BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF011B23

Length=714
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAO25536.1|  cellulose synthase                                      207   3e-68   Populus tremuloides
gb|AFZ78556.1|  cellulose synthase                                      206   5e-68   Populus tomentosa [Chinese white poplar]
ref|XP_002515536.1|  Cellulose synthase A catalytic subunit 6 [UD...    207   5e-68   Ricinus communis
ref|XP_002308657.1|  cellulose synthase family protein                  206   6e-68   
ref|XP_011459196.1|  PREDICTED: cellulose synthase A catalytic su...    205   1e-67   Fragaria vesca subsp. vesca
ref|XP_004291468.1|  PREDICTED: cellulose synthase A catalytic su...    205   1e-67   Fragaria vesca subsp. vesca
gb|AGV22109.1|  cellulose synthase 7                                    205   1e-67   Betula luminifera [liang ye hua]
ref|XP_008394069.1|  PREDICTED: cellulose synthase A catalytic su...    204   3e-67   
ref|XP_011039709.1|  PREDICTED: cellulose synthase A catalytic su...    203   3e-67   Populus euphratica
ref|XP_008219478.1|  PREDICTED: cellulose synthase A catalytic su...    203   5e-67   Prunus mume [ume]
ref|XP_011081578.1|  PREDICTED: cellulose synthase A catalytic su...    204   6e-67   Sesamum indicum [beniseed]
gb|AGC97433.2|  cellulose synthase                                      206   6e-67   Boehmeria nivea [Chinese silk-plant]
ref|XP_010254360.1|  PREDICTED: probable cellulose synthase A cat...    206   7e-67   Nelumbo nucifera [Indian lotus]
ref|XP_007221583.1|  hypothetical protein PRUPE_ppa000611mg             202   8e-67   Prunus persica
ref|XP_009355721.1|  PREDICTED: cellulose synthase A catalytic su...    201   1e-66   Pyrus x bretschneideri [bai li]
ref|XP_008366693.1|  PREDICTED: cellulose synthase A catalytic su...    202   1e-66   Malus domestica [apple tree]
ref|XP_011071168.1|  PREDICTED: cellulose synthase A catalytic su...    204   1e-66   Sesamum indicum [beniseed]
ref|XP_006450469.1|  hypothetical protein CICLE_v10007296mg             202   2e-66   Citrus clementina [clementine]
ref|XP_009597841.1|  PREDICTED: cellulose synthase A catalytic su...    205   2e-66   Nicotiana tomentosiformis
ref|XP_006483337.1|  PREDICTED: cellulose synthase A catalytic su...    202   2e-66   
gb|KDO61693.1|  hypothetical protein CISIN_1g001399mg                   202   2e-66   Citrus sinensis [apfelsine]
ref|XP_010250039.1|  PREDICTED: probable cellulose synthase A cat...    204   3e-66   Nelumbo nucifera [Indian lotus]
gb|EYU32338.1|  hypothetical protein MIMGU_mgv1a000544mg                201   3e-66   Erythranthe guttata [common monkey flower]
gb|AAY78952.3|  cellulose synthase CesA1                                203   4e-66   Boehmeria nivea [Chinese silk-plant]
emb|CDP13491.1|  unnamed protein product                                201   4e-66   Coffea canephora [robusta coffee]
ref|XP_010914890.1|  PREDICTED: probable cellulose synthase A cat...    203   4e-66   Elaeis guineensis
gb|KGN60109.1|  hypothetical protein Csa_3G878780                       199   7e-66   Cucumis sativus [cucumbers]
ref|XP_004136343.1|  PREDICTED: cellulose synthase A catalytic su...    198   1e-65   Cucumis sativus [cucumbers]
ref|XP_011026459.1|  PREDICTED: cellulose synthase A catalytic su...    198   1e-65   Populus euphratica
ref|XP_009768318.1|  PREDICTED: cellulose synthase A catalytic su...    197   2e-65   Nicotiana sylvestris
gb|EPS68064.1|  hypothetical protein M569_06709                         201   2e-65   Genlisea aurea
ref|XP_009623502.1|  PREDICTED: cellulose synthase A catalytic su...    197   2e-65   Nicotiana tomentosiformis
gb|AFZ78558.1|  cellulose synthase                                      197   2e-65   Populus tomentosa [Chinese white poplar]
ref|XP_003522623.1|  PREDICTED: cellulose synthase A catalytic su...    197   2e-65   Glycine max [soybeans]
gb|KHN08123.1|  Cellulose synthase A catalytic subunit 1 [UDP-for...    197   2e-65   Glycine soja [wild soybean]
gb|KHN07088.1|  Cellulose synthase A catalytic subunit 1 [UDP-for...    197   3e-65   Glycine soja [wild soybean]
ref|XP_003526416.1|  PREDICTED: cellulose synthase A catalytic su...    197   3e-65   Glycine max [soybeans]
ref|XP_008466397.1|  PREDICTED: cellulose synthase A catalytic su...    198   3e-65   Cucumis melo [Oriental melon]
ref|XP_002324291.1|  TGACG-motif binding family protein                 197   3e-65   Populus trichocarpa [western balsam poplar]
gb|KDP33612.1|  hypothetical protein JCGZ_07183                         200   3e-65   Jatropha curcas
ref|XP_008792060.1|  PREDICTED: probable cellulose synthase A cat...    197   5e-65   Phoenix dactylifera
ref|XP_010925238.1|  PREDICTED: probable cellulose synthase A cat...    199   6e-65   Elaeis guineensis
ref|XP_008784981.1|  PREDICTED: probable cellulose synthase A cat...    197   7e-65   Phoenix dactylifera
ref|XP_010048223.1|  PREDICTED: cellulose synthase A catalytic su...    196   8e-65   Eucalyptus grandis [rose gum]
ref|XP_007013842.1|  Cellulose synthase 1                               198   9e-65   Theobroma cacao [chocolate]
ref|XP_007137035.1|  hypothetical protein PHAVU_009G094200g             196   1e-64   Phaseolus vulgaris [French bean]
ref|XP_004501313.1|  PREDICTED: cellulose synthase A catalytic su...    195   1e-64   Cicer arietinum [garbanzo]
ref|NP_001105574.1|  cellulose synthase2                                195   1e-64   Zea mays [maize]
ref|XP_002440694.1|  hypothetical protein SORBIDRAFT_09g005280          195   1e-64   Sorghum bicolor [broomcorn]
gb|AFW81389.1|  cellulose synthase1                                     195   1e-64   
gb|AFW81388.1|  cellulose synthase1                                     195   1e-64   
ref|NP_001104954.1|  cellulose synthase-1                               195   2e-64   Zea mays [maize]
gb|AAR29967.1|  putative cellulose synthase catalytic subunit           196   2e-64   Hordeum vulgare [barley]
ref|XP_010110357.1|  Protein radially swollen 1                         196   2e-64   Morus notabilis
gb|EMT03676.1|  Putative cellulose synthase A catalytic subunit 1...    195   2e-64   
gb|ACQ99194.1|  cellulose synthase                                      195   2e-64   Phyllostachys edulis [kikko-chiku]
gb|KJB53892.1|  hypothetical protein B456_009G010200                    195   3e-64   Gossypium raimondii
gb|KJB53893.1|  hypothetical protein B456_009G010200                    195   3e-64   Gossypium raimondii
gb|AFB18635.1|  CESA6                                                   195   3e-64   Gossypium hirsutum [American cotton]
gb|AAY43217.1|  cellulose synthase BoCesA1                              194   3e-64   Bambusa oldhamii
ref|XP_006654097.1|  PREDICTED: probable cellulose synthase A cat...    193   3e-64   Oryza brachyantha
gb|ACS88359.1|  cellulose synthase catalytic subunit                    194   3e-64   Gossypium hirsutum [American cotton]
gb|EMT20923.1|  Putative cellulose synthase A catalytic subunit 1...    195   4e-64   
ref|XP_003568832.2|  PREDICTED: probable cellulose synthase A cat...    194   4e-64   Brachypodium distachyon [annual false brome]
gb|AAY43216.1|  cellulose synthase BoCesA8                              193   4e-64   Bambusa oldhamii
ref|XP_004965873.1|  PREDICTED: probable cellulose synthase A cat...    194   4e-64   Setaria italica
ref|XP_004960821.1|  PREDICTED: probable cellulose synthase A cat...    194   4e-64   Setaria italica
ref|NP_001054788.1|  Os05g0176100                                       193   4e-64   
ref|XP_004960820.1|  PREDICTED: probable cellulose synthase A cat...    193   4e-64   
ref|XP_008392524.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    194   5e-64   
ref|XP_009785781.1|  PREDICTED: cellulose synthase A catalytic su...    195   6e-64   Nicotiana sylvestris
ref|XP_004245031.1|  PREDICTED: cellulose synthase A catalytic su...    195   8e-64   Solanum lycopersicum
gb|KHG11461.1|  Cellulose synthase A catalytic subunit 1 [UDP-for...    195   1e-63   Gossypium arboreum [tree cotton]
gb|KHG16324.1|  putative cellulose synthase A catalytic subunit 1...    195   1e-63   Gossypium arboreum [tree cotton]
gb|AGT16647.1|  cellulose synthase                                      194   1e-63   Saccharum hybrid cultivar R570
ref|XP_009399755.1|  PREDICTED: probable cellulose synthase A cat...    196   1e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003603419.1|  Cellulose synthase                                 193   1e-63   Medicago truncatula
ref|XP_009389939.1|  PREDICTED: probable cellulose synthase A cat...    196   1e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006361724.1|  PREDICTED: cellulose synthase A catalytic su...    194   2e-63   Solanum tuberosum [potatoes]
ref|XP_006842872.1|  hypothetical protein AMTR_s00081p00171100          192   2e-63   Amborella trichopoda
dbj|BAJ88271.1|  predicted protein                                      192   2e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG24504.1|  putative cellulose synthase A catalytic subunit 1...    193   2e-63   Gossypium arboreum [tree cotton]
ref|XP_010648652.1|  PREDICTED: cellulose synthase A catalytic su...    192   3e-63   Vitis vinifera
ref|XP_010525969.1|  PREDICTED: cellulose synthase A catalytic su...    190   3e-63   Tarenaya hassleriana [spider flower]
emb|CAN60659.1|  hypothetical protein VITISV_018069                     192   3e-63   Vitis vinifera
ref|XP_008673642.1|  PREDICTED: probable cellulose synthase A cat...    193   4e-63   
tpg|DAA53225.1|  TPA: cellulose synthase3                               193   4e-63   
ref|XP_010689561.1|  PREDICTED: cellulose synthase A catalytic su...    191   4e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010670651.1|  PREDICTED: cellulose synthase A catalytic su...    191   5e-63   Beta vulgaris subsp. vulgaris [field beet]
gb|AEK31219.1|  cellulose synthase A                                    191   8e-63   Eucalyptus camaldulensis
gb|KCW81421.1|  hypothetical protein EUGRSUZ_C02801                     189   3e-62   Eucalyptus grandis [rose gum]
gb|AAP97497.1|  cellulose synthase                                      193   3e-62   Solanum tuberosum [potatoes]
dbj|BAJ98234.1|  predicted protein                                      186   6e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ85785.1|  predicted protein                                      186   8e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AHL45023.1|  cellulose synthase 1A                                   186   2e-61   Linum usitatissimum
gb|AHL45024.1|  cellulose synthase 1B                                   186   2e-61   Linum usitatissimum
gb|ACF80398.1|  unknown                                                 183   2e-61   Zea mays [maize]
gb|KCW79813.1|  hypothetical protein EUGRSUZ_C01147                     184   1e-60   Eucalyptus grandis [rose gum]
gb|ACT16001.1|  cellulose synthase                                      186   2e-60   Phyllostachys edulis [kikko-chiku]
ref|XP_002455101.1|  hypothetical protein SORBIDRAFT_03g004320          182   2e-60   
ref|XP_010050525.1|  PREDICTED: probable cellulose synthase A cat...    182   3e-60   Eucalyptus grandis [rose gum]
gb|AAT66940.1|  CesA1                                                   180   4e-60   Acacia mangium
gb|KDP43475.1|  hypothetical protein JCGZ_16762                         182   4e-60   Jatropha curcas
gb|AAF89963.1|AF200527_1  cellulose synthase-3                          183   4e-60   Zea mays [maize]
gb|AAY43219.2|  cellulose synthase BoCesA3                              184   5e-60   Bambusa oldhamii
gb|AAY43218.1|  cellulose synthase BoCesA2                              184   5e-60   Bambusa oldhamii
gb|ACZ82297.1|  cellulose synthase                                      184   5e-60   Phyllostachys edulis [kikko-chiku]
ref|XP_007220288.1|  hypothetical protein PRUPE_ppa000593mg             182   5e-60   
ref|XP_003533898.2|  PREDICTED: cellulose synthase A catalytic su...    181   6e-60   Glycine max [soybeans]
gb|KHG03009.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    181   6e-60   Gossypium arboreum [tree cotton]
ref|XP_008231249.1|  PREDICTED: cellulose synthase A catalytic su...    181   6e-60   Prunus mume [ume]
ref|XP_010526207.1|  PREDICTED: cellulose synthase A catalytic su...    180   6e-60   Tarenaya hassleriana [spider flower]
ref|XP_006289427.1|  hypothetical protein CARUB_v10002932mg             181   7e-60   Capsella rubella
ref|XP_004968377.1|  PREDICTED: probable cellulose synthase A cat...    183   7e-60   Setaria italica
ref|NP_196136.1|  cellulose synthase A catalytic subunit 3 [UDP-f...    181   7e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873198.1|  hypothetical protein ARALYDRAFT_487306             181   7e-60   
gb|AAC39336.1|  cellulose synthase catalytic subunit                    181   7e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010491044.1|  PREDICTED: cellulose synthase A catalytic su...    181   7e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010452418.1|  PREDICTED: cellulose synthase A catalytic su...    181   7e-60   Camelina sativa [gold-of-pleasure]
gb|KJB25016.1|  hypothetical protein B456_004G172400                    181   8e-60   Gossypium raimondii
gb|AGC65584.1|  GFP-CESA3ixr1-2                                         183   9e-60   Binary plant gene expression vector pKM24-MD1
gb|KJB25017.1|  hypothetical protein B456_004G172400                    181   9e-60   Gossypium raimondii
gb|ACF83181.1|  unknown                                                 181   1e-59   Zea mays [maize]
gb|AFG25776.1|  cellulose synthase 2                                    184   1e-59   Bambusa emeiensis
ref|XP_006398979.1|  hypothetical protein EUTSA_v10012528mg             181   1e-59   Eutrema salsugineum [saltwater cress]
emb|CDP07782.1|  unnamed protein product                                181   1e-59   Coffea canephora [robusta coffee]
dbj|BAJ33658.1|  unnamed protein product                                181   1e-59   Eutrema halophilum
ref|XP_007148880.1|  hypothetical protein PHAVU_005G022100g             182   1e-59   Phaseolus vulgaris [French bean]
ref|XP_009407595.1|  PREDICTED: probable cellulose synthase A cat...    180   1e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407580.1|  PREDICTED: probable cellulose synthase A cat...    180   1e-59   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACU87559.2|  cellulose synthase                                      180   1e-59   Leucaena leucocephala [cassie]
ref|XP_004499886.1|  PREDICTED: cellulose synthase A catalytic su...    182   2e-59   Cicer arietinum [garbanzo]
gb|AIA10372.1|  cellulose synthase                                      181   2e-59   Boehmeria nivea [Chinese silk-plant]
gb|AAY43225.1|  cellulose synthase BoCesA3                              183   2e-59   Bambusa oldhamii
ref|XP_006439113.1|  hypothetical protein CICLE_v10030723mg             181   2e-59   
ref|XP_006482874.1|  PREDICTED: cellulose synthase A catalytic su...    181   2e-59   Citrus sinensis [apfelsine]
gb|KDO83405.1|  hypothetical protein CISIN_1g001413mg                   181   3e-59   Citrus sinensis [apfelsine]
gb|ACZ82296.1|  cellulose synthase                                      193   3e-59   Phyllostachys edulis [kikko-chiku]
gb|EAZ03185.1|  hypothetical protein OsI_25338                          179   3e-59   Oryza sativa Indica Group [Indian rice]
ref|NP_001105621.1|  cellulose synthase-4                               179   3e-59   
tpg|DAA59989.1|  TPA: putative cellulose synthase family protein        179   3e-59   
gb|AGC65585.1|  CESA3ixr1-2                                             181   3e-59   Binary plant gene expression vector pKM24-MD1
ref|XP_011048033.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    180   4e-59   Populus euphratica
ref|XP_009364979.1|  PREDICTED: cellulose synthase A catalytic su...    181   6e-59   Pyrus x bretschneideri [bai li]
ref|XP_007052526.1|  Cellulose synthase family protein isoform 2        178   7e-59   
ref|XP_008784835.1|  PREDICTED: probable cellulose synthase A cat...    181   7e-59   Phoenix dactylifera
ref|XP_009354747.1|  PREDICTED: cellulose synthase A catalytic su...    180   8e-59   Pyrus x bretschneideri [bai li]
gb|ACC59195.1|  cellulose synthase                                      179   8e-59   Betula platyphylla [Asian white birch]
ref|XP_008375180.1|  PREDICTED: cellulose synthase A catalytic su...    180   1e-58   Malus domestica [apple tree]
gb|AAT66941.1|  CesA2                                                   177   1e-58   Acacia mangium
gb|AGV22107.1|  cellulose synthase 2                                    178   2e-58   Betula luminifera [liang ye hua]
gb|KEH19084.1|  cellulose synthase-like protein                         183   2e-58   Medicago truncatula
gb|AII73575.1|  cellulose synthase 3                                    180   2e-58   Medicago sativa [alfalfa]
ref|XP_003599196.1|  Cellulose synthase                                 180   2e-58   Medicago truncatula
ref|XP_004306536.1|  PREDICTED: cellulose synthase A catalytic su...    176   2e-58   Fragaria vesca subsp. vesca
ref|XP_008461291.1|  PREDICTED: cellulose synthase A catalytic su...    179   2e-58   Cucumis melo [Oriental melon]
gb|KCW44176.1|  hypothetical protein EUGRSUZ_L02402                     180   2e-58   Eucalyptus grandis [rose gum]
ref|NP_001289657.1|  cellulose synthase A catalytic subunit 1           175   3e-58   Eucalyptus grandis [rose gum]
gb|AEK31218.1|  cellulose synthase A                                    176   3e-58   Eucalyptus camaldulensis
ref|XP_010088232.1|  OsCesA3 protein                                    180   4e-58   Morus notabilis
gb|ACT16002.1|  cellulose synthase                                      179   4e-58   Phyllostachys edulis [kikko-chiku]
ref|XP_006412477.1|  hypothetical protein EUTSA_v10024278mg             174   6e-58   Eutrema salsugineum [saltwater cress]
gb|AAQ63936.1|  cellulose synthase                                      174   1e-57   Pinus radiata
ref|XP_002278997.1|  PREDICTED: cellulose synthase A catalytic su...    174   1e-57   Vitis vinifera
gb|AHL45025.1|  cellulose synthase 3A                                   175   1e-57   Linum usitatissimum
ref|XP_003546888.1|  PREDICTED: cellulose synthase A catalytic su...    174   1e-57   Glycine max [soybeans]
gb|KHN39939.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    174   1e-57   Glycine soja [wild soybean]
gb|KHM98952.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    173   2e-57   Glycine soja [wild soybean]
ref|XP_010445007.1|  PREDICTED: cellulose synthase A catalytic su...    174   2e-57   
gb|AEP33538.1|  cellulose synthase catalytic subunit                    173   2e-57   Gossypium schwendimanii
ref|NP_001104955.1|  cellulose synthase5                                178   2e-57   
tpg|DAA52080.1|  TPA: cellulose synthase5                               178   2e-57   
gb|AEP33557.1|  cellulose synthase catalytic subunit                    173   2e-57   Gossypium gossypioides
gb|AEP33537.1|  cellulose synthase catalytic subunit                    173   2e-57   Gossypium laxum
gb|AEP33552.1|  cellulose synthase catalytic subunit                    173   2e-57   Gossypium armourianum
gb|AEP33556.1|  cellulose synthase catalytic subunit                    173   2e-57   Gossypium aridum
gb|AEP33541.1|  cellulose synthase catalytic subunit                    173   2e-57   Gossypium mustelinum
gb|AEP33547.1|  cellulose synthase catalytic subunit                    173   2e-57   Gossypium barbadense var. brasiliense
gb|AEP33551.1|  cellulose synthase catalytic subunit                    173   2e-57   Gossypium hirsutum subsp. latifolium
gb|ADZ16119.1|  cellulose synthase A3                                   173   2e-57   Gossypium barbadense [Egyptian cotton]
gb|ADZ16123.1|  cellulose synthase A3                                   173   2e-57   Gossypium hirsutum [American cotton]
gb|AEP33554.1|  cellulose synthase catalytic subunit                    173   2e-57   Gossypium davidsonii
gb|ADZ16121.1|  cellulose synthase A3                                   173   2e-57   Gossypium raimondii
gb|AEP33543.1|  cellulose synthase catalytic subunit                    173   2e-57   Gossypium darwinii
gb|AAQ63935.1|  cellulose synthase                                      179   2e-57   Pinus radiata
ref|XP_011087713.1|  PREDICTED: cellulose synthase A catalytic su...    173   2e-57   Sesamum indicum [beniseed]
gb|ADZ16120.1|  cellulose synthase A3                                   173   2e-57   Gossypium herbaceum subsp. africanum
ref|XP_010241248.1|  PREDICTED: cellulose synthase A catalytic su...    173   2e-57   Nelumbo nucifera [Indian lotus]
ref|XP_009386450.1|  PREDICTED: probable cellulose synthase A cat...    173   2e-57   Musa acuminata subsp. malaccensis [pisang utan]
gb|AHL45026.1|  cellulose synthase 3B                                   174   2e-57   Linum usitatissimum
gb|EYU29030.1|  hypothetical protein MIMGU_mgv1a000570mg                173   2e-57   Erythranthe guttata [common monkey flower]
ref|XP_011093547.1|  PREDICTED: cellulose synthase A catalytic su...    173   2e-57   
gb|KDP26042.1|  hypothetical protein JCGZ_21075                         173   2e-57   Jatropha curcas
ref|XP_010906116.1|  PREDICTED: probable cellulose synthase A cat...    173   2e-57   Elaeis guineensis
gb|AEP33542.1|  truncated cellulose synthase catalytic subunit          172   2e-57   Gossypium darwinii
gb|ADZ16122.1|  truncated cellulose synthase A3                         172   2e-57   Gossypium hirsutum [American cotton]
gb|AEP33544.1|  truncated cellulose synthase catalytic subunit          172   2e-57   Gossypium tomentosum
gb|AEP33550.1|  truncated cellulose synthase catalytic subunit          172   3e-57   Gossypium hirsutum subsp. latifolium
ref|XP_009799381.1|  PREDICTED: cellulose synthase A catalytic su...    172   3e-57   Nicotiana sylvestris
ref|XP_009601834.1|  PREDICTED: cellulose synthase A catalytic su...    172   3e-57   Nicotiana tomentosiformis
ref|XP_007133819.1|  hypothetical protein PHAVU_011G211500g             172   3e-57   Phaseolus vulgaris [French bean]
gb|AEP33540.1|  cellulose synthase catalytic subunit                    172   3e-57   Gossypium mustelinum
ref|NP_001289668.1|  cellulose synthase A catalytic subunit 3 [UD...    176   4e-57   Eucalyptus grandis [rose gum]
gb|ABY25277.1|  cellulose synthase                                      176   4e-57   Eucalyptus grandis [rose gum]
ref|XP_004162186.1|  PREDICTED: cellulose synthase A catalytic su...    172   4e-57   
ref|XP_006296592.1|  hypothetical protein CARUB_v10012872mg             178   4e-57   Capsella rubella
ref|XP_008460760.1|  PREDICTED: cellulose synthase A catalytic su...    172   4e-57   Cucumis melo [Oriental melon]
ref|XP_004149389.1|  PREDICTED: cellulose synthase A catalytic su...    172   4e-57   Cucumis sativus [cucumbers]
ref|XP_010541595.1|  PREDICTED: cellulose synthase A catalytic su...    172   5e-57   Tarenaya hassleriana [spider flower]
ref|XP_006838305.1|  hypothetical protein AMTR_s00103p00124340          173   5e-57   Amborella trichopoda
ref|XP_010278977.1|  PREDICTED: cellulose synthase A catalytic su...    174   5e-57   Nelumbo nucifera [Indian lotus]
gb|KHN19454.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    172   5e-57   Glycine soja [wild soybean]
dbj|BAF01916.1|  cellulose synthase catalytic subunit                   171   5e-57   Arabidopsis thaliana [mouse-ear cress]
gb|AAD39534.2|  cellulose synthase catalytic subunit                    172   5e-57   Gossypium hirsutum [American cotton]
ref|XP_003540527.1|  PREDICTED: cellulose synthase A catalytic su...    172   6e-57   Glycine max [soybeans]
emb|CBI29854.3|  unnamed protein product                                173   6e-57   Vitis vinifera
gb|KDO83412.1|  hypothetical protein CISIN_1g001413mg                   173   6e-57   Citrus sinensis [apfelsine]
gb|KDO83413.1|  hypothetical protein CISIN_1g001413mg                   173   6e-57   Citrus sinensis [apfelsine]
ref|XP_011033321.1|  PREDICTED: cellulose synthase A catalytic su...    173   6e-57   Populus euphratica
ref|XP_011047398.1|  PREDICTED: cellulose synthase A catalytic su...    171   6e-57   Populus euphratica
ref|NP_001059162.1|  Os07g0208500                                       171   6e-57   
ref|XP_010257191.1|  PREDICTED: cellulose synthase A catalytic su...    173   6e-57   Nelumbo nucifera [Indian lotus]
ref|XP_006373780.1|  hypothetical protein POPTR_0016s05520g             173   7e-57   Populus trichocarpa [western balsam poplar]
ref|XP_006657551.1|  PREDICTED: probable cellulose synthase A cat...    171   7e-57   Oryza brachyantha
ref|XP_002461675.1|  hypothetical protein SORBIDRAFT_02g006290          171   7e-57   
ref|XP_010667061.1|  PREDICTED: cellulose synthase A catalytic su...    171   7e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011033320.1|  PREDICTED: cellulose synthase A catalytic su...    173   7e-57   Populus euphratica
ref|XP_002322712.1|  cellulose synthase family protein                  173   7e-57   
ref|XP_006293591.1|  hypothetical protein CARUB_v10022538mg             169   7e-57   
ref|XP_010653789.1|  PREDICTED: cellulose synthase A catalytic su...    173   7e-57   Vitis vinifera
ref|XP_004229630.1|  PREDICTED: cellulose synthase A catalytic su...    171   8e-57   Solanum lycopersicum
ref|XP_003542849.1|  PREDICTED: cellulose synthase A catalytic su...    171   8e-57   Glycine max [soybeans]
ref|NP_001104959.1|  cellulose synthase-9                               171   8e-57   
ref|XP_008668614.1|  PREDICTED: cellulose synthase-9 isoform X1         171   8e-57   
ref|XP_011020351.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    173   8e-57   Populus euphratica
ref|XP_007028786.1|  Cellulose synthase family protein                  171   8e-57   
gb|AFZ78565.1|  cellulose synthase                                      172   8e-57   Populus tomentosa [Chinese white poplar]
gb|KHN37622.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    171   9e-57   Glycine soja [wild soybean]
ref|XP_004135931.1|  PREDICTED: cellulose synthase A catalytic su...    172   9e-57   Cucumis sativus [cucumbers]
gb|KHG04072.1|  putative cellulose synthase A catalytic subunit 8...    171   9e-57   Gossypium arboreum [tree cotton]
gb|AFB18638.1|  CESA10                                                  171   9e-57   Gossypium hirsutum [American cotton]
ref|XP_010491045.1|  PREDICTED: cellulose synthase A catalytic su...    170   9e-57   Camelina sativa [gold-of-pleasure]
gb|KJB19277.1|  hypothetical protein B456_003G092600                    171   1e-56   Gossypium raimondii
ref|XP_008651867.1|  PREDICTED: cellulose synthase-4 isoform X1         171   1e-56   
gb|KJB19276.1|  hypothetical protein B456_003G092600                    171   1e-56   Gossypium raimondii
ref|XP_002308955.1|  cellulose synthase family protein                  172   1e-56   
ref|NP_001275292.1|  cellulose synthase                                 172   1e-56   Solanum tuberosum [potatoes]
ref|XP_009130870.1|  PREDICTED: cellulose synthase A catalytic su...    171   1e-56   Brassica rapa
emb|CDY14127.1|  BnaC02g02440D                                          171   1e-56   Brassica napus [oilseed rape]
emb|CDY52141.1|  BnaA03g55200D                                          171   1e-56   Brassica napus [oilseed rape]
ref|XP_006474028.1|  PREDICTED: cellulose synthase A catalytic su...    179   1e-56   Citrus sinensis [apfelsine]
emb|CDY04942.1|  BnaAnng01240D                                          170   1e-56   
ref|XP_009125590.1|  PREDICTED: cellulose synthase A catalytic su...    170   1e-56   Brassica rapa
emb|CDX80951.1|  BnaC03g02050D                                          170   1e-56   
ref|XP_006474027.1|  PREDICTED: cellulose synthase A catalytic su...    179   1e-56   Citrus sinensis [apfelsine]
gb|ADZ16118.1|  truncated cellulose synthase A3                         170   1e-56   Gossypium barbadense [Egyptian cotton]
gb|KDO62270.1|  hypothetical protein CISIN_1g039060mg                   179   2e-56   Citrus sinensis [apfelsine]
ref|XP_006453581.1|  hypothetical protein CICLE_v10007321mg             179   2e-56   Citrus clementina [clementine]
ref|XP_010547260.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    170   2e-56   
tpg|DAA39507.1|  TPA: hypothetical protein ZEAMMB73_844715              170   2e-56   
gb|AEP33536.1|  cellulose synthase catalytic subunit                    170   2e-56   Gossypium thurberi
gb|AEP33539.1|  cellulose synthase catalytic subunit                    170   2e-56   Gossypium turneri
gb|AEP33559.1|  cellulose synthase catalytic subunit                    170   2e-56   Gossypium trilobum
gb|AEP33545.1|  cellulose synthase catalytic subunit                    170   2e-56   Gossypium tomentosum
gb|AAY60846.1|  cellulose synthase 4                                    174   2e-56   Eucalyptus grandis [rose gum]
gb|AEP33553.1|  cellulose synthase catalytic subunit                    170   2e-56   Gossypium harknessii
gb|KHG16921.1|  Cellulose synthase A catalytic subunit 3 [UDP-for...    170   2e-56   Gossypium arboreum [tree cotton]
gb|KJB22792.1|  hypothetical protein B456_004G065900                    170   2e-56   Gossypium raimondii
ref|XP_004510986.1|  PREDICTED: cellulose synthase A catalytic su...    173   2e-56   Cicer arietinum [garbanzo]
ref|XP_002314037.1|  cellulose synthase family protein                  172   2e-56   
gb|AFZ78557.1|  cellulose synthase                                      172   2e-56   Populus tomentosa [Chinese white poplar]
ref|XP_010937172.1|  PREDICTED: probable cellulose synthase A cat...    172   2e-56   Elaeis guineensis
ref|XP_002298432.1|  hypothetical protein POPTR_0001s27320g             172   2e-56   
ref|XP_011025442.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    172   2e-56   Populus euphratica
gb|AEE60898.1|  cellulose synthase                                      172   3e-56   Populus tomentosa [Chinese white poplar]
gb|AAY43220.1|  cellulose synthase BoCesA4                              171   3e-56   Bambusa oldhamii
gb|AFG25777.1|  cellulose synthase 3                                    171   3e-56   Bambusa emeiensis
gb|AGX27207.1|  cellulose synthase 7                                    181   3e-56   Populus tomentosa [Chinese white poplar]
gb|AGX27214.1|  cellulose synthase 7                                    181   3e-56   Populus tomentosa [Chinese white poplar]
ref|XP_008790520.1|  PREDICTED: probable cellulose synthase A cat...    172   3e-56   
ref|XP_002308412.1|  cellulose synthase family protein                  181   4e-56   
gb|AGX27236.1|  cellulose synthase 7                                    181   4e-56   
gb|AGX27235.1|  cellulose synthase 7                                    181   4e-56   
gb|AGX27229.1|  cellulose synthase 7                                    181   4e-56   
gb|AGX27223.1|  cellulose synthase 7                                    181   4e-56   
gb|AGX27222.1|  cellulose synthase 7                                    181   4e-56   
gb|AGX27220.1|  cellulose synthase 7                                    181   4e-56   
gb|AGX27219.1|  cellulose synthase 7                                    181   4e-56   
gb|AGX27216.1|  cellulose synthase 7                                    181   4e-56   
gb|AGX27215.1|  cellulose synthase 7                                    181   4e-56   
gb|AGX27212.1|  cellulose synthase 7                                    181   4e-56   
gb|AGX27206.1|  cellulose synthase 7                                    181   4e-56   
gb|AGX27202.1|  cellulose synthase 7                                    181   4e-56   
gb|AGX27201.1|  cellulose synthase 7                                    181   4e-56   
gb|AGX27199.1|  cellulose synthase 7                                    181   4e-56   
ref|XP_006381880.1|  hypothetical protein POPTR_0006s19580g             181   4e-56   
gb|AFZ78559.1|  cellulose synthase                                      181   4e-56   
ref|XP_011033387.1|  PREDICTED: cellulose synthase A catalytic su...    181   4e-56   
gb|AGX27238.1|  cellulose synthase 7                                    181   4e-56   
gb|AGX27233.1|  cellulose synthase 7                                    181   4e-56   
gb|AGX27211.1|  cellulose synthase 7                                    181   4e-56   
gb|AGX27203.1|  cellulose synthase 7                                    181   4e-56   
gb|AGX27205.1|  cellulose synthase 7                                    181   4e-56   
gb|AGX27231.1|  cellulose synthase 7                                    180   4e-56   
ref|XP_010032436.1|  PREDICTED: cellulose synthase A catalytic su...    172   5e-56   
ref|XP_002533228.1|  Cellulose synthase A catalytic subunit 3 [UD...    179   6e-56   
ref|XP_003578137.1|  PREDICTED: cellulose synthase A catalytic su...    179   6e-56   
ref|XP_006650766.1|  PREDICTED: LOW QUALITY PROTEIN: probable cel...    172   6e-56   
ref|NP_001051648.1|  Os03g0808100                                       172   7e-56   
gb|AAY43221.1|  cellulose synthase BoCesA4                              171   7e-56   
ref|XP_010534646.1|  PREDICTED: cellulose synthase A catalytic su...    168   8e-56   
gb|AIS86011.1|  cellulose synthase 3                                    171   1e-55   
gb|AIS85987.1|  cellulose synthase 3                                    171   1e-55   
gb|AEE60897.1|  cellulose synthase                                      179   1e-55   
gb|AIS85978.1|  cellulose synthase 3                                    171   1e-55   
gb|AFZ78551.1|  cellulose synthase                                      179   1e-55   
gb|AIS86009.1|  cellulose synthase 3                                    171   1e-55   
gb|AIS85996.1|  cellulose synthase 3                                    171   1e-55   
gb|AIS85977.1|  cellulose synthase 3                                    171   1e-55   
ref|XP_002325122.1|  cellulose synthase family protein                  179   1e-55   
gb|AIS86005.1|  cellulose synthase 3                                    171   1e-55   
ref|XP_004955797.1|  PREDICTED: probable cellulose synthase A cat...    171   1e-55   
gb|AIS85989.1|  cellulose synthase 3                                    171   1e-55   
gb|AIS85990.1|  cellulose synthase 3                                    171   1e-55   
gb|AIS86004.1|  cellulose synthase 3                                    171   1e-55   
gb|AHL38838.1|  glycosyltransferase                                     166   1e-55   
gb|AFZ78554.1|  cellulose synthase                                      171   1e-55   
gb|AIS85991.1|  cellulose synthase 3                                    171   1e-55   
gb|ACU80553.2|  cellulose synthase                                      171   1e-55   
gb|AAL23710.2|  cellulose synthase                                      171   1e-55   
gb|EMT30130.1|  Cellulose synthase A catalytic subunit 9 (UDP-for...    178   1e-55   
ref|NP_180124.1|  cellulose synthase 10                                 166   1e-55   
gb|ACO06090.1|  cellulose synthase                                      170   1e-55   
ref|XP_010486709.1|  PREDICTED: cellulose synthase A catalytic su...    173   1e-55   
ref|XP_002532166.1|  Cellulose synthase A catalytic subunit 6 [UD...    167   1e-55   
dbj|BAJ85783.1|  predicted protein                                      178   1e-55   
ref|XP_010486710.1|  PREDICTED: cellulose synthase A catalytic su...    173   2e-55   
gb|AEE60896.1|  cellulose synthase                                      178   2e-55   
gb|AAY43222.1|  cellulose synthase BoCesA5                              172   2e-55   
ref|XP_009366208.1|  PREDICTED: cellulose synthase A catalytic su...    181   2e-55   
gb|EYU35355.1|  hypothetical protein MIMGU_mgv1a000638mg                178   2e-55   
ref|XP_010491404.1|  PREDICTED: cellulose synthase A catalytic su...    174   2e-55   
ref|XP_011079381.1|  PREDICTED: cellulose synthase A catalytic su...    178   3e-55   
dbj|BAJ85304.1|  predicted protein                                      169   3e-55   
gb|EMT09789.1|  Putative cellulose synthase A catalytic subunit 8...    169   3e-55   
ref|XP_010228019.1|  PREDICTED: probable cellulose synthase A cat...    171   3e-55   
dbj|BAD06322.1|  putative cellulose synthase                            169   3e-55   
ref|XP_011079380.1|  PREDICTED: cellulose synthase A catalytic su...    178   3e-55   
ref|XP_011018058.1|  PREDICTED: cellulose synthase A catalytic su...    179   3e-55   
ref|XP_003638289.1|  hypothetical protein MTR_125s1017                  172   3e-55   
ref|XP_010228016.1|  PREDICTED: probable cellulose synthase A cat...    170   3e-55   
ref|XP_010228012.1|  PREDICTED: probable cellulose synthase A cat...    170   3e-55   
ref|XP_011079382.1|  PREDICTED: cellulose synthase A catalytic su...    178   3e-55   
ref|XP_009358418.1|  PREDICTED: cellulose synthase A catalytic su...    180   3e-55   
ref|XP_010905024.1|  PREDICTED: cellulose synthase A catalytic su...    177   3e-55   
ref|XP_011083940.1|  PREDICTED: cellulose synthase A catalytic su...    178   3e-55   
ref|XP_006660635.1|  PREDICTED: cellulose synthase A catalytic su...    177   3e-55   
ref|XP_009777624.1|  PREDICTED: cellulose synthase A catalytic su...    177   4e-55   
ref|XP_003557396.1|  PREDICTED: probable cellulose synthase A cat...    169   4e-55   
ref|XP_010228235.1|  PREDICTED: probable cellulose synthase A cat...    169   4e-55   
ref|XP_010929171.1|  PREDICTED: cellulose synthase A catalytic su...    177   4e-55   
ref|XP_004981340.1|  PREDICTED: probable cellulose synthase A cat...    170   5e-55   
emb|CDX72357.1|  BnaC07g43790D                                          164   5e-55   
emb|CDY13484.1|  BnaA03g52020D                                          164   5e-55   
gb|ACS68190.1|  cellulose synthase 1.2 catalytic subunit                164   6e-55   
ref|XP_007052527.1|  Cellulose synthase family protein isoform 3        165   6e-55   
gb|ACS68189.1|  cellulose synthase 1.1 catalytic subunit                164   6e-55   
gb|ADH95191.1|  cellulose synthase                                      170   6e-55   
gb|KFK29850.1|  hypothetical protein AALP_AA7G186800                    164   6e-55   
gb|AAM26299.1|  cellulose synthase                                      178   7e-55   
ref|XP_006285557.1|  hypothetical protein CARUB_v10006999mg             164   8e-55   
ref|XP_010464776.1|  PREDICTED: cellulose synthase A catalytic su...    171   8e-55   
ref|XP_010464777.1|  PREDICTED: cellulose synthase A catalytic su...    171   8e-55   
dbj|BAJ87858.1|  predicted protein                                      167   9e-55   
emb|CDX68844.1|  BnaC01g06090D                                          164   9e-55   
ref|XP_010265522.1|  PREDICTED: cellulose synthase A catalytic su...    179   9e-55   
ref|XP_002867245.1|  hypothetical protein ARALYDRAFT_491486             164   9e-55   
ref|XP_004956855.1|  PREDICTED: cellulose synthase A catalytic su...    175   9e-55   
ref|XP_008670200.1|  PREDICTED: cellulose synthase A catalytic su...    175   1e-54   
dbj|BAJ96780.1|  predicted protein                                      169   1e-54   
gb|EPS60781.1|  hypothetical protein M569_14019                         177   1e-54   
gb|AAR29963.1|  putative cellulose synthase catalytic subunit           169   1e-54   
ref|XP_009126053.1|  PREDICTED: cellulose synthase A catalytic su...    164   1e-54   
gb|KFK25952.1|  hypothetical protein AALP_AA8G184200                    176   1e-54   
ref|XP_009126184.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    176   1e-54   
ref|XP_006826669.1|  hypothetical protein AMTR_s00137p00043990          178   1e-54   
ref|XP_010273667.1|  PREDICTED: cellulose synthase A catalytic su...    178   1e-54   
gb|KFK25953.1|  hypothetical protein AALP_AA8G184200                    176   1e-54   
emb|CDX75242.1|  BnaA01g04600D                                          164   1e-54   
ref|XP_008356761.1|  PREDICTED: cellulose synthase A catalytic su...    169   1e-54   
ref|XP_009622821.1|  PREDICTED: cellulose synthase A catalytic su...    177   1e-54   
gb|ACS68197.1|  cellulose synthase 7.1 catalytic subunit                176   1e-54   
gb|EMT00418.1|  Putative cellulose synthase A catalytic subunit 2...    169   1e-54   
ref|XP_009622822.1|  PREDICTED: cellulose synthase A catalytic su...    177   1e-54   
gb|ACJ38665.1|  cellulose synthase                                      177   1e-54   
ref|XP_010492694.1|  PREDICTED: cellulose synthase A catalytic su...    176   1e-54   
ref|XP_010453934.1|  PREDICTED: cellulose synthase A catalytic su...    176   1e-54   
ref|XP_010453933.1|  PREDICTED: cellulose synthase A catalytic su...    176   1e-54   
ref|XP_010420462.1|  PREDICTED: cellulose synthase A catalytic su...    176   1e-54   
ref|XP_010420461.1|  PREDICTED: cellulose synthase A catalytic su...    176   1e-54   
ref|XP_002460229.1|  hypothetical protein SORBIDRAFT_02g025020          174   1e-54   
ref|XP_006286973.1|  hypothetical protein CARUB_v10000119mg             176   1e-54   
gb|ACC59196.1|  cellulose synthase                                      176   1e-54   
ref|XP_010687624.1|  PREDICTED: cellulose synthase A catalytic su...    179   1e-54   
ref|XP_002463687.1|  hypothetical protein SORBIDRAFT_01g004210          169   1e-54   
ref|XP_007013859.1|  Cellulose synthase family protein isoform 1        178   1e-54   
ref|XP_009131595.1|  PREDICTED: cellulose synthase A catalytic su...    176   1e-54   
gb|ACN27465.1|  unknown                                                 168   2e-54   
emb|CDP02834.1|  unnamed protein product                                172   2e-54   
tpg|DAA61529.1|  TPA: putative cellulose synthase family protein        174   2e-54   
ref|XP_010432725.1|  PREDICTED: cellulose synthase A catalytic su...    164   2e-54   
ref|NP_001105532.1|  cellulose synthase catalytic subunit 12            174   2e-54   
ref|XP_010447394.1|  PREDICTED: cellulose synthase A catalytic su...    164   2e-54   
gb|AFI71894.1|  cellulose synthase 3                                    168   2e-54   
gb|AFW69155.1|  putative cellulose synthase family protein              174   2e-54   
ref|NP_197244.1|  cellulose synthase A catalytic subunit 7 [UDP-f...    175   2e-54   
ref|XP_002873827.1|  hypothetical protein ARALYDRAFT_909737             175   2e-54   
ref|NP_194967.1|  cellulose synthase A catalytic subunit 1 [UDP-f...    164   2e-54   
gb|AAD32031.1|AF088917_1  cellulose synthase catalytic subunit          175   2e-54   
ref|XP_008394301.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    177   2e-54   
ref|XP_006400279.1|  hypothetical protein EUTSA_v10012538mg             175   2e-54   
ref|XP_008794369.1|  PREDICTED: cellulose synthase A catalytic su...    176   2e-54   
gb|ABR26050.1|  cellulose synthase                                      182   2e-54   
ref|XP_009138081.1|  PREDICTED: cellulose synthase A catalytic su...    162   2e-54   
gb|AFP93559.1|  cellulose synthase A1                                   177   3e-54   
gb|AGE09566.1|  cellulose synthase-like protein                         174   3e-54   
ref|XP_008243020.1|  PREDICTED: cellulose synthase A catalytic su...    177   3e-54   
gb|KCW78815.1|  hypothetical protein EUGRSUZ_C00246                     174   3e-54   
gb|KCW78814.1|  hypothetical protein EUGRSUZ_C00246                     174   3e-54   
gb|AGJ71354.1|  cellulose synthase 3                                    174   3e-54   
gb|AFR58756.2|  cellulose synthase 3                                    174   3e-54   
ref|NP_001289644.1|  cellulose synthase A catalytic subunit 7           174   3e-54   
gb|AEK31217.1|  cellulose synthase A                                    174   3e-54   
gb|KCW78813.1|  hypothetical protein EUGRSUZ_C00246                     174   3e-54   
ref|XP_004287144.1|  PREDICTED: cellulose synthase A catalytic su...    179   3e-54   
gb|EPS69824.1|  hypothetical protein M569_04932                         169   4e-54   
ref|XP_007204670.1|  hypothetical protein PRUPE_ppa000618mg             176   4e-54   
ref|XP_004152851.1|  PREDICTED: cellulose synthase A catalytic su...    177   4e-54   
dbj|BAF93202.1|  cellulose synthase catalytic subunit                   175   5e-54   
gb|AFB18636.1|  CESA7                                                   178   6e-54   
gb|KJB07762.1|  hypothetical protein B456_001G044700                    178   6e-54   
gb|KJB07761.1|  hypothetical protein B456_001G044700                    178   6e-54   
ref|XP_010695250.1|  PREDICTED: cellulose synthase A catalytic su...    163   6e-54   
ref|XP_010545449.1|  PREDICTED: cellulose synthase A catalytic su...    175   6e-54   
gb|KHG19749.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    177   6e-54   
dbj|BAD95078.1|  cellulose synthase catalytic subunit                   161   7e-54   
ref|XP_008450511.1|  PREDICTED: cellulose synthase A catalytic su...    176   7e-54   
gb|ADD71499.1|  cellulose synthase catalytic subunit                    176   7e-54   
gb|KJB53884.1|  hypothetical protein B456_009G009700                    176   8e-54   
ref|XP_004242614.1|  PREDICTED: cellulose synthase A catalytic su...    174   8e-54   
gb|AFB18637.1|  CESA8                                                   176   9e-54   
ref|XP_010091161.1|  OsCesA7 protein                                    175   9e-54   
emb|CAN73700.1|  hypothetical protein VITISV_013112                     177   1e-53   
ref|XP_006343620.1|  PREDICTED: cellulose synthase A catalytic su...    174   1e-53   
gb|KHG11460.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    175   1e-53   
ref|XP_002276890.2|  PREDICTED: cellulose synthase A catalytic su...    176   1e-53   
ref|XP_002967423.1|  hypothetical protein SELMODRAFT_86720              174   1e-53   
ref|XP_008233413.1|  PREDICTED: probable cellulose synthase A cat...    173   1e-53   
ref|XP_007210416.1|  hypothetical protein PRUPE_ppa000557mg             173   1e-53   
ref|XP_009410192.1|  PREDICTED: cellulose synthase A catalytic su...    175   1e-53   
ref|XP_007154868.1|  hypothetical protein PHAVU_003G154600g             174   2e-53   
gb|KHN14136.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    175   2e-53   
ref|XP_003519160.1|  PREDICTED: cellulose synthase A catalytic su...    175   2e-53   
gb|ACJ38667.1|  cellulose synthase                                      176   2e-53   
ref|XP_003549532.1|  PREDICTED: cellulose synthase A catalytic su...    174   2e-53   
ref|XP_002983910.1|  family 2 glycosyltransferase                       175   2e-53   
ref|XP_006405185.1|  hypothetical protein EUTSA_v10000022mg             158   2e-53   
ref|XP_006600535.1|  PREDICTED: cellulose synthase A catalytic su...    174   2e-53   
ref|XP_002960291.1|  family 2 glycosyltransferase                       172   2e-53   
gb|AHH81946.1|  cellulose synthase                                      174   2e-53   
ref|XP_002960761.1|  cellulose synthase 4-1                             175   2e-53   
ref|XP_002880684.1|  CESA10                                             159   2e-53   
ref|XP_010472554.1|  PREDICTED: LOW QUALITY PROTEIN: probable cel...    159   2e-53   
ref|XP_008362868.1|  PREDICTED: cellulose synthase A catalytic su...    174   2e-53   
gb|AFM37966.1|  cellulose synthase catalytic subunit                    164   2e-53   
ref|XP_007138395.1|  hypothetical protein PHAVU_009G205100g             174   3e-53   
gb|KHN17507.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    174   3e-53   
ref|XP_010266321.1|  PREDICTED: probable cellulose synthase A cat...    172   3e-53   
ref|XP_011036830.1|  PREDICTED: probable cellulose synthase A cat...    174   4e-53   
ref|XP_003527198.1|  PREDICTED: cellulose synthase A catalytic su...    173   4e-53   
dbj|BAJ05813.1|  cellulose synthase catalytic subunit                   170   4e-53   
ref|NP_001063207.1|  Os09g0422500                                       170   4e-53   
ref|XP_003522926.1|  PREDICTED: cellulose synthase A catalytic su...    173   5e-53   
gb|ACT67415.1|  cellulose synthase                                      174   5e-53   
ref|XP_006849886.1|  hypothetical protein AMTR_s00022p00086120          172   6e-53   
ref|XP_011036833.1|  PREDICTED: probable cellulose synthase A cat...    174   6e-53   
ref|XP_010905025.1|  PREDICTED: cellulose synthase A catalytic su...    169   8e-53   
gb|AAP40636.1|  cellulose synthase 6                                    174   8e-53   
gb|ADV58936.1|  cellulose synthase                                      174   9e-53   
gb|AFS95066.1|  cellulose synthase                                      172   9e-53   
ref|XP_002963550.1|  family 2 glycosyltransferase                       175   9e-53   
gb|ADR74043.1|  cellulose synthase                                      174   9e-53   
ref|XP_002319002.2|  cellulose synthase 6 family protein                174   1e-52   
gb|KEH32618.1|  cellulose synthase-like protein                         175   1e-52   
ref|XP_003610282.1|  Cellulose synthase catalytic subunit               175   1e-52   
ref|XP_001776974.1|  cellulose synthase 10, glycosyltransferase f...    174   1e-52   
ref|XP_011023647.1|  PREDICTED: probable cellulose synthase A cat...    173   1e-52   
ref|XP_010270659.1|  PREDICTED: probable cellulose synthase A cat...    170   1e-52   
ref|XP_009372681.1|  PREDICTED: LOW QUALITY PROTEIN: probable cel...    170   1e-52   
ref|XP_006382504.1|  cellulose synthase 6 family protein                173   1e-52   



