppa019033mg [Prunus persica]
Length=419

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -3

Query  513  RDSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            R  S  DCSHWCLPGLPDTWN LLYAS+ +
Sbjct  381  RPESSADCSHWCLPGLPDTWNRLLYASLLL  410



>ref|NP_564318.1| protein trichome birefringence-like 38 [Arabidopsis thaliana]
 sp|Q8VY22.1|TBL38_ARATH RecName: Full=Protein trichome birefringence-like 38 [Arabidopsis 
thaliana]
 gb|AAL66969.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20296.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99289.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE31037.1| protein trichome birefringence-like 38 [Arabidopsis thaliana]
Length=380

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
             DCSHWCLPGLPDTWN LLYA++TM
Sbjct  356  TDCSHWCLPGLPDTWNQLLYAALTM  380



>ref|NP_180669.2| protein TRICHOME BIREFRINGENCE-LIKE 40 [Arabidopsis thaliana]
 gb|AEC08495.1| uncharacterized protein AT2G31110 [Arabidopsis thaliana]
Length=216

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -3

Query  507  SSDVDCSHWCLPGLPDTWNHLLYASVT  427
            S D+DCSHWCLPGLPDTWN LLY+S+T
Sbjct  189  SKDLDCSHWCLPGLPDTWNLLLYSSLT  215



>ref|XP_002893546.1| hypothetical protein ARALYDRAFT_473111 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69805.1| hypothetical protein ARALYDRAFT_473111 [Arabidopsis lyrata subsp. 
lyrata]
Length=380

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
             DCSHWCLPGLPDTWN LLYA++TM
Sbjct  356  TDCSHWCLPGLPDTWNQLLYAALTM  380



>ref|XP_006305057.1| hypothetical protein CARUB_v10009422mg [Capsella rubella]
 gb|EOA37955.1| hypothetical protein CARUB_v10009422mg [Capsella rubella]
Length=384

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
             DCSHWCLPGLPDTWN LLYA++TM
Sbjct  360  TDCSHWCLPGLPDTWNQLLYAALTM  384



>gb|KJB46924.1| hypothetical protein B456_008G001700 [Gossypium raimondii]
Length=501

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
             DCSHWCLPG+PDTWNHLLYAS+ +
Sbjct  463  ADCSHWCLPGVPDTWNHLLYASMVL  487



>ref|XP_007221982.1| hypothetical protein PRUPE_ppa002834mg [Prunus persica]
 gb|EMJ23181.1| hypothetical protein PRUPE_ppa002834mg [Prunus persica]
Length=629

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLYAS+
Sbjct  598  DCSHWCLPGVPDTWNELLYASL  619



>ref|XP_011005473.1| PREDICTED: protein trichome birefringence-like 37 [Populus euphratica]
Length=359

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            D S  DCSHWCLPGLPDTWN LLYA++ M
Sbjct  331  DGSGTDCSHWCLPGLPDTWNQLLYAALLM  359



>ref|XP_003529365.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN31006.1| hypothetical protein glysoja_020304 [Glycine soja]
Length=368

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  519  GGRDSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            GG D +  DCSHWCLPG+PDTWN LLYA++ M
Sbjct  337  GGLDHTGNDCSHWCLPGVPDTWNELLYAALFM  368



>ref|XP_009790075.1| PREDICTED: protein trichome birefringence-like 38 [Nicotiana 
sylvestris]
 ref|XP_009790076.1| PREDICTED: protein trichome birefringence-like 38 [Nicotiana 
sylvestris]
Length=360

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
            VDCSHWCLPGLPDTWN LLYA++ M
Sbjct  336  VDCSHWCLPGLPDTWNQLLYAALIM  360



>ref|XP_009781572.1| PREDICTED: protein trichome birefringence-like 37 [Nicotiana 
sylvestris]
 ref|XP_009781580.1| PREDICTED: protein trichome birefringence-like 37 [Nicotiana 
sylvestris]
Length=373

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            D   VDCSHWCLPGLPDTWN LLYA++ M
Sbjct  345  DHPGVDCSHWCLPGLPDTWNQLLYAALIM  373



>ref|XP_008812175.1| PREDICTED: protein trichome birefringence-like 2 [Phoenix dactylifera]
Length=612

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM*G  418
            DCSHWCLPG+PD+WN LLYAS+ M G
Sbjct  581  DCSHWCLPGIPDSWNELLYASLLMVG  606



>ref|XP_009599976.1| PREDICTED: protein trichome birefringence-like 37 [Nicotiana 
tomentosiformis]
Length=373

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            D   VDCSHWCLPGLPDTWN LLYA++ M
Sbjct  345  DHPGVDCSHWCLPGLPDTWNQLLYAALIM  373



>dbj|BAD44658.1| unnamed protein product [Arabidopsis thaliana]
Length=364

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -3

Query  507  SSDVDCSHWCLPGLPDTWNHLLYASVT  427
            S D+DCSHWCLPGLPDTWN LLY+S+T
Sbjct  337  SKDLDCSHWCLPGLPDTWNLLLYSSLT  363



>gb|AAO42294.1| unknown protein [Arabidopsis thaliana]
Length=357

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -3

Query  507  SSDVDCSHWCLPGLPDTWNHLLYASVT  427
            S D+DCSHWCLPGLPDTWN LLY+S+T
Sbjct  330  SKDLDCSHWCLPGLPDTWNLLLYSSLT  356



>ref|NP_001077985.1| protein TRICHOME BIREFRINGENCE-LIKE 40 [Arabidopsis thaliana]
 sp|Q67XC4.2|TBL40_ARATH RecName: Full=Protein trichome birefringence-like 40 [Arabidopsis 
thaliana]
 gb|AEC08494.1| uncharacterized protein AT2G31110 [Arabidopsis thaliana]
Length=364

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -3

Query  507  SSDVDCSHWCLPGLPDTWNHLLYASVT  427
            S D+DCSHWCLPGLPDTWN LLY+S+T
Sbjct  337  SKDLDCSHWCLPGLPDTWNLLLYSSLT  363



>gb|AAM65091.1| unknown [Arabidopsis thaliana]
Length=364

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -3

Query  507  SSDVDCSHWCLPGLPDTWNHLLYASVT  427
            S D+DCSHWCLPGLPDTWN LLY+S+T
Sbjct  337  SKDLDCSHWCLPGLPDTWNLLLYSSLT  363



>ref|XP_007048657.1| Trichome birefringence-like 6, putative isoform 1 [Theobroma 
cacao]
 gb|EOX92814.1| Trichome birefringence-like 6, putative isoform 1 [Theobroma 
cacao]
Length=517

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
             DCSHWCLPG+PDTWNHLLYAS+ +
Sbjct  484  ADCSHWCLPGVPDTWNHLLYASMVL  508



>gb|KHF98470.1| Transmembrane protein [Gossypium arboreum]
Length=280

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPGLPDTWNHLLYA++ M
Sbjct  257  DCSHWCLPGLPDTWNHLLYAALFM  280



>ref|XP_006367779.1| PREDICTED: uncharacterized protein LOC102593572 [Solanum tuberosum]
Length=236

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPGLPDTWN LLYAS+ M
Sbjct  213  DCSHWCLPGLPDTWNQLLYASLVM  236



>ref|XP_006357865.1| PREDICTED: uncharacterized protein LOC102596807 [Solanum tuberosum]
Length=673

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPG+PDTWN LLYA + M
Sbjct  634  DCSHWCLPGVPDTWNELLYAQLLM  657



>ref|XP_006410551.1| hypothetical protein EUTSA_v10016785mg [Eutrema salsugineum]
 gb|ESQ52004.1| hypothetical protein EUTSA_v10016785mg [Eutrema salsugineum]
Length=385

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
            +DCSHWCLPGLPDTWN LLYA+++M
Sbjct  361  LDCSHWCLPGLPDTWNQLLYAAISM  385



>gb|KHN32337.1| hypothetical protein glysoja_032520 [Glycine soja]
Length=371

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  516  GRDSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            G D +  DCSHWCLPGLPDTWN LLYA+++M
Sbjct  341  GVDHTGNDCSHWCLPGLPDTWNELLYAALSM  371



>ref|XP_002881157.1| hypothetical protein ARALYDRAFT_482040 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57416.1| hypothetical protein ARALYDRAFT_482040 [Arabidopsis lyrata subsp. 
lyrata]
Length=364

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  507  SSDVDCSHWCLPGLPDTWNHLLYASVT  427
            S D+DCSHWCLPGLPDTWN LLYA +T
Sbjct  337  SKDLDCSHWCLPGLPDTWNSLLYAFLT  363



>ref|XP_003518885.1| PREDICTED: protein YLS7-like [Glycine max]
Length=371

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  516  GRDSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            G D +  DCSHWCLPGLPDTWN LLYA+++M
Sbjct  341  GVDHTGNDCSHWCLPGLPDTWNELLYAALSM  371



