BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF011A01

Length=770
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP15204.1|  unnamed protein product                                343   4e-113   Coffea canephora [robusta coffee]
ref|XP_011092192.1|  PREDICTED: shaggy-related protein kinase alpha     340   7e-112   Sesamum indicum [beniseed]
emb|CAA67554.1|  protein kinase                                         337   9e-112   Trifolium repens [creeping white clover]
ref|XP_004495628.1|  PREDICTED: glycogen synthase kinase-3 homolo...    339   2e-111   
gb|KDP23349.1|  hypothetical protein JCGZ_23182                         339   2e-111   Jatropha curcas
gb|AFH00876.1|  glycogen synthase kinase-3                              338   5e-111   Glycine soja [wild soybean]
ref|XP_010486058.1|  PREDICTED: shaggy-related protein kinase gam...    338   6e-111   Camelina sativa [gold-of-pleasure]
ref|XP_006588432.1|  PREDICTED: glycogen synthase kinase-3 isofor...    338   6e-111   Glycine max [soybeans]
gb|KCW84976.1|  hypothetical protein EUGRSUZ_B01797                     336   6e-111   Eucalyptus grandis [rose gum]
ref|XP_010938176.1|  PREDICTED: shaggy-related protein kinase alp...    337   7e-111   Elaeis guineensis
ref|XP_008793304.1|  PREDICTED: shaggy-related protein kinase alp...    337   7e-111   
ref|XP_006299606.1|  hypothetical protein CARUB_v10015785mg             337   7e-111   Capsella rubella
ref|XP_004495625.1|  PREDICTED: glycogen synthase kinase-3 homolo...    338   7e-111   
emb|CBI39647.3|  unnamed protein product                                337   7e-111   Vitis vinifera
ref|XP_007145031.1|  hypothetical protein PHAVU_007G204000g             337   7e-111   Phaseolus vulgaris [French bean]
ref|NP_001242661.1|  glycogen synthase kinase-3                         337   7e-111   
ref|XP_006408021.1|  hypothetical protein EUTSA_v10020835mg             337   8e-111   Eutrema salsugineum [saltwater cress]
dbj|BAJ34573.1|  unnamed protein product                                337   8e-111   Eutrema halophilum
gb|KGN65982.1|  hypothetical protein Csa_1G560660                       336   9e-111   Cucumis sativus [cucumbers]
gb|ACQ91102.1|  glycogen synthase kinase                                337   1e-110   Glycine max [soybeans]
ref|XP_002882438.1|  hypothetical protein ARALYDRAFT_477878             337   2e-110   
ref|XP_003554602.1|  PREDICTED: shaggy-related protein kinase alp...    337   2e-110   Glycine max [soybeans]
ref|XP_010042192.1|  PREDICTED: shaggy-related protein kinase alpha     337   2e-110   Eucalyptus grandis [rose gum]
gb|KHG02936.1|  Shaggy-related protein kinase alpha                     336   2e-110   Gossypium arboreum [tree cotton]
ref|XP_002280673.1|  PREDICTED: shaggy-related protein kinase alpha     336   2e-110   Vitis vinifera
gb|KJB45479.1|  hypothetical protein B456_007G308500                    336   2e-110   Gossypium raimondii
ref|XP_004135570.1|  PREDICTED: shaggy-related protein kinase alp...    336   2e-110   Cucumis sativus [cucumbers]
ref|XP_003591238.1|  Glycogen synthase kinase                           336   2e-110   Medicago truncatula
ref|XP_009386339.1|  PREDICTED: shaggy-related protein kinase alp...    336   2e-110   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010432712.1|  PREDICTED: shaggy-related protein kinase gam...    336   3e-110   Camelina sativa [gold-of-pleasure]
ref|XP_010464137.1|  PREDICTED: shaggy-related protein kinase gamma     336   3e-110   Camelina sativa [gold-of-pleasure]
ref|XP_009134851.1|  PREDICTED: shaggy-related protein kinase gamma     336   3e-110   Brassica rapa
gb|EPS63877.1|  hypothetical protein M569_10905                         335   7e-110   Genlisea aurea
gb|AAM62970.1|  shaggy related protein kinase ASK-GAMMA                 335   8e-110   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD95892.1|  Ser/Thr protein kinase                                 335   8e-110   Lotus japonicus
ref|XP_010546768.1|  PREDICTED: shaggy-related protein kinase alpha     334   9e-110   Tarenaya hassleriana [spider flower]
ref|NP_187235.1|  Shaggy-related protein kinase gamma                   335   9e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010921357.1|  PREDICTED: shaggy-related protein kinase alpha     334   1e-109   
ref|XP_010270906.1|  PREDICTED: shaggy-related protein kinase alp...    334   1e-109   Nelumbo nucifera [Indian lotus]
gb|KHN26183.1|  Glycogen synthase kinase-3 like MsK-1                   333   1e-109   Glycine soja [wild soybean]
ref|XP_006576226.1|  PREDICTED: uncharacterized protein LOC100788...    334   1e-109   
gb|EPS73818.1|  hypothetical protein M569_00937                         334   1e-109   Genlisea aurea
ref|XP_004163362.1|  PREDICTED: shaggy-related protein kinase alp...    334   1e-109   
ref|XP_003555781.1|  PREDICTED: glycogen synthase kinase-3 homolo...    335   1e-109   Glycine max [soybeans]
sp|P51137.1|MSK1_MEDSA  RecName: Full=Glycogen synthase kinase-3 ...    334   2e-109   Medicago sativa [alfalfa]
ref|XP_007031229.1|  Shaggy-related kinase 11, 11 isoform 1             334   2e-109   
ref|XP_010270905.1|  PREDICTED: shaggy-related protein kinase alp...    335   2e-109   Nelumbo nucifera [Indian lotus]
ref|XP_006382290.1|  hypothetical protein POPTR_0005s00710g             333   2e-109   Populus trichocarpa [western balsam poplar]
ref|XP_006382289.1|  hypothetical protein POPTR_0005s00710g             333   2e-109   
emb|CDY05202.1|  BnaC05g46010D                                          333   3e-109   
ref|XP_011039006.1|  PREDICTED: shaggy-related protein kinase alpha     333   3e-109   Populus euphratica
ref|XP_008450520.1|  PREDICTED: shaggy-related protein kinase NtK-1     333   3e-109   Cucumis melo [Oriental melon]
ref|XP_006408022.1|  hypothetical protein EUTSA_v10020835mg             333   5e-109   Eutrema salsugineum [saltwater cress]
ref|NP_001242406.1|  uncharacterized protein LOC100788612               332   6e-109   
gb|ABY60447.1|  serine/threonine protein kinase                         332   6e-109   Adonis aestivalis var. palaestina
gb|EYU38392.1|  hypothetical protein MIMGU_mgv1a007572mg                332   6e-109   Erythranthe guttata [common monkey flower]
ref|XP_010276519.1|  PREDICTED: shaggy-related protein kinase alpha     332   6e-109   Nelumbo nucifera [Indian lotus]
ref|XP_009147201.1|  PREDICTED: shaggy-related protein kinase gamma     332   6e-109   Brassica rapa
ref|XP_010493929.1|  PREDICTED: shaggy-related protein kinase alp...    331   7e-109   Camelina sativa [gold-of-pleasure]
ref|XP_010455024.1|  PREDICTED: shaggy-related protein kinase alp...    332   7e-109   Camelina sativa [gold-of-pleasure]
ref|XP_002319468.1|  Glycogen synthase kinase-3 MsK-1 family protein    332   7e-109   Populus trichocarpa [western balsam poplar]
ref|XP_006394905.1|  hypothetical protein EUTSA_v10004319mg             332   9e-109   Eutrema salsugineum [saltwater cress]
ref|XP_006289925.1|  hypothetical protein CARUB_v10003541mg             332   9e-109   Capsella rubella
ref|XP_010493927.1|  PREDICTED: shaggy-related protein kinase alp...    332   9e-109   Camelina sativa [gold-of-pleasure]
ref|XP_002874323.1|  hypothetical protein ARALYDRAFT_489503             332   1e-108   
ref|XP_011023844.1|  PREDICTED: shaggy-related protein kinase alpha     332   1e-108   Populus euphratica
ref|XP_002515218.1|  Glycogen synthase kinase-3 beta, putative          332   1e-108   Ricinus communis
ref|XP_009629200.1|  PREDICTED: shaggy-related protein kinase NtK...    332   1e-108   Nicotiana tomentosiformis
ref|XP_010910596.1|  PREDICTED: shaggy-related protein kinase alp...    332   1e-108   Elaeis guineensis
emb|CDY49981.1|  BnaC03g34380D                                          332   1e-108   Brassica napus [oilseed rape]
ref|XP_010421531.1|  PREDICTED: shaggy-related protein kinase alp...    332   1e-108   Camelina sativa [gold-of-pleasure]
ref|XP_011079505.1|  PREDICTED: shaggy-related protein kinase alp...    332   1e-108   Sesamum indicum [beniseed]
ref|XP_004967857.1|  PREDICTED: shaggy-related protein kinase alp...    331   2e-108   Setaria italica
ref|NP_568486.1|  Shaggy-related protein kinase alpha                   331   2e-108   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ99594.1|  predicted protein                                      331   2e-108   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009382471.1|  PREDICTED: shaggy-related protein kinase alp...    331   3e-108   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001148880.1|  glycogen synthase kinase-3 MsK-3                   330   4e-108   
ref|XP_007031230.1|  Shaggy-related kinase 11, 11 isoform 2             330   4e-108   
ref|XP_009384446.1|  PREDICTED: shaggy-related protein kinase alp...    330   4e-108   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382470.1|  PREDICTED: shaggy-related protein kinase alp...    330   5e-108   
ref|XP_009151155.1|  PREDICTED: shaggy-related protein kinase alpha     330   7e-108   Brassica rapa
ref|XP_010941497.1|  PREDICTED: shaggy-related protein kinase alpha     330   8e-108   
ref|XP_002302794.1|  Glycogen synthase kinase-3 MsK-3 family protein    329   9e-108   Populus trichocarpa [western balsam poplar]
gb|ABK93098.1|  unknown                                                 329   1e-107   Populus trichocarpa [western balsam poplar]
ref|XP_008781189.1|  PREDICTED: shaggy-related protein kinase alp...    329   1e-107   Phoenix dactylifera
ref|XP_009111716.1|  PREDICTED: shaggy-related protein kinase alp...    329   1e-107   Brassica rapa
ref|XP_010097328.1|  Shaggy-related protein kinase alpha                333   1e-107   
emb|CDX87033.1|  BnaC09g03480D                                          329   1e-107   
emb|CBI37005.3|  unnamed protein product                                328   1e-107   Vitis vinifera
ref|XP_009775930.1|  PREDICTED: shaggy-related protein kinase NtK...    329   1e-107   Nicotiana sylvestris
gb|KDP28311.1|  hypothetical protein JCGZ_14082                         329   1e-107   Jatropha curcas
emb|CDY19757.1|  BnaA09g04100D                                          329   1e-107   Brassica napus [oilseed rape]
ref|XP_008246288.1|  PREDICTED: shaggy-related protein kinase alpha     329   2e-107   Prunus mume [ume]
ref|XP_010524830.1|  PREDICTED: shaggy-related protein kinase alp...    329   2e-107   Tarenaya hassleriana [spider flower]
ref|XP_007205270.1|  hypothetical protein PRUPE_ppa006473mg             328   2e-107   Prunus persica
ref|XP_010679446.1|  PREDICTED: shaggy-related protein kinase NtK-1     328   2e-107   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007051226.1|  Shaggy-related kinase 11, 11 isoform 1             328   2e-107   
ref|XP_010652295.1|  PREDICTED: shaggy-related protein kinase alp...    328   2e-107   Vitis vinifera
ref|XP_007221484.1|  hypothetical protein PRUPE_ppa006462mg             328   2e-107   Prunus persica
ref|XP_004230343.1|  PREDICTED: shaggy-related protein kinase NtK-1     328   2e-107   Solanum lycopersicum
ref|NP_001269276.1|  glycogen synthase kinase-3 homolog MsK-1-like      328   2e-107   Fragaria vesca [alpine strawberry]
ref|XP_008227813.1|  PREDICTED: glycogen synthase kinase-3 homolo...    328   2e-107   Prunus mume [ume]
ref|XP_002279596.1|  PREDICTED: shaggy-related protein kinase alp...    328   2e-107   Vitis vinifera
ref|XP_008778092.1|  PREDICTED: shaggy-related protein kinase alp...    328   2e-107   Phoenix dactylifera
gb|ABG74911.1|  AtSK12-like protein                                     328   3e-107   Brassica napus [oilseed rape]
ref|XP_011003165.1|  PREDICTED: shaggy-related protein kinase alp...    328   3e-107   Populus euphratica
ref|XP_008388444.1|  PREDICTED: shaggy-related protein kinase alpha     328   3e-107   
gb|ABB55385.1|  Ser/Thr protein kinase-like                             328   4e-107   Solanum tuberosum [potatoes]
ref|NP_001274855.1|  Shaggy-like protein kinase NtK-1                   328   4e-107   Solanum tuberosum [potatoes]
ref|XP_009335521.1|  PREDICTED: shaggy-related protein kinase alpha     328   4e-107   Pyrus x bretschneideri [bai li]
ref|XP_006650852.1|  PREDICTED: shaggy-related protein kinase alp...    328   4e-107   Oryza brachyantha
ref|XP_009363099.1|  PREDICTED: glycogen synthase kinase-3 homolo...    328   4e-107   Pyrus x bretschneideri [bai li]
gb|EYU46859.1|  hypothetical protein MIMGU_mgv1a007395mg                328   4e-107   Erythranthe guttata [common monkey flower]
ref|XP_009366055.1|  PREDICTED: shaggy-related protein kinase alp...    327   6e-107   Pyrus x bretschneideri [bai li]
ref|XP_006643997.1|  PREDICTED: shaggy-related protein kinase alp...    327   6e-107   Oryza brachyantha
ref|XP_002455378.1|  hypothetical protein SORBIDRAFT_03g009580          327   1e-106   Sorghum bicolor [broomcorn]
gb|KDO86867.1|  hypothetical protein CISIN_1g015632mg                   323   1e-106   Citrus sinensis [apfelsine]
ref|XP_009617298.1|  PREDICTED: shaggy-related protein kinase NtK-1     327   1e-106   Nicotiana tomentosiformis
gb|EMT09676.1|  Shaggy-related protein kinase alpha                     327   1e-106   
gb|KHG00969.1|  Glycogen synthase kinase-3 MsK-3                        327   1e-106   Gossypium arboreum [tree cotton]
ref|XP_008353866.1|  PREDICTED: glycogen synthase kinase-3 homolo...    327   1e-106   Malus domestica [apple tree]
ref|XP_009757512.1|  PREDICTED: shaggy-related protein kinase NtK-1     326   1e-106   Nicotiana sylvestris
ref|XP_009383704.1|  PREDICTED: shaggy-related protein kinase alpha     326   2e-106   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO86866.1|  hypothetical protein CISIN_1g015632mg                   325   2e-106   Citrus sinensis [apfelsine]
gb|KJB49765.1|  hypothetical protein B456_008G136600                    326   2e-106   Gossypium raimondii
ref|XP_008812956.1|  PREDICTED: shaggy-related protein kinase alp...    326   2e-106   Phoenix dactylifera
ref|XP_008812957.1|  PREDICTED: shaggy-related protein kinase alp...    323   2e-106   Phoenix dactylifera
ref|XP_006444573.1|  hypothetical protein CICLE_v10020852mg             326   2e-106   
ref|XP_008447666.1|  PREDICTED: glycogen synthase kinase-3 homolo...    318   2e-106   Cucumis melo [Oriental melon]
ref|XP_006480288.1|  PREDICTED: shaggy-related protein kinase alp...    326   3e-106   Citrus sinensis [apfelsine]
tpg|DAA53951.1|  TPA: putative glycogen synthase kinase family pr...    326   3e-106   
gb|EMS62368.1|  Shaggy-related protein kinase alpha                     327   3e-106   Triticum urartu
ref|XP_008381452.1|  PREDICTED: glycogen synthase kinase-3 homolo...    325   3e-106   
ref|NP_001042602.1|  Os01g0252100                                       325   3e-106   
gb|AEN14336.1|  hypothetical protein rf1-C1-g7                          325   3e-106   Zea mays [maize]
emb|CDX80585.1|  BnaC07g28590D                                          325   3e-106   
emb|CDY27737.1|  BnaA05g31460D                                          329   3e-106   Brassica napus [oilseed rape]
sp|Q40518.1|MSK1_TOBAC  RecName: Full=Shaggy-related protein kina...    325   4e-106   Nicotiana tabacum [American tobacco]
emb|CAA53181.1|  shaggy related kinase                                  325   5e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011040636.1|  PREDICTED: shaggy-related protein kinase alp...    325   6e-106   Populus euphratica
ref|XP_004148581.1|  PREDICTED: glycogen synthase kinase-3 homolo...    325   7e-106   Cucumis sativus [cucumbers]
gb|KHN16033.1|  Glycogen synthase kinase-3 like MsK-1                   324   1e-105   Glycine soja [wild soybean]
ref|XP_010070089.1|  PREDICTED: shaggy-related protein kinase alp...    324   1e-105   
gb|KDO45353.1|  hypothetical protein CISIN_1g015298mg                   323   2e-105   Citrus sinensis [apfelsine]
ref|XP_008672929.1|  PREDICTED: LOC100283734 isoform X1                 325   2e-105   Zea mays [maize]
ref|XP_009401663.1|  PREDICTED: shaggy-related protein kinase gamma     323   2e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011466950.1|  PREDICTED: glycogen synthase kinase-3 homolo...    323   2e-105   Fragaria vesca subsp. vesca
ref|XP_011087526.1|  PREDICTED: shaggy-related protein kinase NtK...    323   3e-105   Sesamum indicum [beniseed]
ref|XP_003566380.1|  PREDICTED: shaggy-related protein kinase alpha     323   3e-105   Brachypodium distachyon [annual false brome]
ref|XP_006841582.1|  hypothetical protein AMTR_s00003p00196730          323   3e-105   Amborella trichopoda