>gb|AAO25536.1| cellulose synthase [Populus tremuloides]
Length=1083

 Score =   207 bits (526),  Expect(2) = 3e-68, Method: Composition-based stats.
 Identities = 93/102 (91%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTV+++N+VGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGLLGRQNRT
Sbjct  982   IPPTTVIVLNMVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLLGRQNRT  1041

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTSDS KAAA GQCGINC
Sbjct  1042  PTIVIVWSILLASIFSLLWVRIDPFTSDSTKAAANGQCGINC  1083


 Score = 79.3 bits (194),  Expect(2) = 3e-68, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  946  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  984



>gb|AFZ78556.1| cellulose synthase [Populus tomentosa]
Length=1075

 Score =   206 bits (525),  Expect(2) = 5e-68, Method: Composition-based stats.
 Identities = 93/102 (91%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTV+++N+VGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGLLGRQNRT
Sbjct  974   IPPTTVIVLNMVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLLGRQNRT  1033

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTSDS KAAA GQCGINC
Sbjct  1034  PTIVIVWSILLASIFSLLWVRIDPFTSDSTKAAANGQCGINC  1075


 Score = 79.3 bits (194),  Expect(2) = 5e-68, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  938  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  976



>ref|XP_002515536.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
 gb|EEF46985.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative 
[Ricinus communis]
Length=1083

 Score =   207 bits (528),  Expect(2) = 5e-68, Method: Composition-based stats.
 Identities = 94/102 (92%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTV+IVNLVGIVAGVS+AINSGYQSWGPLFG+LFFA+WV+ HLYPFLKGLLGRQNRT
Sbjct  982   IPPTTVIIVNLVGIVAGVSYAINSGYQSWGPLFGKLFFALWVVAHLYPFLKGLLGRQNRT  1041