>gb|KJB34893.1| hypothetical protein B456_006G088800 [Gossypium raimondii]
Length=380

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPGLPDTWNHLLYA++ M
Sbjct  357  DCSHWCLPGLPDTWNHLLYAALFM  380



>ref|XP_010665989.1| PREDICTED: protein trichome birefringence-like 40 [Beta vulgaris 
subsp. vulgaris]
Length=442

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASV  430
            VDCSHWCLPGLPDTWN LLYAS+
Sbjct  408  VDCSHWCLPGLPDTWNRLLYASI  430



>ref|XP_008439751.1| PREDICTED: protein trichome birefringence-like 38 [Cucumis melo]
Length=362

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPGLPDTWN LLYA+ TM
Sbjct  339  DCSHWCLPGLPDTWNELLYAAFTM  362



>emb|CAN60202.1| hypothetical protein VITISV_036403 [Vitis vinifera]
Length=367

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -3

Query  516  GRDSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            G D + +DCSHWCLPGLPDTWN LL A++ M
Sbjct  335  GEDRTGMDCSHWCLPGLPDTWNQLLXAALVM  365



>gb|KJB31199.1| hypothetical protein B456_005G180600 [Gossypium raimondii]
Length=570

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLYAS+
Sbjct  542  DCSHWCLPGVPDTWNELLYASL  563



>ref|XP_004134666.1| PREDICTED: uncharacterized protein LOC101216213 [Cucumis sativus]
 ref|XP_004155544.1| PREDICTED: uncharacterized protein LOC101228403 [Cucumis sativus]
 gb|KGN49297.1| hypothetical protein Csa_6G519500 [Cucumis sativus]
Length=362

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPGLPDTWN LLYA+ TM
Sbjct  339  DCSHWCLPGLPDTWNELLYAAFTM  362



>ref|XP_010940155.1| PREDICTED: protein trichome birefringence-like 2 [Elaeis guineensis]
Length=619

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM*G  418
            DCSHWCLPG+PD+WN LLYAS+ M G
Sbjct  588  DCSHWCLPGIPDSWNELLYASLLMVG  613



>emb|CDY17220.1| BnaA05g09680D [Brassica napus]
Length=381

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            ++   DCSHWCLPGLPDTWN LLYA+++M
Sbjct  353  ENGRTDCSHWCLPGLPDTWNQLLYAALSM  381



>ref|XP_004234094.1| PREDICTED: protein trichome birefringence-like 38 [Solanum lycopersicum]
Length=357

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPGLPDTWN LLYAS+ M
Sbjct  334  DCSHWCLPGLPDTWNQLLYASLVM  357



>ref|XP_002326021.2| hypothetical protein POPTR_0019s11970g, partial [Populus trichocarpa]
 gb|EEF00403.2| hypothetical protein POPTR_0019s11970g, partial [Populus trichocarpa]
Length=426

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -3

Query  513  RDSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            ++ S  DCSHWCLPGLPDTWN LLYAS+ +
Sbjct  387  QEESHPDCSHWCLPGLPDTWNRLLYASLVL  416



>ref|XP_009348409.1| PREDICTED: protein trichome birefringence-like 38 [Pyrus x bretschneideri]
Length=361

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            D S  DCSHWCLPGLPDTWN LLYA++ M
Sbjct  333  DHSGNDCSHWCLPGLPDTWNQLLYAALIM  361



>ref|XP_010480710.1| PREDICTED: protein trichome birefringence-like 38, partial [Camelina 
sativa]
Length=406

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
             DCSHWCLPGLPDTWN LLYA+++M
Sbjct  382  TDCSHWCLPGLPDTWNQLLYAALSM  406



>ref|XP_008371453.1| PREDICTED: protein trichome birefringence-like 38 [Malus domestica]
Length=361

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            D S  DCSHWCLPGLPDTWN LLYA++ M
Sbjct  333  DHSGNDCSHWCLPGLPDTWNQLLYAALIM  361



>ref|XP_009143809.1| PREDICTED: protein trichome birefringence-like 37 [Brassica rapa]
Length=381

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            ++   DCSHWCLPGLPDTWN LLYA+++M
Sbjct  353  ENGRTDCSHWCLPGLPDTWNQLLYAALSM  381



>ref|XP_010251171.1| PREDICTED: protein trichome birefringence-like 2 [Nelumbo nucifera]
Length=616

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLYAS+
Sbjct  585  DCSHWCLPGVPDTWNELLYASL  606



>gb|KJB31198.1| hypothetical protein B456_005G180600 [Gossypium raimondii]
Length=593

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLYAS+
Sbjct  565  DCSHWCLPGVPDTWNELLYASL  586



>ref|XP_010038289.1| PREDICTED: protein trichome birefringence-like 6 [Eucalyptus 
grandis]
 gb|KCW50113.1| hypothetical protein EUGRSUZ_K03547 [Eucalyptus grandis]
Length=536

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = -3

Query  516  GRDSSDVDCSHWCLPGLPDTWNHLLY  439
            GR S+  DCSHWCLPG+PDTWN LLY
Sbjct  499  GRSSNIQDCSHWCLPGVPDTWNELLY  524



>ref|XP_010689869.1| PREDICTED: protein trichome birefringence-like 36 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=435

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  504  SDVDCSHWCLPGLPDTWNHLLYASV  430
            S VDCSHWCLPGLPDTWN LLYAS+
Sbjct  401  SYVDCSHWCLPGLPDTWNRLLYASL  425



>ref|XP_008244482.1| PREDICTED: protein trichome birefringence-like 42 [Prunus mume]
Length=419

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  507  SSDVDCSHWCLPGLPDTWNHLLYASVTM  424
             S  DCSHWCLPGLPDTWN LLYAS+ +
Sbjct  383  ESSADCSHWCLPGLPDTWNRLLYASLLL  410



>ref|XP_010460674.1| PREDICTED: protein trichome birefringence-like 38 [Camelina sativa]
Length=384

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
             DCSHWCLPGLPDTWN LLYA+++M
Sbjct  360  TDCSHWCLPGLPDTWNQLLYAALSM  384



>ref|XP_009352799.1| PREDICTED: protein trichome birefringence-like 37 [Pyrus x bretschneideri]
Length=361

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            D S  DCSHWCLPGLPDTWN LLYA++ M
Sbjct  333  DHSGNDCSHWCLPGLPDTWNQLLYAALIM  361



>ref|XP_010499424.1| PREDICTED: protein trichome birefringence-like 38 [Camelina sativa]
Length=383

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
             DCSHWCLPGLPDTWN LLYA+++M
Sbjct  359  TDCSHWCLPGLPDTWNQLLYAALSM  383



>ref|XP_011460601.1| PREDICTED: protein trichome birefringence-like 38 [Fragaria vesca 
subsp. vesca]
Length=370

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            D S  DCSHWCLPGLPDTWN LLYA++ M
Sbjct  342  DHSGNDCSHWCLPGLPDTWNQLLYAALIM  370



>ref|XP_004489803.1| PREDICTED: uncharacterized protein LOC101513224 [Cicer arietinum]
Length=528

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLYAS+
Sbjct  497  DCSHWCLPGVPDTWNELLYASL  518



>ref|XP_007044711.1| Uncharacterized protein TCM_010432 [Theobroma cacao]
 gb|EOY00543.1| Uncharacterized protein TCM_010432 [Theobroma cacao]
Length=643

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLYAS+
Sbjct  601  DCSHWCLPGVPDTWNELLYASL  622



>ref|XP_006294394.1| hypothetical protein CARUB_v10023411mg [Capsella rubella]
 gb|EOA27292.1| hypothetical protein CARUB_v10023411mg [Capsella rubella]
Length=385

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
             DCSHWCLPGLPDTWN LLYA+++M
Sbjct  361  TDCSHWCLPGLPDTWNQLLYAALSM  385



>ref|XP_010689872.1| PREDICTED: protein trichome birefringence-like 40 [Beta vulgaris 
subsp. vulgaris]
Length=463

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  504  SDVDCSHWCLPGLPDTWNHLLYASV  430
            S+ DCSHWCLPGLPDTWN LLYAS+
Sbjct  436  SNADCSHWCLPGLPDTWNRLLYASL  460



>ref|XP_009123178.1| PREDICTED: protein trichome birefringence-like 38 [Brassica rapa]
 emb|CDY34081.1| BnaA09g27070D [Brassica napus]
Length=376

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPGLPDTWN LLYA+++M
Sbjct  353  DCSHWCLPGLPDTWNQLLYAALSM  376



>gb|KDP26622.1| hypothetical protein JCGZ_17780 [Jatropha curcas]
Length=584

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLYAS+
Sbjct  553  DCSHWCLPGVPDTWNELLYASL  574



>ref|XP_010509796.1| PREDICTED: protein trichome birefringence-like 37 [Camelina sativa]
Length=385