emb|CAA04265.1|  shaggy-like kinase alpha                               322   4e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011087528.1|  PREDICTED: shaggy-related protein kinase alp...    322   4e-105   Sesamum indicum [beniseed]
ref|XP_007031507.1|  Shaggy-like kinase 13 isoform 4                    320   5e-105   
ref|XP_010070081.1|  PREDICTED: shaggy-related protein kinase alp...    323   5e-105   Eucalyptus grandis [rose gum]
gb|AAB61055.1|  Similar to shaggy related protein kinase. Belongs...    324   5e-105   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001288361.1|  uncharacterized protein LOC103641344               322   6e-105   Zea mays [maize]
ref|XP_010674528.1|  PREDICTED: shaggy-related protein kinase alpha     322   6e-105   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007031504.1|  Shaggy-like kinase 13 isoform 1                    322   7e-105   
gb|KDO66104.1|  hypothetical protein CISIN_1g0141742mg                  314   8e-105   Citrus sinensis [apfelsine]
ref|NP_001150105.1|  LOC100283734                                       322   1e-104   Zea mays [maize]
ref|XP_010248490.1|  PREDICTED: shaggy-related protein kinase eps...    321   2e-104   Nelumbo nucifera [Indian lotus]
ref|XP_002440537.1|  hypothetical protein SORBIDRAFT_09g002710          321   2e-104   Sorghum bicolor [broomcorn]
ref|XP_006654010.1|  PREDICTED: shaggy-related protein kinase alp...    320   3e-104   
ref|XP_004960405.1|  PREDICTED: shaggy-related protein kinase alp...    320   4e-104   Setaria italica
ref|XP_009384996.1|  PREDICTED: shaggy-related protein kinase alp...    320   5e-104   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDM82575.1|  unnamed protein product                                320   6e-104   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003569078.1|  PREDICTED: shaggy-related protein kinase alp...    320   7e-104   Brachypodium distachyon [annual false brome]
gb|AAM77397.1|  GSK-like kinase                                         318   7e-104   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010091400.1|  Glycogen synthase kinase-3-MsK-3-like protein      319   8e-104   Morus notabilis
gb|ABG29422.1|  GSK-like kinase 1A                                      319   1e-103   Triticum aestivum [Canadian hard winter wheat]
gb|EMS50777.1|  Glycogen synthase kinase-3-like protein MsK-3           318   1e-103   Triticum urartu
emb|CDP17018.1|  unnamed protein product                                318   2e-103   Coffea canephora [robusta coffee]
gb|ABK24355.1|  unknown                                                 317   2e-103   Picea sitchensis
dbj|BAF36565.1|  Shaggy-like kinase                                     318   2e-103   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001054564.1|  Os05g0134000                                       318   3e-103   
ref|XP_006470301.1|  PREDICTED: shaggy-related protein kinase eps...    318   3e-103   Citrus sinensis [apfelsine]
ref|XP_007031506.1|  Shaggy-like kinase 13 isoform 3                    318   4e-103   
gb|ABC94949.1|  GSK-like kinase                                         317   5e-103   Aegilops tauschii
ref|XP_009403747.1|  PREDICTED: shaggy-related protein kinase alp...    317   5e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004141099.1|  PREDICTED: shaggy-related protein kinase eps...    317   6e-103   
ref|XP_010251219.1|  PREDICTED: shaggy-related protein kinase eps...    316   6e-103   Nelumbo nucifera [Indian lotus]
gb|AAY98510.1|  glycogen synthase kinase                                317   8e-103   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004164819.1|  PREDICTED: shaggy-related protein kinase eps...    317   8e-103   
gb|KGN59685.1|  hypothetical protein Csa_3G838640                       317   9e-103   Cucumis sativus [cucumbers]
ref|XP_010660897.1|  PREDICTED: shaggy-related protein kinase eps...    316   9e-103   
ref|XP_010251217.1|  PREDICTED: shaggy-related protein kinase eps...    317   1e-102   Nelumbo nucifera [Indian lotus]
gb|ABC94948.1|  GSK-like kinase                                         315   1e-102   Aegilops speltoides
gb|ABG29424.1|  GSK-like kinase 1D                                      316   1e-102   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010660896.1|  PREDICTED: shaggy-related protein kinase eps...    316   1e-102   Vitis vinifera
ref|XP_003518657.1|  PREDICTED: glycogen synthase kinase-3 homolo...    316   1e-102   Glycine max [soybeans]
gb|ABG29426.1|  GSK-like kinase 1                                       316   2e-102   Aegilops speltoides
gb|EAY96448.1|  hypothetical protein OsI_18343                          316   2e-102   Oryza sativa Indica Group [Indian rice]
ref|XP_008443540.1|  PREDICTED: shaggy-related protein kinase eps...    316   2e-102   Cucumis melo [Oriental melon]
emb|CDP02094.1|  unnamed protein product                                316   2e-102   Coffea canephora [robusta coffee]
gb|EMT00762.1|  Glycogen synthase kinase-3-MsK-3-like protein           315   2e-102   
gb|AFK38277.1|  unknown                                                 316   2e-102   Medicago truncatula
ref|XP_003626019.1|  Protein kinase, putative                           315   3e-102   
ref|XP_006446534.1|  hypothetical protein CICLE_v10015323mg             316   3e-102   Citrus clementina [clementine]
ref|XP_008662920.1|  PREDICTED: shaggy-related protein kinase alp...    315   3e-102   
ref|XP_006446533.1|  hypothetical protein CICLE_v10015323mg             315   3e-102   
emb|CAA48472.1|  protein kinase                                         315   5e-102   Medicago sativa [alfalfa]
gb|ABG29423.1|  GSK-like kinase 1B                                      315   5e-102   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006399977.1|  hypothetical protein EUTSA_v10013689mg             315   5e-102   Eutrema salsugineum [saltwater cress]
sp|P51139.2|MSK3_MEDSA  RecName: Full=Glycogen synthase kinase-3 ...    315   5e-102   Medicago sativa [alfalfa]
gb|EPS68300.1|  hypothetical protein M569_06467                         314   9e-102   Genlisea aurea
ref|XP_010453592.1|  PREDICTED: shaggy-related protein kinase eps...    314   1e-101   Camelina sativa [gold-of-pleasure]
ref|XP_010420109.1|  PREDICTED: shaggy-related protein kinase eps...    314   1e-101   Camelina sativa [gold-of-pleasure]
ref|XP_010550142.1|  PREDICTED: shaggy-related protein kinase eps...    314   1e-101   Tarenaya hassleriana [spider flower]
ref|XP_007140965.1|  hypothetical protein PHAVU_008G156000g             313   1e-101   Phaseolus vulgaris [French bean]
ref|XP_007215466.1|  hypothetical protein PRUPE_ppa006497mg             314   1e-101   
ref|XP_010492276.1|  PREDICTED: shaggy-related protein kinase eps...    314   1e-101   Camelina sativa [gold-of-pleasure]
ref|NP_196968.2|  Shaggy-related protein kinase 13                      313   1e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008230580.1|  PREDICTED: shaggy-related protein kinase eps...    313   2e-101   Prunus mume [ume]
ref|XP_004967591.1|  PREDICTED: shaggy-related protein kinase alp...    313   2e-101   Setaria italica
gb|ABC94947.1|  GSK-like kinase                                         313   2e-101   Triticum monococcum [einkorn wheat]
ref|XP_008357735.1|  PREDICTED: shaggy-related protein kinase eps...    313   2e-101   
ref|XP_009334099.1|  PREDICTED: shaggy-related protein kinase eps...    312   4e-101   Pyrus x bretschneideri [bai li]
ref|XP_006287860.1|  hypothetical protein CARUB_v10001087mg             312   5e-101   
dbj|BAG95540.1|  unnamed protein product                                308   7e-101   Oryza sativa Japonica Group [Japonica rice]
emb|CDX78587.1|  BnaA03g04990D                                          312   7e-101   
ref|XP_009131419.1|  PREDICTED: shaggy-related protein kinase eps...    312   7e-101   Brassica rapa
ref|XP_002873682.1|  kinase family protein                              311   9e-101   
ref|XP_002987888.1|  GSK3/shaggy-like protein kinase                    312   9e-101   Selaginella moellendorffii
emb|CDX70574.1|  BnaC03g06580D                                          311   1e-100   
ref|XP_002991115.1|  hypothetical protein SELMODRAFT_451471             313   1e-100   Selaginella moellendorffii
ref|NP_001042804.1|  Os01g0296100                                       311   1e-100   
gb|KHN00229.1|  Glycogen synthase kinase-3 like MsK-3                   317   1e-100   Glycine soja [wild soybean]
ref|NP_001242506.1|  uncharacterized protein LOC100817819               309   3e-100   
ref|XP_006588498.1|  PREDICTED: uncharacterized protein LOC100817...    309   3e-100   Glycine max [soybeans]
gb|KHN00323.1|  Glycogen synthase kinase-3 like MsK-2                   309   3e-100   Glycine soja [wild soybean]
ref|XP_003591342.1|  Glycogen synthase kinase-3-like protein            306   3e-100   
gb|AES61591.2|  glycogen synthase kinase                                310   4e-100   Medicago truncatula
ref|XP_003591339.1|  Glycogen synthase kinase-3-like protein            309   4e-100   
ref|XP_003591340.1|  Glycogen synthase kinase-3-like protein            310   4e-100   
ref|XP_006644095.1|  PREDICTED: glycogen synthase kinase-3 homolo...    310   4e-100   Oryza brachyantha
sp|P51138.1|MSK2_MEDSA  RecName: Full=Glycogen synthase kinase-3 ...    310   4e-100   Medicago sativa [alfalfa]
ref|XP_006588497.1|  PREDICTED: uncharacterized protein LOC100817...    310   5e-100   Glycine max [soybeans]
ref|XP_006338576.1|  PREDICTED: shaggy-related protein kinase eps...    310   5e-100   Solanum tuberosum [potatoes]
ref|XP_003591341.1|  Glycogen synthase kinase-3-like protein            308   6e-100   
ref|XP_006338577.1|  PREDICTED: shaggy-related protein kinase eps...    309   7e-100   Solanum tuberosum [potatoes]
ref|XP_004304635.1|  PREDICTED: shaggy-related protein kinase eps...    309   9e-100   Fragaria vesca subsp. vesca
ref|XP_001763270.1|  predicted protein                                  309   1e-99    
gb|AAQ23111.1|  shaggy-related protein kinase 1                         308   2e-99    Physcomitrella patens
emb|CAB87631.1|  protein kinase MSK-3-like                              307   4e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009759533.1|  PREDICTED: shaggy-related protein kinase eps...    307   5e-99    Nicotiana sylvestris
gb|AAQ23107.1|  shaggy-related protein kinase 2                         307   5e-99    Physcomitrella patens
ref|XP_001763265.1|  predicted protein                                  307   7e-99    
ref|XP_004232308.1|  PREDICTED: shaggy-related protein kinase eps...    306   7e-99    Solanum lycopersicum
gb|AFN42826.1|  GSK3-like protein                                       306   8e-99    Marsilea vestita
ref|XP_004252662.1|  PREDICTED: shaggy-related protein kinase eps...    306   1e-98    Solanum lycopersicum
ref|XP_010038314.1|  PREDICTED: shaggy-related protein kinase alp...    306   2e-98    Eucalyptus grandis [rose gum]
ref|XP_004252661.1|  PREDICTED: shaggy-related protein kinase eps...    306   2e-98    Solanum lycopersicum
ref|XP_006364003.1|  PREDICTED: shaggy-related protein kinase eps...    306   2e-98    Solanum tuberosum [potatoes]
ref|XP_009598967.1|  PREDICTED: shaggy-related protein kinase eps...    306   2e-98    Nicotiana tomentosiformis
gb|AAQ23110.1|  shaggy-related protein kinase 5                         303   2e-98    Physcomitrella patens
gb|ABK24513.1|  unknown                                                 306   2e-98    Picea sitchensis
emb|CAA58594.1|  Petunia Shaggy kinase 4                                305   4e-98    Petunia x hybrida [garden petunia]
gb|AAQ23108.1|  shaggy-related protein kinase 3                         305   4e-98    Physcomitrella patens
ref|XP_001762052.1|  predicted protein                                  305   5e-98    
gb|AAQ23109.1|  shaggy-related protein kinase 4                         305   5e-98    Physcomitrella patens
ref|XP_003567575.1|  PREDICTED: shaggy-related protein kinase alp...    304   5e-98    Brachypodium distachyon [annual false brome]
ref|XP_004495878.1|  PREDICTED: glycogen synthase kinase-3 homolo...    304   7e-98    Cicer arietinum [garbanzo]
emb|CAA10288.1|  protein kinase                                         300   9e-98    Cicer arietinum [garbanzo]
ref|XP_001765207.1|  predicted protein                                  304   1e-97    
tpg|DAA53952.1|  TPA: putative glycogen synthase kinase family pr...    305   1e-97    
ref|XP_009396814.1|  PREDICTED: shaggy-related protein kinase kap...    303   2e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011097427.1|  PREDICTED: shaggy-related protein kinase eps...    303   3e-97    Sesamum indicum [beniseed]
ref|XP_008644282.1|  PREDICTED: uncharacterized protein LOC542518...    302   3e-97    Zea mays [maize]
gb|EYU34725.1|  hypothetical protein MIMGU_mgv1a007335mg                302   4e-97    Erythranthe guttata [common monkey flower]
gb|EYU34726.1|  hypothetical protein MIMGU_mgv1a007335mg                302   4e-97    Erythranthe guttata [common monkey flower]
ref|XP_002463546.1|  hypothetical protein SORBIDRAFT_01g001760          303   4e-97    Sorghum bicolor [broomcorn]
ref|XP_008644283.1|  PREDICTED: uncharacterized protein LOC542518...    301   4e-97    Zea mays [maize]
ref|NP_001105536.1|  uncharacterized protein LOC542518                  302   8e-97    Zea mays [maize]
gb|KGN58535.1|  hypothetical protein Csa_3G664590                       300   9e-97    Cucumis sativus [cucumbers]
ref|XP_008644280.1|  PREDICTED: uncharacterized protein LOC542518...    302   1e-96    Zea mays [maize]
gb|AAW80932.1|  putative protein kinase                                 292   1e-96    Astragalus membranaceus
ref|XP_006650875.1|  PREDICTED: shaggy-related protein kinase kap...    301   1e-96    Oryza brachyantha
ref|XP_001781582.1|  predicted protein                                  301   3e-96    
ref|XP_008347928.1|  PREDICTED: shaggy-related protein kinase kap...    293   3e-96    
ref|XP_001781586.1|  predicted protein                                  300   3e-96    
ref|NP_001051854.1|  Os03g0841800                                       300   4e-96    
ref|XP_010030186.1|  PREDICTED: shaggy-related protein kinase kappa     300   4e-96    
ref|XP_006389513.1|  hypothetical protein POPTR_0022s00490g             294   5e-96    
gb|KDO39711.1|  hypothetical protein CISIN_1g014595mg                   298   6e-96    
gb|KDO39708.1|  hypothetical protein CISIN_1g014595mg                   298   6e-96    
ref|XP_010245513.1|  PREDICTED: shaggy-related protein kinase kap...    300   7e-96    
gb|KDO39706.1|  hypothetical protein CISIN_1g014595mg                   299   7e-96    
ref|XP_004981107.1|  PREDICTED: shaggy-related protein kinase del...    300   7e-96    
ref|XP_009353785.1|  PREDICTED: shaggy-related protein kinase kap...    299   8e-96    
gb|ACN34914.1|  unknown                                                 299   9e-96    
ref|XP_002263398.1|  PREDICTED: shaggy-related protein kinase kappa     299   9e-96    
ref|XP_006858581.1|  hypothetical protein AMTR_s00071p00186380          300   1e-95    
ref|XP_010414797.1|  PREDICTED: shaggy-related protein kinase del...    299   1e-95    
ref|XP_008385705.1|  PREDICTED: shaggy-related protein kinase the...    301   1e-95    
ref|XP_011028359.1|  PREDICTED: shaggy-related protein kinase kappa     299   1e-95    
ref|XP_008383272.1|  PREDICTED: shaggy-related protein kinase theta     301   1e-95    
ref|XP_010470311.1|  PREDICTED: LOW QUALITY PROTEIN: shaggy-relat...    299   1e-95    
gb|KJB16215.1|  hypothetical protein B456_002G218100                    299   1e-95    
gb|ADE76936.1|  unknown                                                 298   1e-95    
gb|EYU33277.1|  hypothetical protein MIMGU_mgv1a007009mg                298   1e-95    
ref|XP_006302308.1|  hypothetical protein CARUB_v10020358mg             298   1e-95    
ref|XP_006431595.1|  hypothetical protein CICLE_v10001277mg             298   1e-95    
ref|XP_008344049.1|  PREDICTED: shaggy-related protein kinase eps...    300   2e-95    
ref|XP_007041204.1|  Shaggy-like protein kinase 41 isoform 1            298   2e-95    
ref|XP_002886726.1|  hypothetical protein ARALYDRAFT_475455             298   2e-95    
ref|XP_009340624.1|  PREDICTED: shaggy-related protein kinase the...    300   2e-95    
ref|NP_176096.1|  shaggy-related protein kinase delta                   298   2e-95    
ref|XP_006349315.1|  PREDICTED: shaggy-related protein kinase kap...    298   3e-95    
ref|XP_009355333.1|  PREDICTED: shaggy-related protein kinase kappa     298   3e-95    
ref|XP_010511360.1|  PREDICTED: shaggy-related protein kinase del...    298   3e-95    