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTSD+AKAAA GQCGINC
Sbjct  1042  PTIVIVWSILLASIFSLLWVRIDPFTSDAAKAAANGQCGINC  1083


 Score = 77.8 bits (190),  Expect(2) = 5e-68, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DGDFAELYVFKWTSLL  P
Sbjct  946  LKVLAGIDTNFTVTSKASDDDGDFAELYVFKWTSLLIPP  984



>ref|XP_002308657.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE92180.1| cellulose synthase family protein [Populus trichocarpa]
Length=1075

 Score =   206 bits (524),  Expect(2) = 6e-68, Method: Composition-based stats.
 Identities = 93/102 (91%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTV+++N+VGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGLLGRQNRT
Sbjct  974   IPPTTVILLNMVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLLGRQNRT  1033

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTSDS KAAA GQCGINC
Sbjct  1034  PTIVIVWSILLASIFSLLWVRIDPFTSDSTKAAANGQCGINC  1075


 Score = 79.3 bits (194),  Expect(2) = 6e-68, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  938  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  976



>ref|XP_011459196.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
isoform X1 [Fragaria vesca subsp. vesca]
Length=1072

 Score =   205 bits (522),  Expect(2) = 1e-67, Method: Composition-based stats.
 Identities = 93/102 (91%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLIVNLVGIVAGVS+AINSGYQSWGPLFG+LFFA+WV+ HLYPFLKGLLGRQNRT
Sbjct  971   IPPTTVLIVNLVGIVAGVSYAINSGYQSWGPLFGKLFFAMWVVAHLYPFLKGLLGRQNRT  1030

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTSD+ KAAA GQCG+NC
Sbjct  1031  PTIVIVWSILLASIFSLLWVRIDPFTSDATKAAAKGQCGVNC  1072


 Score = 79.3 bits (194),  Expect(2) = 1e-67, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  935  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  973



>ref|XP_004291468.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
isoform X2 [Fragaria vesca subsp. vesca]
Length=1069

 Score =   205 bits (522),  Expect(2) = 1e-67, Method: Composition-based stats.
 Identities = 93/102 (91%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLIVNLVGIVAGVS+AINSGYQSWGPLFG+LFFA+WV+ HLYPFLKGLLGRQNRT
Sbjct  968   IPPTTVLIVNLVGIVAGVSYAINSGYQSWGPLFGKLFFAMWVVAHLYPFLKGLLGRQNRT  1027

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTSD+ KAAA GQCG+NC
Sbjct  1028  PTIVIVWSILLASIFSLLWVRIDPFTSDATKAAAKGQCGVNC  1069


 Score = 79.3 bits (194),  Expect(2) = 1e-67, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  932  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  970



>gb|AGV22109.1| cellulose synthase 7 [Betula luminifera]
Length=1085

 Score =   205 bits (522),  Expect(2) = 1e-67, Method: Composition-based stats.
 Identities = 96/102 (94%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLIVNLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGLLGRQNRT
Sbjct  984   IPPTTVLIVNLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLLGRQNRT  1043

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
              TIVIVWSILLASIFSLLWVRIDPFTS SAKAAA GQCGINC
Sbjct  1044  STIVIVWSILLASIFSLLWVRIDPFTSASAKAAANGQCGINC  1085


 Score = 79.3 bits (194),  Expect(2) = 1e-67, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  948  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  986



>ref|XP_008394069.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Malus domestica]
Length=1072

 Score =   204 bits (518),  Expect(2) = 3e-67, Method: Composition-based stats.
 Identities = 91/102 (89%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL+VN+VGIVAGVS+AINSGYQSWGPLFG+LFFA+WV+ HLYPFLKGLLGRQNRT
Sbjct  971   IPPTTVLLVNMVGIVAGVSYAINSGYQSWGPLFGKLFFALWVVAHLYPFLKGLLGRQNRT  1030

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTSD  KAA+ GQCGINC
Sbjct  1031  PTIVIVWSILLASIFSLLWVRIDPFTSDKTKAASNGQCGINC  1072


 Score = 79.3 bits (194),  Expect(2) = 3e-67, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  935  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  973



>ref|XP_011039709.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Populus euphratica]
Length=1097

 Score =   203 bits (517),  Expect(2) = 3e-67, Method: Composition-based stats.
 Identities = 92/102 (90%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTV+++N+VGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGLLGRQNRT
Sbjct  996   IPPTTVILLNMVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLLGRQNRT  1055

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTSDS KA A GQCGINC
Sbjct  1056  PTIVIVWSILLASIFSLLWVRIDPFTSDSTKAVANGQCGINC  1097


 Score = 79.3 bits (194),  Expect(2) = 3e-67, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  960  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  998



>ref|XP_008219478.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Prunus mume]
Length=1072

 Score =   203 bits (516),  Expect(2) = 5e-67, Method: Composition-based stats.
 Identities = 90/102 (88%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL+VN+VGIVAGVS+AINSGYQSWGPLFG+LFFA+WV+ HLYPFLKGLLGRQNRT
Sbjct  971   IPPTTVLLVNMVGIVAGVSYAINSGYQSWGPLFGKLFFALWVVAHLYPFLKGLLGRQNRT  1030

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFT+D+ KAA+ GQCGINC
Sbjct  1031  PTIVIVWSILLASIFSLLWVRIDPFTNDATKAASNGQCGINC  1072


 Score = 79.3 bits (194),  Expect(2) = 5e-67, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  935  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  973



>ref|XP_011081578.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Sesamum indicum]
Length=1084

 Score =   204 bits (519),  Expect(2) = 6e-67, Method: Composition-based stats.
 Identities = 93/102 (91%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLIVN+VGIVAGVS+AINSGYQSWGPLFG+LFFAIWVIVHLYPFLKGLLGRQNRT
Sbjct  983   IPPTTVLIVNMVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIVHLYPFLKGLLGRQNRT  1042

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTS++ + AA GQCGINC
Sbjct  1043  PTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGINC  1084


 Score = 77.8 bits (190),  Expect(2) = 6e-67, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DGDFAELYVFKWTSLL  P
Sbjct  947  LKVLAGIDTNFTVTSKASDDDGDFAELYVFKWTSLLIPP  985



>gb|AGC97433.2| cellulose synthase [Boehmeria nivea]
Length=1082

 Score =   206 bits (523),  Expect(2) = 6e-67, Method: Composition-based stats.
 Identities = 93/102 (91%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLI+NLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGLLGRQNRT
Sbjct  981   IPPTTVLIINLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLLGRQNRT  1040

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTSD+ KAA+ GQCG+NC
Sbjct  1041  PTIVIVWSILLASIFSLLWVRIDPFTSDATKAASRGQCGVNC  1082


 Score = 76.3 bits (186),  Expect(2) = 6e-67, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DG+FAELYVFKWTSLL  P
Sbjct  945  LKVLAGIDTNFTVTSKASDDDGEFAELYVFKWTSLLIPP  983



>ref|XP_010254360.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Nelumbo nucifera]
Length=1085

 Score =   206 bits (523),  Expect(2) = 7e-67, Method: Composition-based stats.
 Identities = 94/102 (92%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLI+N VGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI+HLYPFLKGLLGRQNRT
Sbjct  984   IPPTTVLIINFVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVILHLYPFLKGLLGRQNRT  1043

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTSD+ KAAA GQCGINC
Sbjct  1044  PTIVIVWSILLASIFSLLWVRIDPFTSDATKAAAKGQCGINC  1085


 Score = 75.9 bits (185),  Expect(2) = 7e-67, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DG+FAELYVFKWTSLL  P
Sbjct  948  LKVLAGIDTNFTVTSKASDDDGEFAELYVFKWTSLLIPP  986



>ref|XP_007221583.1| hypothetical protein PRUPE_ppa000611mg [Prunus persica]
 gb|EMJ22782.1| hypothetical protein PRUPE_ppa000611mg [Prunus persica]
Length=1072

 Score =   202 bits (514),  Expect(2) = 8e-67, Method: Composition-based stats.
 Identities = 89/102 (87%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL+VN+VGIVAGVS+AINSGYQSWGPLFG+LFFA+WV+ HLYPFLKGLLGRQNRT
Sbjct  971   IPPTTVLLVNMVGIVAGVSYAINSGYQSWGPLFGKLFFALWVVAHLYPFLKGLLGRQNRT  1030

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFT+D+ KAA+ GQCG+NC
Sbjct  1031  PTIVIVWSILLASIFSLLWVRIDPFTNDATKAASNGQCGVNC  1072


 Score = 79.3 bits (194),  Expect(2) = 8e-67, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  935  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  973



>ref|XP_009355721.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Pyrus x bretschneideri]
 ref|XP_009348606.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Pyrus x bretschneideri]
Length=1072

 Score =   201 bits (512),  Expect(2) = 1e-66, Method: Composition-based stats.
 Identities = 90/102 (88%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL+VN+VGIVAGVS+AINSGYQSWGPLFG+LFFA+WV+ HLYPFLKGLLGRQNRT
Sbjct  971   IPPTTVLLVNMVGIVAGVSYAINSGYQSWGPLFGKLFFALWVVAHLYPFLKGLLGRQNRT  1030

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTSD   AA+ GQCGINC
Sbjct  1031  PTIVIVWSILLASIFSLLWVRIDPFTSDKTTAASNGQCGINC  1072


 Score = 79.3 bits (194),  Expect(2) = 1e-66, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  935  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  973



>ref|XP_008366693.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Malus domestica]
Length=1072

 Score =   202 bits (515),  Expect(2) = 1e-66, Method: Composition-based stats.
 Identities = 91/102 (89%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL+VN+VGIVAGVS+AINSGYQSWGPLFG+LFFA+WV+ HLYPFLKGLLGRQNRT
Sbjct  971   IPPTTVLLVNIVGIVAGVSYAINSGYQSWGPLFGKLFFALWVVAHLYPFLKGLLGRQNRT  1030

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTSD  KAA  GQCGINC
Sbjct  1031  PTIVIVWSILLASIFSLLWVRIDPFTSDKTKAATNGQCGINC  1072


 Score = 78.2 bits (191),  Expect(2) = 1e-66, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSK+SDEDGDFAELYVFKWTSLL  P
Sbjct  935  LKVLAGIDTNFTVTSKSSDEDGDFAELYVFKWTSLLIPP  973



>ref|XP_011071168.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Sesamum indicum]
Length=1084

 Score =   204 bits (520),  Expect(2) = 1e-66, Method: Composition-based stats.
 Identities = 93/102 (91%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLIVNLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVIVHLYPFLKGLLGRQNRT
Sbjct  983   IPPTTVLIVNLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIVHLYPFLKGLLGRQNRT  1042

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTS++ + AA GQCG+NC
Sbjct  1043  PTIVIVWSILLASIFSLLWVRIDPFTSEATRRAANGQCGVNC  1084


 Score = 76.3 bits (186),  Expect(2) = 1e-66, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DG+FAELYVFKWTSLL  P
Sbjct  947  LKVLAGIDTNFTVTSKASDDDGEFAELYVFKWTSLLIPP  985



>ref|XP_006450469.1| hypothetical protein CICLE_v10007296mg [Citrus clementina]
 ref|XP_006483338.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
isoform X2 [Citrus sinensis]
 gb|ESR63709.1| hypothetical protein CICLE_v10007296mg [Citrus clementina]
 gb|KDO61692.1| hypothetical protein CISIN_1g001399mg [Citrus sinensis]
Length=1085

 Score =   202 bits (515),  Expect(2) = 2e-66, Method: Composition-based stats.
 Identities = 93/102 (91%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLIVNLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGLLGRQNRT
Sbjct  984   IPPTTVLIVNLVGIVAGVSWAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLLGRQNRT  1043

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVR+DPFTSD  KA + GQCGINC
Sbjct  1044  PTIVIVWSILLASIFSLLWVRVDPFTSDDTKANSNGQCGINC  1085


 Score = 77.8 bits (190),  Expect(2) = 2e-66, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DGDFAELYVFKWTSLL  P
Sbjct  948  LKVLAGIDTNFTVTSKASDDDGDFAELYVFKWTSLLIPP  986



>ref|XP_009597841.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Nicotiana tomentosiformis]
Length=1085

 Score =   205 bits (521),  Expect(2) = 2e-66, Method: Composition-based stats.
 Identities = 93/102 (91%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLI+N+VGIVAGVS+AINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT
Sbjct  984   IPPTTVLILNMVGIVAGVSYAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  1043

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWS+LLASIFSLLWVRIDPFTSD+ K AA GQCG+NC
Sbjct  1044  PTIVIVWSVLLASIFSLLWVRIDPFTSDATKTAARGQCGVNC  1085


 Score = 75.5 bits (184),  Expect(2) = 2e-66, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDG+F+ELYVFKWTSL+  P
Sbjct  948  LKVLAGIDTNFTVTSKASDEDGEFSELYVFKWTSLIIPP  986



>ref|XP_006483337.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
isoform X1 [Citrus sinensis]
Length=1102

 Score =   202 bits (513),  Expect(2) = 2e-66, Method: Composition-based stats.
 Identities = 93/102 (91%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLIVNLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGLLGRQNRT
Sbjct  1001  IPPTTVLIVNLVGIVAGVSWAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLLGRQNRT  1060

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVR+DPFTSD  KA + GQCGINC
Sbjct  1061  PTIVIVWSILLASIFSLLWVRVDPFTSDDTKANSNGQCGINC  1102


 Score = 77.8 bits (190),  Expect(2) = 2e-66, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713   LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
             LKVLAGIDTNFTVTSKASD+DGDFAELYVFKWTSLL  P
Sbjct  965   LKVLAGIDTNFTVTSKASDDDGDFAELYVFKWTSLLIPP  1003



>gb|KDO61693.1| hypothetical protein CISIN_1g001399mg [Citrus sinensis]
Length=1059

 Score =   202 bits (513),  Expect(2) = 2e-66, Method: Composition-based stats.
 Identities = 93/102 (91%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLIVNLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGLLGRQNRT
Sbjct  958   IPPTTVLIVNLVGIVAGVSWAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLLGRQNRT  1017

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVR+DPFTSD  KA + GQCGINC
Sbjct  1018  PTIVIVWSILLASIFSLLWVRVDPFTSDDTKANSNGQCGINC  1059


 Score = 77.8 bits (190),  Expect(2) = 2e-66, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DGDFAELYVFKWTSLL  P
Sbjct  922  LKVLAGIDTNFTVTSKASDDDGDFAELYVFKWTSLLIPP  960



>ref|XP_010250039.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Nelumbo nucifera]
Length=1085

 Score =   204 bits (518),  Expect(2) = 3e-66, Method: Composition-based stats.
 Identities = 93/102 (91%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLI+N VGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI+HLYPFLKGLLGRQNRT
Sbjct  984   IPPTTVLIINFVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVILHLYPFLKGLLGRQNRT  1043

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTSDS K A  GQCGINC
Sbjct  1044  PTIVIVWSILLASIFSLLWVRIDPFTSDSTKTATKGQCGINC  1085


 Score = 75.9 bits (185),  Expect(2) = 3e-66, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DG+FAELYVFKWTSLL  P
Sbjct  948  LKVLAGIDTNFTVTSKASDDDGEFAELYVFKWTSLLIPP  986



>gb|EYU32338.1| hypothetical protein MIMGU_mgv1a000544mg [Erythranthe guttata]
Length=1084

 Score =   201 bits (511),  Expect(2) = 3e-66, Method: Composition-based stats.
 Identities = 91/102 (89%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL +N+VGIVAGVS AINSGYQSWGPLFG+LFFAIWVIVHLYPFLKGLLGRQNRT
Sbjct  983   IPPTTVLFINMVGIVAGVSAAINSGYQSWGPLFGKLFFAIWVIVHLYPFLKGLLGRQNRT  1042

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWS+LLASIFSLLWVRIDPFTSD+ K AA GQCG+NC
Sbjct  1043  PTIVIVWSVLLASIFSLLWVRIDPFTSDATKKAAQGQCGVNC  1084


 Score = 78.6 bits (192),  Expect(2) = 3e-66, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSL+  P
Sbjct  947  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLIIPP  985



>gb|AAY78952.3| cellulose synthase CesA1 [Boehmeria nivea]
Length=938

 Score =   203 bits (517),  Expect(2) = 4e-66, Method: Composition-based stats.
 Identities = 93/102 (91%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604  IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
            IPPTTVLI+NLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGLLGRQNRT
Sbjct  837  IPPTTVLIINLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLLGRQNRT  896

Query  424  PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
            PTIVIVWSILLASIFSLLWVRIDPFTSD+ KAA+ GQCG+NC
Sbjct  897  PTIVIVWSILLASIFSLLWVRIDPFTSDATKAASRGQCGVNC  938


 Score = 76.3 bits (186),  Expect(2) = 4e-66, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DG+FAELYVFKWTSLL  P
Sbjct  801  LKVLAGIDTNFTVTSKASDDDGEFAELYVFKWTSLLIPP  839



>emb|CDP13491.1| unnamed protein product [Coffea canephora]
Length=1082

 Score =   201 bits (512),  Expect(2) = 4e-66, Method: Composition-based stats.
 Identities = 91/102 (89%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NL+GIVAGVS+AINSGYQSWGPLFG+LFF+IWVI HLYPFLKGLLGRQNRT
Sbjct  981   IPPTTVLVLNLIGIVAGVSYAINSGYQSWGPLFGKLFFSIWVIAHLYPFLKGLLGRQNRT  1040

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTS S KAA+ GQCGINC
Sbjct  1041  PTIVIVWSILLASIFSLLWVRIDPFTSSSTKAASNGQCGINC  1082


 Score = 77.8 bits (190),  Expect(2) = 4e-66, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DGDFAELYVFKWTSLL  P
Sbjct  945  LKVLAGIDTNFTVTSKASDDDGDFAELYVFKWTSLLIPP  983



>ref|XP_010914890.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Elaeis guineensis]
Length=1077

 Score =   203 bits (516),  Expect(2) = 4e-66, Method: Composition-based stats.
 Identities = 93/102 (91%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL+VNLVGIVAGVS+A+NSGYQSWGPLFG+LFFAIWVIVHLYPFLKGLLGR NRT
Sbjct  976   IPPTTVLVVNLVGIVAGVSYAVNSGYQSWGPLFGKLFFAIWVIVHLYPFLKGLLGRTNRT  1035

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTS + KAAA GQCGINC
Sbjct  1036  PTIVIVWSILLASIFSLLWVRIDPFTSPTQKAAAAGQCGINC  1077


 Score = 76.3 bits (186),  Expect(2) = 4e-66, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DG+FAELYVFKWTSLL  P
Sbjct  940  LKVLAGIDTNFTVTSKASDDDGEFAELYVFKWTSLLIPP  978



>gb|KGN60109.1| hypothetical protein Csa_3G878780 [Cucumis sativus]
Length=1062

 Score =   199 bits (506),  Expect(2) = 7e-66, Method: Composition-based stats.
 Identities = 93/102 (91%), Positives = 98/102 (96%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLI+N+VGIVAGVS+AINSGYQSWGPLFG+LFFA+WVIVHLYPFLKGLLGRQNRT
Sbjct  962   IPPTTVLIMNMVGIVAGVSYAINSGYQSWGPLFGKLFFALWVIVHLYPFLKGLLGRQNRT  1021

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTS S K AA GQCGINC
Sbjct  1022  PTIVIVWSILLASIFSLLWVRIDPFTSASTK-AANGQCGINC  1062


 Score = 79.3 bits (194),  Expect(2) = 7e-66, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  926  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  964



>ref|XP_004136343.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Cucumis sativus]
 ref|XP_004169170.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Cucumis sativus]
Length=1081

 Score =   198 bits (504),  Expect(2) = 1e-65, Method: Composition-based stats.
 Identities = 93/102 (91%), Positives = 98/102 (96%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLI+N+VGIVAGVS+AINSGYQSWGPLFG+LFFA+WVIVHLYPFLKGLLGRQNRT
Sbjct  981   IPPTTVLIMNMVGIVAGVSYAINSGYQSWGPLFGKLFFALWVIVHLYPFLKGLLGRQNRT  1040

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTS S K AA GQCGINC
Sbjct  1041  PTIVIVWSILLASIFSLLWVRIDPFTSASTK-AANGQCGINC  1081


 Score = 79.3 bits (194),  Expect(2) = 1e-65, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  945  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  983



>ref|XP_011026459.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Populus euphratica]
Length=1084

 Score =   198 bits (503),  Expect(2) = 1e-65, Method: Composition-based stats.
 Identities = 89/102 (87%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTV+++N++GIVAGVSFAINSGYQSWGPLFG+LFFAIWVI HLYPFLKGLLGRQNRT
Sbjct  983   IPPTTVILLNMMGIVAGVSFAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLLGRQNRT  1042

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTS + + AA GQCGINC
Sbjct  1043  PTIVIVWSILLASIFSLLWVRIDPFTSGTTQTAADGQCGINC  1084


 Score = 79.3 bits (194),  Expect(2) = 1e-65, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  947  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  985



>ref|XP_009768318.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Nicotiana sylvestris]
Length=1085

 Score =   197 bits (502),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVNLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVIVHLYPFLKGLLGRQNRT
Sbjct  984   IPPTTILIVNLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIVHLYPFLKGLLGRQNRT  1043

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVW++LLASIFSLLWVRIDPFTSD+AK AA GQCG+NC
Sbjct  1044  PTIVIVWAVLLASIFSLLWVRIDPFTSDAAKTAARGQCGVNC  1085


 Score = 79.3 bits (194),  Expect(2) = 2e-65, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  948  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  986



>gb|EPS68064.1| hypothetical protein M569_06709, partial [Genlisea aurea]
Length=1088

 Score =   201 bits (510),  Expect(2) = 2e-65, Method: Composition-based stats.
 Identities = 91/102 (89%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++N+VGIVAGVSFAINSGYQSWGPLFG+LFF+IWVIVHLYPFLKGLLGRQNRT
Sbjct  987   IPPTTVLMLNMVGIVAGVSFAINSGYQSWGPLFGKLFFSIWVIVHLYPFLKGLLGRQNRT  1046

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTS +AK+ A GQCGI+C
Sbjct  1047  PTIVIVWSILLASIFSLLWVRIDPFTSQTAKSTAQGQCGISC  1088


 Score = 75.9 bits (185),  Expect(2) = 2e-65, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DGDF ELYVFKWTSLL  P
Sbjct  951  LKVLAGIDTNFTVTSKASDDDGDFEELYVFKWTSLLIPP  989



>ref|XP_009623502.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Nicotiana tomentosiformis]
Length=1085

 Score =   197 bits (501),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVNLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVIVHLYPFLKGLLGRQNRT
Sbjct  984   IPPTTILIVNLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIVHLYPFLKGLLGRQNRT  1043

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVW++LLASIFSLLWVRIDPFTSD+AK AA GQCG+NC
Sbjct  1044  PTIVIVWAVLLASIFSLLWVRIDPFTSDAAKTAARGQCGVNC  1085


 Score = 79.3 bits (194),  Expect(2) = 2e-65, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  948  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  986



>gb|AFZ78558.1| cellulose synthase [Populus tomentosa]
Length=1084

 Score =   197 bits (501),  Expect(2) = 2e-65, Method: Composition-based stats.
 Identities = 88/102 (86%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTV+++N++GIVAGVSFAINSGYQSWGPLFG+LFFAIWVI HLYPFLKGLLGRQNRT
Sbjct  983   IPPTTVILLNMMGIVAGVSFAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLLGRQNRT  1042

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTS + +  A GQCGINC
Sbjct  1043  PTIVIVWSILLASIFSLLWVRIDPFTSSTTQTTANGQCGINC  1084


 Score = 79.3 bits (194),  Expect(2) = 2e-65, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  947  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  985



>ref|XP_003522623.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Glycine max]
Length=1084

 Score =   197 bits (501),  Expect(2) = 2e-65, Method: Composition-based stats.
 Identities = 93/102 (91%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLIVNLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGLLGRQNRT
Sbjct  984   IPPTTVLIVNLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLLGRQNRT  1043

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWS+LLASIFSLLWVRIDPFTSDS K    GQCGINC
Sbjct  1044  PTIVIVWSVLLASIFSLLWVRIDPFTSDSNK-LTNGQCGINC  1084


 Score = 79.3 bits (194),  Expect(2) = 2e-65, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  948  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  986



>gb|KHN08123.1| Cellulose synthase A catalytic subunit 1 [UDP-forming] [Glycine 
soja]
Length=1084

 Score =   197 bits (501),  Expect(2) = 2e-65, Method: Composition-based stats.
 Identities = 93/102 (91%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLIVNLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGLLGRQNRT
Sbjct  984   IPPTTVLIVNLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLLGRQNRT  1043

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWS+LLASIFSLLWVRIDPFTSDS K    GQCGINC
Sbjct  1044  PTIVIVWSVLLASIFSLLWVRIDPFTSDSNK-LTNGQCGINC  1084


 Score = 79.3 bits (194),  Expect(2) = 2e-65, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  948  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  986



>gb|KHN07088.1| Cellulose synthase A catalytic subunit 1 [UDP-forming] [Glycine 
soja]
Length=1084

 Score =   197 bits (501),  Expect(2) = 3e-65, Method: Composition-based stats.
 Identities = 93/102 (91%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLIVNLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGLLGRQNRT
Sbjct  984   IPPTTVLIVNLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLLGRQNRT  1043

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWS+LLASIFSLLWVRIDPFTSDS K    GQCGINC
Sbjct  1044  PTIVIVWSVLLASIFSLLWVRIDPFTSDSNK-LTNGQCGINC  1084


 Score = 79.3 bits (194),  Expect(2) = 3e-65, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  948  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  986



>ref|XP_003526416.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Glycine max]
Length=1084

 Score =   197 bits (501),  Expect(2) = 3e-65, Method: Composition-based stats.
 Identities = 93/102 (91%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLIVNLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGLLGRQNRT
Sbjct  984   IPPTTVLIVNLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLLGRQNRT  1043

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWS+LLASIFSLLWVRIDPFTSDS K    GQCGINC
Sbjct  1044  PTIVIVWSVLLASIFSLLWVRIDPFTSDSNK-LTNGQCGINC  1084


 Score = 79.3 bits (194),  Expect(2) = 3e-65, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  948  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  986



>ref|XP_008466397.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Cucumis melo]
Length=1081

 Score =   198 bits (504),  Expect(2) = 3e-65, Method: Composition-based stats.
 Identities = 93/102 (91%), Positives = 98/102 (96%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLI+N+VGIVAGVS+AINSGYQSWGPLFG+LFFA+WVIVHLYPFLKGLLGRQNRT
Sbjct  981   IPPTTVLIMNMVGIVAGVSYAINSGYQSWGPLFGKLFFALWVIVHLYPFLKGLLGRQNRT  1040

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTS S K AA GQCGINC
Sbjct  1041  PTIVIVWSILLASIFSLLWVRIDPFTSASTK-AANGQCGINC  1081