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
             DCSHWCLPGLPDTWN LLYA+++M
Sbjct  361  TDCSHWCLPGLPDTWNQLLYAALSM  385



>ref|XP_008225213.1| PREDICTED: protein trichome birefringence-like 37 [Prunus mume]
Length=361

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            D S  DCSHWCLPGLPDTWN LLYA++ M
Sbjct  333  DHSGNDCSHWCLPGLPDTWNQLLYAALIM  361



>ref|XP_008383643.1| PREDICTED: protein trichome birefringence-like 38 [Malus domestica]
Length=361

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            D S  DCSHWCLPGLPDTWN LLYA++ M
Sbjct  333  DHSGNDCSHWCLPGLPDTWNQLLYAALIM  361



>ref|XP_009102887.1| PREDICTED: protein trichome birefringence-like 38 [Brassica rapa]
 emb|CDY57453.1| BnaA07g36480D [Brassica napus]
Length=378

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPGLPDTWN LLYA+++M
Sbjct  355  DCSHWCLPGLPDTWNQLLYAALSM  378



>emb|CDY64767.1| BnaCnng44810D [Brassica napus]
Length=381

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
             DCSHWCLPGLPDTWN LLYA+++M
Sbjct  357  TDCSHWCLPGLPDTWNQLLYAALSM  381



>ref|NP_565779.1| trichome birefringence-like 37 protein [Arabidopsis thaliana]
 sp|O22960.2|TBL37_ARATH RecName: Full=Protein trichome birefringence-like 37 [Arabidopsis 
thaliana]
 gb|AAB67625.2| expressed protein [Arabidopsis thaliana]
 gb|AAM63505.1| unknown [Arabidopsis thaliana]
 gb|AEC08913.1| trichome birefringence-like 37 protein [Arabidopsis thaliana]
Length=385

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
             DCSHWCLPGLPDTWN LLYA+++M
Sbjct  361  TDCSHWCLPGLPDTWNQLLYAALSM  385



>emb|CDX94643.1| BnaC07g10150D [Brassica napus]
Length=378

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPGLPDTWN LLYA+++M
Sbjct  355  DCSHWCLPGLPDTWNQLLYAALSM  378



>emb|CDX79555.1| BnaC03g18910D [Brassica napus]
Length=380

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
             DCSHWCLPGLPDTWN LLYA+++M
Sbjct  356  TDCSHWCLPGLPDTWNQLLYAALSM  380



>gb|KJB69610.1| hypothetical protein B456_011G033800 [Gossypium raimondii]
Length=365

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            D S  DCSHWCLPGLPDTWN LLYA++ M
Sbjct  337  DHSGNDCSHWCLPGLPDTWNQLLYAALGM  365



>gb|KHG20284.1| Enolase [Gossypium arboreum]
Length=365

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            D S  DCSHWCLPGLPDTWN LLYA++ M
Sbjct  337  DHSGNDCSHWCLPGLPDTWNQLLYAALGM  365



>ref|XP_004485883.1| PREDICTED: uncharacterized protein LOC101498973 [Cicer arietinum]
Length=366

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            D +  DCSHWCLPGLPDTWN LLYA+++M
Sbjct  338  DHAGNDCSHWCLPGLPDTWNQLLYAALSM  366



>ref|XP_009141359.1| PREDICTED: protein trichome birefringence-like 37 [Brassica rapa]
Length=384

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPGLPDTWN LLYA+++M
Sbjct  361  DCSHWCLPGLPDTWNQLLYAALSM  384



>ref|XP_006415616.1| hypothetical protein EUTSA_v10007896mg [Eutrema salsugineum]
 gb|ESQ33969.1| hypothetical protein EUTSA_v10007896mg [Eutrema salsugineum]
Length=386

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
             DCSHWCLPGLPDTWN LLYA+++M
Sbjct  362  TDCSHWCLPGLPDTWNQLLYAALSM  386



>emb|CDX84658.1| BnaA03g15720D [Brassica napus]
Length=380

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
             DCSHWCLPGLPDTWN LLYA+++M
Sbjct  356  TDCSHWCLPGLPDTWNQLLYAALSM  380



>ref|XP_009132974.1| PREDICTED: protein trichome birefringence-like 37 [Brassica rapa]
Length=381

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
             DCSHWCLPGLPDTWN LLYA+++M
Sbjct  357  TDCSHWCLPGLPDTWNQLLYAALSM  381



>ref|XP_011045911.1| PREDICTED: protein trichome birefringence-like 38 [Populus euphratica]
Length=362

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  504  SDVDCSHWCLPGLPDTWNHLLYASVTM  424
            S  DCSHWCLPGLPDTWN LLYA++ M
Sbjct  336  SGTDCSHWCLPGLPDTWNQLLYAALIM  362



>ref|XP_010469399.1| PREDICTED: protein trichome birefringence-like 37 [Camelina sativa]
Length=385

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
             DCSHWCLPGLPDTWN LLYA+++M
Sbjct  361  TDCSHWCLPGLPDTWNQLLYAALSM  385



>ref|XP_010413780.1| PREDICTED: protein trichome birefringence-like 37 [Camelina sativa]
Length=385

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
             DCSHWCLPGLPDTWN LLYA+++M
Sbjct  361  TDCSHWCLPGLPDTWNQLLYAALSM  385



>ref|XP_009143811.1| PREDICTED: protein trichome birefringence-like 37 [Brassica rapa]
Length=382

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
             DCSHWCLPGLPDTWN LLYA+++M
Sbjct  358  TDCSHWCLPGLPDTWNQLLYAALSM  382



>gb|KFK44758.1| hypothetical protein AALP_AA1G299000 [Arabis alpina]
Length=380

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
             DCSHWCLPGLPDTWN LLYA+++M
Sbjct  356  TDCSHWCLPGLPDTWNQLLYAALSM  380



>ref|XP_009783417.1| PREDICTED: protein trichome birefringence-like 4 [Nicotiana sylvestris]
Length=564

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPG+PDTWN LLYA + M
Sbjct  525  DCSHWCLPGVPDTWNELLYAQLLM  548



>emb|CDY17219.1| BnaA05g09690D [Brassica napus]
Length=382

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
             DCSHWCLPGLPDTWN LLYA+++M
Sbjct  358  TDCSHWCLPGLPDTWNQLLYAALSM  382



>gb|KFK31236.1| hypothetical protein AALP_AA6G086200 [Arabis alpina]
Length=361

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  507  SSDVDCSHWCLPGLPDTWNHLLYASVT  427
            S  +DCSHWCLPGLPDTWN LLYAS+T
Sbjct  334  SKGLDCSHWCLPGLPDTWNLLLYASLT  360



>ref|XP_009392183.1| PREDICTED: protein trichome birefringence-like 2 [Musa acuminata 
subsp. malaccensis]
Length=718

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 19/26 (73%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM*G  418
            DCSHWCLPG+PD+WN LLYAS+ + G
Sbjct  687  DCSHWCLPGIPDSWNELLYASLLIVG  712



>ref|XP_009587467.1| PREDICTED: protein trichome birefringence-like [Nicotiana tomentosiformis]
Length=541

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPG+PDTWN LLYA + M
Sbjct  510  DCSHWCLPGVPDTWNELLYAQLLM  533



>ref|XP_006356414.1| PREDICTED: uncharacterized protein LOC102583109 [Solanum tuberosum]
Length=570

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLYAS+
Sbjct  539  DCSHWCLPGVPDTWNELLYASL  560



>ref|XP_004232960.1| PREDICTED: protein trichome birefringence-like 38 [Solanum lycopersicum]
Length=405

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
            VDCSHWCLPGLPDTWN LLYAS+ +
Sbjct  344  VDCSHWCLPGLPDTWNQLLYASLII  368



>ref|XP_010469762.1| PREDICTED: protein trichome birefringence-like 40 [Camelina sativa]
Length=366

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  507  SSDVDCSHWCLPGLPDTWNHLLYASVT  427
            S  +DCSHWCLPGLPDTWN LLYAS+T
Sbjct  339  SKGLDCSHWCLPGLPDTWNLLLYASLT  365



>ref|XP_002515280.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47264.1| conserved hypothetical protein [Ricinus communis]
Length=563

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 19/23 (83%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  507  SSDVDCSHWCLPGLPDTWNHLLY  439
            SS  DCSHWCLPG+PDTWN LLY
Sbjct  529  SSGQDCSHWCLPGIPDTWNELLY  551



>ref|XP_010414182.1| PREDICTED: protein trichome birefringence-like 40 [Camelina sativa]
Length=366

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  507  SSDVDCSHWCLPGLPDTWNHLLYASVT  427
            S  +DCSHWCLPGLPDTWN LLYAS+T
Sbjct  339  SKGLDCSHWCLPGLPDTWNLLLYASLT  365