ref|NP_001185256.1|  shaggy-related protein kinase delta                298   3e-95    
ref|XP_010511361.1|  PREDICTED: shaggy-related protein kinase del...    298   3e-95    
ref|NP_001240918.1|  uncharacterized protein LOC100820098               297   4e-95    
ref|XP_004147888.1|  PREDICTED: shaggy-related protein kinase kap...    298   4e-95    
emb|CDO97625.1|  unnamed protein product                                291   4e-95    
ref|XP_004485442.1|  PREDICTED: shaggy-related protein kinase kap...    298   4e-95    
ref|XP_002526439.1|  Glycogen synthase kinase-3 beta, putative          291   5e-95    
ref|XP_011092295.1|  PREDICTED: shaggy-related protein kinase del...    296   6e-95    
gb|EMT16766.1|  Shaggy-related protein kinase delta                     297   6e-95    
emb|CDY18828.1|  BnaAnng02930D                                          296   8e-95    
ref|XP_008339410.1|  PREDICTED: shaggy-related protein kinase kappa     297   8e-95    
ref|XP_003592909.1|  Glycogen synthase kinase-3-like protein            297   8e-95    
ref|XP_006385048.1|  hypothetical protein POPTR_0004s23430g             296   9e-95    
gb|AAN63591.1|AF432225_1  GSK-3-like protein MsK4                       297   9e-95    
ref|XP_010475837.1|  PREDICTED: shaggy-related protein kinase kap...    296   9e-95    
ref|XP_004306833.1|  PREDICTED: shaggy-related protein kinase the...    298   1e-94    
ref|XP_010245514.1|  PREDICTED: shaggy-related protein kinase kap...    295   1e-94    
ref|XP_011092292.1|  PREDICTED: shaggy-related protein kinase kap...    296   1e-94    
ref|XP_010245515.1|  PREDICTED: shaggy-related protein kinase kap...    295   1e-94    
ref|XP_008232743.1|  PREDICTED: shaggy-related protein kinase the...    298   1e-94    
emb|CDY65729.1|  BnaCnng48480D                                          296   1e-94    
ref|XP_009110795.1|  PREDICTED: shaggy-related protein kinase kap...    296   2e-94    
ref|XP_010910153.1|  PREDICTED: shaggy-related protein kinase kap...    296   2e-94    
emb|CDY31060.1|  BnaA08g26100D                                          296   2e-94    
ref|XP_010245511.1|  PREDICTED: shaggy-related protein kinase kap...    296   2e-94    
gb|AFW79696.1|  putative glycogen synthase kinase family protein        295   2e-94    
ref|XP_010490391.1|  PREDICTED: shaggy-related protein kinase kap...    295   3e-94    
ref|XP_004492676.1|  PREDICTED: shaggy-related protein kinase the...    297   3e-94    
ref|XP_004229833.1|  PREDICTED: shaggy-related protein kinase eps...    297   3e-94    
ref|XP_010458292.1|  PREDICTED: shaggy-related protein kinase kappa     295   3e-94    
ref|NP_001241073.1|  uncharacterized protein LOC100799387               295   3e-94    
gb|AAT81407.1|  shaggy-related protein kinase 6                         297   3e-94    
ref|XP_010544097.1|  PREDICTED: shaggy-related protein kinase kappa     295   3e-94    
ref|XP_004230443.1|  PREDICTED: shaggy-related protein kinase kappa     295   3e-94    
ref|XP_006307622.1|  hypothetical protein CARUB_v10009250mg             295   3e-94    
ref|NP_172455.1|  Shaggy-related protein kinase kappa                   295   4e-94    
ref|XP_008802921.1|  PREDICTED: shaggy-related protein kinase kap...    295   4e-94    
ref|XP_006392357.1|  hypothetical protein EUTSA_v10023486mg             295   5e-94    
ref|XP_006417527.1|  hypothetical protein EUTSA_v10007729mg             295   5e-94    
ref|XP_008802919.1|  PREDICTED: shaggy-related protein kinase kap...    295   5e-94    
ref|XP_009598595.1|  PREDICTED: shaggy-related protein kinase kappa     295   5e-94    
ref|XP_010278583.1|  PREDICTED: shaggy-related protein kinase eps...    296   6e-94    
ref|XP_008802918.1|  PREDICTED: shaggy-related protein kinase kap...    295   7e-94    
gb|AAB60754.1|  Identical to A. thaliana AtK-1 (gb|X79279)              295   7e-94    
ref|XP_002511803.1|  Glycogen synthase kinase-3 beta, putative          296   7e-94    
gb|KJB47877.1|  hypothetical protein B456_008G045800                    294   8e-94    
ref|XP_007148571.1|  hypothetical protein PHAVU_006G219700g             294   9e-94    
gb|KHF99017.1|  Shaggy-related protein kinase delta                     295   9e-94    
ref|XP_008802915.1|  PREDICTED: shaggy-related protein kinase kap...    296   9e-94    
ref|XP_002892530.1|  hypothetical protein ARALYDRAFT_471093             294   1e-93    
ref|XP_006339456.1|  PREDICTED: shaggy-related protein kinase the...    295   1e-93    
gb|ABR17316.1|  unknown                                                 295   1e-93    
ref|XP_006833052.1|  hypothetical protein AMTR_s00170p00028260          291   1e-93    
ref|XP_010682019.1|  PREDICTED: shaggy-related protein kinase kap...    293   2e-93    
ref|XP_010682020.1|  PREDICTED: shaggy-related protein kinase kap...    293   2e-93    
ref|XP_007222549.1|  hypothetical protein PRUPE_ppa006218mg             293   2e-93    
ref|XP_009148291.1|  PREDICTED: shaggy-related protein kinase kappa     293   2e-93    
dbj|BAJ89558.1|  predicted protein                                      293   2e-93    
gb|EMS50941.1|  Shaggy-related protein kinase kappa                     291   2e-93    
ref|XP_002512564.1|  Glycogen synthase kinase-3 beta, putative          291   3e-93    
ref|XP_009775075.1|  PREDICTED: shaggy-related protein kinase kappa     293   3e-93    
ref|XP_003562606.1|  PREDICTED: shaggy-related protein kinase kappa     293   3e-93    
ref|XP_006647108.1|  PREDICTED: shaggy-related protein kinase zet...    291   5e-93    
ref|XP_003626020.1|  Protein kinase, putative                           293   5e-93    
emb|CAA55866.1|  K-1                                                    292   5e-93    
emb|CAA68872.1|  shaggy-like kinase kappa                               290   6e-93    
gb|ABR16348.1|  unknown                                                 292   6e-93    
gb|KEH23337.1|  shaggy-like kinase                                      290   6e-93    
ref|XP_007218957.1|  hypothetical protein PRUPE_ppa003552mg             296   6e-93    
ref|XP_003623822.1|  Shaggy-related protein kinase                      293   7e-93    
ref|XP_006289072.1|  hypothetical protein CARUB_v10002475mg             293   9e-93    
ref|XP_008795406.1|  PREDICTED: shaggy-related protein kinase eps...    285   1e-92    
ref|XP_006375322.1|  shaggy-related protein kinase theta                291   2e-92    
ref|XP_010556680.1|  PREDICTED: shaggy-related protein kinase alp...    289   2e-92    
ref|XP_010556679.1|  PREDICTED: shaggy-related protein kinase alp...    290   2e-92    
ref|XP_011035087.1|  PREDICTED: shaggy-related protein kinase theta     292   2e-92    
ref|XP_009365289.1|  PREDICTED: shaggy-related protein kinase zet...    289   2e-92    
ref|XP_002320754.2|  hypothetical protein POPTR_0014s07120g             292   2e-92    
gb|KDP28680.1|  hypothetical protein JCGZ_14451                         292   2e-92    
gb|ACN27271.1|  unknown                                                 282   2e-92    
ref|XP_006643888.1|  PREDICTED: shaggy-related protein kinase eta...    288   3e-92    
ref|XP_007051908.1|  Shaggy-like protein kinase 32 isoform 1            293   3e-92    
gb|EMT32435.1|  Glycogen synthase kinase-3-MsK-3-like protein           290   3e-92    
ref|NP_191981.1|  Shaggy-related protein kinase theta                   291   4e-92    
ref|XP_010924595.1|  PREDICTED: shaggy-related protein kinase eta...    289   4e-92    
ref|XP_002872933.1|  hypothetical protein ARALYDRAFT_490498             291   5e-92    
ref|XP_010919259.1|  PREDICTED: shaggy-related protein kinase eps...    291   6e-92    
ref|XP_008363964.1|  PREDICTED: shaggy-related protein kinase alpha     289   6e-92    
ref|XP_009365288.1|  PREDICTED: shaggy-related protein kinase eta...    289   7e-92    
ref|XP_006654148.1|  PREDICTED: shaggy-related protein kinase zet...    286   8e-92    
ref|XP_010933863.1|  PREDICTED: shaggy-related protein kinase eps...    290   1e-91    
ref|XP_004300628.1|  PREDICTED: shaggy-related protein kinase kappa     288   1e-91    
ref|XP_006445137.1|  hypothetical protein CICLE_v10020026mg             290   1e-91    
ref|XP_006598764.1|  PREDICTED: uncharacterized protein LOC100820...    288   1e-91    
ref|XP_008795404.1|  PREDICTED: shaggy-related protein kinase the...    287   1e-91    
gb|EMS48919.1|  Shaggy-related protein kinase eta                       286   2e-91    
emb|CDY51144.1|  BnaA09g51790D                                          290   2e-91    
ref|XP_009124961.1|  PREDICTED: shaggy-related protein kinase gam...    287   2e-91    
ref|XP_004951349.1|  PREDICTED: shaggy-related protein kinase eta...    288   2e-91    
ref|XP_007134960.1|  hypothetical protein PHAVU_010G090200g             290   2e-91    
ref|XP_006396267.1|  hypothetical protein EUTSA_v10028631mg             290   2e-91    
gb|EEE62704.1|  hypothetical protein OsJ_17507                          286   2e-91    
ref|XP_009602858.1|  PREDICTED: shaggy-related protein kinase eps...    290   2e-91    
ref|XP_009790920.1|  PREDICTED: shaggy-related protein kinase eps...    290   2e-91    
emb|CAA11860.1|  shaggy-like kinase 91                                  289   2e-91    
emb|CDX74346.1|  BnaA03g27010D                                          289   2e-91    
ref|XP_009111468.1|  PREDICTED: shaggy-related protein kinase theta     290   3e-91    
gb|EEC72801.1|  hypothetical protein OsI_06492                          286   3e-91    
emb|CDY07202.1|  BnaCnng02170D                                          289   3e-91    
ref|NP_001042341.1|  Os01g0205700                                       281   3e-91    
ref|XP_009134534.1|  PREDICTED: shaggy-related protein kinase theta     289   3e-91    
gb|EMT19129.1|  Shaggy-related protein kinase iota                      286   3e-91    
ref|NP_001054901.1|  Os05g0207500                                       286   4e-91    
gb|KFK30649.1|  hypothetical protein AALP_AA6G009500                    289   4e-91    
emb|CDM82043.1|  unnamed protein product                                286   4e-91    
gb|EMS65432.1|  Shaggy-related protein kinase iota                      286   4e-91    
ref|XP_010108792.1|  Shaggy-related protein kinase epsilon              306   4e-91    
ref|XP_004494455.1|  PREDICTED: glycogen synthase kinase-3 homolo...    286   4e-91    
ref|XP_009588662.1|  PREDICTED: shaggy-related protein kinase eta...    286   5e-91    
dbj|BAJ93751.1|  predicted protein                                      288   5e-91    
ref|NP_001149983.1|  shaggy-related protein kinase eta                  286   5e-91    
ref|XP_008657609.1|  PREDICTED: shaggy-related protein kinase alp...    288   5e-91    
ref|XP_003596713.1|  Shaggy-related protein kinase                      282   6e-91    
ref|XP_010456251.1|  PREDICTED: shaggy-related protein kinase theta     288   6e-91    
ref|XP_010523040.1|  PREDICTED: shaggy-related protein kinase theta     288   6e-91    
ref|XP_008365741.1|  PREDICTED: shaggy-related protein kinase eta...    286   7e-91    
ref|XP_004983886.1|  PREDICTED: LOW QUALITY PROTEIN: shaggy-relat...    288   7e-91    
gb|AGJ93558.1|  SHAGGY-like kinase                                      286   7e-91    
ref|XP_008343095.1|  PREDICTED: shaggy-related protein kinase zet...    285   8e-91    
gb|ACJ85178.1|  unknown                                                 285   9e-91    
dbj|BAJ91341.1|  predicted protein                                      286   9e-91    
gb|AGK41245.1|  SHAGGY-like kinase                                      286   9e-91    
gb|ACG34459.1|  shaggy-related protein kinase eta                       286   1e-90    
ref|XP_003521276.1|  PREDICTED: shaggy-related protein kinase theta     288   1e-90    
ref|XP_009394192.1|  PREDICTED: shaggy-related protein kinase eta...    286   1e-90    
gb|AGJ93554.1|  SHAGGY-like kinase                                      285   1e-90    
ref|XP_009378930.1|  PREDICTED: shaggy-related protein kinase zet...    285   1e-90    
gb|AES66964.2|  shaggy-like kinase dzeta                                285   1e-90    
gb|EMT26120.1|  Shaggy-related protein kinase iota                      286   1e-90    
gb|EMS49677.1|  Glycogen synthase kinase-3-like protein MsK-3           288   1e-90    
ref|NP_001065093.1|  Os10g0521700                                       288   1e-90    
ref|XP_008789340.1|  PREDICTED: shaggy-related protein kinase eta       285   1e-90    
gb|ACG33866.1|  shaggy-related protein kinase eta                       285   1e-90    
gb|KHN27286.1|  Shaggy-related protein kinase theta                     288   1e-90    
ref|XP_011466967.1|  PREDICTED: shaggy-related protein kinase zet...    284   1e-90    
ref|XP_002453590.1|  hypothetical protein SORBIDRAFT_04g008580          286   1e-90    
ref|XP_008799541.1|  PREDICTED: shaggy-related protein kinase alp...    287   1e-90    
ref|NP_001149135.1|  shaggy-related protein kinase eta                  285   1e-90    
ref|XP_007215447.1|  hypothetical protein PRUPE_ppa006349mg             286   1e-90    
ref|XP_010940878.1|  PREDICTED: shaggy-related protein kinase eps...    287   1e-90    
gb|AFW71144.1|  putative glycogen synthase kinase family protein        285   2e-90    
emb|CDP08875.1|  unnamed protein product                                287   2e-90    
ref|XP_008343093.1|  PREDICTED: shaggy-related protein kinase eta...    285   2e-90    
gb|AES66963.2|  shaggy-like kinase dzeta                                286   2e-90    
gb|AGJ93555.1|  SHAGGY-like kinase                                      285   2e-90    
ref|XP_011466966.1|  PREDICTED: shaggy-related protein kinase zet...    284   2e-90    
ref|NP_001130511.1|  uncharacterized protein LOC100191610               285   2e-90    
emb|CAA64409.1|  shaggy-like kinase etha                                284   2e-90    
ref|XP_008672878.1|  PREDICTED: shaggy-related protein kinase eta...    285   2e-90    
gb|ACG33869.1|  shaggy-related protein kinase eta                       285   2e-90    
ref|XP_010255500.1|  PREDICTED: shaggy-related protein kinase the...    284   3e-90    
ref|XP_006428242.1|  hypothetical protein CICLE_v10013624mg             286   3e-90    
ref|XP_009378929.1|  PREDICTED: shaggy-related protein kinase eta...    285   3e-90    
ref|XP_003596712.1|  Shaggy-related protein kinase                      285   3e-90    
emb|CDX91895.1|  BnaC03g31970D                                          286   3e-90    
ref|XP_010529205.1|  PREDICTED: shaggy-related protein kinase eta...    283   3e-90    
gb|AGK41246.1|  SHAGGY-like kinase                                      284   3e-90    
ref|XP_010529206.1|  PREDICTED: shaggy-related protein kinase eta...    283   3e-90    
gb|KDO63403.1|  hypothetical protein CISIN_1g014750mg                   283   3e-90    
ref|XP_004168158.1|  PREDICTED: shaggy-related protein kinase the...    286   3e-90    
gb|ACJ84453.1|  unknown                                                 283   4e-90    
ref|XP_004144981.1|  PREDICTED: shaggy-related protein kinase the...    286   4e-90    
sp|O04160.2|KSGT_BRANA  RecName: Full=Shaggy-related protein kina...    286   4e-90    
ref|XP_002272112.1|  PREDICTED: shaggy-related protein kinase theta     286   4e-90    
ref|XP_006661970.1|  PREDICTED: shaggy-related protein kinase the...    286   4e-90    
ref|XP_002465046.1|  hypothetical protein SORBIDRAFT_01g031220          286   4e-90    
ref|XP_010915474.1|  PREDICTED: shaggy-related protein kinase eta...    284   4e-90    
ref|XP_010255498.1|  PREDICTED: shaggy-related protein kinase eps...    286   4e-90    
ref|XP_004303195.1|  PREDICTED: shaggy-related protein kinase eta...    284   4e-90    
gb|EYU32069.1|  hypothetical protein MIMGU_mgv1a006024mg                286   5e-90    
gb|KDO63406.1|  hypothetical protein CISIN_1g014750mg                   283   5e-90    
ref|XP_003528879.1|  PREDICTED: shaggy-related protein kinase the...    286   5e-90    
ref|XP_004968576.1|  PREDICTED: shaggy-related protein kinase iot...    284   5e-90    
gb|AFK37839.1|  unknown                                                 283   5e-90    
ref|XP_008460173.1|  PREDICTED: shaggy-related protein kinase theta     286   5e-90    
ref|XP_010255499.1|  PREDICTED: shaggy-related protein kinase eps...    285   6e-90    
gb|KDO77892.1|  hypothetical protein CISIN_1g016950mg                   280   6e-90    
ref|XP_009770234.1|  PREDICTED: shaggy-related protein kinase eta...    283   6e-90    
ref|XP_010427333.1|  PREDICTED: shaggy-related protein kinase the...    286   6e-90    
ref|XP_007149727.1|  hypothetical protein PHAVU_005G094100g             284   6e-90    