 Score = 77.8 bits (190),  Expect(2) = 3e-65, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DGDFAELYVFKWTSLL  P
Sbjct  945  LKVLAGIDTNFTVTSKASDDDGDFAELYVFKWTSLLIPP  983



>ref|XP_002324291.1| TGACG-motif binding family protein [Populus trichocarpa]
 gb|EEF02856.1| TGACG-motif binding family protein [Populus trichocarpa]
Length=1084

 Score =   197 bits (500),  Expect(2) = 3e-65, Method: Composition-based stats.
 Identities = 87/102 (85%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTV+++N++GIVAGVSFAINSGYQSWGPLFG+LFFAIWVI HLYPFLKGLLGRQNRT
Sbjct  983   IPPTTVILLNMMGIVAGVSFAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLLGRQNRT  1042

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTS + + A+ GQCG+NC
Sbjct  1043  PTIVIVWSILLASIFSLLWVRIDPFTSGTTQTASNGQCGVNC  1084


 Score = 79.3 bits (194),  Expect(2) = 3e-65, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  947  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  985



>gb|KDP33612.1| hypothetical protein JCGZ_07183 [Jatropha curcas]
Length=1084

 Score =   200 bits (509),  Expect(2) = 3e-65, Method: Composition-based stats.
 Identities = 94/102 (92%), Positives = 98/102 (96%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLIVNLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGLLGRQNRT
Sbjct  984   IPPTTVLIVNLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLLGRQNRT  1043

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTSDS  A++ GQCGINC
Sbjct  1044  PTIVIVWSILLASIFSLLWVRIDPFTSDST-ASSNGQCGINC  1084


 Score = 76.3 bits (186),  Expect(2) = 3e-65, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DG+FAELYVFKWTSLL  P
Sbjct  948  LKVLAGIDTNFTVTSKASDDDGEFAELYVFKWTSLLIPP  986



>ref|XP_008792060.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Phoenix dactylifera]
Length=1077

 Score =   197 bits (502),  Expect(2) = 5e-65, Method: Composition-based stats.
 Identities = 90/102 (88%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL+VNLVG+VAGVS+AINSGYQSWGPLFG+LFF+IWVIVHLYPFLKGLLGR NRT
Sbjct  976   IPPTTVLVVNLVGMVAGVSYAINSGYQSWGPLFGKLFFSIWVIVHLYPFLKGLLGRTNRT  1035

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTS + KAA  GQCG+NC
Sbjct  1036  PTIVIVWSILLASIFSLLWVRIDPFTSPTQKAATMGQCGVNC  1077


 Score = 77.8 bits (190),  Expect(2) = 5e-65, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DGDFAELYVFKWTSLL  P
Sbjct  940  LKVLAGIDTNFTVTSKASDDDGDFAELYVFKWTSLLIPP  978



>ref|XP_010925238.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Elaeis guineensis]
Length=1077

 Score =   199 bits (506),  Expect(2) = 6e-65, Method: Composition-based stats.
 Identities = 91/102 (89%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             +PPTTVL++NLVGIVAGVS+AINSGYQSWGPLFG+LFF+IWVIVHLYPFLKGLLGR NRT
Sbjct  976   VPPTTVLVMNLVGIVAGVSYAINSGYQSWGPLFGKLFFSIWVIVHLYPFLKGLLGRTNRT  1035

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTS + KAAA GQCGINC
Sbjct  1036  PTIVIVWSILLASIFSLLWVRIDPFTSPTQKAAAVGQCGINC  1077


 Score = 76.3 bits (186),  Expect(2) = 6e-65, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DG+FAELYVFKWTSLL  P
Sbjct  940  LKVLAGIDTNFTVTSKASDDDGEFAELYVFKWTSLLVPP  978



>ref|XP_008784981.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Phoenix dactylifera]
Length=1077

 Score =   197 bits (501),  Expect(2) = 7e-65, Method: Composition-based stats.
 Identities = 90/102 (88%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVG+VAGVS+AINSGYQSWGPLFG+LFF+IWVIVHLYPFLKGLLGR NRT
Sbjct  976   IPPTTVLVMNLVGMVAGVSYAINSGYQSWGPLFGKLFFSIWVIVHLYPFLKGLLGRTNRT  1035

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTS + KAA  GQCGINC
Sbjct  1036  PTIVIVWSILLASIFSLLWVRIDPFTSPTQKAATVGQCGINC  1077


 Score = 77.8 bits (190),  Expect(2) = 7e-65, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DGDFAELYVFKWTSLL  P
Sbjct  940  LKVLAGIDTNFTVTSKASDDDGDFAELYVFKWTSLLIPP  978



>ref|XP_010048223.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Eucalyptus grandis]
 gb|KCW80412.1| hypothetical protein EUGRSUZ_C01769 [Eucalyptus grandis]
Length=1082

 Score =   196 bits (497),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 94/102 (92%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLIVNLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGL+GRQNRT
Sbjct  981   IPPTTVLIVNLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLVGRQNRT  1040

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTSD+ KA+A GQCGINC
Sbjct  1041  PTIVIVWSILLASIFSLLWVRIDPFTSDATKASAKGQCGINC  1082


 Score = 79.3 bits (194),  Expect(2) = 8e-65, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  945  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  983



>ref|XP_007013842.1| Cellulose synthase 1 [Theobroma cacao]
 gb|EOY31461.1| Cellulose synthase 1 [Theobroma cacao]
Length=1085

 Score =   198 bits (503),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 95/102 (93%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLIVNLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGLLGRQNRT
Sbjct  984   IPPTTVLIVNLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLLGRQNRT  1043

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTSD+ K+AA GQCGINC
Sbjct  1044  PTIVIVWSILLASIFSLLWVRIDPFTSDATKSAANGQCGINC  1085


 Score = 77.0 bits (188),  Expect(2) = 9e-65, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DGDFAELYVFKWT+LL  P
Sbjct  948  LKVLAGIDTNFTVTSKASDDDGDFAELYVFKWTTLLIPP  986



>ref|XP_007137035.1| hypothetical protein PHAVU_009G094200g [Phaseolus vulgaris]
 gb|ESW09029.1| hypothetical protein PHAVU_009G094200g [Phaseolus vulgaris]
Length=1084

 Score =   196 bits (499),  Expect(2) = 1e-64, Method: Composition-based stats.
 Identities = 92/102 (90%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLIVNLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGLLGRQNRT
Sbjct  984   IPPTTVLIVNLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLLGRQNRT  1043

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWS+LLASIFSLLWVRIDPFTSDS +    GQCGINC
Sbjct  1044  PTIVIVWSVLLASIFSLLWVRIDPFTSDSNR-LTNGQCGINC  1084


 Score = 78.2 bits (191),  Expect(2) = 1e-64, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+DEDGDFAELYVFKWTSLL  P
Sbjct  948  LKVLAGIDTNFTVTSKATDEDGDFAELYVFKWTSLLIPP  986



>ref|XP_004501313.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Cicer arietinum]
Length=1082

 Score =   195 bits (496),  Expect(2) = 1e-64, Method: Composition-based stats.
 Identities = 90/102 (88%), Positives = 97/102 (95%), Gaps = 2/102 (2%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLIVNL+GIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGLLGRQNRT
Sbjct  983   IPPTTVLIVNLIGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLLGRQNRT  1042

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPF +D++K+   GQCGINC
Sbjct  1043  PTIVIVWSILLASIFSLLWVRIDPFITDTSKST--GQCGINC  1082


 Score = 79.3 bits (194),  Expect(2) = 1e-64, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  947  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  985



>ref|NP_001105574.1| cellulose synthase2 [Zea mays]
 gb|AAF89962.1|AF200526_1 cellulose synthase-2 [Zea mays]
 gb|AFW77326.1| cellulose synthase2 [Zea mays]
Length=1074

 Score =   195 bits (495),  Expect(2) = 1e-64, Method: Composition-based stats.
 Identities = 86/102 (84%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVG+VAG+S+AINSGYQSWGPLFG+LFF+IWVI+HLYPFLKGL+GRQNRT
Sbjct  973   IPPTTVLVINLVGMVAGISYAINSGYQSWGPLFGKLFFSIWVILHLYPFLKGLMGRQNRT  1032

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV+IDPF S + KAAA GQCG+NC
Sbjct  1033  PTIVIVWSILLASIFSLLWVKIDPFISPTQKAAALGQCGVNC  1074


 Score = 79.3 bits (194),  Expect(2) = 1e-64, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  937  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  975



>ref|XP_002440694.1| hypothetical protein SORBIDRAFT_09g005280 [Sorghum bicolor]
 gb|EES19124.1| hypothetical protein SORBIDRAFT_09g005280 [Sorghum bicolor]
Length=1073

 Score =   195 bits (495),  Expect(2) = 1e-64, Method: Composition-based stats.
 Identities = 86/102 (84%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVG+VAG+S+AINSGYQSWGPLFG+LFF+IWVI+HLYPFLKGL+GRQNRT
Sbjct  972   IPPTTVLVINLVGMVAGISYAINSGYQSWGPLFGKLFFSIWVILHLYPFLKGLMGRQNRT  1031

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV+IDPF S + KAAA GQCG+NC
Sbjct  1032  PTIVIVWSILLASIFSLLWVKIDPFISPTQKAAALGQCGVNC  1073


 Score = 79.3 bits (194),  Expect(2) = 1e-64, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  936  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  974



>gb|AFW81389.1| cellulose synthase1 [Zea mays]
Length=1071

 Score =   195 bits (495),  Expect(2) = 1e-64, Method: Composition-based stats.
 Identities = 86/102 (84%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVG+VAG+S+AINSGYQSWGPLFG+LFF+IWVI+HLYPFLKGL+GRQNRT
Sbjct  970   IPPTTVLVINLVGMVAGISYAINSGYQSWGPLFGKLFFSIWVILHLYPFLKGLMGRQNRT  1029

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV+IDPF S + KAAA GQCG+NC
Sbjct  1030  PTIVIVWSILLASIFSLLWVKIDPFISPTQKAAALGQCGVNC  1071


 Score = 79.3 bits (194),  Expect(2) = 1e-64, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  934  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  972



>gb|AFW81388.1| cellulose synthase1 [Zea mays]
Length=1075

 Score =   195 bits (495),  Expect(2) = 1e-64, Method: Composition-based stats.
 Identities = 86/102 (84%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVG+VAG+S+AINSGYQSWGPLFG+LFF+IWVI+HLYPFLKGL+GRQNRT
Sbjct  974   IPPTTVLVINLVGMVAGISYAINSGYQSWGPLFGKLFFSIWVILHLYPFLKGLMGRQNRT  1033

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV+IDPF S + KAAA GQCG+NC
Sbjct  1034  PTIVIVWSILLASIFSLLWVKIDPFISPTQKAAALGQCGVNC  1075


 Score = 79.3 bits (194),  Expect(2) = 1e-64, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  938  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  976



>ref|NP_001104954.1| cellulose synthase-1 [Zea mays]
 gb|AAF89961.1|AF200525_1 cellulose synthase-1 [Zea mays]
Length=1075

 Score =   195 bits (495),  Expect(2) = 2e-64, Method: Composition-based stats.
 Identities = 86/102 (84%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVG+VAG+S+AINSGYQSWGPLFG+LFF+IWVI+HLYPFLKGL+GRQNRT
Sbjct  974   IPPTTVLVINLVGMVAGISYAINSGYQSWGPLFGKLFFSIWVILHLYPFLKGLMGRQNRT  1033

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV+IDPF S + KAAA GQCG+NC
Sbjct  1034  PTIVIVWSILLASIFSLLWVKIDPFISPTQKAAALGQCGVNC  1075


 Score = 79.3 bits (194),  Expect(2) = 2e-64, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  938  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  976



>gb|AAR29967.1| putative cellulose synthase catalytic subunit [Hordeum vulgare]
Length=1074

 Score =   196 bits (498),  Expect(2) = 2e-64, Method: Composition-based stats.
 Identities = 85/102 (83%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVG+VAG+S+AINSGYQSWGPLFG+LFF+IWVI+HLYPFLKGL+G+QNRT
Sbjct  973   IPPTTVLVINLVGMVAGISYAINSGYQSWGPLFGKLFFSIWVILHLYPFLKGLMGKQNRT  1032

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV+IDPF SD+ KA A GQCG+NC
Sbjct  1033  PTIVIVWSILLASIFSLLWVKIDPFISDTQKAVAMGQCGVNC  1074


 Score = 78.2 bits (191),  Expect(2) = 2e-64, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+DEDGDFAELYVFKWTSLL  P
Sbjct  937  LKVLAGIDTNFTVTSKANDEDGDFAELYVFKWTSLLIPP  975



>ref|XP_010110357.1| Protein radially swollen 1 [Morus notabilis]
 gb|EXC26044.1| Protein radially swollen 1 [Morus notabilis]
Length=1080

 Score =   196 bits (498),  Expect(2) = 2e-64, Method: Composition-based stats.
 Identities = 91/102 (89%), Positives = 96/102 (94%), Gaps = 2/102 (2%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL+VNLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGLLGRQNRT
Sbjct  981   IPPTTVLLVNLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLLGRQNRT  1040

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWS LLASIFSLLWVRIDPFTSDS   A+ GQCG+NC
Sbjct  1041  PTIVIVWSTLLASIFSLLWVRIDPFTSDS--KASSGQCGVNC  1080


 Score = 77.8 bits (190),  Expect(2) = 2e-64, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DGDFAELYVFKWTSLL  P
Sbjct  945  LKVLAGIDTNFTVTSKASDDDGDFAELYVFKWTSLLIPP  983



>gb|EMT03676.1| Putative cellulose synthase A catalytic subunit 1 (UDP-forming) 
[Aegilops tauschii]
Length=1075

 Score =   195 bits (496),  Expect(2) = 2e-64, Method: Composition-based stats.
 Identities = 85/102 (83%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVG+VAG+S+AINSGYQSWGPLFG+LFF+IWVI+HLYPFLKGL+G+QNRT
Sbjct  974   IPPTTVLVINLVGMVAGISYAINSGYQSWGPLFGKLFFSIWVILHLYPFLKGLMGKQNRT  1033

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV+IDPF SD+ KA A GQCG+NC
Sbjct  1034  PTIVIVWSILLASIFSLLWVKIDPFISDTQKAVAMGQCGVNC  1075


 Score = 78.2 bits (191),  Expect(2) = 2e-64, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+DEDGDFAELYVFKWTSLL  P
Sbjct  938  LKVLAGIDTNFTVTSKANDEDGDFAELYVFKWTSLLIPP  976



>gb|ACQ99194.1| cellulose synthase [Phyllostachys edulis]
Length=1078

 Score =   195 bits (495),  Expect(2) = 2e-64, Method: Composition-based stats.
 Identities = 86/102 (84%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVG+VAG+S+AINSGYQSWGPLFG+LFF+IWVI+HLYPFLKGL+GRQNRT
Sbjct  977   IPPTTVLVINLVGMVAGISYAINSGYQSWGPLFGKLFFSIWVILHLYPFLKGLMGRQNRT  1036

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV+IDPF S + KAAA GQCG+NC
Sbjct  1037  PTIVIVWSILLASIFSLLWVKIDPFISPTQKAAALGQCGVNC  1078


 Score = 78.6 bits (192),  Expect(2) = 2e-64, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSL+  P
Sbjct  941  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLIIPP  979



>gb|KJB53892.1| hypothetical protein B456_009G010200 [Gossypium raimondii]
Length=1083

 Score =   195 bits (496),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLI+NLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGL+GRQNRT
Sbjct  982   IPPTTVLIINLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLVGRQNRT  1041

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTS++ KAAA GQCGINC
Sbjct  1042  PTIVIVWSILLASIFSLLWVRIDPFTSEATKAAANGQCGINC  1083


 Score = 77.8 bits (190),  Expect(2) = 3e-64, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DGDFAELYVFKWTSLL  P
Sbjct  946  LKVLAGIDTNFTVTSKASDDDGDFAELYVFKWTSLLIPP  984



>gb|KJB53893.1| hypothetical protein B456_009G010200 [Gossypium raimondii]
Length=683

 Score =   195 bits (495),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604  IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
            IPPTTVLI+NLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGL+GRQNRT
Sbjct  582  IPPTTVLIINLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLVGRQNRT  641

Query  424  PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
            PTIVIVWSILLASIFSLLWVRIDPFTS++ KAAA GQCGINC
Sbjct  642  PTIVIVWSILLASIFSLLWVRIDPFTSEATKAAANGQCGINC  683


 Score = 78.2 bits (191),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DGDFAELYVFKWTSLL  P
Sbjct  546  LKVLAGIDTNFTVTSKASDDDGDFAELYVFKWTSLLIPP  584



>gb|AFB18635.1| CESA6 [Gossypium hirsutum]
 gb|KJB53882.1| hypothetical protein B456_009G009500 [Gossypium raimondii]
Length=1083

 Score =   195 bits (496),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLI+NLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGL+GRQNRT
Sbjct  982   IPPTTVLIINLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLVGRQNRT  1041

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTS++ KAAA GQCGINC
Sbjct  1042  PTIVIVWSILLASIFSLLWVRIDPFTSEATKAAANGQCGINC  1083


 Score = 77.8 bits (190),  Expect(2) = 3e-64, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DGDFAELYVFKWTSLL  P
Sbjct  946  LKVLAGIDTNFTVTSKASDDDGDFAELYVFKWTSLLIPP  984



>gb|AAY43217.1| cellulose synthase BoCesA1 [Bambusa oldhamii]
Length=1078

 Score =   194 bits (492),  Expect(2) = 3e-64, Method: Composition-based stats.
 Identities = 85/102 (83%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVG+VAG+S+AINSGYQSWGPLFG+LFF+IWVI+HLYPFLKGL+GRQNRT
Sbjct  977   IPPTTVLVINLVGMVAGISYAINSGYQSWGPLFGKLFFSIWVILHLYPFLKGLMGRQNRT  1036

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV+IDPF S + KA A GQCG+NC
Sbjct  1037  PTIVIVWSILLASIFSLLWVKIDPFISPTQKAVALGQCGVNC  1078


 Score = 79.3 bits (194),  Expect(2) = 3e-64, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  941  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  979



>ref|XP_006654097.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming]-like [Oryza brachyantha]
Length=1076

 Score =   193 bits (491),  Expect(2) = 3e-64, Method: Composition-based stats.
 Identities = 85/102 (83%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVG+VAG+S+AINSGYQSWGPLFG+LFF+IWVI+HLYPFLKGL+GRQNRT
Sbjct  975   IPPTTVLVINLVGMVAGISYAINSGYQSWGPLFGKLFFSIWVILHLYPFLKGLMGRQNRT  1034

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV+IDPF S + KA A GQCG+NC
Sbjct  1035  PTIVIVWSILLASIFSLLWVKIDPFISPTQKAVALGQCGVNC  1076


 Score = 79.3 bits (194),  Expect(2) = 3e-64, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  939  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  977



>gb|ACS88359.1| cellulose synthase catalytic subunit [Gossypium hirsutum]
Length=657

 Score =   194 bits (494),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604  IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
            IPPTTVLI+NLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGL+GRQNRT
Sbjct  556  IPPTTVLIINLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLVGRQNRT  615

Query  424  PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
            PTIVIVWSILLASIFSLLWVRIDPFTS++ KAAA GQCGINC
Sbjct  616  PTIVIVWSILLASIFSLLWVRIDPFTSEATKAAANGQCGINC  657


 Score = 78.2 bits (191),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DGDFAELYVFKWTSLL  P
Sbjct  520  LKVLAGIDTNFTVTSKASDDDGDFAELYVFKWTSLLIPP  558



>gb|EMT20923.1| Putative cellulose synthase A catalytic subunit 1 (UDP-forming) 
[Aegilops tauschii]
Length=1074

 Score =   195 bits (495),  Expect(2) = 4e-64, Method: Composition-based stats.
 Identities = 85/102 (83%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVG+VAG+S+AINSGYQSWGPLFG+LFF+IWVI+HLYPFLKGL+G+QNRT
Sbjct  973   IPPTTVLVINLVGMVAGISYAINSGYQSWGPLFGKLFFSIWVILHLYPFLKGLMGKQNRT  1032

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV+IDPF SD+ KA A GQCG+NC
Sbjct  1033  PTIVIVWSILLASIFSLLWVKIDPFISDTQKAVAMGQCGVNC  1074


 Score = 78.2 bits (191),  Expect(2) = 4e-64, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+DEDGDFAELYVFKWTSLL  P
Sbjct  937  LKVLAGIDTNFTVTSKANDEDGDFAELYVFKWTSLLIPP  975



>ref|XP_003568832.2| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Brachypodium distachyon]
Length=1078

 Score =   194 bits (494),  Expect(2) = 4e-64, Method: Composition-based stats.
 Identities = 84/102 (82%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVG+VAG+S+AINSGYQSWGPLFG+LFF++WVI+HLYPFLKGL+G+QNRT
Sbjct  977   IPPTTVLVINLVGMVAGISYAINSGYQSWGPLFGKLFFSVWVILHLYPFLKGLMGKQNRT  1036

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV+IDPF SD+ KA A GQCG+NC
Sbjct  1037  PTIVIVWSILLASIFSLLWVKIDPFISDTQKAVALGQCGVNC  1078


 Score = 78.2 bits (191),  Expect(2) = 4e-64, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+DEDGDFAELYVFKWTSLL  P
Sbjct  941  LKVLAGIDTNFTVTSKANDEDGDFAELYVFKWTSLLIPP  979



>gb|AAY43216.1| cellulose synthase BoCesA8 [Bambusa oldhamii]
Length=1078

 Score =   193 bits (491),  Expect(2) = 4e-64, Method: Composition-based stats.
 Identities = 85/102 (83%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVG+VAG+S+AINSGYQSWGPLFG+LFF+IWVI+HLYPFLKGL+GRQNRT
Sbjct  977   IPPTTVLVINLVGMVAGISYAINSGYQSWGPLFGKLFFSIWVILHLYPFLKGLMGRQNRT  1036

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV+IDPF S + KA A GQCG+NC
Sbjct  1037  PTIVIVWSILLASIFSLLWVKIDPFISPTQKAVALGQCGVNC  1078


 Score = 79.3 bits (194),  Expect(2) = 4e-64, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  941  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  979



>ref|XP_004965873.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming]-like [Setaria italica]
Length=1077

 Score =   194 bits (492),  Expect(2) = 4e-64, Method: Composition-based stats.
 Identities = 85/102 (83%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVG+VAG+S+AINSGYQSWGPLFG+LFF+IWVI+HLYPFLKGL+GRQNRT
Sbjct  976   IPPTTVLVINLVGMVAGISYAINSGYQSWGPLFGKLFFSIWVILHLYPFLKGLMGRQNRT  1035

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV+IDPF S + KA A GQCG+NC
Sbjct  1036  PTIVIVWSILLASIFSLLWVKIDPFISPTQKAVALGQCGVNC  1077


 Score = 79.0 bits (193),  Expect(2) = 4e-64, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  940  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  978



>ref|XP_004960821.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming]-like isoform X2 [Setaria italica]
Length=1077

 Score =   194 bits (492),  Expect(2) = 4e-64, Method: Composition-based stats.
 Identities = 85/102 (83%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVG+VAG+S+AINSGYQSWGPLFG+LFF+IWVI+HLYPFLKGL+GRQNRT
Sbjct  976   IPPTTVLVINLVGMVAGISYAINSGYQSWGPLFGKLFFSIWVILHLYPFLKGLMGRQNRT  1035

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV+IDPF S + KA A GQCG+NC
Sbjct  1036  PTIVIVWSILLASIFSLLWVKIDPFISPTQKAVALGQCGVNC  1077


 Score = 79.0 bits (193),  Expect(2) = 4e-64, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  940  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  978



>ref|NP_001054788.1| Os05g0176100 [Oryza sativa Japonica Group]
 sp|Q6AT26.1|CESA1_ORYSJ RecName: Full=Probable cellulose synthase A catalytic subunit 
1 [UDP-forming]; AltName: Full=OsCesA1 [Oryza sativa Japonica 
Group]
 sp|A2Y0X2.1|CESA1_ORYSI RecName: Full=Probable cellulose synthase A catalytic subunit 
1 [UDP-forming]; AltName: Full=OsCesA1 [Oryza sativa Indica 
Group]
 gb|AAT77342.1| putative cellulose synthase [Oryza sativa Japonica Group]
 gb|AAU44296.1| putative cellulose synthase [Oryza sativa Japonica Group]
 dbj|BAF16702.1| Os05g0176100 [Oryza sativa Japonica Group]
 gb|EAY96732.1| hypothetical protein OsI_18650 [Oryza sativa Indica Group]
 dbj|BAG90687.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93842.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94005.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95409.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62512.1| hypothetical protein OsJ_17310 [Oryza sativa Japonica Group]
Length=1076

 Score =   193 bits (491),  Expect(2) = 4e-64, Method: Composition-based stats.
 Identities = 85/102 (83%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVG+VAG+S+AINSGYQSWGPLFG+LFF+IWVI+HLYPFLKGL+GRQNRT
Sbjct  975   IPPTTVLVINLVGMVAGISYAINSGYQSWGPLFGKLFFSIWVILHLYPFLKGLMGRQNRT  1034

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV+IDPF S + KA A GQCG+NC
Sbjct  1035  PTIVIVWSILLASIFSLLWVKIDPFISPTQKAVALGQCGVNC  1076


 Score = 79.3 bits (194),  Expect(2) = 4e-64, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  939  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  977



>ref|XP_004960820.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming]-like isoform X1 [Setaria italica]
Length=1106

 Score =   193 bits (491),  Expect(2) = 4e-64, Method: Composition-based stats.
 Identities = 85/102 (83%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVG+VAG+S+AINSGYQSWGPLFG+LFF+IWVI+HLYPFLKGL+GRQNRT
Sbjct  1005  IPPTTVLVINLVGMVAGISYAINSGYQSWGPLFGKLFFSIWVILHLYPFLKGLMGRQNRT  1064

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV+IDPF S + KA A GQCG+NC
Sbjct  1065  PTIVIVWSILLASIFSLLWVKIDPFISPTQKAVALGQCGVNC  1106


 Score = 79.3 bits (194),  Expect(2) = 4e-64, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713   LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
             LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  969   LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  1007



>ref|XP_008392524.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic 
subunit 1 [UDP-forming]-like, partial [Malus domestica]
Length=720

 Score =   194 bits (493),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604  IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
            IPPTTVL+VN+VGIVAGVS+AINSGYQSWGPLFG+LFFA+WV+ HLYPFLKGLLGRQNRT
Sbjct  619  IPPTTVLLVNIVGIVAGVSYAINSGYQSWGPLFGKLFFALWVVAHLYPFLKGLLGRQNRT  678

Query  424  PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
            PTIVIVWSILLASIFSLLWVRIDPFTSD  KAA  GQCGINC
Sbjct  679  PTIVIVWSILLASIFSLLWVRIDPFTSDKTKAATNGQCGINC  720