>ref|XP_006294476.1| hypothetical protein CARUB_v10023492mg [Capsella rubella]
 gb|EOA27374.1| hypothetical protein CARUB_v10023492mg [Capsella rubella]
Length=364

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  507  SSDVDCSHWCLPGLPDTWNHLLYASVT  427
            S  +DCSHWCLPGLPDTWN LLYAS+T
Sbjct  337  SQGLDCSHWCLPGLPDTWNLLLYASLT  363



>ref|XP_009593638.1| PREDICTED: protein trichome birefringence-like 28 [Nicotiana 
tomentosiformis]
Length=442

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  507  SSDVDCSHWCLPGLPDTWNHLLYASVTM  424
             S  DCSHWCLPGLPDTWN LLYAS+ +
Sbjct  401  ESFADCSHWCLPGLPDTWNRLLYASLVL  428



>ref|XP_010540499.1| PREDICTED: protein trichome birefringence-like 38 [Tarenaya hassleriana]
Length=380

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
             DCSHWCLPGLPDTWN LLYA+++M
Sbjct  356  TDCSHWCLPGLPDTWNRLLYAALSM  380



>ref|XP_003593751.1| hypothetical protein MTR_2g015720 [Medicago truncatula]
Length=376

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            D +  DCSHWCLPGLPDTWN LLYA+++M
Sbjct  348  DHAGNDCSHWCLPGLPDTWNQLLYAALSM  376



>ref|XP_003593750.1| hypothetical protein MTR_2g015720 [Medicago truncatula]
 gb|AES64001.1| trichome birefringence-like protein [Medicago truncatula]
Length=360

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            D +  DCSHWCLPGLPDTWN LLYA+++M
Sbjct  332  DHAGNDCSHWCLPGLPDTWNQLLYAALSM  360



>ref|XP_010510241.1| PREDICTED: protein trichome birefringence-like 40 [Camelina sativa]
Length=366

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  507  SSDVDCSHWCLPGLPDTWNHLLYASVT  427
            S  +DCSHWCLPGLPDTWN LLYAS+T
Sbjct  339  SKGLDCSHWCLPGLPDTWNLLLYASLT  365



>emb|CDP13190.1| unnamed protein product [Coffea canephora]
Length=624

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLYAS+
Sbjct  593  DCSHWCLPGVPDTWNELLYASL  614



>ref|XP_010052546.1| PREDICTED: protein trichome birefringence-like 36 [Eucalyptus 
grandis]
 gb|KCW89620.1| hypothetical protein EUGRSUZ_A01903 [Eucalyptus grandis]
Length=428

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM*G  418
             DCSHWCLPGLPDTWN LLYAS+ + G
Sbjct  390  ADCSHWCLPGLPDTWNRLLYASLVLDG  416



>gb|KEH16599.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=526

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPG+PDTWN +LYA + M
Sbjct  488  DCSHWCLPGVPDTWNEILYAELLM  511



>ref|XP_009786368.1| PREDICTED: protein trichome birefringence-like 28 [Nicotiana 
sylvestris]
Length=402

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  507  SSDVDCSHWCLPGLPDTWNHLLYASVTM  424
             S  DCSHWCLPGLPDTWN LLYAS+ +
Sbjct  361  ESFADCSHWCLPGLPDTWNRLLYASLVL  388



>ref|XP_011002530.1| PREDICTED: protein trichome birefringence-like 42 [Populus euphratica]
 ref|XP_011002531.1| PREDICTED: protein trichome birefringence-like 42 [Populus euphratica]
Length=441

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  513  RDSSDVDCSHWCLPGLPDTWNHLLYASVT  427
            ++ S  DCSHWCLPGLPDTWN LLYAS+ 
Sbjct  402  QEESHPDCSHWCLPGLPDTWNRLLYASLV  430



>ref|XP_008221854.1| PREDICTED: protein trichome birefringence-like 2 [Prunus mume]
Length=620

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 18/22 (82%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLY S+
Sbjct  589  DCSHWCLPGVPDTWNELLYVSL  610



>ref|XP_009599983.1| PREDICTED: protein trichome birefringence-like 37 [Nicotiana 
tomentosiformis]
Length=363

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
            VDCSHWCLPGLPDTWN LLYA++ +
Sbjct  339  VDCSHWCLPGLPDTWNQLLYAALII  363



>ref|XP_010665988.1| PREDICTED: protein trichome birefringence-like 40 [Beta vulgaris 
subsp. vulgaris]
Length=395

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASV  430
            +DCSHWCLPGLPDTWN LLYAS+
Sbjct  362  LDCSHWCLPGLPDTWNRLLYASI  384



>ref|XP_002525401.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37039.1| conserved hypothetical protein [Ricinus communis]
Length=581

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLYAS+
Sbjct  550  DCSHWCLPGVPDTWNELLYASL  571



>ref|XP_010686317.1| PREDICTED: protein trichome birefringence-like 37 [Beta vulgaris 
subsp. vulgaris]
Length=368

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            + + +DCSHWCLPGLPDTWN LLYA++ M
Sbjct  340  EHAGLDCSHWCLPGLPDTWNQLLYAALIM  368



>ref|XP_009591829.1| PREDICTED: protein trichome birefringence-like 2 [Nicotiana tomentosiformis]
Length=622

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLYAS+
Sbjct  591  DCSHWCLPGVPDTWNELLYASL  612



>emb|CCI55362.1| PH01B035L11.7 [Phyllostachys edulis]
Length=696

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLYAS+
Sbjct  665  DCSHWCLPGVPDTWNELLYASL  686



>ref|XP_007145701.1| hypothetical protein PHAVU_007G261000g [Phaseolus vulgaris]
 gb|ESW17695.1| hypothetical protein PHAVU_007G261000g [Phaseolus vulgaris]
Length=670

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPG+PDTWN +LYA + +
Sbjct  635  DCSHWCLPGVPDTWNEILYAELLL  658



>ref|XP_011002532.1| PREDICTED: protein trichome birefringence-like 39 [Populus euphratica]
Length=371

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  516  GRDSSDVDCSHWCLPGLPDTWNHLLYASV  430
            G D+   DCSHWCLPGLPDTWN LLYA++
Sbjct  341  GGDNGGTDCSHWCLPGLPDTWNQLLYAAL  369



>emb|CDY19065.1| BnaA04g18050D [Brassica napus]
Length=220

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  507  SSDVDCSHWCLPGLPDTWNHLLYASVT  427
            +  +DCSHWCLPGLPDTWN LLYAS+T
Sbjct  193  AKGLDCSHWCLPGLPDTWNLLLYASLT  219



>ref|XP_002528306.1| hypothetical protein RCOM_0838230 [Ricinus communis]
 gb|EEF34064.1| hypothetical protein RCOM_0838230 [Ricinus communis]
Length=110

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASV  430
             DC HWCLPGLPDTWN LLYAS+
Sbjct  80   ADCLHWCLPGLPDTWNELLYASI  102



>ref|XP_006492340.1| PREDICTED: protein YLS7-like [Citrus sinensis]
 gb|KDO86991.1| hypothetical protein CISIN_1g009237mg [Citrus sinensis]
Length=539

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 1/26 (4%)
 Frame = -3

Query  513  RDSSDV-DCSHWCLPGLPDTWNHLLY  439
            R SS++ DCSHWCLPG+PDTWN LLY
Sbjct  506  RYSSNIQDCSHWCLPGVPDTWNELLY  531



>gb|KDO54062.1| hypothetical protein CISIN_1g036968mg [Citrus sinensis]
Length=352

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  504  SDVDCSHWCLPGLPDTWNHLLYASV  430
            S  DCSHWCLPG+PDTWNHLLYA++
Sbjct  325  STPDCSHWCLPGVPDTWNHLLYATI  349



>ref|XP_007025417.1| Trichome birefringence-like 37 isoform 1 [Theobroma cacao]
 ref|XP_007025418.1| Trichome birefringence-like 37 isoform 1 [Theobroma cacao]
 gb|EOY28039.1| Trichome birefringence-like 37 isoform 1 [Theobroma cacao]
 gb|EOY28040.1| Trichome birefringence-like 37 isoform 1 [Theobroma cacao]
Length=363

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            + S  DCSHWCLPGLPDTWN LLYA++ M
Sbjct  335  EHSGNDCSHWCLPGLPDTWNQLLYAALVM  363



>ref|XP_002325581.2| hypothetical protein POPTR_0019s11990g [Populus trichocarpa]
 gb|EEE99962.2| hypothetical protein POPTR_0019s11990g [Populus trichocarpa]
Length=371

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  516  GRDSSDVDCSHWCLPGLPDTWNHLLYASV  430
            G D+   DCSHWCLPGLPDTWN LLYA++
Sbjct  341  GGDNGGTDCSHWCLPGLPDTWNQLLYAAL  369



>ref|XP_006480514.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=352

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWNHLLYA++
Sbjct  328  DCSHWCLPGVPDTWNHLLYATI  349