>emb|CDP15204.1| unnamed protein product [Coffea canephora]
Length=409

 Score =   343 bits (880),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 163/172 (95%), Positives = 167/172 (97%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDPS RLPNGRF+PPLFNFKPHELKGVP ET+ KL+PEHARKQCPFL L
Sbjct  358  DELRDPSSRLPNGRFLPPLFNFKPHELKGVPVETLVKLIPEHARKQCPFLAL  409



>ref|XP_011092192.1| PREDICTED: shaggy-related protein kinase alpha [Sesamum indicum]
Length=409

 Score =   340 bits (872),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 161/172 (94%), Positives = 166/172 (97%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDAL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP ET+ KL+PEHARKQCP LGL
Sbjct  358  DELRDPNTRLPNGRFLPPLFNFKPHELKGVPAETLVKLIPEHARKQCPVLGL  409



>emb|CAA67554.1| protein kinase [Trifolium repens]
Length=341

 Score =   337 bits (865),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 161/172 (94%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  170  YYRAPELIFGATEYTTAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  229

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC ALDALTHPFF
Sbjct  230  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCQALDALTHPFF  289

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLP GRF+PPLFNFKPHELKG+P ET+ KLVPEHARKQCPFLGL
Sbjct  290  DELRDPNARLPTGRFLPPLFNFKPHELKGIPVETLVKLVPEHARKQCPFLGL  341



>ref|XP_004495628.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X4 [Cicer arietinum]
Length=410

 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/172 (94%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC ALDALTHPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCQALDALTHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLP GRF+PPLFNFKPHELKGVP ET+ KLVPEHARKQCPFLGL
Sbjct  359  DELRDPNARLPTGRFLPPLFNFKPHELKGVPVETLVKLVPEHARKQCPFLGL  410



>gb|KDP23349.1| hypothetical protein JCGZ_23182 [Jatropha curcas]
Length=408

 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/172 (93%), Positives = 166/172 (97%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  237  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  296

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTE+KFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF
Sbjct  297  IKCMNPNYTEYKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  356

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFK HELKGV  ET+ KL+PEHARKQCPFLGL
Sbjct  357  DELRDPNTRLPNGRFLPPLFNFKSHELKGVAAETLAKLIPEHARKQCPFLGL  408



>gb|AFH00876.1| glycogen synthase kinase-3 [Glycine soja]
Length=410

 Score =   338 bits (866),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 161/172 (94%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFK HELKGVP E + KLVPEHARKQCPFLGL
Sbjct  359  DELRDPNSRLPNGRFLPPLFNFKSHELKGVPAEILVKLVPEHARKQCPFLGL  410



>ref|XP_010486058.1| PREDICTED: shaggy-related protein kinase gamma-like [Camelina 
sativa]
Length=408

 Score =   338 bits (866),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 161/172 (94%), Positives = 166/172 (97%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  237  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  296

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL HPFF
Sbjct  297  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDALVHPFF  356

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  357  DELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLGL  408



>ref|XP_006588432.1| PREDICTED: glycogen synthase kinase-3 isoform X1 [Glycine max]
Length=410

 Score =   338 bits (866),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 161/172 (94%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFK HELKGVP E + KLVPEHARKQCPFLGL
Sbjct  359  DELRDPNSRLPNGRFLPPLFNFKSHELKGVPAEILVKLVPEHARKQCPFLGL  410



>gb|KCW84976.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
Length=370

 Score =   336 bits (862),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIK+LGTPTREE
Sbjct  199  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKILGTPTREE  258

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF
Sbjct  259  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  318

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTET-MKLVPEHARKQCPFLGL  258
            +ELRDPS RLPNGRF+PPLFNFK HELK +P E  +KLVPEHARKQCPFLGL
Sbjct  319  NELRDPSTRLPNGRFLPPLFNFKAHELKNIPAEVQLKLVPEHARKQCPFLGL  370



>ref|XP_010938176.1| PREDICTED: shaggy-related protein kinase alpha-like [Elaeis guineensis]
Length=409

 Score =   337 bits (865),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPG+SGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTET-MKLVPEHARKQCPFLGL  258
            DELRDPS RLPNGRF+PPLFNFKPHELKGVP E  +KL+PEHARKQC FLGL
Sbjct  358  DELRDPSTRLPNGRFLPPLFNFKPHELKGVPMEILLKLIPEHARKQCAFLGL  409



>ref|XP_008793304.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
Length=409

 Score =   337 bits (865),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPG+SGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDPS RLPNGRF+PPLFNFKPHELKGVP E + KL+PEHARKQC FLGL
Sbjct  358  DELRDPSTRLPNGRFLPPLFNFKPHELKGVPMEILSKLIPEHARKQCAFLGL  409



>ref|XP_006299606.1| hypothetical protein CARUB_v10015785mg [Capsella rubella]
 gb|EOA32504.1| hypothetical protein CARUB_v10015785mg [Capsella rubella]
Length=409

 Score =   337 bits (865),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 161/172 (94%), Positives = 166/172 (97%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDALVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  358  DELRDPNARLPNGRFLPPLFNFKPHELKGVPMEMVAKLVPEHARKQCPWLGL  409



>ref|XP_004495625.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004495626.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X2 [Cicer arietinum]
 ref|XP_004495627.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X3 [Cicer arietinum]
Length=434

 Score =   338 bits (867),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 162/172 (94%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  263  YYRAPELIFGATEYTTAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  322

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC ALDALTHPFF
Sbjct  323  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCQALDALTHPFF  382

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLP GRF+PPLFNFKPHELKGVP ET+ KLVPEHARKQCPFLGL
Sbjct  383  DELRDPNARLPTGRFLPPLFNFKPHELKGVPVETLVKLVPEHARKQCPFLGL  434



>emb|CBI39647.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   337 bits (863),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 158/172 (92%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  210  YYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTREE  269

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+A+DALTH FF
Sbjct  270  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTAMDALTHSFF  329

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRD S RLPNGRF+PPLFNFKPHELKGVP E + KL+PEHARKQCPFLGL
Sbjct  330  DELRDSSTRLPNGRFLPPLFNFKPHELKGVPVEILVKLIPEHARKQCPFLGL  381



>ref|XP_007145031.1| hypothetical protein PHAVU_007G204000g [Phaseolus vulgaris]
 ref|XP_007145032.1| hypothetical protein PHAVU_007G204000g [Phaseolus vulgaris]
 gb|ESW17025.1| hypothetical protein PHAVU_007G204000g [Phaseolus vulgaris]
 gb|ESW17026.1| hypothetical protein PHAVU_007G204000g [Phaseolus vulgaris]
Length=410

 Score =   337 bits (865),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 160/172 (93%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFK HELKGVP E + KLVPEHARKQCPFLGL
Sbjct  359  DELRDPNTRLPNGRFLPPLFNFKSHELKGVPAEILVKLVPEHARKQCPFLGL  410



>ref|NP_001242661.1| glycogen synthase kinase-3 [Glycine max]
 gb|ACU18223.1| unknown [Glycine max]
Length=410

 Score =   337 bits (865),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 161/172 (94%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFK HELKGVP E + KLVPEHARKQCPFLGL
Sbjct  359  DELRDPNSRLPNGRFLPPLFNFKSHELKGVPAEILVKLVPEHARKQCPFLGL  410



>ref|XP_006408021.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
 ref|XP_006408023.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
 gb|ESQ49474.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
 gb|ESQ49476.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
Length=409

 Score =   337 bits (865),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 161/172 (94%), Positives = 166/172 (97%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDALVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  358  DELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLGL  409



>dbj|BAJ34573.1| unnamed protein product [Thellungiella halophila]
Length=409

 Score =   337 bits (865),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 161/172 (94%), Positives = 166/172 (97%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDALVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  358  DELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLGL  409



>gb|KGN65982.1| hypothetical protein Csa_1G560660 [Cucumis sativus]
Length=387

 Score =   336 bits (862),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  216  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  275

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTE+KFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTH FF
Sbjct  276  IKCMNPNYTEYKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHQFF  335

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFK HELKGVP E + KL+PEHARKQCPFLGL
Sbjct  336  DELRDPNTRLPNGRFLPPLFNFKAHELKGVPVEILVKLIPEHARKQCPFLGL  387



>gb|ACQ91102.1| glycogen synthase kinase [Glycine max]
Length=410

 Score =   337 bits (864),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/172 (94%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFK HELKGVP E + KLVPEHARKQCPFLGL
Sbjct  359  DELRDPNSRLPNGRFLPPLFNFKSHELKGVPAEILVKLVPEHARKQCPFLGL  410



>ref|XP_002882438.1| hypothetical protein ARALYDRAFT_477878 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58697.1| hypothetical protein ARALYDRAFT_477878 [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/172 (93%), Positives = 166/172 (97%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALD+L HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDSLVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  358  DELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLGL  409



>ref|XP_003554602.1| PREDICTED: shaggy-related protein kinase alpha-like isoform 1 
[Glycine max]
Length=406

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWS GCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  235  YYRAPELIFGATEYTTAIDVWSVGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTREE  294

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHPFF
Sbjct  295  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHPFF  354

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTET-MKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFK HELKGVP E  +KL+PEHARKQCPFLGL
Sbjct  355  DELRDPNTRLPNGRFLPPLFNFKSHELKGVPVEILLKLIPEHARKQCPFLGL  406



>ref|XP_010042192.1| PREDICTED: shaggy-related protein kinase alpha [Eucalyptus grandis]
 ref|XP_010042197.1| PREDICTED: shaggy-related protein kinase alpha [Eucalyptus grandis]
 ref|XP_010042204.1| PREDICTED: shaggy-related protein kinase alpha [Eucalyptus grandis]
 gb|KCW84972.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
 gb|KCW84973.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
 gb|KCW84974.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
 gb|KCW84975.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
Length=413

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIK+LGTPTREE
Sbjct  242  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKILGTPTREE  301

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF
Sbjct  302  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  361

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTET-MKLVPEHARKQCPFLGL  258
            +ELRDPS RLPNGRF+PPLFNFK HELK +P E  +KLVPEHARKQCPFLGL
Sbjct  362  NELRDPSTRLPNGRFLPPLFNFKAHELKNIPAEVQLKLVPEHARKQCPFLGL  413



>gb|KHG02936.1| Shaggy-related protein kinase alpha [Gossypium arboreum]
 gb|KHG22311.1| Shaggy-related protein kinase alpha [Gossypium arboreum]
Length=407

 Score =   336 bits (862),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAE+LLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  236  YYRAPELIFGATEYTTAIDIWSAGCVLAEMLLGQPLFPGESGVDQLVEIIKVLGTPTREE  295

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFH+RMPPEAVDLVSRLLQYSPNLRCSALDAL HPFF
Sbjct  296  IKCMNPNYTEFKFPQIKAHPWHKIFHRRMPPEAVDLVSRLLQYSPNLRCSALDALIHPFF  355

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTE-TMKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP E T KL+PEHARKQCP LGL
Sbjct  356  DELRDPNARLPNGRFLPPLFNFKPHELKGVPEEITAKLIPEHARKQCPSLGL  407



>ref|XP_002280673.1| PREDICTED: shaggy-related protein kinase alpha [Vitis vinifera]
Length=409

 Score =   336 bits (862),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/172 (92%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+A+DALTH FF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTAMDALTHSFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRD S RLPNGRF+PPLFNFKPHELKGVP E + KL+PEHARKQCPFLGL
Sbjct  358  DELRDSSTRLPNGRFLPPLFNFKPHELKGVPVEILVKLIPEHARKQCPFLGL  409



>gb|KJB45479.1| hypothetical protein B456_007G308500 [Gossypium raimondii]
 gb|KJB45481.1| hypothetical protein B456_007G308500 [Gossypium raimondii]
Length=407

 Score =   336 bits (862),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAE+LLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  236  YYRAPELIFGATEYTTAIDIWSAGCVLAEMLLGQPLFPGESGVDQLVEIIKVLGTPTREE  295

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFH+RMPPEAVDLVSRLLQYSPNLRCSALDAL HPFF
Sbjct  296  IKCMNPNYTEFKFPQIKAHPWHKIFHRRMPPEAVDLVSRLLQYSPNLRCSALDALIHPFF  355

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTE-TMKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP E T KL+PEHARKQCP LGL
Sbjct  356  DELRDPNARLPNGRFLPPLFNFKPHELKGVPEEITAKLIPEHARKQCPSLGL  407