 Score = 78.2 bits (191),  Expect(2) = 5e-64, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSK+SDEDGDFAELYVFKWTSLL  P
Sbjct  583  LKVLAGIDTNFTVTSKSSDEDGDFAELYVFKWTSLLIPP  621



>ref|XP_009785781.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Nicotiana sylvestris]
Length=1085

 Score =   195 bits (496),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLI+N+VGIVAGVS+AINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT
Sbjct  984   IPPTTVLILNMVGIVAGVSYAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  1043

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWS+LLASIFSLLWVRIDPFTSD+ + AA GQCG+NC
Sbjct  1044  PTIVIVWSVLLASIFSLLWVRIDPFTSDATQNAAKGQCGVNC  1085


 Score = 76.6 bits (187),  Expect(2) = 6e-64, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDG+FAELYVFKWTSL+  P
Sbjct  948  LKVLAGIDTNFTVTSKASDEDGEFAELYVFKWTSLIIPP  986



>ref|XP_004245031.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Solanum lycopersicum]
Length=1086

 Score =   195 bits (495),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPT +LIVNLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVIVHLYPFLKGLLGRQNRT
Sbjct  985   IPPTAILIVNLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIVHLYPFLKGLLGRQNRT  1044

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVW++LLASIFSLLWVRIDPFTSD++K AA GQCGINC
Sbjct  1045  PTIVIVWAVLLASIFSLLWVRIDPFTSDASKTAARGQCGINC  1086


 Score = 76.6 bits (187),  Expect(2) = 8e-64, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+DEDGDFAELYVFKWT+LL  P
Sbjct  949  LKVLAGIDTNFTVTSKANDEDGDFAELYVFKWTTLLIPP  987



>gb|KHG11461.1| Cellulose synthase A catalytic subunit 1 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=1083

 Score =   195 bits (496),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLI+NLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGL+GRQNRT
Sbjct  982   IPPTTVLIINLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLVGRQNRT  1041

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTS++ KAAA GQCGINC
Sbjct  1042  PTIVIVWSILLASIFSLLWVRIDPFTSEATKAAANGQCGINC  1083


 Score = 75.9 bits (185),  Expect(2) = 1e-63, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DG+FAELYVFKWTSLL  P
Sbjct  946  LKVLAGIDTNFTVTSKASDDDGEFAELYVFKWTSLLIPP  984



>gb|KHG16324.1| putative cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Gossypium arboreum]
Length=855

 Score =   195 bits (496),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604  IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
            IPPTTVLI+NLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGL+GRQNRT
Sbjct  754  IPPTTVLIINLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLVGRQNRT  813

Query  424  PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
            PTIVIVWSILLASIFSLLWVRIDPFTS++ KAAA GQCGINC
Sbjct  814  PTIVIVWSILLASIFSLLWVRIDPFTSEATKAAANGQCGINC  855


 Score = 76.3 bits (186),  Expect(2) = 1e-63, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DG+FAELYVFKWTSLL  P
Sbjct  718  LKVLAGIDTNFTVTSKASDDDGEFAELYVFKWTSLLIPP  756



>gb|AGT16647.1| cellulose synthase [Saccharum hybrid cultivar R570]
Length=1073

 Score =   194 bits (493),  Expect(2) = 1e-63, Method: Composition-based stats.
 Identities = 86/102 (84%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI+HLYPFLKGL+G+QNRT
Sbjct  972   IPPTTVLVINLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVILHLYPFLKGLMGKQNRT  1031

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV+IDPF S + KA + GQCG+NC
Sbjct  1032  PTIVIVWSILLASIFSLLWVKIDPFISPTQKAISRGQCGVNC  1073


 Score = 77.0 bits (188),  Expect(2) = 1e-63, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+D+DGDFAELYVFKWTSLL  P
Sbjct  936  LKVLAGIDTNFTVTSKATDDDGDFAELYVFKWTSLLIPP  974



>ref|XP_009399755.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Musa acuminata subsp. malaccensis]
Length=1077

 Score =   196 bits (497),  Expect(2) = 1e-63, Method: Composition-based stats.
 Identities = 87/102 (85%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++N+VGIVAGVS+A+NSGYQSWGPLFGRLFFA WVI HLYPFLKGL+GRQNRT
Sbjct  976   IPPTTVLVINMVGIVAGVSYAVNSGYQSWGPLFGRLFFAFWVIAHLYPFLKGLMGRQNRT  1035

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV IDPFTS + KAA  GQCG+NC
Sbjct  1036  PTIVIVWSILLASIFSLLWVHIDPFTSPTQKAATMGQCGVNC  1077


 Score = 75.5 bits (184),  Expect(2) = 1e-63, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDT+FTVTSKASDEDGDF+ELY+FKWTSLL  P
Sbjct  940  LKVLAGIDTSFTVTSKASDEDGDFSELYIFKWTSLLIPP  978



>ref|XP_003603419.1| Cellulose synthase [Medicago truncatula]
 gb|AES73670.1| cellulose synthase-like protein [Medicago truncatula]
Length=1087

 Score =   193 bits (490),  Expect(2) = 1e-63, Method: Composition-based stats.
 Identities = 87/102 (85%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLIVNL+GIVAGVSFAINSGYQSWGPLFG+LFFAIWVI HLYPFLKGLLG+ NRT
Sbjct  986   IPPTTVLIVNLIGIVAGVSFAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLLGKSNRT  1045

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVW++LLASIFSLLWVRIDPF SD  K+++  QCGINC
Sbjct  1046  PTIVIVWAVLLASIFSLLWVRIDPFISDPNKSSSNSQCGINC  1087


 Score = 78.2 bits (191),  Expect(2) = 1e-63, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+DEDGDFAELYVFKWTSLL  P
Sbjct  950  LKVLAGIDTNFTVTSKANDEDGDFAELYVFKWTSLLIPP  988



>ref|XP_009389939.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Musa acuminata subsp. malaccensis]
Length=1078

 Score =   196 bits (498),  Expect(2) = 1e-63, Method: Composition-based stats.
 Identities = 87/102 (85%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             +PPTTVL++N+VGIVAGVS+AINSGYQSWGPLFGRLFFA WVI HLYPFLKGL+GRQNRT
Sbjct  977   VPPTTVLVINMVGIVAGVSYAINSGYQSWGPLFGRLFFAFWVIAHLYPFLKGLMGRQNRT  1036

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV IDPFTS + KAA  GQCG+NC
Sbjct  1037  PTIVIVWSILLASIFSLLWVHIDPFTSSTQKAAVMGQCGVNC  1078


 Score = 74.7 bits (182),  Expect(2) = 1e-63, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDT+FTVTSK+SD+DGDFAELYVFKWTSLL  P
Sbjct  941  LKVLAGIDTSFTVTSKSSDDDGDFAELYVFKWTSLLVPP  979



>ref|XP_006361724.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Solanum tuberosum]
Length=1086

 Score =   194 bits (492),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPT +LI+NLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVIVHLYPFLKGLLGRQNRT
Sbjct  985   IPPTAILIMNLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIVHLYPFLKGLLGRQNRT  1044

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVW++LLASIFSLLWVRIDPFTSD++K AA GQCGINC
Sbjct  1045  PTIVIVWAVLLASIFSLLWVRIDPFTSDASKTAARGQCGINC  1086


 Score = 77.0 bits (188),  Expect(2) = 2e-63, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+DEDGDFAELYVFKWT+LL  P
Sbjct  949  LKVLAGIDTNFTVTSKANDEDGDFAELYVFKWTTLLIPP  987



>ref|XP_006842872.1| hypothetical protein AMTR_s00081p00171100 [Amborella trichopoda]
 gb|ERN04547.1| hypothetical protein AMTR_s00081p00171100 [Amborella trichopoda]
Length=1083

 Score =   192 bits (488),  Expect(2) = 2e-63, Method: Composition-based stats.
 Identities = 89/102 (87%), Positives = 97/102 (95%), Gaps = 2/102 (2%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++N+VGIVAGVS+AINSGYQSWGPLFG+LFFA+WVIVHLYPFLKGLLGRQNRT
Sbjct  984   IPPTTVLLINMVGIVAGVSYAINSGYQSWGPLFGKLFFALWVIVHLYPFLKGLLGRQNRT  1043

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTS ++ A   GQCGINC
Sbjct  1044  PTIVIVWSILLASIFSLLWVRIDPFTSRTSTAQ--GQCGINC  1083


 Score = 78.2 bits (191),  Expect(2) = 2e-63, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWT+LL  P
Sbjct  948  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTALLIPP  986



>dbj|BAJ88271.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1060

 Score =   192 bits (488),  Expect(2) = 2e-63, Method: Composition-based stats.
 Identities = 83/102 (81%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVG+VAG+S+AINSGY+SWGPLFG+LFF+IWVI+HLYPFLKG +G+QNRT
Sbjct  959   IPPTTVLVINLVGMVAGISYAINSGYRSWGPLFGKLFFSIWVILHLYPFLKGFMGKQNRT  1018

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV+IDPF SD+ KA A GQCG+NC
Sbjct  1019  PTIVIVWSILLASIFSLLWVKIDPFISDTQKAVAMGQCGVNC  1060


 Score = 78.2 bits (191),  Expect(2) = 2e-63, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+DEDGDFAELYVFKWTSLL  P
Sbjct  923  LKVLAGIDTNFTVTSKANDEDGDFAELYVFKWTSLLIPP  961



>gb|KHG24504.1| putative cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Gossypium arboreum]
Length=603

 Score =   193 bits (491),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604  IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
            IPPTTVLI+NLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGL+GRQNRT
Sbjct  502  IPPTTVLIINLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLVGRQNRT  561

Query  424  PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
            PTIVIVWSILLASIFSLLWVRIDPFTS++ KAAA GQCGINC
Sbjct  562  PTIVIVWSILLASIFSLLWVRIDPFTSEATKAAANGQCGINC  603


 Score = 76.6 bits (187),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DG+FAELYVFKWTSLL  P
Sbjct  466  LKVLAGIDTNFTVTSKASDDDGEFAELYVFKWTSLLIPP  504



>ref|XP_010648652.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Vitis vinifera]
Length=1084

 Score =   192 bits (488),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 95/102 (93%), Positives = 99/102 (97%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL+VNLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVIVHLYPFLKGLLGRQNRT
Sbjct  984   IPPTTVLVVNLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIVHLYPFLKGLLGRQNRT  1043

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTS S KAA+ GQCGINC
Sbjct  1044  PTIVIVWSILLASIFSLLWVRIDPFTSSSTKAAS-GQCGINC  1084


 Score = 77.8 bits (190),  Expect(2) = 3e-63, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DGDFAELYVFKWTSLL  P
Sbjct  948  LKVLAGIDTNFTVTSKASDDDGDFAELYVFKWTSLLIPP  986



>ref|XP_010525969.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010525970.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
isoform X2 [Tarenaya hassleriana]
Length=1085

 Score =   190 bits (483),  Expect(2) = 3e-63, Method: Composition-based stats.
 Identities = 85/102 (83%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             +PPTTVLIVNLVGIV GVS+AINSGYQSWGPLFG+LFFA+WVI HLYPFLKGLLGRQNRT
Sbjct  984   VPPTTVLIVNLVGIVTGVSYAINSGYQSWGPLFGKLFFALWVIAHLYPFLKGLLGRQNRT  1043

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRI+PF S ++     GQCG+NC
Sbjct  1044  PTIVIVWSILLASIFSLLWVRINPFVSTTSSTNVNGQCGVNC  1085


 Score = 79.3 bits (194),  Expect(2) = 3e-63, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  948  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLVPP  986



>emb|CAN60659.1| hypothetical protein VITISV_018069 [Vitis vinifera]
Length=1097

 Score =   192 bits (487),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 95/102 (93%), Positives = 99/102 (97%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL+VNLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVIVHLYPFLKGLLGRQNRT
Sbjct  997   IPPTTVLVVNLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIVHLYPFLKGLLGRQNRT  1056

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTS S KAA+ GQCGINC
Sbjct  1057  PTIVIVWSILLASIFSLLWVRIDPFTSSSTKAAS-GQCGINC  1097


 Score = 77.8 bits (190),  Expect(2) = 3e-63, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASD+DGDFAELYVFKWTSLL  P
Sbjct  961  LKVLAGIDTNFTVTSKASDDDGDFAELYVFKWTSLLIPP  999



>ref|XP_008673642.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Zea mays]
 tpg|DAA53226.1| TPA: cellulose synthase3 [Zea mays]
Length=1074

 Score =   193 bits (491),  Expect(2) = 4e-63, Method: Composition-based stats.
 Identities = 85/102 (83%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI+HLYPFLKGL+G+QNRT
Sbjct  973   IPPTTVLVINLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVILHLYPFLKGLMGKQNRT  1032

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWS+LLASIFSLLWV+IDPF S + KA + GQCG+NC
Sbjct  1033  PTIVIVWSVLLASIFSLLWVKIDPFISPTQKALSRGQCGVNC  1074


 Score = 75.9 bits (185),  Expect(2) = 4e-63, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+D+DGDFAELYVFKWT+LL  P
Sbjct  937  LKVLAGIDTNFTVTSKATDDDGDFAELYVFKWTTLLIPP  975



>tpg|DAA53225.1| TPA: cellulose synthase3 [Zea mays]
Length=1073

 Score =   193 bits (491),  Expect(2) = 4e-63, Method: Composition-based stats.
 Identities = 85/102 (83%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI+HLYPFLKGL+G+QNRT
Sbjct  972   IPPTTVLVINLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVILHLYPFLKGLMGKQNRT  1031

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWS+LLASIFSLLWV+IDPF S + KA + GQCG+NC
Sbjct  1032  PTIVIVWSVLLASIFSLLWVKIDPFISPTQKALSRGQCGVNC  1073


 Score = 75.9 bits (185),  Expect(2) = 4e-63, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+D+DGDFAELYVFKWT+LL  P
Sbjct  936  LKVLAGIDTNFTVTSKATDDDGDFAELYVFKWTTLLIPP  974



>ref|XP_010689561.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] 
[Beta vulgaris subsp. vulgaris]
Length=1086

 Score =   191 bits (486),  Expect(2) = 4e-63, Method: Composition-based stats.
 Identities = 87/102 (85%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLIVNLVG+VAGVS+AINSGYQSWGPLFG+LFF+ WVI HLYPFLKGLLGRQNRT
Sbjct  985   IPPTTVLIVNLVGVVAGVSYAINSGYQSWGPLFGKLFFSFWVIAHLYPFLKGLLGRQNRT  1044

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWS+LLASIFSLLWVRI+PFTSD+ K AA   CG NC
Sbjct  1045  PTIVIVWSVLLASIFSLLWVRINPFTSDADKIAANNLCGANC  1086


 Score = 77.8 bits (190),  Expect(2) = 4e-63, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+DEDGDFAELY+FKWTSLL  P
Sbjct  949  LKVLAGIDTNFTVTSKAADEDGDFAELYIFKWTSLLIPP  987



>ref|XP_010670651.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Beta vulgaris subsp. vulgaris]
Length=1086

 Score =   191 bits (486),  Expect(2) = 5e-63, Method: Composition-based stats.
 Identities = 87/102 (85%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLIVNLVG+VAGVS+AINSGYQSWGPLFG+LFF+ WVI HLYPFLKGLLGRQNRT
Sbjct  985   IPPTTVLIVNLVGVVAGVSYAINSGYQSWGPLFGKLFFSFWVIAHLYPFLKGLLGRQNRT  1044

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWS+LLASIFSLLWVRI+PFTSD+ K AA   CG NC
Sbjct  1045  PTIVIVWSVLLASIFSLLWVRINPFTSDADKIAANNLCGANC  1086


 Score = 77.4 bits (189),  Expect(2) = 5e-63, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+DEDGDFAELY+FKWTSLL  P
Sbjct  949  LKVLAGIDTNFTVTSKANDEDGDFAELYIFKWTSLLIPP  987



>gb|AEK31219.1| cellulose synthase A [Eucalyptus camaldulensis]
Length=1085

 Score =   191 bits (484),  Expect(2) = 8e-63, Method: Composition-based stats.
 Identities = 90/102 (88%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLIVN++GIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGLLGRQNRT
Sbjct  984   IPPTTVLIVNIIGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLLGRQNRT  1043

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTS +  + A GQCGINC
Sbjct  1044  PTIVIVWSILLASIFSLLWVRIDPFTSATTTSTANGQCGINC  1085


 Score = 77.8 bits (190),  Expect(2) = 8e-63, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA DEDGDFAELYVFKWTSLL  P
Sbjct  948  LKVLAGIDTNFTVTSKAGDEDGDFAELYVFKWTSLLIPP  986



>gb|KCW81421.1| hypothetical protein EUGRSUZ_C02801 [Eucalyptus grandis]
Length=1085

 Score =   189 bits (479),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLIVN++GIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGLLGRQNRT
Sbjct  984   IPPTTVLIVNIIGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLLGRQNRT  1043

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFTS +  + A GQCGINC
Sbjct  1044  PTIVIVWSILLASIFSLLWVRIDPFTSATTASTANGQCGINC  1085


 Score = 77.8 bits (190),  Expect(2) = 3e-62, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA DEDGDFAELYVFKWTSLL  P
Sbjct  948  LKVLAGIDTNFTVTSKAGDEDGDFAELYVFKWTSLLIPP  986



>gb|AAP97497.1| cellulose synthase [Solanum tuberosum]
Length=771

 Score =   193 bits (491),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604  IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
            IPPT +LI+NLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVIVHLYPFLKGLLGRQNRT
Sbjct  670  IPPTAILIMNLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIVHLYPFLKGLLGRQNRT  729

Query  424  PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
            PTIVIVW++LLASIFSLLWVRIDPFTSD++K AA GQCGINC
Sbjct  730  PTIVIVWAVLLASIFSLLWVRIDPFTSDASKTAARGQCGINC  771


 Score = 72.8 bits (177),  Expect(2) = 3e-62, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDT FTVTSKA+DEDGDF ELYVFKWT+LL  P
Sbjct  634  LKVLAGIDTTFTVTSKANDEDGDFVELYVFKWTTLLIPP  672



>dbj|BAJ98234.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=681

 Score =   186 bits (473),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -3

Query  604  IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
            IPPTTVL++NLVG+VAG+S+AINSGYQSWGPLFG+LFF+IWVI+HLYPFLKGL+G+QNRT
Sbjct  580  IPPTTVLVINLVGMVAGISYAINSGYQSWGPLFGKLFFSIWVILHLYPFLKGLMGKQNRT  639

Query  424  PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
            PTIVIVWSILLASIFSLLWV+IDPF SD+ KA A GQCG+NC
Sbjct  640  PTIVIVWSILLASIFSLLWVKIDPFISDTQKAVAMGQCGVNC  681


 Score = 78.6 bits (192),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+DEDGDFAELYVFKWTSLL  P
Sbjct  544  LKVLAGIDTNFTVTSKANDEDGDFAELYVFKWTSLLIPP  582



>dbj|BAJ85785.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=566

 Score =   186 bits (472),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -3

Query  604  IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
            IPPTTVL++NLVG+VAG+S+AINSGYQSWGPLFG+LFF+IWVI+HLYPFLKGL+G+QNRT
Sbjct  465  IPPTTVLVINLVGMVAGISYAINSGYQSWGPLFGKLFFSIWVILHLYPFLKGLMGKQNRT  524

Query  424  PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
            PTIVIVWSILLASIFSLLWV+IDPF SD+ KA A GQCG+NC
Sbjct  525  PTIVIVWSILLASIFSLLWVKIDPFISDTQKAVAMGQCGVNC  566


 Score = 79.0 bits (193),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+DEDGDFAELYVFKWTSLL  P
Sbjct  429  LKVLAGIDTNFTVTSKANDEDGDFAELYVFKWTSLLIPP  467



>gb|AHL45023.1| cellulose synthase 1A [Linum usitatissimum]
Length=1079

 Score =   186 bits (471),  Expect(2) = 2e-61, Method: Composition-based stats.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLIVNLVGIVAGVS+AINSGYQSWGPLFG+LFFA+WV+ HLYPFLKGLLGRQNRT
Sbjct  983   IPPTTVLIVNLVGIVAGVSYAINSGYQSWGPLFGKLFFALWVVAHLYPFLKGLLGRQNRT  1042

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQ  314
             PTIVIVWSILLASIFSLLWVRIDPFT++S K  + GQ
Sbjct  1043  PTIVIVWSILLASIFSLLWVRIDPFTTNSTKTVSNGQ  1079


 Score = 78.2 bits (191),  Expect(2) = 2e-61, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWTSLL  P
Sbjct  947  LKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTSLLIPP  985



>gb|AHL45024.1| cellulose synthase 1B [Linum usitatissimum]
Length=1079

 Score =   186 bits (471),  Expect(2) = 2e-61, Method: Composition-based stats.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLIVNLVGIVAGVS+AINSGYQSWGPLFG+LFFA+WV+ HLYPFLKGLLGRQNRT
Sbjct  983   IPPTTVLIVNLVGIVAGVSYAINSGYQSWGPLFGKLFFALWVVAHLYPFLKGLLGRQNRT  1042

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQ  314
             PTIVIVWSILLASIFSLLWVRIDPFT++S K  + GQ
Sbjct  1043  PTIVIVWSILLASIFSLLWVRIDPFTTNSTKTVSNGQ  1079


 Score = 78.2 bits (191),  Expect(2) = 2e-61, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWTSLL  P
Sbjct  947  LKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTSLLIPP  985



>gb|ACF80398.1| unknown [Zea mays]
Length=295

 Score =   183 bits (464),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -3

Query  604  IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
            IPPTTVL++NLVG+VAG+S+AINSGYQSWGPLFG+LFF+IWVI+HLYPFLKGL+GRQNRT
Sbjct  194  IPPTTVLVINLVGMVAGISYAINSGYQSWGPLFGKLFFSIWVILHLYPFLKGLMGRQNRT  253

Query  424  PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
            PTIVIVWSILLASIFSLLWV+IDPF S + KAAA GQCG+NC
Sbjct  254  PTIVIVWSILLASIFSLLWVKIDPFISPTQKAAALGQCGVNC  295


 Score = 80.5 bits (197),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  158  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  196



>gb|KCW79813.1| hypothetical protein EUGRSUZ_C01147 [Eucalyptus grandis]
Length=217

 Score =   184 bits (466),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -3

Query  604  IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
            IPPTTVLIVN++GIVAGVS+AINSGYQSWGPLFG+LFFAIWVI  LYPFLKGLLGRQNRT
Sbjct  116  IPPTTVLIVNIIGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIADLYPFLKGLLGRQNRT  175

Query  424  PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGIN  302
             TIVIVWSILLASIFSLLWVRIDPFTS S K+AA GQCGIN
Sbjct  176  RTIVIVWSILLASIFSLLWVRIDPFTSASTKSAANGQCGIN  216


 Score = 77.0 bits (188),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+DE+GDFAELYVFKWTSLL  P
Sbjct  80   LKVLAGIDTNFTVTSKAADEEGDFAELYVFKWTSLLIPP  118



>gb|ACT16001.1| cellulose synthase [Phyllostachys edulis]
Length=1070

 Score =   186 bits (472),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI+HLYPFLKGL+GRQNRT
Sbjct  969   IPPTTVLVINLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVILHLYPFLKGLMGRQNRT  1028

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV+IDPF S + KA A GQCG+NC
Sbjct  1029  PTIVIVWSILLASIFSLLWVKIDPFISPTQKAVALGQCGVNC  1070


 Score = 74.3 bits (181),  Expect(2) = 2e-60, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+DE+GDF+ELYVFKWTSL+  P
Sbjct  933  LKVLAGIDTNFTVTSKATDEEGDFSELYVFKWTSLIIPP  971



>ref|XP_002455101.1| hypothetical protein SORBIDRAFT_03g004320 [Sorghum bicolor]
 gb|EES00221.1| hypothetical protein SORBIDRAFT_03g004320 [Sorghum bicolor]
Length=504

 Score =   182 bits (463),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604  IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
            IPPTTVL++NLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI+HLYPFLKGL+G+QNRT
Sbjct  403  IPPTTVLVINLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVILHLYPFLKGLMGKQNRT  462

Query  424  PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
            PTIVIVWSILLASIFSLLWV+IDPF S + KA + GQCG+NC
Sbjct  463  PTIVIVWSILLASIFSLLWVKIDPFISPTQKAISRGQCGVNC  504


 Score = 77.4 bits (189),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+D+DGDFAELYVFKWTSLL  P
Sbjct  367  LKVLAGIDTNFTVTSKATDDDGDFAELYVFKWTSLLIPP  405



>ref|XP_010050525.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming] [Eucalyptus grandis]
Length=189

 Score =   182 bits (463),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -3

Query  604  IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
            IPPTTVLIVN++GIVAGVS+AINSGYQSWGPLFG+LFFAIWVI  LYPFLKGLLGRQNRT
Sbjct  88   IPPTTVLIVNIIGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIADLYPFLKGLLGRQNRT  147

Query  424  PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGIN  302
             TIVIVWSILLASIFSLLWVRIDPFTS S K+AA GQCGIN
Sbjct  148  RTIVIVWSILLASIFSLLWVRIDPFTSASTKSAANGQCGIN  188


 Score = 77.4 bits (189),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+DE+GDFAELYVFKWTSLL  P
Sbjct  52   LKVLAGIDTNFTVTSKAADEEGDFAELYVFKWTSLLIPP  90



>gb|AAT66940.1| CesA1 [Acacia mangium]
Length=1082

 Score =   180 bits (456),  Expect(2) = 4e-60, Method: Composition-based stats.
 Identities = 87/102 (85%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTV++VN++GIVAGVS AINSGYQSWGPLFG+LFFAIWV+ HLYPFLKGLLGRQNRT
Sbjct  981   IPPTTVIVVNIIGIVAGVSCAINSGYQSWGPLFGKLFFAIWVVAHLYPFLKGLLGRQNRT  1040

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFT+D++KA++ GQCG+NC
Sbjct  1041  PTIVIVWSILLASIFSLLWVRIDPFTADTSKASSNGQCGVNC  1082


 Score = 79.3 bits (194),  Expect(2) = 4e-60, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  945  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  983



>gb|KDP43475.1| hypothetical protein JCGZ_16762 [Jatropha curcas]
Length=1078

 Score =   182 bits (462),  Expect(2) = 4e-60, Method: Composition-based stats.
 Identities = 83/102 (81%), Positives = 93/102 (91%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVN+VG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  978   IPPTTLLIVNIVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1037

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVR+DPFT+ S       QCGINC
Sbjct  1038  PTIVVVWSILLASIFSLLWVRVDPFTT-SVTGPDVQQCGINC  1078


 Score = 77.0 bits (188),  Expect(2) = 4e-60, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  942  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  980



>gb|AAF89963.1|AF200527_1 cellulose synthase-3 [Zea mays]
Length=821

 Score =   183 bits (465),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604  IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
            IPPTTVL++NLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI+HLYPFLKGL+G+QNRT
Sbjct  720  IPPTTVLVINLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVILHLYPFLKGLMGKQNRT  779

Query  424  PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
            PTIVIVWS+LLASIFSLLWV+IDPF S + KA + GQCG+NC
Sbjct  780  PTIVIVWSVLLASIFSLLWVKIDPFISPTQKALSRGQCGVNC  821


 Score = 75.9 bits (185),  Expect(2) = 4e-60, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+D+DGDFAELYVFKWT+LL  P
Sbjct  684  LKVLAGIDTNFTVTSKATDDDGDFAELYVFKWTTLLIPP  722



>gb|AAY43219.2| cellulose synthase BoCesA3 [Bambusa oldhamii]
Length=1074

 Score =   184 bits (466),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVGIVAGVS+AINSGYQSWGPLFG+LFF+IWVI+HLYPFLKGL+GRQNRT
Sbjct  973   IPPTTVLVINLVGIVAGVSYAINSGYQSWGPLFGKLFFSIWVILHLYPFLKGLMGRQNRT  1032

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV+IDPF S + KA   GQCG+NC
Sbjct  1033  PTIVIVWSILLASIFSLLWVKIDPFISPTQKAVTLGQCGVNC  1074


 Score = 75.5 bits (184),  Expect(2) = 5e-60, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+DE+GDF+ELYVFKWTSLL  P
Sbjct  937  LKVLAGIDTNFTVTSKATDEEGDFSELYVFKWTSLLIPP  975



>gb|AAY43218.1| cellulose synthase BoCesA2 [Bambusa oldhamii]
Length=1073

 Score =   184 bits (466),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVGIVAGVS+AINSGYQSWGPLFG+LFF+IWVI+HLYPFLKGL+G+QNRT
Sbjct  972   IPPTTVLVINLVGIVAGVSYAINSGYQSWGPLFGKLFFSIWVILHLYPFLKGLMGKQNRT  1031

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV+IDPF S + KA A GQCG+NC
Sbjct  1032  PTIVIVWSILLASIFSLLWVKIDPFISPTQKAVALGQCGVNC  1073


 Score = 75.1 bits (183),  Expect(2) = 5e-60, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+D++GDFAELYVFKWTSLL  P
Sbjct  936  LKVLAGIDTNFTVTSKATDDEGDFAELYVFKWTSLLIPP  974



>gb|ACZ82297.1| cellulose synthase [Phyllostachys edulis]
Length=1076

 Score =   184 bits (468),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI+HLYPFLKGL+GRQNRT
Sbjct  975   IPPTTVLVINLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVILHLYPFLKGLMGRQNRT  1034

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV+IDPF S + KA   GQCG+NC
Sbjct  1035  PTIVIVWSILLASIFSLLWVKIDPFISPTQKAVTLGQCGVNC  1076


 Score = 74.3 bits (181),  Expect(2) = 5e-60, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+DE+GDF+ELYVFKWTSL+  P
Sbjct  939  LKVLAGIDTNFTVTSKATDEEGDFSELYVFKWTSLIIPP  977



>ref|XP_007220288.1| hypothetical protein PRUPE_ppa000593mg [Prunus persica]
 gb|EMJ21487.1| hypothetical protein PRUPE_ppa000593mg [Prunus persica]
Length=1082

 Score =   182 bits (461),  Expect(2) = 5e-60, Method: Composition-based stats.
 Identities = 83/102 (81%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  982   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1041

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVR+DPFT+         QCGINC
Sbjct  1042  PTIVIVWSILLASIFSLLWVRVDPFTT-RVTGPDVEQCGINC  1082


 Score = 77.0 bits (188),  Expect(2) = 5e-60, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  946  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  984



>ref|XP_003533898.2| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X1 [Glycine max]
 ref|XP_006587173.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X2 [Glycine max]
Length=1074

 Score =   181 bits (460),  Expect(2) = 6e-60, Method: Composition-based stats.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  974   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1033

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1034  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1074


 Score = 77.0 bits (188),  Expect(2) = 6e-60, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  938  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  976



>gb|KHG03009.1| Cellulose synthase A catalytic subunit 3 [UDP-forming] -like 
protein [Gossypium arboreum]
Length=1068

 Score =   181 bits (460),  Expect(2) = 6e-60, Method: Composition-based stats.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  968   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1027

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1028  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1068


 Score = 77.0 bits (188),  Expect(2) = 6e-60, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  932  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  970



>ref|XP_008231249.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Prunus mume]
 ref|XP_008231250.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Prunus mume]
Length=1082

 Score =   181 bits (460),  Expect(2) = 6e-60, Method: Composition-based stats.
 Identities = 83/102 (81%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  982   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1041

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVR+DPFT+         QCGINC
Sbjct  1042  PTIVIVWSILLASIFSLLWVRVDPFTT-RVTGPDVEQCGINC  1082


 Score = 77.0 bits (188),  Expect(2) = 6e-60, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  946  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  984



>ref|XP_010526207.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Tarenaya hassleriana]
Length=1084

 Score =   180 bits (457),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             +PPTTVL+VNLVGIVAGVS+AINSGYQSWGPLFG+LFFA+WVI HLYPFLKGLLGRQNRT
Sbjct  983   VPPTTVLLVNLVGIVAGVSYAINSGYQSWGPLFGKLFFALWVIAHLYPFLKGLLGRQNRT  1042

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRI+PF S +      GQCG+NC
Sbjct  1043  PTIVIVWSILLASIFSLLWVRINPFVSTTGSINVSGQCGVNC  1084


 Score = 78.6 bits (192),  Expect(2) = 6e-60, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWT+LL  P
Sbjct  947  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTTLLVPP  985



>ref|XP_006289427.1| hypothetical protein CARUB_v10002932mg [Capsella rubella]
 gb|EOA22325.1| hypothetical protein CARUB_v10002932mg [Capsella rubella]
Length=1065

 Score =   181 bits (460),  Expect(2) = 7e-60, Method: Composition-based stats.
 Identities = 84/102 (82%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVNLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  965   IPPTTLLIVNLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1024

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWS+LLASIFSLLWVRIDPFTS         +CGINC
Sbjct  1025  PTIVVVWSVLLASIFSLLWVRIDPFTS-RVTGPDILECGINC  1065


 Score = 77.0 bits (188),  Expect(2) = 7e-60, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  929  LKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPP  967



>ref|XP_004968377.1| PREDICTED: probable cellulose synthase A catalytic subunit 1 
[UDP-forming]-like [Setaria italica]
Length=1075

 Score =   183 bits (464),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVGIVAGVS+AINSGYQSWGPLFG+LFF+IWVI+HLYPFLKGL+G+QNRT
Sbjct  974   IPPTTVLVINLVGIVAGVSYAINSGYQSWGPLFGKLFFSIWVILHLYPFLKGLMGKQNRT  1033

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV+IDPF S + KA + GQCG+NC
Sbjct  1034  PTIVIVWSILLASIFSLLWVKIDPFISPTQKALSRGQCGVNC  1075


 Score = 75.5 bits (184),  Expect(2) = 7e-60, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+DE+GDF+ELYVFKWTSLL  P
Sbjct  938  LKVLAGIDTNFTVTSKATDEEGDFSELYVFKWTSLLIPP  976



>ref|NP_196136.1| cellulose synthase A catalytic subunit 3 [UDP-forming] [Arabidopsis 
thaliana]
 sp|Q941L0.2|CESA3_ARATH RecName: Full=Cellulose synthase A catalytic subunit 3 [UDP-forming]; 
Short=AtCesA3; AltName: Full=Constitutive expression 
of VSP1 protein 1; AltName: Full=Isoxaben-resistant protein 
1; Short=Ath-B; AltName: Full=Protein ECTOPIC LIGNIN 1; AltName: 
Full=Protein RADIALLY SWOLLEN 5; Short=AtRSW5 [Arabidopsis 
thaliana]
 dbj|BAB09693.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AAN86168.1| putative cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AED90836.1| cellulose synthase A catalytic subunit 3 [UDP-forming] [Arabidopsis 
thaliana]
 gb|AHL38644.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1065

 Score =   181 bits (460),  Expect(2) = 7e-60, Method: Composition-based stats.
 Identities = 84/102 (82%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVNLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  965   IPPTTLLIVNLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1024

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWS+LLASIFSLLWVRIDPFTS         +CGINC
Sbjct  1025  PTIVVVWSVLLASIFSLLWVRIDPFTS-RVTGPDILECGINC  1065


 Score = 77.0 bits (188),  Expect(2) = 7e-60, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  929  LKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPP  967



>ref|XP_002873198.1| hypothetical protein ARALYDRAFT_487306 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49457.1| hypothetical protein ARALYDRAFT_487306 [Arabidopsis lyrata subsp. 
lyrata]
Length=1065

 Score =   181 bits (460),  Expect(2) = 7e-60, Method: Composition-based stats.
 Identities = 84/102 (82%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVNLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  965   IPPTTLLIVNLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1024

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWS+LLASIFSLLWVRIDPFTS         +CGINC
Sbjct  1025  PTIVVVWSVLLASIFSLLWVRIDPFTS-RVTGPDILECGINC  1065


 Score = 77.0 bits (188),  Expect(2) = 7e-60, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  929  LKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPP  967



>gb|AAC39336.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
Length=1065

 Score =   181 bits (460),  Expect(2) = 7e-60, Method: Composition-based stats.
 Identities = 84/102 (82%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVNLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  965   IPPTTLLIVNLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1024

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWS+LLASIFSLLWVRIDPFTS         +CGINC
Sbjct  1025  PTIVVVWSVLLASIFSLLWVRIDPFTS-RVTGPDILECGINC  1065


 Score = 77.0 bits (188),  Expect(2) = 7e-60, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  929  LKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPP  967



>ref|XP_010491044.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Camelina sativa]
Length=1061

 Score =   181 bits (460),  Expect(2) = 7e-60, Method: Composition-based stats.
 Identities = 84/102 (82%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVNLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  961   IPPTTLLIVNLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1020

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWS+LLASIFSLLWVRIDPFTS         +CGINC
Sbjct  1021  PTIVVVWSVLLASIFSLLWVRIDPFTS-RVTGPDILECGINC  1061


 Score = 77.0 bits (188),  Expect(2) = 7e-60, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  925  LKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPP  963



>ref|XP_010452418.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Camelina sativa]
Length=1060

 Score =   181 bits (460),  Expect(2) = 7e-60, Method: Composition-based stats.
 Identities = 84/102 (82%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVNLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  960   IPPTTLLIVNLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1019

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWS+LLASIFSLLWVRIDPFTS         +CGINC
Sbjct  1020  PTIVVVWSVLLASIFSLLWVRIDPFTS-RVTGPDILECGINC  1060


 Score = 77.0 bits (188),  Expect(2) = 7e-60, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  924  LKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPP  962



>gb|KJB25016.1| hypothetical protein B456_004G172400 [Gossypium raimondii]
 gb|KJB25018.1| hypothetical protein B456_004G172400 [Gossypium raimondii]
 gb|KJB25019.1| hypothetical protein B456_004G172400 [Gossypium raimondii]
 gb|KJB25020.1| hypothetical protein B456_004G172400 [Gossypium raimondii]
Length=1068

 Score =   181 bits (459),  Expect(2) = 8e-60, Method: Composition-based stats.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  968   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1027

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1028  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1068


 Score = 77.0 bits (188),  Expect(2) = 8e-60, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  932  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  970



>gb|AGC65584.1| GFP-CESA3ixr1-2 [Binary plant gene expression vector pKM24-MD1]
Length=1344

 Score =   183 bits (465),  Expect(2) = 9e-60, Method: Composition-based stats.
 Identities = 84/102 (82%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVNLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  1244  IPPTTLLIVNLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1303

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWS+LLASIFSLLWVRIDPFTS         +CGINC
Sbjct  1304  PTIVVVWSVLLASIFSLLWVRIDPFTS-RVTGPDILECGINC  1344


 Score = 74.7 bits (182),  Expect(2) = 9e-60, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713   LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
             LKVLAGIDTNFTV SKASDEDGDFAELY+FKWT+LL  P
Sbjct  1208  LKVLAGIDTNFTVISKASDEDGDFAELYLFKWTTLLIPP  1246



>gb|KJB25017.1| hypothetical protein B456_004G172400 [Gossypium raimondii]
Length=1054

 Score =   181 bits (459),  Expect(2) = 9e-60, Method: Composition-based stats.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  954   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1013

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1014  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1054


 Score = 77.0 bits (188),  Expect(2) = 9e-60, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  918  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  956



>gb|ACF83181.1| unknown [Zea mays]
Length=348

 Score =   181 bits (459),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604  IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
            IPPTTVL++NLVGIVAGVS+AINSGYQSWGPLFG+LFFAIWVI+HLYPFLKGL+G+QNRT
Sbjct  247  IPPTTVLVINLVGIVAGVSYAINSGYQSWGPLFGKLFFAIWVILHLYPFLKGLMGKQNRT  306

Query  424  PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
            PTIVIVWS+LLASIFSLLWV+IDPF S + KA + GQCG+NC
Sbjct  307  PTIVIVWSVLLASIFSLLWVKIDPFISPTQKALSRGQCGVNC  348


 Score = 77.0 bits (188),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+D+DGDFAELYVFKWT+LL  P
Sbjct  211  LKVLAGIDTNFTVTSKATDDDGDFAELYVFKWTTLLIPP  249



>gb|AFG25776.1| cellulose synthase 2 [Bambusa emeiensis]
Length=1074

 Score =   184 bits (467),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVGIVAGVS+AINSGYQSWGPLFG+LFF+IWVI+HLYPFLKGL+GRQNRT
Sbjct  973   IPPTTVLVINLVGIVAGVSYAINSGYQSWGPLFGKLFFSIWVILHLYPFLKGLMGRQNRT  1032

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV+IDPF S + KA + GQCG+NC
Sbjct  1033  PTIVIVWSILLASIFSLLWVKIDPFISPTQKAVSLGQCGVNC  1074


 Score = 73.9 bits (180),  Expect(2) = 1e-59, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+D++GDF+ELYVFKWTSLL  P
Sbjct  937  LKVLAGIDTNFTVTSKATDDEGDFSELYVFKWTSLLIPP  975



>ref|XP_006398979.1| hypothetical protein EUTSA_v10012528mg [Eutrema salsugineum]
 gb|ESQ40432.1| hypothetical protein EUTSA_v10012528mg [Eutrema salsugineum]
Length=1065

 Score =   181 bits (460),  Expect(2) = 1e-59, Method: Composition-based stats.
 Identities = 84/102 (82%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVNLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  965   IPPTTLLIVNLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1024

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWS+LLASIFSLLWVRIDPFTS         +CGINC
Sbjct  1025  PTIVVVWSVLLASIFSLLWVRIDPFTS-RVTGPDILECGINC  1065


 Score = 76.6 bits (187),  Expect(2) = 1e-59, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAG+DTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  929  LKVLAGVDTNFTVTSKASDEDGDFAELYLFKWTTLLIPP  967



>emb|CDP07782.1| unnamed protein product [Coffea canephora]
Length=1083

 Score =   181 bits (458),  Expect(2) = 1e-59, Method: Composition-based stats.
 Identities = 83/102 (81%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVNLVG+VAG+S+AINSGYQ+WGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  983   IPPTTLLIVNLVGVVAGISYAINSGYQTWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1042

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1043  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1083


 Score = 77.0 bits (188),  Expect(2) = 1e-59, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  947  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  985



>dbj|BAJ33658.1| unnamed protein product [Thellungiella halophila]
Length=1065

 Score =   181 bits (459),  Expect(2) = 1e-59, Method: Composition-based stats.
 Identities = 84/102 (82%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVNLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  965   IPPTTLLIVNLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1024

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWS+LLASIFSLLWVRIDPFTS         +CGINC
Sbjct  1025  PTIVVVWSVLLASIFSLLWVRIDPFTS-RVTGPDILECGINC  1065


 Score = 76.6 bits (187),  Expect(2) = 1e-59, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAG+DTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  929  LKVLAGVDTNFTVTSKASDEDGDFAELYLFKWTTLLIPP  967



>ref|XP_007148880.1| hypothetical protein PHAVU_005G022100g [Phaseolus vulgaris]
 gb|ESW20874.1| hypothetical protein PHAVU_005G022100g [Phaseolus vulgaris]
Length=1075

 Score =   182 bits (461),  Expect(2) = 1e-59, Method: Composition-based stats.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  975   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1034

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1035  PTIVVVWSILLASIFSLLWVRIDPFTT-KVTGPDVEQCGINC  1075


 Score = 75.9 bits (185),  Expect(2) = 1e-59, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+DEDGDFAELY+FKWT+LL  P
Sbjct  939  LKVLAGIDTNFTVTSKATDEDGDFAELYMFKWTTLLIPP  977



>ref|XP_009407595.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] isoform X2 [Musa acuminata subsp. malaccensis]
Length=1065

 Score =   180 bits (457),  Expect(2) = 1e-59, Method: Composition-based stats.
 Identities = 83/102 (81%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVNLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  965   IPPTTLLIVNLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1024

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVR+DPFT+         QCGINC
Sbjct  1025  PTIVVVWSILLASIFSLLWVRVDPFTT-RVTGPDVLQCGINC  1065


 Score = 77.0 bits (188),  Expect(2) = 1e-59, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  929  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  967



>ref|XP_009407580.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009407588.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] isoform X1 [Musa acuminata subsp. malaccensis]
Length=1066

 Score =   180 bits (457),  Expect(2) = 1e-59, Method: Composition-based stats.
 Identities = 83/102 (81%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVNLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  966   IPPTTLLIVNLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1025

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVR+DPFT+         QCGINC
Sbjct  1026  PTIVVVWSILLASIFSLLWVRVDPFTT-RVTGPDVLQCGINC  1066


 Score = 77.0 bits (188),  Expect(2) = 1e-59, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  930  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  968



>gb|ACU87559.2| cellulose synthase [Leucaena leucocephala]
Length=1075

 Score =   180 bits (457),  Expect(2) = 1e-59, Method: Composition-based stats.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVN+VG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  975   IPPTTLLIVNMVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1034

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVR+DPF +   +     QCGINC
Sbjct  1035  PTIVVVWSILLASIFSLLWVRVDPFIT-RVRGPDTEQCGINC  1075


 Score = 77.0 bits (188),  Expect(2) = 1e-59, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  939  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  977



>ref|XP_004499886.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cicer arietinum]
Length=1078

 Score =   182 bits (462),  Expect(2) = 2e-59, Method: Composition-based stats.
 Identities = 81/102 (79%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+A+NSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  978   IPPTTLLIINLVGVVAGISYAVNSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1037

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1038  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDSEQCGINC  1078


 Score = 75.1 bits (183),  Expect(2) = 2e-59, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDF ELY+FKWT+LL  P
Sbjct  942  LKVLAGIDTNFTVTSKASDEDGDFQELYMFKWTTLLIPP  980



>gb|AIA10372.1| cellulose synthase [Boehmeria nivea]
Length=1079

 Score =   181 bits (459),  Expect(2) = 2e-59, Method: Composition-based stats.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  979   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1038

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1039  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1079


 Score = 75.9 bits (185),  Expect(2) = 2e-59, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+DEDGDFAELY+FKWT+LL  P
Sbjct  943  LKVLAGIDTNFTVTSKATDEDGDFAELYMFKWTTLLIPP  981



>gb|AAY43225.1| cellulose synthase BoCesA3 [Bambusa oldhamii]
Length=1074

 Score =   183 bits (464),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVGIVAGVS+AINSGYQSWGPLFG+LFF+IWVI+HLYPFLKGL+GRQNRT
Sbjct  973   IPPTTVLVINLVGIVAGVSYAINSGYQSWGPLFGKLFFSIWVILHLYPFLKGLMGRQNRT  1032

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWS+LLASIFSLLWV+IDPF S + KA   GQCG+NC
Sbjct  1033  PTIVIVWSVLLASIFSLLWVKIDPFISPTQKAVTLGQCGVNC  1074


 Score = 73.9 bits (180),  Expect(2) = 2e-59, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+D++GDF+ELYVFKWTSLL  P
Sbjct  937  LKVLAGIDTNFTVTSKATDDEGDFSELYVFKWTSLLIPP  975



>ref|XP_006439113.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
 ref|XP_006439114.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
 gb|ESR52353.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
 gb|ESR52354.1| hypothetical protein CICLE_v10030723mg [Citrus clementina]
Length=1079

 Score =   181 bits (460),  Expect(2) = 2e-59, Method: Composition-based stats.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+L++NLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  979   IPPTTLLVINLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1038

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVR+DPFT+         QCGINC
Sbjct  1039  PTIVVVWSILLASIFSLLWVRVDPFTT-RVTGPDVKQCGINC  1079


 Score = 75.5 bits (184),  Expect(2) = 2e-59, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDF ELY+FKWT+LL  P
Sbjct  943  LKVLAGIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPP  981



>ref|XP_006482874.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X1 [Citrus sinensis]
 ref|XP_006482875.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X2 [Citrus sinensis]
 ref|XP_006482876.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X3 [Citrus sinensis]
 ref|XP_006482877.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X4 [Citrus sinensis]
Length=1079

 Score =   181 bits (459),  Expect(2) = 2e-59, Method: Composition-based stats.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+L++NLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  979   IPPTTLLVINLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1038

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVR+DPFT+         QCGINC
Sbjct  1039  PTIVVVWSILLASIFSLLWVRVDPFTT-RVTGPDVEQCGINC  1079


 Score = 75.5 bits (184),  Expect(2) = 2e-59, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDF ELY+FKWT+LL  P
Sbjct  943  LKVLAGIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPP  981



>gb|KDO83405.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83406.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83407.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83408.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83409.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83410.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
 gb|KDO83411.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
Length=1079

 Score =   181 bits (459),  Expect(2) = 3e-59, Method: Composition-based stats.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+L++NLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  979   IPPTTLLVINLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1038

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVR+DPFT+         QCGINC
Sbjct  1039  PTIVVVWSILLASIFSLLWVRVDPFTT-RVTGPDVEQCGINC  1079


 Score = 75.5 bits (184),  Expect(2) = 3e-59, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDF ELY+FKWT+LL  P
Sbjct  943  LKVLAGIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPP  981



>gb|ACZ82296.1| cellulose synthase [Phyllostachys edulis]
Length=1077

 Score =   193 bits (491),  Expect(2) = 3e-59, Method: Composition-based stats.
 Identities = 85/102 (83%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL++NLVG+VAG+S+AINSGYQSWGPLFG+LFF+IWVI+HLYPFLKGL+GRQNR 
Sbjct  976   IPPTTVLVINLVGMVAGISYAINSGYQSWGPLFGKLFFSIWVILHLYPFLKGLMGRQNRA  1035

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWV+IDPF S + KAAA GQCG+NC
Sbjct  1036  PTIVIVWSILLASIFSLLWVKIDPFISPTQKAAALGQCGVNC  1077


 Score = 63.2 bits (152),  Expect(2) = 3e-59, Method: Composition-based stats.
 Identities = 28/31 (90%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = -2

Query  689  TNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            TNFTVTSKASDEDGDFAELYVFKWTSL+  P
Sbjct  948  TNFTVTSKASDEDGDFAELYVFKWTSLIIPP  978



>gb|EAZ03185.1| hypothetical protein OsI_25338 [Oryza sativa Indica Group]
Length=1063

 Score =   179 bits (455),  Expect(2) = 3e-59, Method: Composition-based stats.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  963   IPPTTILIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1022

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VW+ILLASIFSLLWVRIDPFT+          CGINC
Sbjct  1023  PTIVVVWAILLASIFSLLWVRIDPFTT-RVTGPDTQTCGINC  1063


 Score = 77.0 bits (188),  Expect(2) = 3e-59, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  927  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  965



>ref|NP_001105621.1| cellulose synthase-4 [Zea mays]
 gb|AAF89964.1|AF200528_1 cellulose synthase-4 [Zea mays]
Length=1077

 Score =   179 bits (454),  Expect(2) = 3e-59, Method: Composition-based stats.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  977   IPPTTILIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1036

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VW+ILLASIFSLLWVRIDPFT+          CGINC
Sbjct  1037  PTIVVVWAILLASIFSLLWVRIDPFTT-RVTGPDTQTCGINC  1077


 Score = 77.0 bits (188),  Expect(2) = 3e-59, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  941  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  979



>tpg|DAA59989.1| TPA: putative cellulose synthase family protein [Zea mays]
Length=1077

 Score =   179 bits (454),  Expect(2) = 3e-59, Method: Composition-based stats.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  977   IPPTTILIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1036

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VW+ILLASIFSLLWVRIDPFT+          CGINC
Sbjct  1037  PTIVVVWAILLASIFSLLWVRIDPFTT-RVTGPDTQTCGINC  1077


 Score = 77.0 bits (188),  Expect(2) = 3e-59, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  941  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  979



>gb|AGC65585.1| CESA3ixr1-2 [Binary plant gene expression vector pKM24-MD1]
Length=1066

 Score =   181 bits (460),  Expect(2) = 3e-59, Method: Composition-based stats.
 Identities = 84/102 (82%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVNLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  966   IPPTTLLIVNLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1025

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWS+LLASIFSLLWVRIDPFTS         +CGINC
Sbjct  1026  PTIVVVWSVLLASIFSLLWVRIDPFTS-RVTGPDILECGINC  1066


 Score = 74.7 bits (182),  Expect(2) = 3e-59, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTV SKASDEDGDFAELY+FKWT+LL  P
Sbjct  930  LKVLAGIDTNFTVISKASDEDGDFAELYLFKWTTLLIPP  968



>ref|XP_011048033.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic 
subunit 3 [UDP-forming]-like [Populus euphratica]
Length=1061

 Score =   180 bits (457),  Expect(2) = 4e-59, Method: Composition-based stats.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  961   IPPTTLLIINLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1020

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTI++VWS+LLASIFSLLWVR+DPFT+         QCGINC
Sbjct  1021  PTIIVVWSVLLASIFSLLWVRVDPFTT-RVTGPDVEQCGINC  1061


 Score = 75.5 bits (184),  Expect(2) = 4e-59, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDF ELY+FKWT+LL  P
Sbjct  925  LKVLAGIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPP  963



>ref|XP_009364979.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Pyrus x bretschneideri]
 ref|XP_009364980.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Pyrus x bretschneideri]
Length=1081

 Score =   181 bits (458),  Expect(2) = 6e-59, Method: Composition-based stats.
 Identities = 83/102 (81%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVNLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  981   IPPTTLLIVNLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1040

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVR+DPFT+         +CGINC
Sbjct  1041  PTIVIVWSILLASIFSLLWVRVDPFTT-RVTGPNIDECGINC  1081


 Score = 74.7 bits (182),  Expect(2) = 6e-59, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDF ELY+FKWT+LL  P
Sbjct  945  LKVLAGIDTNFTVTSKASDEDGDFNELYMFKWTTLLIPP  983