>gb|EPS62153.1| hypothetical protein M569_12640, partial [Genlisea aurea]
Length=78

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
             DCSHWCLPGLPDTWN L YA++ +
Sbjct  52   ADCSHWCLPGLPDTWNQLFYAALFL  76



>gb|KDP41035.1| hypothetical protein JCGZ_03567 [Jatropha curcas]
Length=374

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  516  GRDSSDVDCSHWCLPGLPDTWNHLLYASV  430
            G+D    DCSHWCLPG+PDTWN LLYA++
Sbjct  342  GQDMKQNDCSHWCLPGVPDTWNQLLYAAL  370



>ref|XP_006410237.1| hypothetical protein EUTSA_v10016834mg [Eutrema salsugineum]
 gb|ESQ51690.1| hypothetical protein EUTSA_v10016834mg [Eutrema salsugineum]
Length=365

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  507  SSDVDCSHWCLPGLPDTWNHLLYASVT  427
            +  +DCSHWCLPGLPDTWN LLYAS+T
Sbjct  338  TKALDCSHWCLPGLPDTWNLLLYASLT  364



>ref|XP_004509571.1| PREDICTED: uncharacterized protein LOC101508086 [Cicer arietinum]
Length=589

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/22 (82%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLY S+
Sbjct  558  DCSHWCLPGVPDTWNELLYVSL  579



>ref|XP_004161492.1| PREDICTED: uncharacterized protein LOC101228487 [Cucumis sativus]
Length=613

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPG+PD WN +LYA + M
Sbjct  582  DCSHWCLPGVPDAWNEILYAELLM  605



>ref|XP_004136561.1| PREDICTED: uncharacterized protein LOC101220024 [Cucumis sativus]
 gb|KGN59288.1| hypothetical protein Csa_3G800710 [Cucumis sativus]
Length=613

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPG+PD WN +LYA + M
Sbjct  582  DCSHWCLPGVPDAWNEILYAELLM  605



>ref|XP_010689958.1| PREDICTED: protein trichome birefringence-like 43 [Beta vulgaris 
subsp. vulgaris]
Length=368

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWNHLLYAS+
Sbjct  345  DCSHWCLPGVPDTWNHLLYASL  366



>emb|CDY30832.1| BnaC05g22080D [Brassica napus]
Length=376

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPGLPDTWN LLYA++ M
Sbjct  353  DCSHWCLPGLPDTWNQLLYAALFM  376



>ref|XP_002973496.1| hypothetical protein SELMODRAFT_53072, partial [Selaginella moellendorffii]
 gb|EFJ25156.1| hypothetical protein SELMODRAFT_53072, partial [Selaginella moellendorffii]
Length=335

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  507  SSDVDCSHWCLPGLPDTWNHLLYASVT  427
            S   DCSHWCLPG+PDTWN LLYAS+T
Sbjct  307  SGRQDCSHWCLPGVPDTWNELLYASLT  333



>ref|XP_006469127.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=409

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -3

Query  513  RDSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            +  +  DCSHWCLPGLPDTWN LLYAS+ +
Sbjct  362  QQETYADCSHWCLPGLPDTWNTLLYASMVL  391



>ref|XP_006597476.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN18917.1| hypothetical protein glysoja_036096 [Glycine soja]
Length=364

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVT  427
            D +  DCSHWCLPGLPDTWN LLYA++T
Sbjct  336  DHAGNDCSHWCLPGLPDTWNQLLYAALT  363



>ref|XP_007148060.1| hypothetical protein PHAVU_006G177100g [Phaseolus vulgaris]
 gb|ESW20054.1| hypothetical protein PHAVU_006G177100g [Phaseolus vulgaris]
Length=364

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVT  427
            D +  DCSHWCLPGLPDTWN LLYA++T
Sbjct  336  DHAGNDCSHWCLPGLPDTWNQLLYAALT  363



>gb|EMS67231.1| hypothetical protein TRIUR3_03922 [Triticum urartu]
Length=117

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVT  427
             DC HWCLPGLPDTWNH LYA + 
Sbjct  75   ADCIHWCLPGLPDTWNHFLYAQIV  98



>gb|KDP21076.1| hypothetical protein JCGZ_21547 [Jatropha curcas]
Length=367

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            + S  DCSHWCLPGLPD WN LLYA++ M
Sbjct  339  EGSGTDCSHWCLPGLPDIWNQLLYAALIM  367



>emb|CDP10159.1| unnamed protein product [Coffea canephora]
Length=623

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PD+WN LLYA +
Sbjct  587  DCSHWCLPGVPDSWNELLYAEL  608



>ref|XP_010672635.1| PREDICTED: protein trichome birefringence-like 1 [Beta vulgaris 
subsp. vulgaris]
Length=602

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PD+WN LLYA +
Sbjct  573  DCSHWCLPGVPDSWNELLYAEI  594



>ref|XP_006849537.1| hypothetical protein AMTR_s00024p00162030 [Amborella trichopoda]
 gb|ERN11118.1| hypothetical protein AMTR_s00024p00162030 [Amborella trichopoda]
Length=718

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PD WN LLYA++
Sbjct  691  DCSHWCLPGVPDIWNELLYAAI  712



>gb|KDO63330.1| hypothetical protein CISIN_1g043893mg [Citrus sinensis]
Length=419

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -3

Query  513  RDSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            +  +  DCSHWCLPGLPDTWN LLYAS+ +
Sbjct  372  QQETYADCSHWCLPGLPDTWNTLLYASMVL  401



>ref|XP_009132768.1| PREDICTED: protein trichome birefringence-like 40 [Brassica rapa]
 emb|CDX84800.1| BnaA03g14300D [Brassica napus]
Length=365

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  507  SSDVDCSHWCLPGLPDTWNHLLYASVT  427
            +  +DCSHWCLPGLPDTWN LLYAS+T
Sbjct  338  AKGLDCSHWCLPGLPDTWNLLLYASLT  364



>emb|CDY23962.1| BnaC03g17290D [Brassica napus]
Length=365

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  507  SSDVDCSHWCLPGLPDTWNHLLYASVT  427
            +  +DCSHWCLPGLPDTWN LLYAS+T
Sbjct  338  AKGLDCSHWCLPGLPDTWNLLLYASLT  364



>ref|XP_008449392.1| PREDICTED: protein trichome birefringence-like 42 [Cucumis melo]
Length=419

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -3

Query  513  RDSSDVDCSHWCLPGLPDTWNHLLYASVT  427
            ++    DCSHWCLPGLPDTWN LLYA++ 
Sbjct  387  KEEIIADCSHWCLPGLPDTWNRLLYATIV  415



>ref|XP_010553609.1| PREDICTED: protein trichome birefringence-like 2 [Tarenaya hassleriana]
Length=556

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/25 (76%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  504  SDVDCSHWCLPGLPDTWNHLLYASV  430
            S  DCSHWCLPG+PDTWN LLY S+
Sbjct  522  SHQDCSHWCLPGVPDTWNELLYVSL  546



>ref|XP_007029023.1| Emb:CAB82953.1, putative [Theobroma cacao]
 gb|EOY09525.1| Emb:CAB82953.1, putative [Theobroma cacao]
Length=650

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PD+WN LLYA +
Sbjct  614  DCSHWCLPGVPDSWNELLYAEL  635



>ref|XP_006351351.1| PREDICTED: uncharacterized protein LOC102598735 isoform X1 [Solanum 
tuberosum]
Length=713

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PD WN LLYA +
Sbjct  679  DCSHWCLPGVPDAWNELLYAEL  700



>ref|XP_008363351.1| PREDICTED: protein trichome birefringence-like 1 [Malus domestica]
Length=563

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/22 (82%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLYA +
Sbjct  522  DCSHWCLPGVPDTWNELLYAQL  543



>ref|XP_009141436.1| PREDICTED: protein trichome birefringence-like 3 [Brassica rapa]
Length=485

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  507  SSDVDCSHWCLPGLPDTWNHLLYASVT  427
            +  +DCSHWCLPGLPDTWN LLYAS+T
Sbjct  458  AKGLDCSHWCLPGLPDTWNLLLYASLT  484



>gb|KJB76673.1| hypothetical protein B456_012G100000 [Gossypium raimondii]
Length=652

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PD+WN LLYA +
Sbjct  616  DCSHWCLPGVPDSWNELLYAEL  637



>ref|XP_010549391.1| PREDICTED: protein trichome birefringence-like 37 [Tarenaya hassleriana]
Length=387

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASVTM  424
             DCSHWCLPGLPDTWN LLY++++M
Sbjct  363  TDCSHWCLPGLPDTWNQLLYSALSM  387



>ref|XP_007147753.1| hypothetical protein PHAVU_006G152100g [Phaseolus vulgaris]
 gb|ESW19747.1| hypothetical protein PHAVU_006G152100g [Phaseolus vulgaris]
Length=544