>ref|XP_004135570.1| PREDICTED: shaggy-related protein kinase alpha-like [Cucumis 
sativus]
Length=409

 Score =   336 bits (862),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTE+KFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTH FF
Sbjct  298  IKCMNPNYTEYKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHQFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFK HELKGVP E + KL+PEHARKQCPFLGL
Sbjct  358  DELRDPNTRLPNGRFLPPLFNFKAHELKGVPVEILVKLIPEHARKQCPFLGL  409



>ref|XP_003591238.1| Glycogen synthase kinase [Medicago truncatula]
 gb|AES61489.1| glycogen synthase kinase [Medicago truncatula]
 gb|AFK45213.1| unknown [Medicago truncatula]
Length=411

 Score =   336 bits (862),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/172 (94%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  240  YYRAPELIFGATEYTTAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  299

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSPNLRC ALD LTHPFF
Sbjct  300  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPNLRCQALDCLTHPFF  359

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTET-MKLVPEHARKQCPFLGL  258
            DELRDP+ RLP GRF+PPLFNFKPHELKGVP ET MKLVPEHARKQCPFLGL
Sbjct  360  DELRDPNARLPTGRFLPPLFNFKPHELKGVPVETLMKLVPEHARKQCPFLGL  411



>ref|XP_009386339.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   336 bits (862),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEF FPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+AL HPFF
Sbjct  298  IKCMNPNYTEFNFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDPS RLPNGRF+PPLFNFKPHELKGVP ET+ KL+PEHARKQC FLGL
Sbjct  358  DELRDPSTRLPNGRFMPPLFNFKPHELKGVPMETLTKLIPEHARKQCAFLGL  409



>ref|XP_010432712.1| PREDICTED: shaggy-related protein kinase gamma-like [Camelina 
sativa]
Length=407

 Score =   336 bits (861),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/172 (93%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  236  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  295

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALD L HPFF
Sbjct  296  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDTLIHPFF  355

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  356  DELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLGL  407



>ref|XP_010464137.1| PREDICTED: shaggy-related protein kinase gamma [Camelina sativa]
Length=410

 Score =   336 bits (861),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/172 (93%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALD L HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDTLVHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  359  DELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLGL  410



>ref|XP_009134851.1| PREDICTED: shaggy-related protein kinase gamma [Brassica rapa]
Length=410

 Score =   336 bits (861),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/172 (93%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDVWSTGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDAL HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALIHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + +LVPEHARKQCP+LGL
Sbjct  359  DELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVARLVPEHARKQCPWLGL  410



>gb|EPS63877.1| hypothetical protein M569_10905 [Genlisea aurea]
Length=409

 Score =   335 bits (859),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 158/172 (92%), Positives = 167/172 (97%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDMWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+AL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTE-TMKLVPEHARKQCPFLGL  258
            +ELRDP++RLPNGRFVPPLFNFK HELKG+PTE  +KL+PEHARKQCPFLGL
Sbjct  358  NELRDPNVRLPNGRFVPPLFNFKQHELKGIPTEFIVKLIPEHARKQCPFLGL  409



>gb|AAM62970.1| shaggy related protein kinase ASK-GAMMA [Arabidopsis thaliana]
Length=409

 Score =   335 bits (858),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALD+L HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDSLVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+L L
Sbjct  358  DELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLSL  409



>dbj|BAD95892.1| Ser/Thr protein kinase [Lotus japonicus]
Length=412

 Score =   335 bits (858),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 160/172 (93%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  241  YYRAPELIFGATEYTTAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  300

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHPFF
Sbjct  301  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHPFF  360

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELR+PS RLP GRF+PPLFNFK HELKGVP E + KLVPEHARKQCPFLGL
Sbjct  361  DELREPSTRLPTGRFLPPLFNFKSHELKGVPAEILVKLVPEHARKQCPFLGL  412



>ref|XP_010546768.1| PREDICTED: shaggy-related protein kinase alpha [Tarenaya hassleriana]
Length=399

 Score =   334 bits (857),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 158/172 (92%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  228  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  287

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALD L HPFF
Sbjct  288  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDTLVHPFF  347

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVP+HARKQCP+LGL
Sbjct  348  DELRDPNARLPNGRFLPPLFNFKPHELKGVPAEMVAKLVPDHARKQCPWLGL  399



>ref|NP_187235.1| Shaggy-related protein kinase gamma [Arabidopsis thaliana]
 ref|NP_850520.1| Shaggy-related protein kinase gamma [Arabidopsis thaliana]
 sp|P43289.1|KSG3_ARATH RecName: Full=Shaggy-related protein kinase gamma; AltName: Full=ASK-gamma 
[Arabidopsis thaliana]
 gb|AAF26086.1|AC012393_12 shaggy related protein kinase, ASK-GAMMA [Arabidopsis thaliana]
 emb|CAA53180.1| ASK-gamma (Arabidopsis shaggy-related kinase) [Arabidopsis thaliana]
 emb|CAA73247.1| shaggy-like kinase gamma [Arabidopsis thaliana]
 gb|AAL32791.1| shaggy related protein kinase, ASK-GAMMA [Arabidopsis thaliana]
 gb|AAM13346.1| shaggy related protein kinase, ASK-GAMMA [Arabidopsis thaliana]
 dbj|BAE99095.1| shaggy related protein kinase [Arabidopsis thaliana]
 dbj|BAH19402.1| AT3G05840 [Arabidopsis thaliana]
 gb|AEE74303.1| Shaggy-related protein kinase gamma [Arabidopsis thaliana]
 gb|AEE74304.1| Shaggy-related protein kinase gamma [Arabidopsis thaliana]
Length=409

 Score =   335 bits (858),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALD+L HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDSLVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+L L
Sbjct  358  DELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLSL  409



>ref|XP_010921357.1| PREDICTED: shaggy-related protein kinase alpha [Elaeis guineensis]
Length=409

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/172 (91%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPG+SGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTET-MKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR++PPLFNFKPHELKGVP E  +KL+PEHARKQC FLGL
Sbjct  358  DELRDPNTRLPNGRYLPPLFNFKPHELKGVPMEILLKLIPEHARKQCAFLGL  409



>ref|XP_010270906.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Nelumbo nucifera]
 ref|XP_010270907.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Nelumbo nucifera]
Length=409

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/172 (92%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+AL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTET-MKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP E  +KL+PEHARKQC FLGL
Sbjct  358  DELRDPNTRLPNGRFMPPLFNFKPHELKGVPKEMLLKLIPEHARKQCAFLGL  409



>gb|KHN26183.1| Glycogen synthase kinase-3 like MsK-1 [Glycine soja]
Length=370

 Score =   333 bits (854),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/171 (92%), Positives = 164/171 (96%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYT+AID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  199  YYRAPELIFGATEYTSAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  258

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+A DALTHPFF
Sbjct  259  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTAFDALTHPFF  318

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFK HELKGVP+E + KLVPEHARKQCPFLG
Sbjct  319  DELRDPNTRLPNGRFLPPLFNFKSHELKGVPSEILVKLVPEHARKQCPFLG  369



>ref|XP_006576226.1| PREDICTED: uncharacterized protein LOC100788612 isoform X1 [Glycine 
max]
 gb|KHN14222.1| Shaggy-related protein kinase alpha [Glycine soja]
Length=406

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/172 (91%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WS GCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  235  YYRAPELIFGATEYTTAIDIWSVGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTREE  294

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALD LTHPFF
Sbjct  295  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDTLTHPFF  354

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFK HELKGVP E + KL+PEHARKQCPFLGL
Sbjct  355  DELRDPNTRLPNGRFLPPLFNFKSHELKGVPVEILVKLIPEHARKQCPFLGL  406



>gb|EPS73818.1| hypothetical protein M569_00937, partial [Genlisea aurea]
Length=408

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/171 (92%), Positives = 166/171 (97%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDLVSRLLQYSPNLRC+AL+AL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLVSRLLQYSPNLRCTALEALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTE-TMKLVPEHARKQCPFLG  261
            +ELRDP++RLPNGRF+PPLFNFKPHELKGVP E +MKL+PEHARKQCPFLG
Sbjct  358  NELRDPNVRLPNGRFIPPLFNFKPHELKGVPLELSMKLIPEHARKQCPFLG  408



>ref|XP_004163362.1| PREDICTED: shaggy-related protein kinase alpha-like [Cucumis 
sativus]
Length=409

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/172 (92%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTE+KFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTH FF
Sbjct  298  IKCMNPNYTEYKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHQFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFK HE KGVP E + KL+PEHARKQCPFLGL
Sbjct  358  DELRDPNTRLPNGRFLPPLFNFKAHESKGVPVEILVKLIPEHARKQCPFLGL  409



>ref|XP_003555781.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X1 [Glycine max]
 ref|XP_006605787.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X2 [Glycine max]
 ref|XP_006605788.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X3 [Glycine max]
 ref|XP_006605789.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X4 [Glycine max]
Length=426

 Score =   335 bits (858),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/171 (92%), Positives = 164/171 (96%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYT+AID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  255  YYRAPELIFGATEYTSAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  314

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+A DALTHPFF
Sbjct  315  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTAFDALTHPFF  374

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFK HELKGVP+E + KLVPEHARKQCPFLG
Sbjct  375  DELRDPNTRLPNGRFLPPLFNFKSHELKGVPSEILVKLVPEHARKQCPFLG  425



>sp|P51137.1|MSK1_MEDSA RecName: Full=Glycogen synthase kinase-3 homolog MsK-1 [Medicago 
sativa]
 emb|CAA48474.1| protein kinase [Medicago sativa]
Length=411

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/172 (93%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGE GVDQLVEIIKVLGTPTREE
Sbjct  240  YYRAPELIFGATEYTTAIDVWSVGCVLAELLLGQPLFPGERGVDQLVEIIKVLGTPTREE  299

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSPNLRC ALD LTHPFF
Sbjct  300  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPNLRCQALDCLTHPFF  359

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTET-MKLVPEHARKQCPFLGL  258
            DELRDP+ RLP GRF+PPLFNFKPHELKGVP ET MKLVPEHARKQCPFLGL
Sbjct  360  DELRDPNARLPTGRFLPPLFNFKPHELKGVPVETLMKLVPEHARKQCPFLGL  411



>ref|XP_007031229.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
 gb|EOY11731.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
Length=407

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/172 (91%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  236  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  295

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFH+RMPPEAVDLVSRLLQYSPNLRC+ALDAL HPFF
Sbjct  296  IKCMNPNYTEFKFPQIKAHPWHKIFHRRMPPEAVDLVSRLLQYSPNLRCTALDALIHPFF  355

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFK HEL GVP E + KL+PEHARKQCPFLGL
Sbjct  356  DELRDPNARLPNGRFLPPLFNFKSHELNGVPVEILAKLIPEHARKQCPFLGL  407



>ref|XP_010270905.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Nelumbo nucifera]
Length=434

 Score =   335 bits (858),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/172 (92%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  263  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  322

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+AL HPFF
Sbjct  323  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEALIHPFF  382

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTET-MKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP E  +KL+PEHARKQC FLGL
Sbjct  383  DELRDPNTRLPNGRFMPPLFNFKPHELKGVPKEMLLKLIPEHARKQCAFLGL  434



>ref|XP_006382290.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 ref|XP_006382291.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 ref|XP_006382292.1| Glycogen synthase kinase-3 MsK-1 family protein [Populus trichocarpa]
 gb|ERP60087.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 gb|ERP60088.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 gb|ERP60089.1| Glycogen synthase kinase-3 MsK-1 family protein [Populus trichocarpa]
Length=409

 Score =   333 bits (855),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/172 (91%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTE+KFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHPFF
Sbjct  298  IKCMNPNYTEYKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRD + RLPNGRF+PPLFNFK HELKGV  ET+ KL+PEHARKQCPFLGL
Sbjct  358  DELRDQNTRLPNGRFLPPLFNFKSHELKGVSVETLVKLIPEHARKQCPFLGL  409



>ref|XP_006382289.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 gb|ERP60086.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
Length=405

 Score =   333 bits (855),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/172 (91%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  234  YYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  293

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTE+KFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHPFF
Sbjct  294  IKCMNPNYTEYKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHPFF  353

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRD + RLPNGRF+PPLFNFK HELKGV  ET+ KL+PEHARKQCPFLGL
Sbjct  354  DELRDQNTRLPNGRFLPPLFNFKSHELKGVSVETLVKLIPEHARKQCPFLGL  405



>emb|CDY05202.1| BnaC05g46010D [Brassica napus]
Length=410

 Score =   333 bits (854),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCV+AELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDVWSAGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSP+LRC ALDAL HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPSLRCGALDALVHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  359  DELRDPNARLPNGRFFPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLGL  410



>ref|XP_011039006.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039008.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039009.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039010.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039011.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
Length=409

 Score =   333 bits (854),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTE+KFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHPFF
Sbjct  298  IKCMNPNYTEYKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRD + RLPNGRF+PPLFNFK HELKG+  ET+ KL+PEHARKQCPFLGL
Sbjct  358  DELRDQNTRLPNGRFLPPLFNFKSHELKGISVETLVKLIPEHARKQCPFLGL  409



>ref|XP_008450520.1| PREDICTED: shaggy-related protein kinase NtK-1 [Cucumis melo]
Length=409

 Score =   333 bits (854),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/172 (91%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTE+KFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTH FF
Sbjct  298  IKCMNPNYTEYKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHQFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFNFK HELKGVP E + KL+PEHARKQCPFLGL
Sbjct  358  DELRDPNTRLPNGRILPPLFNFKAHELKGVPVEILVKLIPEHARKQCPFLGL  409



>ref|XP_006408022.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
 gb|ESQ49475.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
Length=410

 Score =   333 bits (853),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 161/173 (93%), Positives = 166/173 (96%), Gaps = 2/173 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDALVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPH-ELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPH ELKGVP E + KLVPEHARKQCP+LGL
Sbjct  358  DELRDPNARLPNGRFLPPLFNFKPHAELKGVPVEMVAKLVPEHARKQCPWLGL  410



>ref|NP_001242406.1| uncharacterized protein LOC100788612 [Glycine max]
 gb|ACU21024.1| unknown [Glycine max]
Length=406

 Score =   332 bits (852),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRA ELIFGATEYTTAID+WS GCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  235  YYRASELIFGATEYTTAIDIWSVGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTREE  294

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALD LTHPFF
Sbjct  295  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDTLTHPFF  354

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFK HELKGVP E + KL+PEHARKQCPFLGL
Sbjct  355  DELRDPNTRLPNGRFLPPLFNFKSHELKGVPVEILVKLIPEHARKQCPFLGL  406



>gb|ABY60447.1| serine/threonine protein kinase [Adonis aestivalis var. palaestina]
Length=409

 Score =   332 bits (852),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 158/172 (92%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALDAL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALDALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KL+PEHARKQC FLGL
Sbjct  358  DELRDPTTRLPNGRFLPPLFNFKPHELKGVPVEILGKLIPEHARKQCAFLGL  409



>gb|EYU38392.1| hypothetical protein MIMGU_mgv1a007572mg [Erythranthe guttata]
Length=403

 Score =   332 bits (852),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 157/172 (91%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  232  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  291

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSA+D L H FF
Sbjct  292  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSAMDVLVHSFF  351

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+  LPNGRF+PPLFNFKPHELK VP ET+ KL+PEHARKQCPFLGL
Sbjct  352  DELRDPNAHLPNGRFLPPLFNFKPHELKDVPMETLVKLIPEHARKQCPFLGL  403



>ref|XP_010276519.1| PREDICTED: shaggy-related protein kinase alpha [Nelumbo nucifera]
 ref|XP_010276520.1| PREDICTED: shaggy-related protein kinase alpha [Nelumbo nucifera]
Length=409

 Score =   332 bits (852),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 157/172 (91%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIK+LGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKILGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+AL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEALVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTET-MKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKP+ELKGVP E  +KLVPEHARKQC FLGL
Sbjct  358  DELRDPNTRLPNGRFLPPLFNFKPNELKGVPVEMLLKLVPEHARKQCAFLGL  409



>ref|XP_009147201.1| PREDICTED: shaggy-related protein kinase gamma [Brassica rapa]
Length=410

 Score =   332 bits (852),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 158/172 (92%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCV+AELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDIWSAGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSP+LRC ALDAL HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPSLRCGALDALVHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTE-TMKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF PPLFNFKPHELKGVP E   KLVPEHARKQCP+LGL
Sbjct  359  DELRDPNARLPNGRFFPPLFNFKPHELKGVPVEMAAKLVPEHARKQCPWLGL  410