>ref|XP_007052526.1| Cellulose synthase family protein isoform 2 [Theobroma cacao]
 ref|XP_007052530.1| Cellulose synthase family protein isoform 2 [Theobroma cacao]
 gb|EOX96683.1| Cellulose synthase family protein isoform 2 [Theobroma cacao]
 gb|EOX96687.1| Cellulose synthase family protein isoform 2 [Theobroma cacao]
Length=1068

 Score =   178 bits (451),  Expect(2) = 7e-59, Method: Composition-based stats.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  968   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1027

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+          CGINC
Sbjct  1028  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEVCGINC  1068


 Score = 77.0 bits (188),  Expect(2) = 7e-59, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  932  LKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPP  970



>ref|XP_008784835.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Phoenix dactylifera]
Length=1077

 Score =   181 bits (460),  Expect(2) = 7e-59, Method: Composition-based stats.
 Identities = 83/102 (81%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVNLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  977   IPPTTLLIVNLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1036

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVR+DPFT+         QCGINC
Sbjct  1037  PTIVVVWSILLASIFSLLWVRVDPFTT-RVTGPDVQQCGINC  1077


 Score = 73.6 bits (179),  Expect(2) = 7e-59, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDE+GDF ELY+FKWT+LL  P
Sbjct  941  LKVLAGIDTNFTVTSKASDEEGDFTELYMFKWTTLLIPP  979



>ref|XP_009354747.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Pyrus x bretschneideri]
 ref|XP_009354748.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Pyrus x bretschneideri]
Length=1082

 Score =   180 bits (457),  Expect(2) = 8e-59, Method: Composition-based stats.
 Identities = 81/102 (79%), Positives = 93/102 (91%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+L++NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  982   IPPTTLLVINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1041

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVR+DPFT+ +       +CGINC
Sbjct  1042  PTIVIVWSILLASIFSLLWVRVDPFTT-TVTGPDIEECGINC  1082


 Score = 74.7 bits (182),  Expect(2) = 8e-59, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDF ELY+FKWT+LL  P
Sbjct  946  LKVLAGIDTNFTVTSKASDEDGDFNELYMFKWTTLLIPP  984



>gb|ACC59195.1| cellulose synthase [Betula platyphylla]
Length=1084

 Score =   179 bits (455),  Expect(2) = 8e-59, Method: Composition-based stats.
 Identities = 81/102 (79%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  984   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1043

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVR+DPFT+ +        CGINC
Sbjct  1044  PTIVVVWSILLASIFSLLWVRVDPFTT-TVTGPDVQLCGINC  1084


 Score = 75.5 bits (184),  Expect(2) = 8e-59, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDF ELY+FKWT+LL  P
Sbjct  948  LKVLAGIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPP  986



>ref|XP_008375180.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Malus domestica]
Length=1082

 Score =   180 bits (456),  Expect(2) = 1e-58, Method: Composition-based stats.
 Identities = 81/102 (79%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+A+NSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  982   IPPTTLLIINLVGVVAGISYAVNSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1041

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVR+DPFT+         +CGINC
Sbjct  1042  PTIVIVWSILLASIFSLLWVRVDPFTT-RVTGPDIEECGINC  1082


 Score = 74.7 bits (182),  Expect(2) = 1e-58, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDF ELY+FKWT+LL  P
Sbjct  946  LKVLAGIDTNFTVTSKASDEDGDFNELYMFKWTTLLIPP  984



>gb|AAT66941.1| CesA2 [Acacia mangium]
Length=1075

 Score =   177 bits (449),  Expect(2) = 1e-58, Method: Composition-based stats.
 Identities = 78/102 (76%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+N+VG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFL+GL+GRQNRT
Sbjct  975   IPPTTLLIINMVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLRGLMGRQNRT  1034

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVR DPF +   +     QCGINC
Sbjct  1035  PTIVVVWSILLASIFSLLWVRADPFIT-RVRGPDTEQCGINC  1075


 Score = 77.0 bits (188),  Expect(2) = 1e-58, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  939  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  977



>gb|AGV22107.1| cellulose synthase 2 [Betula luminifera]
Length=1084

 Score =   178 bits (452),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  984   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1043

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVR+DPFT+          CGINC
Sbjct  1044  PTIVVVWSILLASIFSLLWVRVDPFTT-RVTGPDVQLCGINC  1084


 Score = 75.5 bits (184),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDF ELY+FKWT+LL  P
Sbjct  948  LKVLAGIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPP  986



>gb|KEH19084.1| cellulose synthase-like protein [Medicago truncatula]
Length=1078

 Score =   183 bits (464),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 82/102 (80%), Positives = 93/102 (91%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  978   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1037

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVR+DPFT+      A  +CGINC
Sbjct  1038  PTIVVVWSILLASIFSLLWVRVDPFTTRVTGPKA-EECGINC  1078


 Score = 70.9 bits (172),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGD AELY+ KWT+LL  P
Sbjct  942  LKVLAGIDTNFTVTSKASDEDGDSAELYMIKWTTLLIPP  980



>gb|AII73575.1| cellulose synthase 3 [Medicago sativa]
Length=1078

 Score =   180 bits (457),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 80/102 (78%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+A+NSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  978   IPPTTLLIINLVGVVAGISYAVNSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1037

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+          CGINC
Sbjct  1038  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPKSEMCGINC  1078


 Score = 73.6 bits (179),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGD AELY+FKWT+LL  P
Sbjct  942  LKVLAGIDTNFTVTSKASDEDGDSAELYMFKWTTLLIPP  980



>ref|XP_003599196.1| Cellulose synthase [Medicago truncatula]
 gb|AES69447.1| cellulose synthase-like protein [Medicago truncatula]
Length=1078

 Score =   180 bits (457),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 80/102 (78%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+A+NSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  978   IPPTTLLIINLVGVVAGISYAVNSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1037

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+          CGINC
Sbjct  1038  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPKSEMCGINC  1078


 Score = 73.6 bits (179),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGD AELY+FKWT+LL  P
Sbjct  942  LKVLAGIDTNFTVTSKASDEDGDSAELYMFKWTTLLIPP  980



>ref|XP_004306536.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Fragaria vesca subsp. vesca]
Length=1083

 Score =   176 bits (447),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 79/102 (77%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+A+NSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  983   IPPTTLLIINLVGVVAGISYAVNSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1042

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWS+LLASIFSLLWVR+DPFT+          CGINC
Sbjct  1043  PTIVVVWSVLLASIFSLLWVRVDPFTT-RVTGPDVEVCGINC  1083


 Score = 77.0 bits (188),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  947  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  985



>ref|XP_008461291.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis melo]
 ref|XP_008461292.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis melo]
 ref|XP_008461293.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis melo]
 ref|XP_008461294.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis melo]
Length=1083

 Score =   179 bits (455),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 82/102 (80%), Positives = 93/102 (91%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVNLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  983   IPPTTLLIVNLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1042

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+ +       +CGINC
Sbjct  1043  PTIVVVWSILLASIFSLLWVRIDPFTT-TVIGPDIEECGINC  1083


 Score = 73.9 bits (180),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDE+GD+AELY+FKWT+LL  P
Sbjct  947  LKVLAGIDTNFTVTSKASDEEGDYAELYMFKWTTLLIPP  985



>gb|KCW44176.1| hypothetical protein EUGRSUZ_L02402 [Eucalyptus grandis]
Length=590

 Score =   180 bits (457),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = -3

Query  604  IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
            IP TTVLIVN++GIVAGVS+AINSGYQSWGPLFG+LFFAIWVI  LYPFLKGLLGRQNRT
Sbjct  489  IPLTTVLIVNIIGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIADLYPFLKGLLGRQNRT  548

Query  424  PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             TIVIVWSILLASIFSLLWV+IDPFTS S K+AA GQCGINC
Sbjct  549  RTIVIVWSILLASIFSLLWVQIDPFTSASTKSAANGQCGINC  590


 Score = 73.2 bits (178),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  606
            LKVLAGID NFTVTSKA+DE+GDFAELYVFKWTSLL
Sbjct  453  LKVLAGIDANFTVTSKAADEEGDFAELYVFKWTSLL  488



>ref|NP_001289657.1| cellulose synthase A catalytic subunit 1 [Eucalyptus grandis]
 gb|AAY60847.1| cellulose synthase 5 [Eucalyptus grandis]
Length=1085

 Score =   175 bits (444),  Expect(2) = 3e-58, Method: Composition-based stats.
 Identities = 89/102 (87%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVLIVN++GIVAGVS+AINSGYQSWGPLFG+LFFAIWVI HLYPFLKGLLGRQNRT
Sbjct  984   IPPTTVLIVNIIGIVAGVSYAINSGYQSWGPLFGKLFFAIWVIAHLYPFLKGLLGRQNRT  1043

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASI SLLWVRIDPFTS +  + A GQCGINC
Sbjct  1044  PTIVIVWSILLASILSLLWVRIDPFTSATTASTANGQCGINC  1085


 Score = 77.8 bits (190),  Expect(2) = 3e-58, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA DEDGDFAELYVFKWTSLL  P
Sbjct  948  LKVLAGIDTNFTVTSKAGDEDGDFAELYVFKWTSLLIPP  986



>gb|AEK31218.1| cellulose synthase A [Eucalyptus camaldulensis]
Length=1080

 Score =   176 bits (445),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 93/102 (91%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  980   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1039

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+      A  QCGINC
Sbjct  1040  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPAVEQCGINC  1080


 Score = 77.0 bits (188),  Expect(2) = 3e-58, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  944  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  982



>ref|XP_010088232.1| OsCesA3 protein [Morus notabilis]
 gb|EXB32784.1| OsCesA3 protein [Morus notabilis]
Length=1077

 Score =   180 bits (456),  Expect(2) = 4e-58, Method: Composition-based stats.
 Identities = 81/102 (79%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AIN+GYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  977   IPPTTLLIINLVGVVAGISYAINNGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1036

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVR+DPFT+         QCGINC
Sbjct  1037  PTIVVVWSILLASIFSLLWVRVDPFTT-RVTGPDVEQCGINC  1077


 Score = 72.8 bits (177),  Expect(2) = 4e-58, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDE+ DFAELY+FKWT+LL  P
Sbjct  941  LKVLAGIDTNFTVTSKASDEENDFAELYMFKWTTLLIPP  979



>gb|ACT16002.1| cellulose synthase [Phyllostachys edulis]
Length=1081

 Score =   179 bits (453),  Expect(2) = 4e-58, Method: Composition-based stats.
 Identities = 80/102 (78%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  981   IPPTTILIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1040

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VW+ILLASIFSLLWVR+DPFT+          CGINC
Sbjct  1041  PTIVVVWAILLASIFSLLWVRVDPFTT-RVTGPDTQTCGINC  1081


 Score = 73.9 bits (180),  Expect(2) = 4e-58, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+DE+GDFAELY+FKWT+LL  P
Sbjct  945  LKVLAGIDTNFTVTSKANDEEGDFAELYMFKWTTLLIPP  983



>ref|XP_006412477.1| hypothetical protein EUTSA_v10024278mg [Eutrema salsugineum]
 gb|ESQ53930.1| hypothetical protein EUTSA_v10024278mg [Eutrema salsugineum]
Length=1082

 Score =   174 bits (442),  Expect(2) = 6e-58, Method: Composition-based stats.
 Identities = 81/101 (80%), Positives = 91/101 (90%), Gaps = 1/101 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL+VNL+GIVAGVS+A+NSGYQSWGPLFG+LFFA+WVI HLYPFLKGLLGRQNRT
Sbjct  981   IPPTTVLLVNLIGIVAGVSYAVNSGYQSWGPLFGKLFFALWVIAHLYPFLKGLLGRQNRT  1040

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAA-GGQCGI  305
             PTIVIVWS+LLASIFSLLWVRI+PF S +  A    GQ G+
Sbjct  1041  PTIVIVWSVLLASIFSLLWVRINPFVSVTPNANNFNGQGGV  1081


 Score = 77.4 bits (189),  Expect(2) = 6e-58, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  945  LKVLAGIDTNFTVTSKASDEDGDFAELYIFKWTALLIPP  983



>gb|AAQ63936.1| cellulose synthase [Pinus radiata]
Length=1066

 Score =   174 bits (441),  Expect(2) = 1e-57, Method: Composition-based stats.
 Identities = 78/102 (76%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+L++N+VG+VAG+S AI+SGY +WGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  966   IPPTTLLVINIVGVVAGISQAISSGYAAWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1025

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWS+LLASIFSLLWVRIDPFT+   K     QCGINC
Sbjct  1026  PTIVVVWSVLLASIFSLLWVRIDPFTT-QIKGPDLQQCGINC  1066


 Score = 77.0 bits (188),  Expect(2) = 1e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  930  LKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTALLIPP  968



>ref|XP_002278997.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Vitis vinifera]
Length=1081

 Score =   174 bits (440),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  981   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1040

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1041  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1081


 Score = 77.0 bits (188),  Expect(2) = 1e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  945  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  983



>gb|AHL45025.1| cellulose synthase 3A [Linum usitatissimum]
Length=1060

 Score =   175 bits (443),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 93/102 (91%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+L++NLVG+VAGVS+AINSGYQSWGPLFG+LFFA+WVIVHLYPFLKGL+GRQNRT
Sbjct  960   IPPTTLLVINLVGVVAGVSYAINSGYQSWGPLFGKLFFALWVIVHLYPFLKGLMGRQNRT  1019

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1020  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPNVDQCGINC  1060


 Score = 75.9 bits (185),  Expect(2) = 1e-57, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+DEDGDFAELY+FKWT+LL  P
Sbjct  924  LKVLAGIDTNFTVTSKANDEDGDFAELYLFKWTTLLIPP  962



>ref|XP_003546888.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Glycine max]
Length=1073

 Score =   174 bits (440),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  973   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1032

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1033  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1073


 Score = 77.0 bits (188),  Expect(2) = 1e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  937  LKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPP  975



>gb|KHN39939.1| Cellulose synthase A catalytic subunit 3 [UDP-forming] [Glycine 
soja]
Length=1073

 Score =   174 bits (440),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  973   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1032

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1033  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1073


 Score = 77.0 bits (188),  Expect(2) = 1e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  937  LKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPP  975



>gb|KHM98952.1| Cellulose synthase A catalytic subunit 3 [UDP-forming] [Glycine 
soja]
Length=1062

 Score =   173 bits (439),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  962   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1021

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1022  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1062


 Score = 77.0 bits (188),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  926  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  964



>ref|XP_010445007.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Camelina sativa]
Length=1286

 Score =   174 bits (440),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 77/92 (84%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTVL+VNL+GIVAGVS+A+NSGYQSWGPLFG+LFFA+WVI HLYPFLKGLLGRQNRT
Sbjct  1185  IPPTTVLLVNLIGIVAGVSYAVNSGYQSWGPLFGKLFFALWVIAHLYPFLKGLLGRQNRT  1244

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKA  329
             PTIVIVWS+LLASIFSLLWVRI+PF   +  A
Sbjct  1245  PTIVIVWSVLLASIFSLLWVRINPFVDANPNA  1276


 Score = 76.6 bits (187),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713   LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
             LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+L+  P
Sbjct  1149  LKVLAGIDTNFTVTSKASDEDGDFAELYIFKWTALIIPP  1187



>gb|AEP33538.1| cellulose synthase catalytic subunit [Gossypium schwendimanii]
Length=1067

 Score =   173 bits (439),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  967   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1026

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1027  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1067


 Score = 77.0 bits (188),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  931  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  969



>ref|NP_001104955.1| cellulose synthase5 [Zea mays]
 gb|AAF89965.1|AF200529_1 cellulose synthase-5 [Zea mays]
Length=1076

 Score =   178 bits (452),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 79/102 (77%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+G+QNRT
Sbjct  976   IPPTTILIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGKQNRT  1035

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VW+ILLASIFSL+WVRIDPFT+         +CGINC
Sbjct  1036  PTIVVVWAILLASIFSLMWVRIDPFTT-RVTGPDIAKCGINC  1076


 Score = 72.0 bits (175),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDT+FTVTSKA+DE+GDFAELY+FKWT+LL  P
Sbjct  940  LKVLAGIDTSFTVTSKATDEEGDFAELYMFKWTTLLIPP  978



>tpg|DAA52080.1| TPA: cellulose synthase5 [Zea mays]
Length=1076

 Score =   178 bits (452),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 79/102 (77%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+G+QNRT
Sbjct  976   IPPTTILIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGKQNRT  1035

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VW+ILLASIFSL+WVRIDPFT+         +CGINC
Sbjct  1036  PTIVVVWAILLASIFSLMWVRIDPFTT-RVTGPDIAKCGINC  1076


 Score = 72.0 bits (175),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDT+FTVTSKA+DE+GDFAELY+FKWT+LL  P
Sbjct  940  LKVLAGIDTSFTVTSKATDEEGDFAELYMFKWTTLLIPP  978



>gb|AEP33557.1| cellulose synthase catalytic subunit [Gossypium gossypioides]
Length=1067

 Score =   173 bits (439),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  967   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1026

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1027  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1067


 Score = 77.0 bits (188),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  931  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  969



>gb|AEP33537.1| cellulose synthase catalytic subunit [Gossypium laxum]
Length=1067

 Score =   173 bits (439),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  967   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1026

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1027  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1067


 Score = 77.0 bits (188),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  931  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  969



>gb|AEP33552.1| cellulose synthase catalytic subunit [Gossypium armourianum]
Length=1067

 Score =   173 bits (439),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  967   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1026

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1027  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1067


 Score = 77.0 bits (188),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  931  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  969



>gb|AEP33556.1| cellulose synthase catalytic subunit [Gossypium aridum]
 gb|AEP33558.1| cellulose synthase catalytic subunit [Gossypium lobatum]
Length=1067

 Score =   173 bits (439),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  967   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1026

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1027  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1067


 Score = 77.0 bits (188),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  931  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  969



>gb|AEP33541.1| cellulose synthase catalytic subunit [Gossypium mustelinum]
Length=1067

 Score =   173 bits (439),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  967   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1026

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1027  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1067


 Score = 77.0 bits (188),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  931  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  969



>gb|AEP33547.1| cellulose synthase catalytic subunit [Gossypium barbadense var. 
brasiliense]
 gb|AEP33549.1| cellulose synthase catalytic subunit [Gossypium barbadense var. 
peruvianum]
Length=1066

 Score =   173 bits (439),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  966   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1025

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1026  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1066


 Score = 77.0 bits (188),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  930  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  968



>gb|AEP33551.1| cellulose synthase catalytic subunit [Gossypium hirsutum subsp. 
latifolium]
Length=1067

 Score =   173 bits (439),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  967   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1026

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1027  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1067


 Score = 77.0 bits (188),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  931  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  969



>gb|ADZ16119.1| cellulose synthase A3 [Gossypium barbadense]
Length=1067

 Score =   173 bits (439),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  967   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1026

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1027  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1067


 Score = 77.0 bits (188),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  931  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  969



>gb|ADZ16123.1| cellulose synthase A3 [Gossypium hirsutum]
Length=1067

 Score =   173 bits (439),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  967   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1026

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1027  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1067


 Score = 77.0 bits (188),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  931  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  969



>gb|AEP33554.1| cellulose synthase catalytic subunit [Gossypium davidsonii]
 gb|AEP33555.1| cellulose synthase catalytic subunit [Gossypium klotzschianum]
Length=1067

 Score =   173 bits (439),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  967   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1026

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1027  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1067


 Score = 77.0 bits (188),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  931  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  969



>gb|ADZ16121.1| cellulose synthase A3 [Gossypium raimondii]
Length=1067

 Score =   173 bits (439),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  967   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1026

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1027  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1067


 Score = 77.0 bits (188),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  931  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  969



>gb|AEP33543.1| cellulose synthase catalytic subunit [Gossypium darwinii]
Length=1067

 Score =   173 bits (439),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  967   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1026

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1027  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1067


 Score = 77.0 bits (188),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  931  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  969



>gb|AAQ63935.1| cellulose synthase [Pinus radiata]
Length=1096

 Score =   179 bits (453),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 81/102 (79%), Positives = 93/102 (91%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+N+VG+VAG+S+AI++GY+SWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  996   IPPTTLLIINIVGVVAGISYAISTGYRSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1055

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLASIFSLLWVRIDPFT+   K     QCGINC
Sbjct  1056  PTIVIVWSILLASIFSLLWVRIDPFTT-RIKGPDLQQCGINC  1096


 Score = 71.6 bits (174),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAG+DTNFTVTSKASDE GDFAELY+ KWT+LL  P
Sbjct  960  LKVLAGVDTNFTVTSKASDEGGDFAELYIIKWTALLIPP  998



>ref|XP_011087713.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Sesamum indicum]
 ref|XP_011087722.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Sesamum indicum]
Length=1066

 Score =   173 bits (439),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  966   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1025

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVR+DPFT+         QCGINC
Sbjct  1026  PTIVVVWSILLASIFSLLWVRVDPFTT-RVTGPDVEQCGINC  1066


 Score = 77.0 bits (188),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  930  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  968



>gb|ADZ16120.1| cellulose synthase A3 [Gossypium herbaceum subsp. africanum]
Length=1067

 Score =   173 bits (439),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  967   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFACWVIIHLYPFLKGLMGRQNRT  1026

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1027  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1067


 Score = 77.0 bits (188),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  931  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  969



>ref|XP_010241248.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Nelumbo nucifera]
 ref|XP_010241249.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Nelumbo nucifera]
 ref|XP_010241250.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Nelumbo nucifera]
Length=1071

 Score =   173 bits (439),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  971   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1030

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1031  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVQQCGINC  1071


 Score = 77.0 bits (188),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  935  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  973



>ref|XP_009386450.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Musa acuminata subsp. malaccensis]
 ref|XP_009386451.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Musa acuminata subsp. malaccensis]
Length=1066

 Score =   173 bits (439),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVNLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  966   IPPTTLLIVNLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1025

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVR+DPFT+         QCGINC
Sbjct  1026  PTIVVVWSILLASIFSLLWVRVDPFTT-RVTGPDVQQCGINC  1066


 Score = 77.0 bits (188),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  930  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  968



>gb|AHL45026.1| cellulose synthase 3B [Linum usitatissimum]
Length=1059

 Score =   174 bits (442),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+L++NLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  959   IPPTTLLVINLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1018

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1019  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVDQCGINC  1059


 Score = 75.9 bits (185),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+DEDGDFAELY+FKWT+LL  P
Sbjct  923  LKVLAGIDTNFTVTSKANDEDGDFAELYLFKWTTLLIPP  961



>gb|EYU29030.1| hypothetical protein MIMGU_mgv1a000570mg [Erythranthe guttata]
Length=1065

 Score =   173 bits (438),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVN+VG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  965   IPPTTLLIVNIVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1024

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1025  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1065


 Score = 77.0 bits (188),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  929  LKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPP  967



>ref|XP_011093547.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Sesamum indicum]
Length=1047

 Score =   173 bits (438),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  947   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1006

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVR+DPFT+         QCGINC
Sbjct  1007  PTIVVVWSILLASIFSLLWVRVDPFTT-RVTGPDVEQCGINC  1047


 Score = 77.0 bits (188),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  911  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  949



>gb|KDP26042.1| hypothetical protein JCGZ_21075 [Jatropha curcas]
Length=957

 Score =   173 bits (438),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604  IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
            IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  857  IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  916

Query  424  PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
            PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  917  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVQQCGINC  957


 Score = 77.0 bits (188),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  821  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  859



>ref|XP_010906116.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Elaeis guineensis]
 ref|XP_010906117.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming] [Elaeis guineensis]
Length=1068

 Score =   173 bits (438),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  968   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1027

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVR+DPFT+         QCGINC
Sbjct  1028  PTIVVVWSILLASIFSLLWVRVDPFTT-RVTGPDVQQCGINC  1068


 Score = 77.0 bits (188),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  932  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  970



>gb|AEP33542.1| truncated cellulose synthase catalytic subunit [Gossypium darwinii]
 gb|AEP33546.1| truncated cellulose synthase catalytic subunit [Gossypium barbadense 
var. brasiliense]
 gb|AEP33548.1| truncated cellulose synthase catalytic subunit [Gossypium barbadense 
var. peruvianum]
Length=684

 Score =   172 bits (437),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604  IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
            IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  584  IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  643

Query  424  PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
            PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  644  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  684


 Score = 77.4 bits (189),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  548  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  586



>gb|ADZ16122.1| truncated cellulose synthase A3 [Gossypium hirsutum]
Length=684

 Score =   172 bits (437),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604  IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
            IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  584  IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  643

Query  424  PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
            PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  644  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  684


 Score = 77.4 bits (189),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  548  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  586



>gb|AEP33544.1| truncated cellulose synthase catalytic subunit [Gossypium tomentosum]
Length=684

 Score =   172 bits (437),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604  IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
            IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  584  IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  643

Query  424  PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
            PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  644  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  684


 Score = 77.4 bits (189),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  548  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  586



>gb|AEP33550.1| truncated cellulose synthase catalytic subunit [Gossypium hirsutum 
subsp. latifolium]
Length=684

 Score =   172 bits (437),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604  IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
            IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  584  IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  643

Query  424  PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
            PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  644  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  684


 Score = 77.4 bits (189),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  548  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  586



>ref|XP_009799381.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Nicotiana sylvestris]
Length=1087

 Score =   172 bits (437),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVNLVG+VAG+S+A+NSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  987   IPPTTLLIVNLVGVVAGISYAVNSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1046

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         +CGINC
Sbjct  1047  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVQECGINC  1087


 Score = 77.0 bits (188),  Expect(2) = 3e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  951  LKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPP  989



>ref|XP_009601834.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Nicotiana tomentosiformis]
 ref|XP_009601835.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Nicotiana tomentosiformis]
Length=1087

 Score =   172 bits (437),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVNLVG+VAG+S+A+NSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  987   IPPTTLLIVNLVGVVAGISYAVNSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1046

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         +CGINC
Sbjct  1047  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVQECGINC  1087


 Score = 77.0 bits (188),  Expect(2) = 3e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  951  LKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPP  989



>ref|XP_007133819.1| hypothetical protein PHAVU_011G211500g [Phaseolus vulgaris]
 gb|ESW05813.1| hypothetical protein PHAVU_011G211500g [Phaseolus vulgaris]
Length=1074

 Score =   172 bits (436),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+N+VG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  974   IPPTTLLIINMVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1033

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         +CGINC
Sbjct  1034  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEECGINC  1074


 Score = 77.0 bits (188),  Expect(2) = 3e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  938  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  976



>gb|AEP33540.1| cellulose synthase catalytic subunit [Gossypium mustelinum]
Length=1067

 Score =   172 bits (436),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  967   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGNLFFAFWVIIHLYPFLKGLMGRQNRT  1026

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1027  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1067


 Score = 77.0 bits (188),  Expect(2) = 3e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  931  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  969