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/20 (90%), Positives = 19/20 (95%), Gaps = 0/20 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYA  436
            DCSHWCLPG+PDTWN LLYA
Sbjct  513  DCSHWCLPGVPDTWNELLYA  532



>ref|XP_008352661.1| PREDICTED: protein trichome birefringence-like 1 [Malus domestica]
Length=563

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/22 (82%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLYA +
Sbjct  522  DCSHWCLPGVPDTWNELLYAQL  543



>gb|KEH20203.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=526

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/22 (82%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLY S+
Sbjct  495  DCSHWCLPGVPDTWNELLYVSL  516



>ref|XP_006852457.1| hypothetical protein AMTR_s00021p00115070 [Amborella trichopoda]
 gb|ERN13924.1| hypothetical protein AMTR_s00021p00115070 [Amborella trichopoda]
Length=435

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPGLPDTWN LLYAS+ +
Sbjct  405  DCSHWCLPGLPDTWNELLYASLLL  428



>ref|XP_006575299.1| PREDICTED: uncharacterized protein LOC102666330 [Glycine max]
Length=104

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLYA +
Sbjct  68   DCSHWCLPGVPDTWNELLYAQL  89



>ref|XP_004140241.1| PREDICTED: uncharacterized protein LOC101217736 [Cucumis sativus]
 ref|XP_004165199.1| PREDICTED: uncharacterized LOC101217736 [Cucumis sativus]
 gb|KGN47947.1| hypothetical protein Csa_6G419440 [Cucumis sativus]
Length=419

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -3

Query  513  RDSSDVDCSHWCLPGLPDTWNHLLYASVT  427
            ++    DCSHWCLPGLPDTWN LLYA++ 
Sbjct  387  KEEIIADCSHWCLPGLPDTWNRLLYATIV  415



>ref|XP_006585942.1| PREDICTED: protein YLS7-like [Glycine max]
Length=534

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/22 (82%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLY S+
Sbjct  501  DCSHWCLPGVPDTWNELLYVSL  522



>ref|XP_007204980.1| hypothetical protein PRUPE_ppa003027mg [Prunus persica]
 gb|EMJ06179.1| hypothetical protein PRUPE_ppa003027mg [Prunus persica]
Length=610

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/22 (82%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLYA +
Sbjct  569  DCSHWCLPGVPDTWNELLYAQL  590



>ref|XP_010099368.1| hypothetical protein L484_004794 [Morus notabilis]
 gb|EXB78093.1| hypothetical protein L484_004794 [Morus notabilis]
Length=370

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASVT  427
            + S  DCSHWCLPGLPDTWN LLYAS+ 
Sbjct  342  EHSGTDCSHWCLPGLPDTWNELLYASLV  369



>gb|KDP28262.1| hypothetical protein JCGZ_14033 [Jatropha curcas]
Length=563

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/25 (72%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  513  RDSSDVDCSHWCLPGLPDTWNHLLY  439
            R S+  DCSHWCLPG+PDTWN  LY
Sbjct  527  RGSNGQDCSHWCLPGVPDTWNEFLY  551



>ref|XP_009763711.1| PREDICTED: protein trichome birefringence-like 5 [Nicotiana sylvestris]
Length=520

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 24/32 (75%), Gaps = 1/32 (3%)
 Frame = -3

Query  519  GGRDSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            GGR     DCSHWCLPG+PD WN L+YA++ +
Sbjct  481  GGRKVKQ-DCSHWCLPGVPDAWNELIYATLVL  511



>gb|AFK42564.1| unknown [Lotus japonicus]
Length=90

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  516  GRDSSDVDCSHWCLPGLPDTWNHLLYASV  430
            GR +S  DCSHWCL G+PDTWN +LYA++
Sbjct  59   GRGTSFEDCSHWCLAGVPDTWNEILYAAL  87



>ref|XP_006351352.1| PREDICTED: uncharacterized protein LOC102598735 isoform X2 [Solanum 
tuberosum]
Length=656

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PD WN LLYA +
Sbjct  622  DCSHWCLPGVPDAWNELLYAEL  643



>gb|ADD54603.1| conserved hypothetical protein [Linum usitatissimum]
Length=74

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM*G  418
            DCSHWCLPG+PDTWN LLYAS    G
Sbjct  43   DCSHWCLPGVPDTWNELLYASFVKPG  68



>ref|XP_009354322.1| PREDICTED: protein trichome birefringence-like 1 [Pyrus x bretschneideri]
Length=331

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPGLPDTWN LLY S+ +
Sbjct  299  DCSHWCLPGLPDTWNRLLYVSLVL  322



>ref|XP_010087235.1| hypothetical protein L484_009744 [Morus notabilis]
 gb|EXB28585.1| hypothetical protein L484_009744 [Morus notabilis]
Length=529

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/24 (75%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  507  SSDVDCSHWCLPGLPDTWNHLLYA  436
            SS  DCSHWCLPG+PD+WN +LYA
Sbjct  490  SSIQDCSHWCLPGVPDSWNEILYA  513



>ref|XP_007201163.1| hypothetical protein PRUPE_ppa004056mg [Prunus persica]
 gb|EMJ02362.1| hypothetical protein PRUPE_ppa004056mg [Prunus persica]
Length=532

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 22/29 (76%), Gaps = 1/29 (3%)
 Frame = -3

Query  519  GGRDSSDV-DCSHWCLPGLPDTWNHLLYA  436
            G   SS + DCSHWCLPG+PD WN LLYA
Sbjct  501  GKHSSSGIQDCSHWCLPGIPDLWNELLYA  529



>dbj|BAE98654.1| hypothetical protein [Arabidopsis thaliana]
Length=329

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPG+PD WNHL+YAS+ +
Sbjct  302  DCSHWCLPGVPDVWNHLIYASLLL  325



>tpg|DAA64249.1| TPA: putative DUF231 domain containing family protein [Zea mays]
Length=111

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -3

Query  498  VDCSHWCLPGLPDTWNHLLYASV  430
             DC HWCLPGLPDTWNH LYA +
Sbjct  79   ADCIHWCLPGLPDTWNHFLYAHI  101



>gb|AFK37265.1| unknown [Lotus japonicus]
Length=120

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLYA +
Sbjct  68   DCSHWCLPGVPDTWNELLYAQL  89



>ref|XP_008229347.1| PREDICTED: protein trichome birefringence-like [Prunus mume]
Length=763

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/22 (82%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLYA +
Sbjct  719  DCSHWCLPGVPDTWNELLYAQL  740



>ref|XP_010917266.1| PREDICTED: protein trichome birefringence [Elaeis guineensis]
Length=678

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PD+WN LLYA +
Sbjct  648  DCSHWCLPGVPDSWNELLYAQL  669



>ref|XP_004493599.1| PREDICTED: uncharacterized protein LOC101511851 [Cicer arietinum]
Length=617

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN +LYA +
Sbjct  582  DCSHWCLPGVPDTWNEILYAEL  603



>ref|XP_006362212.1| PREDICTED: uncharacterized protein LOC102599885 [Solanum tuberosum]
Length=691

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PD WN LLYA +
Sbjct  656  DCSHWCLPGVPDAWNELLYAKI  677



>ref|XP_003560398.1| PREDICTED: protein trichome birefringence-like 5 [Brachypodium 
distachyon]
Length=456

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = -3

Query  513  RDSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            R     DCSHWCLPG+PD WN L+YAS  M
Sbjct  417  RRKKKQDCSHWCLPGVPDVWNELIYASFVM  446



>ref|XP_004249181.1| PREDICTED: protein trichome birefringence [Solanum lycopersicum]
Length=691

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PD WN LLYA +
Sbjct  656  DCSHWCLPGVPDAWNELLYAKI  677



>ref|XP_009610815.1| PREDICTED: protein trichome birefringence-like 5 [Nicotiana tomentosiformis]
Length=528

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 24/32 (75%), Gaps = 1/32 (3%)
 Frame = -3

Query  519  GGRDSSDVDCSHWCLPGLPDTWNHLLYASVTM  424
            GGR     DCSHWCLPG+PD WN L+YA++ +
Sbjct  489  GGRKVKQ-DCSHWCLPGVPDAWNELIYATLVL  519



>ref|XP_004488993.1| PREDICTED: uncharacterized protein LOC101512583 [Cicer arietinum]
Length=342

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -3

Query  516  GRDSSDVDCSHWCLPGLPDTWNHLLYASV  430
            GR +S VDCSHWCL G+PDTWN +LYA++
Sbjct  311  GRGNSYVDCSHWCLAGVPDTWNQMLYATL  339



>ref|XP_003625280.1| hypothetical protein MTR_7g093450 [Medicago truncatula]
 gb|AES81498.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=601

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPG+PD WN +LYA + M
Sbjct  566  DCSHWCLPGVPDAWNEILYAELLM  589