>ref|XP_010493929.1| PREDICTED: shaggy-related protein kinase alpha isoform X2 [Camelina 
sativa]
Length=370

 Score =   331 bits (848),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  199  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  258

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HPFF
Sbjct  259  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHPFF  318

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  319  DELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLGL  370



>ref|XP_010455024.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
 ref|XP_010455025.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
Length=412

 Score =   332 bits (852),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  241  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  300

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HPFF
Sbjct  301  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHPFF  360

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  361  DELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLGL  412



>ref|XP_002319468.1| Glycogen synthase kinase-3 MsK-1 family protein [Populus trichocarpa]
 gb|EEE95391.1| Glycogen synthase kinase-3 MsK-1 family protein [Populus trichocarpa]
Length=409

 Score =   332 bits (852),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 157/172 (91%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTE+KFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHPFF
Sbjct  298  IKCMNPNYTEYKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRD + RLPNGRF+PPLFNFK HELKGV  E + KLVPEHARKQC FLGL
Sbjct  358  DELRDQNTRLPNGRFLPPLFNFKSHELKGVSVEMLVKLVPEHARKQCAFLGL  409



>ref|XP_006394905.1| hypothetical protein EUTSA_v10004319mg [Eutrema salsugineum]
 gb|ESQ32191.1| hypothetical protein EUTSA_v10004319mg [Eutrema salsugineum]
Length=409

 Score =   332 bits (851),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  358  DELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVGKLVPEHARKQCPWLGL  409



>ref|XP_006289925.1| hypothetical protein CARUB_v10003541mg [Capsella rubella]
 gb|EOA22823.1| hypothetical protein CARUB_v10003541mg [Capsella rubella]
Length=409

 Score =   332 bits (851),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  358  DELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLGL  409



>ref|XP_010493927.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Camelina 
sativa]
 ref|XP_010493928.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Camelina 
sativa]
Length=412

 Score =   332 bits (851),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  241  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  300

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HPFF
Sbjct  301  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHPFF  360

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  361  DELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLGL  412



>ref|XP_002874323.1| hypothetical protein ARALYDRAFT_489503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50582.1| hypothetical protein ARALYDRAFT_489503 [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  358  DELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLGL  409



>ref|XP_011023844.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011023845.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
Length=409

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/172 (91%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTE+KFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL HPFF
Sbjct  298  IKCMNPNYTEYKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALMHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRD + RLPNGRF+PPLFNFK HELKGV  ET+ KLVPEHARKQC FLGL
Sbjct  358  DELRDQNTRLPNGRFLPPLFNFKSHELKGVSVETLVKLVPEHARKQCAFLGL  409



>ref|XP_002515218.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
 gb|EEF47202.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
Length=409

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/172 (91%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALDAL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALDALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNF+PHELKGVP E + KL+PEHARKQC FLGL
Sbjct  358  DELRDPNTRLPNGRFLPPLFNFRPHELKGVPVEVLVKLIPEHARKQCAFLGL  409



>ref|XP_009629200.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
tomentosiformis]
 ref|XP_009629201.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
tomentosiformis]
Length=409

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/172 (92%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNY EFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHPFF
Sbjct  298  IKCMNPNYNEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDALTHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFK HELK V  ET+ KLVPEHARKQCP LGL
Sbjct  358  DELRDPNTRLPNGRFLPPLFNFKAHELKNVHAETLVKLVPEHARKQCPSLGL  409



>ref|XP_010910596.1| PREDICTED: shaggy-related protein kinase alpha-like [Elaeis guineensis]
Length=409

 Score =   332 bits (850),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLL Q LFPG+SGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLQQPLFPGDSGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTET-MKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR++PPLFNFKPHELKGVP E  +KL+PEHARKQC FLGL
Sbjct  358  DELRDPNTRLPNGRYLPPLFNFKPHELKGVPMEILLKLIPEHARKQCAFLGL  409



>emb|CDY49981.1| BnaC03g34380D [Brassica napus]
 emb|CDX74129.1| BnaA03g29180D [Brassica napus]
Length=411

 Score =   332 bits (850),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 165/173 (95%), Gaps = 2/173 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDVWSTGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDAL HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALVHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPH-ELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPH ELKGVP E + +LVPEHARKQCP+LGL
Sbjct  359  DELRDPNARLPNGRFLPPLFNFKPHAELKGVPVEMVARLVPEHARKQCPWLGL  411



>ref|XP_010421531.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
 ref|XP_010421533.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
Length=412

 Score =   332 bits (850),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/172 (92%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  241  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  300

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HPFF
Sbjct  301  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHPFF  360

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KL+PEHARKQCP+LGL
Sbjct  361  DELRDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLIPEHARKQCPWLGL  412



>ref|XP_011079505.1| PREDICTED: shaggy-related protein kinase alpha-like [Sesamum 
indicum]
Length=413

 Score =   332 bits (850),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 165/171 (96%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+AL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP++RLPNGRFVPPLFNFKP+E+KGVP E + KL+PEHARKQC FLG
Sbjct  358  DELRDPNVRLPNGRFVPPLFNFKPNEIKGVPAELLGKLIPEHARKQCAFLG  408



>ref|XP_004967857.1| PREDICTED: shaggy-related protein kinase alpha-like [Setaria 
italica]
Length=408

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 166/172 (97%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  237  YYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTREE  296

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSPNLRC+A++AL HPFF
Sbjct  297  IKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCTAVEALVHPFF  356

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP + + KL+PEHA+KQCP++GL
Sbjct  357  DELRDPNTRLPNGRFLPPLFNFKPHELKGVPADIVAKLIPEHAKKQCPYVGL  408



>ref|NP_568486.1| Shaggy-related protein kinase alpha [Arabidopsis thaliana]
 sp|P43288.3|KSG1_ARATH RecName: Full=Shaggy-related protein kinase alpha; AltName: Full=ASK-alpha 
[Arabidopsis thaliana]
 gb|AAL16257.1|AF428327_1 AT5g26750/F2P16_10 [Arabidopsis thaliana]
 gb|AAK76698.1| putative shaggy kinase alpha [Arabidopsis thaliana]
 gb|AAN13164.1| putative shaggy kinase alpha [Arabidopsis thaliana]
 gb|AED93596.1| Shaggy-related protein kinase alpha [Arabidopsis thaliana]
Length=405

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  234  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  293

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HPFF
Sbjct  294  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHPFF  353

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  354  DELRDPNARLPNGRFLPPLFNFKPHELKGVPLEMVAKLVPEHARKQCPWLGL  405



>dbj|BAJ99594.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=408

 Score =   331 bits (848),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELL GQ LFPGESGVDQLVEIIK+LGTPTREE
Sbjct  237  YYRAPELIFGATEYTTAIDIWSAGCVLAELLTGQPLFPGESGVDQLVEIIKILGTPTREE  296

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSP+LR SALDAL HPFF
Sbjct  297  IKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPHLRSSALDALIHPFF  356

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTE-TMKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKG+P E  MKLVPEHAR QCPFLGL
Sbjct  357  DELRDPNTRLPNGRFLPPLFNFKPHELKGLPMEIAMKLVPEHARSQCPFLGL  408



>ref|XP_009382471.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Musa acuminata subsp. malaccensis]
 ref|XP_009382472.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=409

 Score =   331 bits (848),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYT+AID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTSAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+AL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRD   RLPNGRF+PPLFNFKPHELKGVP E + KL+PEHARKQC FLGL
Sbjct  358  DELRDSDTRLPNGRFLPPLFNFKPHELKGVPMEIVAKLIPEHARKQCAFLGL  409



>ref|NP_001148880.1| glycogen synthase kinase-3 MsK-3 [Zea mays]
 ref|XP_008654975.1| PREDICTED: glycogen synthase kinase-3 MsK-3 isoform X1 [Zea mays]
 gb|ACG33274.1| glycogen synthase kinase-3 MsK-3 [Zea mays]
 gb|AFW79697.1| putative glycogen synthase kinase family protein [Zea mays]
Length=408

 Score =   330 bits (847),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 166/172 (97%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  237  YYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTREE  296

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSPNLRC+A++AL HPFF
Sbjct  297  IKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCTAMEALVHPFF  356

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP++ + KL+PEHA+KQC ++GL
Sbjct  357  DELRDPNTRLPNGRFLPPLFNFKPHELKGVPSDIVAKLIPEHAKKQCSYVGL  408



>ref|XP_007031230.1| Shaggy-related kinase 11, 11 isoform 2 [Theobroma cacao]
 gb|EOY11732.1| Shaggy-related kinase 11, 11 isoform 2 [Theobroma cacao]
Length=409

 Score =   330 bits (847),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 157/173 (91%), Positives = 164/173 (95%), Gaps = 2/173 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQT-LFPGESGVDQLVEIIKVLGTPTRE  594
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ  LFPGESGVDQLVEIIKVLGTPTRE
Sbjct  237  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQQPLFPGESGVDQLVEIIKVLGTPTRE  296

Query  593  EIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPF  414
            EIKCMNPNYTEFKFPQIKAHPWHKIFH+RMPPEAVDLVSRLLQYSPNLRC+ALDAL HPF
Sbjct  297  EIKCMNPNYTEFKFPQIKAHPWHKIFHRRMPPEAVDLVSRLLQYSPNLRCTALDALIHPF  356

Query  413  FDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            FDELRDP+ RLPNGRF+PPLFNFK HEL GVP E + KL+PEHARKQCPFLGL
Sbjct  357  FDELRDPNARLPNGRFLPPLFNFKSHELNGVPVEILAKLIPEHARKQCPFLGL  409



>ref|XP_009384446.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384447.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384448.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   330 bits (847),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGA EYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGAIEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIK HPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+AL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKGHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTE-TMKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKP+ELKGVP+E  +KL+PEHARKQC FLGL
Sbjct  358  DELRDPTTRLPNGRFLPPLFNFKPYELKGVPSEIVVKLIPEHARKQCAFLGL  409



>ref|XP_009382470.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=421

 Score =   330 bits (847),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYT+AID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  250  YYRAPELIFGATEYTSAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  309

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+AL HPFF
Sbjct  310  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEALIHPFF  369

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRD   RLPNGRF+PPLFNFKPHELKGVP E + KL+PEHARKQC FLGL
Sbjct  370  DELRDSDTRLPNGRFLPPLFNFKPHELKGVPMEIVAKLIPEHARKQCAFLGL  421



>ref|XP_009151155.1| PREDICTED: shaggy-related protein kinase alpha [Brassica rapa]
 emb|CDX88238.1| BnaA06g28290D [Brassica napus]
Length=403

 Score =   330 bits (845),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 158/172 (92%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  232  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  291

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HPFF
Sbjct  292  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHPFF  351

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGV  E + KLVPEHARKQCP+LGL
Sbjct  352  DELRDPNARLPNGRFLPPLFNFKPHELKGVAVEIVAKLVPEHARKQCPWLGL  403



>ref|XP_010941497.1| PREDICTED: shaggy-related protein kinase alpha [Elaeis guineensis]
Length=409

 Score =   330 bits (845),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIK+LGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKILGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHK+F+KRMPPEAVDLVSRLLQYSPNLR +ALDAL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKVFNKRMPPEAVDLVSRLLQYSPNLRSTALDALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KL+PEHARKQC FLGL
Sbjct  358  DELRDPNTRLPNGRFLPPLFNFKPHELKGVPMEMVAKLIPEHARKQCAFLGL  409



>ref|XP_002302794.1| Glycogen synthase kinase-3 MsK-3 family protein [Populus trichocarpa]
 gb|EEE82067.1| Glycogen synthase kinase-3 MsK-3 family protein [Populus trichocarpa]
Length=409

 Score =   329 bits (844),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFNFKPHELKGVP E + KL+PEHARKQC FLGL
Sbjct  358  DELRDPNARLPNGRILPPLFNFKPHELKGVPVEMLVKLIPEHARKQCAFLGL  409



>gb|ABK93098.1| unknown [Populus trichocarpa]
Length=409

 Score =   329 bits (844),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTE+KFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHPFF
Sbjct  298  IKCMNPNYTEYKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRD + RLPNGRF+PPL NFK HELKGV  E + KLVPEHARKQC FLGL
Sbjct  358  DELRDQNTRLPNGRFLPPLSNFKSHELKGVSVEMLVKLVPEHARKQCAFLGL  409



>ref|XP_008781189.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
 ref|XP_008781190.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
Length=409

 Score =   329 bits (844),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPG+SGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+AL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTET-MKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR++PPLFNFKPHELKGVP E  +KL+PEH RKQC FLG 
Sbjct  358  DELRDPNTRLPNGRYLPPLFNFKPHELKGVPMEILLKLIPEHVRKQCAFLGF  409



>ref|XP_009111716.1| PREDICTED: shaggy-related protein kinase alpha-like [Brassica 
rapa]
Length=406

 Score =   329 bits (844),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/172 (92%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  235  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  294

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HPFF
Sbjct  295  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHPFF  354

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGV  E + KLVPEHARKQCP+LGL
Sbjct  355  DELRDPNARLPNGRFLPPLFNFKPHELKGVAVEIVAKLVPEHARKQCPWLGL  406



>ref|XP_010097328.1| Shaggy-related protein kinase alpha [Morus notabilis]
 gb|EXB67560.1| Shaggy-related protein kinase alpha [Morus notabilis]
Length=522

 Score =   333 bits (853),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYT+AID+WSAGCVLAELLLGQ LFPG+SGVDQLVEIIKVLGTPTREE
Sbjct  237  YYRAPELIFGATEYTSAIDIWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTREE  296

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHPFF
Sbjct  297  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHPFF  356

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFK HELKGV  E + KL+PEHARKQC FLGL
Sbjct  357  DELRDPNTRLPNGRFLPPLFNFKAHELKGVSVEILVKLIPEHARKQCSFLGL  408



>emb|CDX87033.1| BnaC09g03480D [Brassica napus]
Length=406

 Score =   329 bits (843),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/172 (92%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  235  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  294

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HPFF
Sbjct  295  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHPFF  354

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGV  E + KLVPEHARKQCP+LGL
Sbjct  355  DELRDPNARLPNGRFLPPLFNFKPHELKGVAVEIVAKLVPEHARKQCPWLGL  406



>emb|CBI37005.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   328 bits (841),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  210  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  269

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  270  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALIHPFF  329

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELR+P+ RLPNGRF+PPLFNFKPHELKGVP + + KL+PEHARKQC FLGL
Sbjct  330  DELREPNTRLPNGRFLPPLFNFKPHELKGVPVDMLVKLIPEHARKQCAFLGL  381



>ref|XP_009775930.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
sylvestris]
 ref|XP_009775931.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
sylvestris]
Length=409

 Score =   329 bits (843),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/172 (91%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNY EFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTH FF
Sbjct  298  IKCMNPNYNEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDALTHHFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTET-MKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFK HELK V  ET +KLVPEHARKQCP LGL
Sbjct  358  DELRDPNTRLPNGRFLPPLFNFKAHELKNVHAETLLKLVPEHARKQCPSLGL  409



>gb|KDP28311.1| hypothetical protein JCGZ_14082 [Jatropha curcas]
Length=409

 Score =   329 bits (843),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            +ELRDP+ RLPNGRF+PPLFNFKPHEL+GVP E + KL+PEHARKQC FLGL
Sbjct  358  NELRDPNTRLPNGRFLPPLFNFKPHELRGVPVEMLAKLIPEHARKQCAFLGL  409



>emb|CDY19757.1| BnaA09g04100D [Brassica napus]
Length=406

 Score =   329 bits (843),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/172 (92%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  235  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  294

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HPFF
Sbjct  295  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHPFF  354

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGV  E + KLVPEHARKQCP+LGL
Sbjct  355  DELRDPNARLPNGRFLPPLFNFKPHELKGVAVEIVAKLVPEHARKQCPWLGL  406



>ref|XP_008246288.1| PREDICTED: shaggy-related protein kinase alpha [Prunus mume]
 ref|XP_008246289.1| PREDICTED: shaggy-related protein kinase alpha [Prunus mume]
 ref|XP_008246290.1| PREDICTED: shaggy-related protein kinase alpha [Prunus mume]
Length=410

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/171 (92%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTET-MKLVPEHARKQCPFLG  261
            DELRD + RLPNGRF+PPLFNFK HELKGVP E  MKL+PEHARKQ PFL 
Sbjct  358  DELRDLNTRLPNGRFLPPLFNFKSHELKGVPVEILMKLIPEHARKQAPFLA  408