>ref|NP_001289668.1| cellulose synthase A catalytic subunit 3 [UDP-forming]-like [Eucalyptus 
grandis]
 gb|ABY25274.1| cellulose synthase [Eucalyptus grandis]
 gb|KCW66107.1| hypothetical protein EUGRSUZ_G03380 [Eucalyptus grandis]
 gb|KCW66108.1| hypothetical protein EUGRSUZ_G03380 [Eucalyptus grandis]
Length=1080

 Score =   176 bits (446),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 93/102 (91%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  980   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1039

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+      A  QCGINC
Sbjct  1040  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPAVEQCGINC  1080


 Score = 73.6 bits (179),  Expect(2) = 4e-57, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGD AELY+FKWT+LL  P
Sbjct  944  LKVLAGIDTNFTVTSKASDEDGDSAELYMFKWTTLLIPP  982



>gb|ABY25277.1| cellulose synthase [Eucalyptus grandis]
Length=1080

 Score =   176 bits (445),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 93/102 (91%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  980   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1039

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+      A  QCGINC
Sbjct  1040  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPAVEQCGINC  1080


 Score = 73.6 bits (179),  Expect(2) = 4e-57, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGD AELY+FKWT+LL  P
Sbjct  944  LKVLAGIDTNFTVTSKASDEDGDSAELYMFKWTTLLIPP  982



>ref|XP_004162186.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis sativus]
Length=1070

 Score =   172 bits (436),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+N+VG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  970   IPPTTLLIINIVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1029

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1030  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1070


 Score = 77.0 bits (188),  Expect(2) = 4e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  934  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  972



>ref|XP_006296592.1| hypothetical protein CARUB_v10012872mg [Capsella rubella]
 gb|EOA29490.1| hypothetical protein CARUB_v10012872mg [Capsella rubella]
Length=1077

 Score =   178 bits (451),  Expect(2) = 4e-57, Method: Composition-based stats.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             +PPTT+LI+NLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  977   VPPTTLLIINLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1036

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTI++VWS+LLASIFSLLWVRIDPFTS          CGINC
Sbjct  1037  PTIIVVWSVLLASIFSLLWVRIDPFTS-RVTGPDVMLCGINC  1077


 Score = 70.9 bits (172),  Expect(2) = 4e-57, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGD AELY+ KWT+LL  P
Sbjct  941  LKVLAGIDTNFTVTSKASDEDGDSAELYLIKWTTLLVPP  979



>ref|XP_008460760.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis melo]
Length=1050

 Score =   172 bits (436),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+N+VG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  950   IPPTTLLIINIVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1009

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1010  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1050


 Score = 77.0 bits (188),  Expect(2) = 4e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  914  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  952



>ref|XP_004149389.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis sativus]
 gb|KGN53854.1| hypothetical protein Csa_4G166980 [Cucumis sativus]
Length=1050

 Score =   172 bits (436),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+N+VG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  950   IPPTTLLIINIVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1009

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1010  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1050


 Score = 77.0 bits (188),  Expect(2) = 4e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  914  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  952



>ref|XP_010541595.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like 
[Tarenaya hassleriana]
Length=1072

 Score =   172 bits (437),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTTV+IVNLVGIVAGVS AINSGY SWGPL GRLFFA+WVI+HLYPFLKGLLGRQNRT
Sbjct  971   IPPTTVIIVNLVGIVAGVSSAINSGYDSWGPLVGRLFFAMWVIMHLYPFLKGLLGRQNRT  1030

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIVIVWSILLAS+FSLLW RI+PF +D  K A+   CGI+C
Sbjct  1031  PTIVIVWSILLASVFSLLWARINPFDADPGKIASKHWCGIDC  1072


 Score = 76.3 bits (186),  Expect(2) = 5e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDG+F+ELYVFKWTSLL  P
Sbjct  935  LKVLAGIDTNFTVTSKASDEDGEFSELYVFKWTSLLIPP  973



>ref|XP_006838305.1| hypothetical protein AMTR_s00103p00124340 [Amborella trichopoda]
 gb|ERN00874.1| hypothetical protein AMTR_s00103p00124340 [Amborella trichopoda]
Length=1088

 Score =   173 bits (439),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  988   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1047

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWS+LLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1048  PTIVVVWSVLLASIFSLLWVRIDPFTT-RVTGPDVQQCGINC  1088


 Score = 75.9 bits (185),  Expect(2) = 5e-57, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+DEDGDFAELY+FKWT+LL  P
Sbjct  952  LKVLAGIDTNFTVTSKATDEDGDFAELYMFKWTTLLIPP  990



>ref|XP_010278977.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Nelumbo nucifera]
 ref|XP_010278978.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Nelumbo nucifera]
 ref|XP_010278979.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Nelumbo nucifera]
Length=1056

 Score =   174 bits (440),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  956   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1015

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1016  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVQQCGINC  1056


 Score = 75.1 bits (183),  Expect(2) = 5e-57, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDE+GDFAELY+FKWT+LL  P
Sbjct  920  LKVLAGIDTNFTVTSKASDEEGDFAELYMFKWTTLLIPP  958



>gb|KHN19454.1| Cellulose synthase A catalytic subunit 3 [UDP-forming] [Glycine 
soja]
Length=1093

 Score =   172 bits (435),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  993   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1052

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWS+LLASIFSLLWVRIDPFT+         +CGINC
Sbjct  1053  PTIVVVWSVLLASIFSLLWVRIDPFTT-RVTGPDVEECGINC  1093


 Score = 77.0 bits (188),  Expect(2) = 5e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  957  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  995



>dbj|BAF01916.1| cellulose synthase catalytic subunit [Arabidopsis thaliana]
Length=431

 Score =   171 bits (434),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604  IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
            IPPTT+LIVNLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  331  IPPTTLLIVNLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  390

Query  424  PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
            PTIV+VWS+LLASIFSLLWVRIDPFTS         +CGINC
Sbjct  391  PTIVVVWSVLLASIFSLLWVRIDPFTS-RVTGPDILECGINC  431


 Score = 77.4 bits (189),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  295  LKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPP  333



>gb|AAD39534.2| cellulose synthase catalytic subunit [Gossypium hirsutum]
Length=1067

 Score =   172 bits (435),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+ INSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  967   IPPTTLLIINLVGVVAGISYVINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1026

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1027  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1067


 Score = 77.0 bits (188),  Expect(2) = 5e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  931  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  969



>ref|XP_003540527.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Glycine max]
Length=1079

 Score =   172 bits (435),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  979   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1038

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWS+LLASIFSLLWVRIDPFT+         +CGINC
Sbjct  1039  PTIVVVWSVLLASIFSLLWVRIDPFTT-RVTGPDVEECGINC  1079


 Score = 77.0 bits (188),  Expect(2) = 6e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  943  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  981



>emb|CBI29854.3| unnamed protein product [Vitis vinifera]
Length=1243

 Score =   173 bits (439),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  1143  IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1202

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1203  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1243


 Score = 75.1 bits (183),  Expect(2) = 6e-57, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713   LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
             LKVLAGIDTNFTVTSKASDE+GDFAELY+FKWT+LL  P
Sbjct  1107  LKVLAGIDTNFTVTSKASDEEGDFAELYMFKWTTLLIPP  1145



>gb|KDO83412.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
Length=1082

 Score =   173 bits (439),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+L++NLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  982   IPPTTLLVINLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1041

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVR+DPFT+         QCGINC
Sbjct  1042  PTIVVVWSILLASIFSLLWVRVDPFTT-RVTGPDVEQCGINC  1082


 Score = 75.5 bits (184),  Expect(2) = 6e-57, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDF ELY+FKWT+LL  P
Sbjct  946  LKVLAGIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPP  984



>gb|KDO83413.1| hypothetical protein CISIN_1g001413mg [Citrus sinensis]
Length=918

 Score =   173 bits (439),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604  IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
            IPPTT+L++NLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  818  IPPTTLLVINLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  877

Query  424  PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
            PTIV+VWSILLASIFSLLWVR+DPFT+         QCGINC
Sbjct  878  PTIVVVWSILLASIFSLLWVRVDPFTT-RVTGPDVEQCGINC  918


 Score = 75.5 bits (184),  Expect(2) = 6e-57, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDF ELY+FKWT+LL  P
Sbjct  782  LKVLAGIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPP  820



>ref|XP_011033321.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X2 [Populus euphratica]
Length=1064

 Score =   173 bits (439),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+L++NLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  964   IPPTTLLVINLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1023

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWS+LLASIFSLLWVR+DPFT+         QCGINC
Sbjct  1024  PTIVVVWSVLLASIFSLLWVRVDPFTT-KVTGPDVAQCGINC  1064


 Score = 75.5 bits (184),  Expect(2) = 6e-57, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDF ELY+FKWT+LL  P
Sbjct  928  LKVLAGIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPP  966



>ref|XP_011047398.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
isoform X1 [Populus euphratica]
 ref|XP_011047399.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
isoform X2 [Populus euphratica]
 ref|XP_011047400.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
isoform X1 [Populus euphratica]
Length=1079

 Score =   171 bits (434),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             +PPTT+LIVNLVG+VAG+S AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  979   VPPTTLLIVNLVGVVAGISHAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1038

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVR+DPFT+         QCGINC
Sbjct  1039  PTIVVVWSILLASIFSLLWVRVDPFTT-RVTGPDVEQCGINC  1079


 Score = 77.0 bits (188),  Expect(2) = 6e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  943  LKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLVPP  981



>ref|NP_001059162.1| Os07g0208500 [Oryza sativa Japonica Group]
 sp|Q84ZN6.1|CESA8_ORYSJ RecName: Full=Probable cellulose synthase A catalytic subunit 
8 [UDP-forming]; AltName: Full=OsCesA8 [Oryza sativa Japonica 
Group]
 dbj|BAC57282.1| cellulose synthase-4 [Oryza sativa Japonica Group]
 dbj|BAD30175.1| cellulose synthase-4 [Oryza sativa Japonica Group]
 dbj|BAF21076.1| Os07g0208500 [Oryza sativa Japonica Group]
 gb|EAZ39084.1| hypothetical protein OsJ_23516 [Oryza sativa Japonica Group]
 dbj|BAG92935.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1081

 Score =   171 bits (434),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  981   IPPTTILIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1040

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VW+ILLASIFSLLWVRIDPFT+          CGINC
Sbjct  1041  PTIVVVWAILLASIFSLLWVRIDPFTT-RVTGPDTQTCGINC  1081


 Score = 77.0 bits (188),  Expect(2) = 6e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  945  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  983



>ref|XP_010257191.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Nelumbo nucifera]
Length=1076

 Score =   173 bits (439),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  976   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1035

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1036  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVQQCGINC  1076


 Score = 75.1 bits (183),  Expect(2) = 6e-57, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDE+GDFAELY+FKWT+LL  P
Sbjct  940  LKVLAGIDTNFTVTSKASDEEGDFAELYMFKWTTLLIPP  978



>ref|XP_006373780.1| hypothetical protein POPTR_0016s05520g [Populus trichocarpa]
 gb|ERP51577.1| hypothetical protein POPTR_0016s05520g [Populus trichocarpa]
Length=1064

 Score =   173 bits (438),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  964   IPPTTLLIINLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1023

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWS+LLASIFSLLWVR+DPFT+         QCGINC
Sbjct  1024  PTIVVVWSVLLASIFSLLWVRVDPFTT-KVTGPDVTQCGINC  1064


 Score = 75.5 bits (184),  Expect(2) = 7e-57, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDF ELY+FKWT+LL  P
Sbjct  928  LKVLAGIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPP  966



>ref|XP_006657551.1| PREDICTED: probable cellulose synthase A catalytic subunit 8 
[UDP-forming]-like [Oryza brachyantha]
Length=1081

 Score =   171 bits (434),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  981   IPPTTILIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1040

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VW+ILLASIFSLLWVRIDPFT+          CGINC
Sbjct  1041  PTIVVVWAILLASIFSLLWVRIDPFTT-RVTGPDTQTCGINC  1081


 Score = 77.0 bits (188),  Expect(2) = 7e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  945  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  983



>ref|XP_002461675.1| hypothetical protein SORBIDRAFT_02g006290 [Sorghum bicolor]
 gb|EER98196.1| hypothetical protein SORBIDRAFT_02g006290 [Sorghum bicolor]
Length=1081

 Score =   171 bits (434),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  981   IPPTTILIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1040

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VW+ILLASIFSLLWVRIDPFT+          CGINC
Sbjct  1041  PTIVVVWAILLASIFSLLWVRIDPFTT-RVTGPDTQTCGINC  1081


 Score = 77.0 bits (188),  Expect(2) = 7e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  945  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  983



>ref|XP_010667061.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Beta vulgaris subsp. vulgaris]
Length=1061

 Score =   171 bits (434),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLV +VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  961   IPPTTLLIINLVAVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1020

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVR+DPFT+         QCGINC
Sbjct  1021  PTIVVVWSILLASIFSLLWVRVDPFTT-RVTGPDIKQCGINC  1061


 Score = 77.0 bits (188),  Expect(2) = 7e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  925  LKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPP  963



>ref|XP_011033320.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X1 [Populus euphratica]
Length=1068

 Score =   173 bits (438),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+L++NLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  968   IPPTTLLVINLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1027

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWS+LLASIFSLLWVR+DPFT+         QCGINC
Sbjct  1028  PTIVVVWSVLLASIFSLLWVRVDPFTT-KVTGPDVAQCGINC  1068


 Score = 75.5 bits (184),  Expect(2) = 7e-57, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDF ELY+FKWT+LL  P
Sbjct  932  LKVLAGIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPP  970



>ref|XP_002322712.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEF04473.1| cellulose synthase family protein [Populus trichocarpa]
Length=1068

 Score =   173 bits (438),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  968   IPPTTLLIINLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1027

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWS+LLASIFSLLWVR+DPFT+         QCGINC
Sbjct  1028  PTIVVVWSVLLASIFSLLWVRVDPFTT-KVTGPDVTQCGINC  1068


 Score = 75.5 bits (184),  Expect(2) = 7e-57, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDF ELY+FKWT+LL  P
Sbjct  932  LKVLAGIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPP  970



>ref|XP_006293591.1| hypothetical protein CARUB_v10022538mg [Capsella rubella]
 gb|EOA26489.1| hypothetical protein CARUB_v10022538mg [Capsella rubella]
Length=1091

 Score =   169 bits (427),  Expect(2) = 7e-57, Method: Composition-based stats.
 Identities = 76/90 (84%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+L+VNLVGIVAGVS+AINSGYQSWGPL G+LFFA+WV+ HLYPFLKGLLGRQNRT
Sbjct  992   IPPTTILLVNLVGIVAGVSYAINSGYQSWGPLMGKLFFALWVVAHLYPFLKGLLGRQNRT  1051

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSA  335
             PTIVIVWS LLASIFSLLWVRI+PF S + 
Sbjct  1052  PTIVIVWSALLASIFSLLWVRINPFVSTTG  1081


 Score = 79.3 bits (194),  Expect(2) = 7e-57, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLL  P
Sbjct  956  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLIPP  994



>ref|XP_010653789.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Vitis vinifera]
Length=1087

 Score =   173 bits (438),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  987   IPPTTLLIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1046

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1047  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEQCGINC  1087


 Score = 75.1 bits (183),  Expect(2) = 7e-57, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDE+GDFAELY+FKWT+LL  P
Sbjct  951  LKVLAGIDTNFTVTSKASDEEGDFAELYMFKWTTLLIPP  989



>ref|XP_004229630.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Solanum lycopersicum]
Length=1083

 Score =   171 bits (433),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVNLVG+VAG+S+A+NSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  983   IPPTTLLIVNLVGVVAGISYAVNSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1042

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+          CGINC
Sbjct  1043  PTIVVVWSILLASIFSLLWVRIDPFTTRVTGPDVQA-CGINC  1083


 Score = 77.0 bits (188),  Expect(2) = 8e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  947  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  985



>ref|XP_003542849.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X1 [Glycine max]
 ref|XP_006594411.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X2 [Glycine max]
 ref|XP_006594412.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X3 [Glycine max]
 ref|XP_006594413.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
isoform X4 [Glycine max]
Length=1080

 Score =   171 bits (433),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+N++G+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  980   IPPTTLLIINMIGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1039

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         +CGINC
Sbjct  1040  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEECGINC  1080


 Score = 77.0 bits (188),  Expect(2) = 8e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  944  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  982



>ref|NP_001104959.1| cellulose synthase-9 [Zea mays]
 gb|AAF89969.1|AF200533_1 cellulose synthase-9 [Zea mays]
Length=1079

 Score =   171 bits (433),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  979   IPPTTILIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1038

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VW+ILLASIFSLLWVRIDPFT +         CGINC
Sbjct  1039  PTIVVVWAILLASIFSLLWVRIDPFT-NRVTGPDTRTCGINC  1079


 Score = 77.0 bits (188),  Expect(2) = 8e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  943  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  981



>ref|XP_008668614.1| PREDICTED: cellulose synthase-9 isoform X1 [Zea mays]
 tpg|DAA39506.1| TPA: cellulose synthase9 [Zea mays]
Length=1079

 Score =   171 bits (433),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  979   IPPTTILIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1038

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VW+ILLASIFSLLWVRIDPFT+          CGINC
Sbjct  1039  PTIVVVWAILLASIFSLLWVRIDPFTT-RVTGPDTRTCGINC  1079


 Score = 77.0 bits (188),  Expect(2) = 8e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  943  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  981



>ref|XP_011020351.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic 
subunit 3 [UDP-forming]-like [Populus euphratica]
Length=1085

 Score =   173 bits (438),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  985   IPPTTLLIINLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1044

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTI++VWS+LLASIFSLLWVR+DPFT+         QCGINC
Sbjct  1045  PTIIVVWSVLLASIFSLLWVRVDPFTT-RVTGPDVEQCGINC  1085


 Score = 75.5 bits (184),  Expect(2) = 8e-57, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDF ELY+FKWT+LL  P
Sbjct  949  LKVLAGIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPP  987



>ref|XP_007028786.1| Cellulose synthase family protein [Theobroma cacao]
 gb|EOY09288.1| Cellulose synthase family protein [Theobroma cacao]
Length=1069

 Score =   171 bits (433),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNR 
Sbjct  969   IPPTTLLIINLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRM  1028

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VW+ILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1029  PTIVVVWAILLASIFSLLWVRIDPFTT-QVTGPDVEQCGINC  1069


 Score = 77.0 bits (188),  Expect(2) = 8e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  933  LKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPP  971



>gb|AFZ78565.1| cellulose synthase [Populus tomentosa]
Length=1064

 Score =   172 bits (437),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  964   IPPTTLLIINLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1023

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWS+LLASIFSLLWVR+DPFT+         QCGINC
Sbjct  1024  PTIVVVWSVLLASIFSLLWVRVDPFTT-RVTGPDVTQCGINC  1064


 Score = 75.5 bits (184),  Expect(2) = 8e-57, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDF ELY+FKWT+LL  P
Sbjct  928  LKVLAGIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPP  966



>gb|KHN37622.1| Cellulose synthase A catalytic subunit 3 [UDP-forming] [Glycine 
soja]
Length=1091

 Score =   171 bits (433),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+N++G+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  991   IPPTTLLIINMIGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1050

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+         +CGINC
Sbjct  1051  PTIVVVWSILLASIFSLLWVRIDPFTT-RVTGPDVEECGINC  1091


 Score = 77.0 bits (188),  Expect(2) = 9e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  955  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  993



>ref|XP_004135931.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Cucumis sativus]
 gb|KGN45128.1| hypothetical protein Csa_7G428160 [Cucumis sativus]
Length=1083

 Score =   172 bits (436),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 93/102 (91%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVNLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  983   IPPTTLLIVNLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1042

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+ +       +CGINC
Sbjct  1043  PTIVVVWSILLASIFSLLWVRIDPFTT-TVIGPDVEECGINC  1083


 Score = 75.9 bits (185),  Expect(2) = 9e-57, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGD+AELY+FKWT+LL  P
Sbjct  947  LKVLAGIDTNFTVTSKASDEDGDYAELYMFKWTTLLIPP  985



>gb|KHG04072.1| putative cellulose synthase A catalytic subunit 8 [UDP-forming] 
[Gossypium arboreum]
Length=1068

 Score =   171 bits (433),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNR 
Sbjct  968   IPPTTLLIINLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRM  1027

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VW+ILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1028  PTIVVVWAILLASIFSLLWVRIDPFTT-KVTGPDVEQCGINC  1068


 Score = 77.0 bits (188),  Expect(2) = 9e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  932  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  970



>gb|AFB18638.1| CESA10 [Gossypium hirsutum]
Length=1068

 Score =   171 bits (433),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNR 
Sbjct  968   IPPTTLLIINLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRM  1027

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VW+ILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1028  PTIVVVWAILLASIFSLLWVRIDPFTT-KVTGPDVEQCGINC  1068


 Score = 77.0 bits (188),  Expect(2) = 9e-57, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  932  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  970



>ref|XP_010491045.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like 
[Camelina sativa]
Length=347

 Score =   170 bits (431),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604  IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
            IPPTT+LIVNLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  247  IPPTTLLIVNLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  306

Query  424  PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
            PTIV+VWS+LLASIFSLLWVRIDPFTS         +CGINC
Sbjct  307  PTIVVVWSVLLASIFSLLWVRIDPFTS-RVTGPDILECGINC  347


 Score = 77.8 bits (190),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  211  LKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPP  249



>gb|KJB19277.1| hypothetical protein B456_003G092600 [Gossypium raimondii]
Length=1069

 Score =   171 bits (432),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNR 
Sbjct  969   IPPTTLLIINLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRM  1028

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VW+ILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1029  PTIVVVWAILLASIFSLLWVRIDPFTT-KVTGPDVEQCGINC  1069


 Score = 77.0 bits (188),  Expect(2) = 1e-56, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  933  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  971



>ref|XP_008651867.1| PREDICTED: cellulose synthase-4 isoform X1 [Zea mays]
Length=870

 Score =   171 bits (432),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604  IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
            IPPTT+LI+NLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  770  IPPTTILIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  829

Query  424  PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
            PTIV+VW+ILLASIFSLLWVRIDPFT+          CGINC
Sbjct  830  PTIVVVWAILLASIFSLLWVRIDPFTT-RVTGPDTQTCGINC  870


 Score = 77.0 bits (188),  Expect(2) = 1e-56, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  734  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  772



>gb|KJB19276.1| hypothetical protein B456_003G092600 [Gossypium raimondii]
Length=1068

 Score =   171 bits (432),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNR 
Sbjct  968   IPPTTLLIINLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRM  1027

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VW+ILLASIFSLLWVRIDPFT+         QCGINC
Sbjct  1028  PTIVVVWAILLASIFSLLWVRIDPFTT-KVTGPDVEQCGINC  1068


 Score = 77.0 bits (188),  Expect(2) = 1e-56, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  932  LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPP  970



>ref|XP_002308955.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE92478.1| cellulose synthase family protein [Populus trichocarpa]
Length=1058

 Score =   172 bits (437),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LI+NLVG+VAGVS+AINSGYQSWGPLFG+LFFA WVI+HLYPFLKGL+GRQNRT
Sbjct  958   IPPTTLLIINLVGVVAGVSYAINSGYQSWGPLFGKLFFAFWVIIHLYPFLKGLMGRQNRT  1017

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTI++VWS+LLASIFSLLWVR+DPFT+         QCGINC
Sbjct  1018  PTIIVVWSVLLASIFSLLWVRVDPFTT-RVTGPDVEQCGINC  1058


 Score = 75.1 bits (183),  Expect(2) = 1e-56, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDF ELY+FKWT+LL  P
Sbjct  922  LKVLAGIDTNFTVTSKASDEDGDFTELYMFKWTTLLIPP  960



>ref|NP_001275292.1| cellulose synthase [Solanum tuberosum]
 gb|AAP97495.1| cellulose synthase [Solanum tuberosum]
Length=1083

 Score =   172 bits (435),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVNLVG+VAG+S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  983   IPPTTLLIVNLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1042

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGGQCGINC  299
             PTIV+VWSILLASIFSLLWVRIDPFT+          CGINC
Sbjct  1043  PTIVVVWSILLASIFSLLWVRIDPFTTRVTGPDVQA-CGINC  1083


 Score = 75.9 bits (185),  Expect(2) = 1e-56, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKA+DEDGDFAELY+FKWT+LL  P
Sbjct  947  LKVLAGIDTNFTVTSKATDEDGDFAELYLFKWTTLLIPP  985



>ref|XP_009130870.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Brassica rapa]
 ref|XP_009130871.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming] 
[Brassica rapa]
Length=1066

 Score =   171 bits (432),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 92/105 (88%), Gaps = 7/105 (7%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVNLVG+VAG S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  966   IPPTTLLIVNLVGVVAGFSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1025

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGG---QCGINC  299
             PTIV+VWS+LLASIFSLLWVRIDPFT    K   G    +CGINC
Sbjct  1026  PTIVVVWSVLLASIFSLLWVRIDPFT----KRVTGPDILECGINC  1066


 Score = 77.0 bits (188),  Expect(2) = 1e-56, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  930  LKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPP  968



>emb|CDY14127.1| BnaC02g02440D [Brassica napus]
Length=1066

 Score =   171 bits (432),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 92/105 (88%), Gaps = 7/105 (7%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVNLVG+VAG S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  966   IPPTTLLIVNLVGVVAGFSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1025

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGG---QCGINC  299
             PTIV+VWS+LLASIFSLLWVRIDPFT    K   G    +CGINC
Sbjct  1026  PTIVVVWSVLLASIFSLLWVRIDPFT----KRVTGPDILECGINC  1066


 Score = 77.0 bits (188),  Expect(2) = 1e-56, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  930  LKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPP  968



>emb|CDY52141.1| BnaA03g55200D [Brassica napus]
Length=1066

 Score =   171 bits (432),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 92/105 (88%), Gaps = 7/105 (7%)
 Frame = -3

Query  604   IPPTTVLIVNLVGIVAGVSFAINSGYQSWGPLFGRLFFAIWVIVHLYPFLKGLLGRQNRT  425
             IPPTT+LIVNLVG+VAG S+AINSGYQSWGPLFG+LFFA WVIVHLYPFLKGL+GRQNRT
Sbjct  966   IPPTTLLIVNLVGVVAGFSYAINSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRT  1025

Query  424   PTIVIVWSILLASIFSLLWVRIDPFTSDSAKAAAGG---QCGINC  299
             PTIV+VWS+LLASIFSLLWVRIDPFT    K   G    +CGINC
Sbjct  1026  PTIVVVWSVLLASIFSLLWVRIDPFT----KRVTGPDILECGINC  1066


 Score = 77.0 bits (188),  Expect(2) = 1e-56, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  713  LKVLAGIDTNFTVTSKASDEDGDFAELYVFKWTSLLHSP  597
            LKVLAGIDTNFTVTSKASDEDGDFAELY+FKWT+LL  P
Sbjct  930  LKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPP  968



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1246782646395