>ref|XP_007200128.1| hypothetical protein PRUPE_ppa017879mg [Prunus persica]
 gb|EMJ01327.1| hypothetical protein PRUPE_ppa017879mg [Prunus persica]
Length=764

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/27 (67%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -3

Query  519  GGRDSSDVDCSHWCLPGLPDTWNHLLY  439
            G + S   DCSHWCLPG+PD WN LLY
Sbjct  734  GNQRSGIQDCSHWCLPGIPDVWNELLY  760



>ref|XP_010665993.1| PREDICTED: protein trichome birefringence-like 42 [Beta vulgaris 
subsp. vulgaris]
Length=455

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  504  SDVDCSHWCLPGLPDTWNHLLYASVTM  424
            S VDCS+WCLPGLPDTWN LLYAS+ +
Sbjct  429  SFVDCSNWCLPGLPDTWNRLLYASLYL  455



>ref|XP_006841061.1| hypothetical protein AMTR_s00085p00172090 [Amborella trichopoda]
 gb|ERN02736.1| hypothetical protein AMTR_s00085p00172090 [Amborella trichopoda]
Length=495

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM*G  418
            DCSHWCLPG+PDTWN LLYAS+ + G
Sbjct  469  DCSHWCLPGVPDTWNELLYASLLIKG  494



>ref|XP_004243820.1| PREDICTED: protein trichome birefringence-like 42 isoform X1 
[Solanum lycopersicum]
Length=440

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPG+PDTWN LLYAS+ +
Sbjct  392  DCSHWCLPGMPDTWNRLLYASLLL  415



>ref|XP_009783309.1| PREDICTED: protein trichome birefringence-like [Nicotiana sylvestris]
Length=658

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PD WN LLYA +
Sbjct  624  DCSHWCLPGVPDAWNELLYAEL  645



>ref|XP_008783904.1| PREDICTED: protein trichome birefringence-like 38 [Phoenix dactylifera]
Length=373

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -3

Query  513  RDSSDVDCSHWCLPGLPDTWNHLLYASV  430
            RD+S +DCSHWC+ GLPDTWN LLYA++
Sbjct  345  RDNSGMDCSHWCVAGLPDTWNQLLYAAL  372



>ref|XP_010093461.1| hypothetical protein L484_017522 [Morus notabilis]
 gb|EXB54085.1| hypothetical protein L484_017522 [Morus notabilis]
Length=381

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -3

Query  513  RDSSDVDCSHWCLPGLPDTWNHLLYA  436
            +D + VDCSHWCLPG+PDTWN +LYA
Sbjct  347  KDRAFVDCSHWCLPGVPDTWNEILYA  372



>ref|XP_010323758.1| PREDICTED: protein trichome birefringence-like 42 isoform X2 
[Solanum lycopersicum]
Length=436

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPG+PDTWN LLYAS+ +
Sbjct  388  DCSHWCLPGMPDTWNRLLYASLLL  411



>ref|XP_008799800.1| PREDICTED: protein trichome birefringence-like 34 isoform X1 
[Phoenix dactylifera]
Length=547

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DC+HWCLPG+PDTWN LLYA +
Sbjct  523  DCTHWCLPGVPDTWNELLYAYI  544



>ref|XP_002448144.1| hypothetical protein SORBIDRAFT_06g022030 [Sorghum bicolor]
 gb|EES12472.1| hypothetical protein SORBIDRAFT_06g022030 [Sorghum bicolor]
Length=720

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLYAS+
Sbjct  689  DCSHWCLPGVPDTWNQLLYASL  710



>ref|XP_010493164.1| PREDICTED: protein trichome birefringence-like 5 [Camelina sativa]
Length=485

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPG+PD WNHL+YAS+ +
Sbjct  458  DCSHWCLPGVPDVWNHLIYASLLL  481



>gb|KJB16333.1| hypothetical protein B456_002G223800 [Gossypium raimondii]
Length=620

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PD+WN LLYA +
Sbjct  584  DCSHWCLPGVPDSWNELLYAEL  605



>gb|KDP24643.1| hypothetical protein JCGZ_25559 [Jatropha curcas]
Length=638

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN +LYA +
Sbjct  602  DCSHWCLPGVPDTWNEILYAEL  623



>gb|KFK26286.1| hypothetical protein AALP_AA8G228100 [Arabis alpina]
Length=490

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPG+PD WNHL+YAS+ +
Sbjct  463  DCSHWCLPGVPDVWNHLIYASLLL  486



>ref|XP_007162340.1| hypothetical protein PHAVU_001G143600g [Phaseolus vulgaris]
 gb|ESW34334.1| hypothetical protein PHAVU_001G143600g [Phaseolus vulgaris]
Length=633

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPG+PD WN +LYA + M
Sbjct  598  DCSHWCLPGVPDIWNEILYAELLM  621



>ref|XP_006348848.1| PREDICTED: uncharacterized protein LOC102594004 [Solanum tuberosum]
Length=429

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPG+PDTWN LLYAS+ +
Sbjct  392  DCSHWCLPGMPDTWNRLLYASLLL  415



>ref|XP_002871948.1| hypothetical protein ARALYDRAFT_488963 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48207.1| hypothetical protein ARALYDRAFT_488963 [Arabidopsis lyrata subsp. 
lyrata]
Length=481

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPG+PD WNHL+YAS+ +
Sbjct  454  DCSHWCLPGVPDVWNHLIYASLLL  477



>ref|XP_007011182.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007011183.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY19992.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY19993.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=602

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN L+YA +
Sbjct  560  DCSHWCLPGVPDTWNELVYAQL  581



>ref|XP_010454365.1| PREDICTED: protein trichome birefringence-like 5 [Camelina sativa]
Length=500

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPG+PD WNHL+YAS+ +
Sbjct  473  DCSHWCLPGVPDVWNHLIYASLLL  496



>ref|XP_008444354.1| PREDICTED: protein trichome birefringence-like 2 [Cucumis melo]
Length=551

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLYASV
Sbjct  520  DCSHWCLPGVPDTWNELLYASV  541



>ref|XP_008361466.1| PREDICTED: protein trichome birefringence-like 1 [Malus domestica]
Length=621

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN L+YA +
Sbjct  580  DCSHWCLPGVPDTWNELIYAQL  601



>ref|XP_010265940.1| PREDICTED: protein trichome birefringence-like [Nelumbo nucifera]
Length=617

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PD+WN LLYA +
Sbjct  577  DCSHWCLPGVPDSWNELLYAEL  598



>gb|AAM64322.1| unknown [Arabidopsis thaliana]
Length=485

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPG+PD WNHL+YAS+ +
Sbjct  458  DCSHWCLPGVPDVWNHLIYASLLL  481



>ref|XP_009380702.1| PREDICTED: protein trichome birefringence-like 28 [Musa acuminata 
subsp. malaccensis]
Length=486

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVT  427
            DC HWCLPGLPDTWN LLYA +T
Sbjct  461  DCIHWCLPGLPDTWNELLYARIT  483



>ref|XP_010671195.1| PREDICTED: protein trichome birefringence-like 4 [Beta vulgaris 
subsp. vulgaris]
Length=474

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPG+PD+WN LLYAS+ M
Sbjct  442  DCSHWCLPGVPDSWNQLLYASLLM  465



>ref|XP_009757308.1| PREDICTED: protein trichome birefringence-like [Nicotiana sylvestris]
Length=684

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PD WN LLYA +
Sbjct  649  DCSHWCLPGVPDAWNELLYAKL  670



>ref|XP_004296154.1| PREDICTED: protein trichome birefringence-like 4 [Fragaria vesca 
subsp. vesca]
Length=520

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/20 (90%), Positives = 19/20 (95%), Gaps = 0/20 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYA  436
            DCSHWCLPG+PDTWN LLYA
Sbjct  492  DCSHWCLPGVPDTWNELLYA  511



>gb|EMT18980.1| hypothetical protein F775_19154 [Aegilops tauschii]
Length=123

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DC HWCLPGLPDTWNH LYA +
Sbjct  78   DCIHWCLPGLPDTWNHFLYAHI  99



>ref|XP_007050058.1| Trichome birefringence-like 39 [Theobroma cacao]
 gb|EOX94215.1| Trichome birefringence-like 39 [Theobroma cacao]
Length=360

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = -3

Query  504  SDVDCSHWCLPGLPDTWNHLLYASV  430
            S  DCSHWCLPGLPDTWN LLYA++
Sbjct  334  SGTDCSHWCLPGLPDTWNQLLYAAL  358



>ref|XP_009611858.1| PREDICTED: protein trichome birefringence-like [Nicotiana tomentosiformis]
Length=648

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PD WN LLYA +
Sbjct  613  DCSHWCLPGVPDAWNELLYAKL  634



>gb|KDP31784.1| hypothetical protein JCGZ_12245 [Jatropha curcas]
Length=413

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPGLPDTWN LLYA++ +
Sbjct  379  DCSHWCLPGLPDTWNILLYATIVL  402