>ref|XP_010524830.1| PREDICTED: shaggy-related protein kinase alpha-like [Tarenaya 
hassleriana]
Length=409

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSP LRC++LDAL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPYLRCTSLDALVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFK HELKGVP E + KLVPEHAR+QCP+LGL
Sbjct  358  DELRDPNARLPNGRFLPPLFNFKAHELKGVPAEMVAKLVPEHARRQCPWLGL  409



>ref|XP_007205270.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 ref|XP_007205271.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 ref|XP_007205272.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 gb|EMJ06469.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 gb|EMJ06470.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 gb|EMJ06471.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
Length=410

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/171 (92%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTET-MKLVPEHARKQCPFLG  261
            DELRD + RLPNGRF+PPLFNFK HELKGVP E  MKL+PEHARKQ PFL 
Sbjct  358  DELRDLNTRLPNGRFLPPLFNFKSHELKGVPVEILMKLIPEHARKQVPFLA  408



>ref|XP_010679446.1| PREDICTED: shaggy-related protein kinase NtK-1 [Beta vulgaris 
subsp. vulgaris]
Length=409

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 164/171 (96%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDA+THPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDAITHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGR +PPLFNFK HELKGVP ET+ ++VPEHARKQC FLG
Sbjct  358  DELRDPNSRLPNGRPLPPLFNFKAHELKGVPEETLVRVVPEHARKQCGFLG  408



>ref|XP_007051226.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
 ref|XP_007051227.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
 gb|EOX95383.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
 gb|EOX95384.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
Length=409

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +A++AL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTAIEALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP + + KL+PEHARKQC FLGL
Sbjct  358  DELRDPNTRLPNGRFLPPLFNFKPHELKGVPVDIIVKLIPEHARKQCAFLGL  409



>ref|XP_010652295.1| PREDICTED: shaggy-related protein kinase alpha isoform X2 [Vitis 
vinifera]
Length=390

 Score =   328 bits (840),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  219  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  278

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  279  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALIHPFF  338

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELR+P+ RLPNGRF+PPLFNFKPHELKGVP + + KL+PEHARKQC FLGL
Sbjct  339  DELREPNTRLPNGRFLPPLFNFKPHELKGVPVDMLVKLIPEHARKQCAFLGL  390



>ref|XP_007221484.1| hypothetical protein PRUPE_ppa006462mg [Prunus persica]
 gb|EMJ22683.1| hypothetical protein PRUPE_ppa006462mg [Prunus persica]
Length=410

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/171 (91%), Positives = 162/171 (95%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALAHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFK HELKGVP E + KL+PEHARKQC FLG
Sbjct  358  DELRDPNTRLPNGRFLPPLFNFKAHELKGVPAEMLVKLIPEHARKQCAFLG  408



>ref|XP_004230343.1| PREDICTED: shaggy-related protein kinase NtK-1 [Solanum lycopersicum]
Length=409

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/172 (91%), Positives = 161/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNY EFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL HPFF
Sbjct  298  IKCMNPNYNEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDALVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTET-MKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFK HELK V  E  +KLVPEHARKQCP LGL
Sbjct  358  DELRDPNTRLPNGRFLPPLFNFKAHELKNVHAEILLKLVPEHARKQCPSLGL  409



>ref|NP_001269276.1| glycogen synthase kinase-3 homolog MsK-1-like [Fragaria vesca]
 ref|XP_011465886.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X1 [Fragaria vesca subsp. vesca]
 ref|XP_011465887.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X1 [Fragaria vesca subsp. vesca]
 gb|AEH02865.1| protein kinase [Fragaria vesca]
Length=412

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/170 (92%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  240  YYRAPELIFGATEYTTAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  299

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHPFF
Sbjct  300  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHPFF  359

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTET-MKLVPEHARKQCPFL  264
            DELRD + RLPNGRF+PPLFNFK HELKGVP E  MKLVPEHARKQ PF+
Sbjct  360  DELRDLNTRLPNGRFLPPLFNFKSHELKGVPAEILMKLVPEHARKQVPFM  409



>ref|XP_008227813.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 [Prunus mume]
Length=410

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/171 (91%), Positives = 162/171 (95%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALAHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFK HELKGVP E + KL+PEHARKQC FLG
Sbjct  358  DELRDPNTRLPNGRFLPPLFNFKAHELKGVPAEMLVKLIPEHARKQCAFLG  408



>ref|XP_002279596.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Vitis 
vinifera]
 emb|CAN75652.1| hypothetical protein VITISV_017659 [Vitis vinifera]
Length=409

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELR+P+ RLPNGRF+PPLFNFKPHELKGVP + + KL+PEHARKQC FLGL
Sbjct  358  DELREPNTRLPNGRFLPPLFNFKPHELKGVPVDMLVKLIPEHARKQCAFLGL  409



>ref|XP_008778092.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
 ref|XP_008778093.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
Length=409

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLL Q LFPGESGVDQLVEIIK+LGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLEQPLFPGESGVDQLVEIIKILGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRSTALEALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVPTE + KL+PEHARKQC FLGL
Sbjct  358  DELRDPNTRLPNGRFLPPLFNFKPHELKGVPTEIVAKLIPEHARKQCAFLGL  409



>gb|ABG74911.1| AtSK12-like protein [Brassica napus]
Length=410

 Score =   328 bits (842),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/172 (91%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDVWSTGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGV  E + KLVPEHARKQCP+LGL
Sbjct  359  DELRDPNARLPNGRFLPPLFNFKPHELKGVAVEIVAKLVPEHARKQCPWLGL  410



>ref|XP_011003165.1| PREDICTED: shaggy-related protein kinase alpha-like [Populus 
euphratica]
 ref|XP_011003166.1| PREDICTED: shaggy-related protein kinase alpha-like [Populus 
euphratica]
Length=409

 Score =   328 bits (841),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFNFKPHELKGVP E + KL+PEHARKQC FLGL
Sbjct  358  DELRDPNARLPNGRILPPLFNFKPHELKGVPFEMLVKLIPEHARKQCAFLGL  409



>ref|XP_008388444.1| PREDICTED: shaggy-related protein kinase alpha [Malus domestica]
 ref|XP_008388445.1| PREDICTED: shaggy-related protein kinase alpha [Malus domestica]
 ref|XP_008388446.1| PREDICTED: shaggy-related protein kinase alpha [Malus domestica]
Length=412

 Score =   328 bits (841),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYT+AIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  240  YYRAPELIFGATEYTSAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  299

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL H FF
Sbjct  300  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALVHSFF  359

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTET-MKLVPEHARKQCPFLG  261
            D+LRDP+ RLPNGRF+PPLFNFK HELKGVP ET MKLVPEHARKQ PFL 
Sbjct  360  DDLRDPNTRLPNGRFLPPLFNFKSHELKGVPAETLMKLVPEHARKQVPFLA  410



>gb|ABB55385.1| Ser/Thr protein kinase-like [Solanum tuberosum]
Length=409

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 157/172 (91%), Positives = 160/172 (93%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNY EFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC ALDAL HPFF
Sbjct  298  IKCMNPNYNEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCGALDALVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTET-MKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFK HELK V  E  +KLVPEHARKQCP LGL
Sbjct  358  DELRDPNTRLPNGRFLPPLFNFKAHELKNVHAEILLKLVPEHARKQCPSLGL  409



>ref|NP_001274855.1| Shaggy-like protein kinase NtK-1 [Solanum tuberosum]
 ref|XP_006344811.1| PREDICTED: shaggy-related protein kinase NtK-1 [Solanum tuberosum]
 gb|ABB87119.1| NtK-1-like [Solanum tuberosum]
Length=409

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 157/172 (91%), Positives = 160/172 (93%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNY EFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC ALDAL HPFF
Sbjct  298  IKCMNPNYNEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCGALDALVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTET-MKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFK HELK V  E  +KLVPEHARKQCP LGL
Sbjct  358  DELRDPNTRLPNGRFLPPLFNFKAHELKNVHAEILLKLVPEHARKQCPSLGL  409



>ref|XP_009335521.1| PREDICTED: shaggy-related protein kinase alpha [Pyrus x bretschneideri]
 ref|XP_009335522.1| PREDICTED: shaggy-related protein kinase alpha [Pyrus x bretschneideri]
 ref|XP_009335523.1| PREDICTED: shaggy-related protein kinase alpha [Pyrus x bretschneideri]
Length=414

 Score =   328 bits (841),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYT+AIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  242  YYRAPELIFGATEYTSAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  301

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL H FF
Sbjct  302  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALVHSFF  361

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTET-MKLVPEHARKQCPFLG  261
            D+LRDP+ RLPNGRF+PPLFNFK HELKGVP ET MKLVPEHARKQ PFL 
Sbjct  362  DDLRDPNTRLPNGRFLPPLFNFKSHELKGVPAETLMKLVPEHARKQVPFLA  412



>ref|XP_006650852.1| PREDICTED: shaggy-related protein kinase alpha-like [Oryza brachyantha]
Length=409

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELL GQ LFPGESG+DQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLTGQPLFPGESGLDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHK+FHKR+PPEAVDLVSRLLQYSP+LRCSALDAL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKVFHKRIPPEAVDLVSRLLQYSPHLRCSALDALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP E + KL+P HAR QCPFLGL
Sbjct  358  DELRDPNARLPNGRFLPPLFNFKPHELKGVPVEVVKKLIPGHARNQCPFLGL  409



>ref|XP_009363099.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 [Pyrus x 
bretschneideri]
Length=409

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 155/171 (91%), Positives = 162/171 (95%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALAHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFK HELKGVP E + KL+PEHARKQC FLG
Sbjct  358  DELRDPNTRLPNGRFLPPLFNFKAHELKGVPAEMLVKLIPEHARKQCAFLG  408



>gb|EYU46859.1| hypothetical protein MIMGU_mgv1a007395mg [Erythranthe guttata]
 gb|EYU46860.1| hypothetical protein MIMGU_mgv1a007395mg [Erythranthe guttata]
Length=409

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYT+AID+WSAGCV+AELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTSAIDIWSAGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEA DLVSRLLQYSPNLRC+AL+A+ HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEATDLVSRLLQYSPNLRCTALEAMIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP++RLPNGR VPPLFNFKPHELKGV  E + +L+PEHARKQC FLGL
Sbjct  358  DELRDPNVRLPNGRVVPPLFNFKPHELKGVAVEMLGRLIPEHARKQCAFLGL  409



>ref|XP_009366055.1| PREDICTED: shaggy-related protein kinase alpha-like [Pyrus x 
bretschneideri]
 ref|XP_009366056.1| PREDICTED: shaggy-related protein kinase alpha-like [Pyrus x 
bretschneideri]
Length=412

 Score =   327 bits (839),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 155/171 (91%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYT+AIDVWS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  240  YYRAPELIFGATEYTSAIDVWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  299

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFH+RMPPEAVDLVSRLLQYSPNLRC+ALDAL H FF
Sbjct  300  IKCMNPNYTEFKFPQIKAHPWHKIFHRRMPPEAVDLVSRLLQYSPNLRCTALDALVHSFF  359

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTET-MKLVPEHARKQCPFLG  261
            D+LRDP+ RLPNGRF+PPLFNFK HELKGVP ET MKLVPEHARKQ PFL 
Sbjct  360  DDLRDPNTRLPNGRFLPPLFNFKSHELKGVPAETLMKLVPEHARKQVPFLA  410



>ref|XP_006643997.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Oryza brachyantha]
 ref|XP_006643998.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Oryza brachyantha]
Length=408

 Score =   327 bits (839),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  237  YYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTREE  296

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHK+FHKR+PPEAVDLVSRLLQYSPNLRC+A++AL HPFF
Sbjct  297  IKCMNPNYTEFKFPQIKAHPWHKVFHKRLPPEAVDLVSRLLQYSPNLRCTAVEALVHPFF  356

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKG+P++ M KL+PEHA+KQC + G+
Sbjct  357  DELRDPNARLPNGRFLPPLFNFKPHELKGIPSDIMAKLIPEHAKKQCSYAGV  408



>ref|XP_002455378.1| hypothetical protein SORBIDRAFT_03g009580 [Sorghum bicolor]
 gb|EES00498.1| hypothetical protein SORBIDRAFT_03g009580 [Sorghum bicolor]
Length=408

 Score =   327 bits (838),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  237  YYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTREE  296

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSPNLRC+A++AL HPFF
Sbjct  297  IKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCTAVEALVHPFF  356

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFK HELKGVP + + KL+PEHA+KQC ++GL
Sbjct  357  DELRDPNTRLPNGRFLPPLFNFKAHELKGVPADIVAKLIPEHAKKQCSYVGL  408



>gb|KDO86867.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
 gb|KDO86868.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
Length=292

 Score =   323 bits (827),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYT AID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  121  YYRAPELIFGATEYTAAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  180

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIF KRMPPEAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  181  IKCMNPNYTEFKFPQIKAHPWHKIFQKRMPPEAVDLVSRLLQYSPNLRSTALEALIHPFF  240

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP + + KL+PEHARKQC FLGL
Sbjct  241  DELRDPNTRLPNGRFLPPLFNFKPHELKGVPVDMLVKLIPEHARKQCAFLGL  292



>ref|XP_009617298.1| PREDICTED: shaggy-related protein kinase NtK-1 [Nicotiana tomentosiformis]
 ref|XP_009617299.1| PREDICTED: shaggy-related protein kinase NtK-1 [Nicotiana tomentosiformis]
 ref|XP_009617301.1| PREDICTED: shaggy-related protein kinase NtK-1 [Nicotiana tomentosiformis]
Length=409

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYT+AID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTSAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNY EFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSAL+A+TH FF
Sbjct  298  IKCMNPNYNEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALEAVTHAFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTET-MKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFNFK HELKGV  ET +KLVPEHARKQCP LGL
Sbjct  358  DELRDPNTRLPNGRVLPPLFNFKAHELKGVSAETLLKLVPEHARKQCPSLGL  409



>gb|EMT09676.1| Shaggy-related protein kinase alpha [Aegilops tauschii]
Length=418

 Score =   327 bits (838),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELL GQ LFPGESGVDQLVEIIK+LGTPTREE
Sbjct  247  YYRAPELIFGATEYTTAIDIWSAGCVLAELLTGQPLFPGESGVDQLVEIIKILGTPTREE  306

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHK+FH+RMPPEAVDLVSRLLQYSP+LR SALDAL HPFF
Sbjct  307  IKCMNPNYTEFKFPQIKAHPWHKVFHRRMPPEAVDLVSRLLQYSPHLRSSALDALIHPFF  366

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTE-TMKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKG+P E   KLVPEHAR QCPFLGL
Sbjct  367  DELRDPNTRLPNGRFLPPLFNFKPHELKGLPMEIAAKLVPEHARSQCPFLGL  418



>gb|KHG00969.1| Glycogen synthase kinase-3 MsK-3 [Gossypium arboreum]
Length=409

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGA EYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGAIEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +A++AL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTAIEALVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP  RLPNGRF+PPLFNFKPHELKGVPT+ + KL+PEHA+KQC FLGL
Sbjct  358  DELRDPHTRLPNGRFLPPLFNFKPHELKGVPTDMLPKLIPEHAKKQCSFLGL  409



>ref|XP_008353866.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 [Malus domestica]
 ref|XP_009367184.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Pyrus 
x bretschneideri]
 ref|XP_009367186.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Pyrus 
x bretschneideri]
Length=409

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/171 (90%), Positives = 162/171 (95%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLV+IIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVQIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALAHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFK HELKGVP E + KL+PEHARKQC FLG
Sbjct  358  DELRDPNTRLPNGRFLPPLFNFKAHELKGVPAEMLVKLIPEHARKQCAFLG  408



>ref|XP_009757512.1| PREDICTED: shaggy-related protein kinase NtK-1 [Nicotiana sylvestris]
 ref|XP_009757513.1| PREDICTED: shaggy-related protein kinase NtK-1 [Nicotiana sylvestris]
Length=409

 Score =   326 bits (836),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNY EFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A+TH FF
Sbjct  298  IKCMNPNYNEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEAVTHAFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTET-MKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFNFK HELKGV  E+ +KLVPEHARKQCP LGL
Sbjct  358  DELRDPNTRLPNGRVLPPLFNFKAHELKGVSAESLLKLVPEHARKQCPSLGL  409