>ref|XP_006379631.1| hypothetical protein POPTR_0008s070201g, partial [Populus trichocarpa]
 gb|ERP57428.1| hypothetical protein POPTR_0008s070201g, partial [Populus trichocarpa]
Length=111

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVT  427
            DC HWC+PGLPDTWN LLYA +T
Sbjct  86   DCVHWCVPGLPDTWNELLYAYIT  108



>ref|XP_008663376.1| PREDICTED: protein trichome birefringence-like 16 [Zea mays]
Length=715

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLYAS+
Sbjct  684  DCSHWCLPGVPDTWNELLYASL  705



>ref|XP_002265658.2| PREDICTED: protein trichome birefringence-like 2 [Vitis vinifera]
Length=623

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLYAS+
Sbjct  592  DCSHWCLPGVPDTWNELLYASL  613



>ref|XP_004143065.1| PREDICTED: uncharacterized protein LOC101210768 [Cucumis sativus]
 ref|XP_004159591.1| PREDICTED: uncharacterized LOC101210768 [Cucumis sativus]
 gb|KGN62305.1| hypothetical protein Csa_2G348910 [Cucumis sativus]
Length=553

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLYASV
Sbjct  522  DCSHWCLPGVPDTWNELLYASV  543



>gb|KEH38564.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=348

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  516  GRDSSDVDCSHWCLPGLPDTWNHLLYASV  430
            GR  S VDCSHWCL G+PDTWN +LYA++
Sbjct  317  GRGESYVDCSHWCLAGVPDTWNEMLYAAL  345



>ref|NP_197559.1| protein trichome birefringence-like 5 [Arabidopsis thaliana]
 sp|F4K5K4.1|TBL5_ARATH RecName: Full=Protein trichome birefringence-like 5 [Arabidopsis 
thaliana]
 gb|AED92864.1| protein trichome birefringence-like 5 [Arabidopsis thaliana]
Length=485

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPG+PD WNHL+YAS+ +
Sbjct  458  DCSHWCLPGVPDVWNHLIYASLLL  481



>gb|EYU43352.1| hypothetical protein MIMGU_mgv1a017695mg [Erythranthe guttata]
Length=357

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -3

Query  513  RDSSDVDCSHWCLPGLPDTWNHLLYASVT  427
            +D    DC+HWCLPGLPDTWN LLYA++ 
Sbjct  329  KDHVSTDCTHWCLPGLPDTWNELLYAALV  357



>ref|XP_004243016.1| PREDICTED: protein trichome birefringence-like 5 [Solanum lycopersicum]
Length=532

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPG+PD WN L+YA++ +
Sbjct  507  DCSHWCLPGVPDAWNELIYATLVL  530



>ref|XP_010070349.1| PREDICTED: protein trichome birefringence-like 40 [Eucalyptus 
grandis]
Length=365

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -3

Query  519  GGRDSSDVDCSHWCLPGLPDTWNHLLYA  436
            G R    VDC+HWCLPGLPDTWN L YA
Sbjct  334  GTRRGKGVDCTHWCLPGLPDTWNELFYA  361



>gb|KCW89619.1| hypothetical protein EUGRSUZ_A01902 [Eucalyptus grandis]
Length=365

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -3

Query  519  GGRDSSDVDCSHWCLPGLPDTWNHLLYA  436
            G R    VDC+HWCLPGLPDTWN L YA
Sbjct  334  GTRRGKGVDCTHWCLPGLPDTWNELFYA  361



>ref|XP_007207689.1| hypothetical protein PRUPE_ppa023743mg, partial [Prunus persica]
 gb|EMJ08888.1| hypothetical protein PRUPE_ppa023743mg, partial [Prunus persica]
Length=541

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN L+YA +
Sbjct  500  DCSHWCLPGVPDTWNELIYAQL  521



>ref|XP_004249290.1| PREDICTED: protein trichome birefringence-like [Solanum lycopersicum]
Length=578

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PD WN LLYA +
Sbjct  544  DCSHWCLPGVPDAWNELLYAEL  565



>ref|XP_008342804.1| PREDICTED: protein trichome birefringence-like 42 [Malus domestica]
 ref|XP_008368633.1| PREDICTED: protein trichome birefringence-like 42 [Malus domestica]
Length=422

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPGLPDTWN LLY S+ +
Sbjct  390  DCSHWCLPGLPDTWNRLLYVSLVL  413



>ref|XP_003607565.1| hypothetical protein MTR_4g079700 [Medicago truncatula]
 gb|AES89762.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=365

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVT  427
            DCSHWCLPGLPDTWN LLYA+++
Sbjct  342  DCSHWCLPGLPDTWNQLLYAALS  364



>ref|XP_008389689.1| PREDICTED: protein trichome birefringence-like 2 [Malus domestica]
Length=595

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PD WN LLYA++
Sbjct  564  DCSHWCLPGVPDAWNELLYAAL  585



>ref|XP_007211478.1| hypothetical protein PRUPE_ppa007592mg [Prunus persica]
 gb|EMJ12677.1| hypothetical protein PRUPE_ppa007592mg [Prunus persica]
Length=362

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = -3

Query  519  GGRDSSDVDCSHWCLPGLPDTWNHLLYASV  430
             G+    VDCSHWCLPG PDTWN LLYA++
Sbjct  332  AGQGPKFVDCSHWCLPGAPDTWNELLYAAL  361



>emb|CDP15911.1| unnamed protein product [Coffea canephora]
Length=368

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  510  DSSDVDCSHWCLPGLPDTWNHLLYASV  430
            ++  +DCSHWCLPGLPDTWN LLYA++
Sbjct  340  ENKGLDCSHWCLPGLPDTWNELLYAAL  366



>ref|XP_002280022.1| PREDICTED: protein trichome birefringence [Vitis vinifera]
Length=659

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PD WN LLYA +
Sbjct  616  DCSHWCLPGVPDAWNELLYAEI  637



>ref|XP_009604045.1| PREDICTED: protein trichome birefringence-like [Nicotiana tomentosiformis]
Length=647

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PD WN LLYA +
Sbjct  613  DCSHWCLPGVPDAWNELLYAEL  634



>ref|XP_004502134.1| PREDICTED: uncharacterized protein LOC101510392 [Cicer arietinum]
Length=449

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPG+PD+WN LLYA++ M
Sbjct  416  DCSHWCLPGIPDSWNQLLYATLLM  439



>ref|XP_010257492.1| PREDICTED: protein trichome birefringence [Nelumbo nucifera]
Length=597

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 17/22 (77%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PD+WN LLYA +
Sbjct  565  DCSHWCLPGVPDSWNELLYAEL  586



>ref|XP_009391441.1| PREDICTED: protein trichome birefringence-like [Musa acuminata 
subsp. malaccensis]
Length=715

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPG+PD+WN LLYA + +
Sbjct  686  DCSHWCLPGVPDSWNELLYAQLII  709



>ref|XP_010100425.1| hypothetical protein L484_027736 [Morus notabilis]
 gb|EXB82559.1| hypothetical protein L484_027736 [Morus notabilis]
Length=500

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLYAS+
Sbjct  472  DCSHWCLPGVPDTWNELLYASL  493



>ref|XP_010538205.1| PREDICTED: protein trichome birefringence-like 38 [Tarenaya hassleriana]
Length=250

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVT  427
            DCSHWCLPGLPDTWN LLYA+++
Sbjct  227  DCSHWCLPGLPDTWNQLLYAALS  249



>ref|XP_002882764.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59023.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=559

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 16/22 (73%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PD+WN +LYA +
Sbjct  517  DCSHWCLPGVPDSWNEILYAEI  538



>ref|XP_002282459.1| PREDICTED: protein trichome birefringence-like 43 [Vitis vinifera]
Length=361

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPG+PDTWN LLYAS+ +
Sbjct  336  DCSHWCLPGVPDTWNQLLYASLIL  359



>ref|XP_010227191.1| PREDICTED: protein trichome birefringence-like 2 [Brachypodium 
distachyon]
Length=733

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLYAS+
Sbjct  702  DCSHWCLPGVPDTWNELLYASL  723



>ref|XP_002276383.1| PREDICTED: protein trichome birefringence-like 42 [Vitis vinifera]
 emb|CBI21962.3| unnamed protein product [Vitis vinifera]
Length=414

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASVTM  424
            DCSHWCLPGLPDTWN LLYAS+  
Sbjct  382  DCSHWCLPGLPDTWNGLLYASLVF  405



>gb|KCW59798.1| hypothetical protein EUGRSUZ_H02546 [Eucalyptus grandis]
Length=268

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -3

Query  495  DCSHWCLPGLPDTWNHLLYASV  430
            DCSHWCLPG+PDTWN LLYAS+
Sbjct  238  DCSHWCLPGVPDTWNELLYASL  259



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566636427000