>ref|XP_009383704.1| PREDICTED: shaggy-related protein kinase alpha [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   326 bits (836),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPG+SGVDQLVEIIK+LGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKILGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRSTALEALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTE-TMKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR++PPLFNFKPHELKGVP E  +KL+PEHAR+QC FLGL
Sbjct  358  DELRDPNARLPNGRYLPPLFNFKPHELKGVPMEIVLKLIPEHARQQCAFLGL  409



>gb|KDO86866.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
Length=373

 Score =   325 bits (833),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYT AID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  202  YYRAPELIFGATEYTAAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  261

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIF KRMPPEAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  262  IKCMNPNYTEFKFPQIKAHPWHKIFQKRMPPEAVDLVSRLLQYSPNLRSTALEALIHPFF  321

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP + + KL+PEHARKQC FLGL
Sbjct  322  DELRDPNTRLPNGRFLPPLFNFKPHELKGVPVDMLVKLIPEHARKQCAFLGL  373



>gb|KJB49765.1| hypothetical protein B456_008G136600 [Gossypium raimondii]
Length=409

 Score =   326 bits (836),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSPNLR +A++AL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPLEAVDLVSRLLQYSPNLRSTAIEALVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVPT+ + KL+PEHA+KQC FLGL
Sbjct  358  DELRDPNTRLPNGRFLPPLFNFKPHELKGVPTDMLPKLIPEHAKKQCSFLGL  409



>ref|XP_008812956.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Phoenix 
dactylifera]
Length=409

 Score =   326 bits (836),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIK+LGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKILGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL +PFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALINPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTE-TMKLVPEHARKQCPFLGL  258
            DELR+P  RLPNGRF+PPLFNFKPHELKGVP E   KL+PEHARKQC FLGL
Sbjct  358  DELRNPDTRLPNGRFLPPLFNFKPHELKGVPMEIAAKLIPEHARKQCTFLGL  409



>ref|XP_008812957.1| PREDICTED: shaggy-related protein kinase alpha isoform X2 [Phoenix 
dactylifera]
Length=336

 Score =   323 bits (829),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIK+LGTPTREE
Sbjct  165  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKILGTPTREE  224

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL +PFF
Sbjct  225  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALINPFF  284

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTE-TMKLVPEHARKQCPFLGL  258
            DELR+P  RLPNGRF+PPLFNFKPHELKGVP E   KL+PEHARKQC FLGL
Sbjct  285  DELRNPDTRLPNGRFLPPLFNFKPHELKGVPMEIAAKLIPEHARKQCTFLGL  336



>ref|XP_006444573.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 ref|XP_006444575.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 ref|XP_006492384.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like isoform 
X1 [Citrus sinensis]
 gb|ESR57813.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 gb|ESR57815.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 gb|KDO86860.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
 gb|KDO86861.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
 gb|KDO86862.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
 gb|KDO86863.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
Length=403

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYT AID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  232  YYRAPELIFGATEYTAAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  291

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIF KRMPPEAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  292  IKCMNPNYTEFKFPQIKAHPWHKIFQKRMPPEAVDLVSRLLQYSPNLRSTALEALIHPFF  351

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP + + KL+PEHARKQC FLGL
Sbjct  352  DELRDPNTRLPNGRFLPPLFNFKPHELKGVPVDMLVKLIPEHARKQCAFLGL  403



>ref|XP_008447666.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3, partial 
[Cucumis melo]
Length=205

 Score =   318 bits (816),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 162/171 (95%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  34   YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  93

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  94   IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALIHPFF  153

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            +ELRDP+ RLPNGRF+PPLFNFK HELKGVP E + +L+PEHARKQC FLG
Sbjct  154  NELRDPNTRLPNGRFLPPLFNFKAHELKGVPPEMLVRLIPEHARKQCNFLG  204



>ref|XP_006480288.1| PREDICTED: shaggy-related protein kinase alpha-like [Citrus sinensis]
Length=409

 Score =   326 bits (835),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/172 (89%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCV+AEL+LG+ LFPG+SGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVVAELMLGKPLFPGDSGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIF KRMPPEAVDLVSRLLQYSPNLRC+ALDAL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFPKRMPPEAVDLVSRLLQYSPNLRCTALDALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLP+GRF+PPLFNFK HELKGVP E + KL+PEHARKQCPFLGL
Sbjct  358  DELRDPNARLPSGRFLPPLFNFKSHELKGVPVEILVKLIPEHARKQCPFLGL  409



>tpg|DAA53951.1| TPA: putative glycogen synthase kinase family protein [Zea mays]
Length=408

 Score =   326 bits (835),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 164/171 (96%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  237  YYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTREE  296

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHK+F+KRMPPEAVDLVSRLLQYSPNLRC+A++AL HPFF
Sbjct  297  IKCMNPNYTEFKFPQIKAHPWHKVFNKRMPPEAVDLVSRLLQYSPNLRCTAVEALVHPFF  356

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP + + KLVPEHA+KQC ++G
Sbjct  357  DELRDPNTRLPNGRFLPPLFNFKPHELKGVPADIVAKLVPEHAKKQCSYVG  407



>gb|EMS62368.1| Shaggy-related protein kinase alpha [Triticum urartu]
Length=455

 Score =   327 bits (839),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELL GQ LFPGESGVDQLVEIIK+LGTPTREE
Sbjct  284  YYRAPELIFGATEYTTAIDIWSAGCVLAELLTGQPLFPGESGVDQLVEIIKILGTPTREE  343

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSP+LR SALDAL HPFF
Sbjct  344  IKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPHLRSSALDALIHPFF  403

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTE-TMKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKG+P E   KLVPEHAR QCPFLGL
Sbjct  404  DELRDPNTRLPNGRFLPPLFNFKPHELKGLPMEIAAKLVPEHARSQCPFLGL  455



>ref|XP_008381452.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 [Malus domestica]
Length=409

 Score =   325 bits (834),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALAHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFL  264
            DELRDP+ RLPNGRF+PPLFNFK HELKGVP E + KL+PEHARKQC FL
Sbjct  358  DELRDPNTRLPNGRFLPPLFNFKAHELKGVPAEMLVKLIPEHARKQCAFL  407



>ref|NP_001042602.1| Os01g0252100 [Oryza sativa Japonica Group]
 dbj|BAA92214.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAB40983.1| shaggy-related protein kinase gamma [Oryza sativa (japonica cultivar-group)]
 dbj|BAF04516.1| Os01g0252100 [Oryza sativa Japonica Group]
 dbj|BAG94276.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70327.1| hypothetical protein OsI_01196 [Oryza sativa Indica Group]
 gb|EEE54244.1| hypothetical protein OsJ_01119 [Oryza sativa Japonica Group]
Length=408

 Score =   325 bits (834),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  237  YYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTREE  296

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHK+FHKR+PPEAVDLVSRLLQYSPNLRC+A++AL HPFF
Sbjct  297  IKCMNPNYTEFKFPQIKAHPWHKVFHKRLPPEAVDLVSRLLQYSPNLRCTAVEALVHPFF  356

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKG+P++ M KL+PEH +KQC + G+
Sbjct  357  DELRDPNARLPNGRFLPPLFNFKPHELKGIPSDIMAKLIPEHVKKQCSYAGV  408



>gb|AEN14336.1| hypothetical protein rf1-C1-g7 [Zea mays]
Length=408

 Score =   325 bits (834),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 164/171 (96%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  237  YYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTREE  296

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHK+F+KRMPPEAVDLVSRLLQYSPNLRC+A++AL HPFF
Sbjct  297  IKCMNPNYTEFKFPQIKAHPWHKVFNKRMPPEAVDLVSRLLQYSPNLRCTAVEALVHPFF  356

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP + + KLVPEHA+KQC ++G
Sbjct  357  DELRDPNTRLPNGRFLPPLFNFKPHELKGVPADIVAKLVPEHAKKQCSYVG  407



>emb|CDX80585.1| BnaC07g28590D [Brassica napus]
Length=402

 Score =   325 bits (833),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  231  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  290

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HPFF
Sbjct  291  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHPFF  350

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELKGV  E + KLVP+HARKQC +LGL
Sbjct  351  DELRDPNARLPNGRFLPPLFNFKPHELKGVAVEIVAKLVPDHARKQCHWLGL  402



>emb|CDY27737.1| BnaA05g31460D [Brassica napus]
Length=514

 Score =   329 bits (843),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 164/173 (95%), Gaps = 2/173 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCV+AELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  342  YYRAPELIFGATEYTTAIDVWSAGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  401

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSP+LRC ALDAL HPFF
Sbjct  402  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPSLRCGALDALIHPFF  461

Query  410  DELRDPSIRLPNGRFVPPLFNFKPH-ELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF PPLFNFKPH ELKGVP E + KLVPEHARKQCP+LGL
Sbjct  462  DELRDPNARLPNGRFFPPLFNFKPHAELKGVPVEMVAKLVPEHARKQCPWLGL  514



>sp|Q40518.1|MSK1_TOBAC RecName: Full=Shaggy-related protein kinase NtK-1 [Nicotiana 
tabacum]
 emb|CAA54803.1| shaggy like protein kinase [Nicotiana tabacum]
 prf||2106142A Ser/Thr protein kinase
Length=409

 Score =   325 bits (833),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 161/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNY EFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A+TH FF
Sbjct  298  IKCMNPNYNEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEAVTHAFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTET-MKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFNFK HELKGV  E  +KLVPEHARKQCP LGL
Sbjct  358  DELRDPNTRLPNGRVLPPLFNFKAHELKGVSAENLLKLVPEHARKQCPSLGL  409



>emb|CAA53181.1| shaggy related kinase [Arabidopsis thaliana]
 emb|CAA48538.1| serine /threonine protein kinase [Arabidopsis thaliana]
Length=405

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLV IIKVLGTPTREE
Sbjct  234  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVHIIKVLGTPTREE  293

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HPFF
Sbjct  294  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHPFF  353

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PP F+FKPHELKGVP E + KLVPEHARKQCP+LGL
Sbjct  354  DELRDPNARLPNGRFLPPAFHFKPHELKGVPLEMVAKLVPEHARKQCPWLGL  405



>ref|XP_011040636.1| PREDICTED: shaggy-related protein kinase alpha-like [Populus 
euphratica]
Length=409

 Score =   325 bits (832),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYT+AID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTSAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLVSRLLQYSPNLRSTALEALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLP+GRF+PPLFNFKPHELKGVP E + KL+PEHARKQC FLGL
Sbjct  358  DELRDPNTRLPSGRFLPPLFNFKPHELKGVPLEMLVKLIPEHARKQCAFLGL  409



>ref|XP_004148581.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Cucumis 
sativus]
 ref|XP_004163975.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Cucumis 
sativus]
Length=409

 Score =   325 bits (832),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 154/171 (90%), Positives = 162/171 (95%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFK HELKGVP E + +L+PEHARKQC FLG
Sbjct  358  DELRDPNTRLPNGRFLPPLFNFKAHELKGVPPEMLVRLIPEHARKQCNFLG  408



>gb|KHN16033.1| Glycogen synthase kinase-3 like MsK-1 [Glycine soja]
Length=411

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/173 (90%), Positives = 163/173 (94%), Gaps = 2/173 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLG-QTLFPGESGVDQLVEIIKVLGTPTRE  594
            YYRAPELIFGATEYT+AID+WS GCVLAELLL    LFPGESGVDQLVEIIKVLGTPTRE
Sbjct  239  YYRAPELIFGATEYTSAIDIWSVGCVLAELLLAFYPLFPGESGVDQLVEIIKVLGTPTRE  298

Query  593  EIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPF  414
            EIKCMNP+YTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDALTHPF
Sbjct  299  EIKCMNPDYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALTHPF  358

Query  413  FDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            FDELRDP+ RLPNGRF+PPLFNFK HELKGVP E + KLVPEHARKQCPFLGL
Sbjct  359  FDELRDPNSRLPNGRFLPPLFNFKSHELKGVPAEILVKLVPEHARKQCPFLGL  411



>ref|XP_010070089.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Eucalyptus grandis]
 gb|KCW58654.1| hypothetical protein EUGRSUZ_H01313 [Eucalyptus grandis]
 gb|KCW58655.1| hypothetical protein EUGRSUZ_H01313 [Eucalyptus grandis]
 gb|KCW58656.1| hypothetical protein EUGRSUZ_H01313 [Eucalyptus grandis]
 gb|KCW58657.1| hypothetical protein EUGRSUZ_H01313 [Eucalyptus grandis]
 gb|KCW58658.1| hypothetical protein EUGRSUZ_H01313 [Eucalyptus grandis]
Length=409

 Score =   324 bits (830),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNG F+PPLF+FK +ELKGVP E + KL+PEHARKQC  LGL
Sbjct  358  DELRDPNARLPNGLFLPPLFSFKSNELKGVPVEVLAKLIPEHARKQCSSLGL  409



>gb|KDO45353.1| hypothetical protein CISIN_1g015298mg [Citrus sinensis]
Length=409

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCV+AEL+LG+ LFPG+SGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVVAELMLGKPLFPGDSGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIF KRMPPEAVDLVSRLLQYSPNLRC+ALDAL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFPKRMPPEAVDLVSRLLQYSPNLRCTALDALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLP+GRF+PPLFNFK HELK VP E + KL+PEHARKQCPFLGL
Sbjct  358  DELRDPNARLPSGRFLPPLFNFKSHELKSVPVEILVKLIPEHARKQCPFLGL  409



>ref|XP_008672929.1| PREDICTED: LOC100283734 isoform X1 [Zea mays]
Length=438

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 164/171 (96%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  267  YYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTREE  326

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHK+F+KRMPPEAVDLVSRLLQYSPNLRC+A++AL HPFF
Sbjct  327  IKCMNPNYTEFKFPQIKAHPWHKVFNKRMPPEAVDLVSRLLQYSPNLRCTAVEALVHPFF  386

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP + + KLVPEHA+KQC ++G
Sbjct  387  DELRDPNTRLPNGRFLPPLFNFKPHELKGVPADIVAKLVPEHAKKQCSYVG  437



>ref|XP_009401663.1| PREDICTED: shaggy-related protein kinase gamma [Musa acuminata 
subsp. malaccensis]
Length=405

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/167 (90%), Positives = 160/167 (96%), Gaps = 1/167 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLV+IIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVQIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKF QIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+AL HPFF
Sbjct  298  IKCMNPNYTEFKFSQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEALVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQC  273
            DELRD + RLPNGRF+PPLFNFKPHELKGVP ET+ +L+PEHARKQC
Sbjct  358  DELRDHNTRLPNGRFLPPLFNFKPHELKGVPVETVARLIPEHARKQC  404



>ref|XP_011466950.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 isoform X1 
[Fragaria vesca subsp. vesca]
 ref|XP_011466953.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 isoform X2 
[Fragaria vesca subsp. vesca]
Length=409

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 160/170 (94%), Gaps = 1/170 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPNLRSTALEALVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFL  264
            DELRDP+ RLPNGRF+PPLFNFK HELKGVP E + KL+P+HARKQC FL
Sbjct  358  DELRDPNTRLPNGRFLPPLFNFKAHELKGVPAEMIVKLIPDHARKQCAFL  407



>ref|XP_011087526.1| PREDICTED: shaggy-related protein kinase NtK-1 isoform X1 [Sesamum 
indicum]
 ref|XP_011087527.1| PREDICTED: shaggy-related protein kinase NtK-1 isoform X1 [Sesamum 
indicum]
Length=409

 Score =   323 bits (828),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTT ID+WSAGCV+AELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTNIDIWSAGCVIAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFP+IKAHPWHKIFHKRMPPEA+DLVSR+LQYSPNLRCSALDALTHPFF
Sbjct  298  IKCMNPNYTEFKFPEIKAHPWHKIFHKRMPPEAIDLVSRVLQYSPNLRCSALDALTHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            +ELRDP+ RLPNGR +PPLFNFKP ELK VP ET+ KL+PEHARK CP LGL
Sbjct  358  NELRDPNTRLPNGRSLPPLFNFKPQELKNVPEETLTKLIPEHARKHCPSLGL  409



>ref|XP_003566380.1| PREDICTED: shaggy-related protein kinase alpha [Brachypodium 
distachyon]
Length=408

 Score =   323 bits (828),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  237  YYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTREE  296

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSPNLRC+A++AL HPFF
Sbjct  297  IKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCTAVEALIHPFF  356

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKP+ELKG P + + KL+PEHARKQC   GL
Sbjct  357  DELRDPNTRLPNGRFLPPLFNFKPNELKGTPVDIVAKLIPEHARKQCSHAGL  408



>ref|XP_006841582.1| hypothetical protein AMTR_s00003p00196730 [Amborella trichopoda]
 gb|ERN03257.1| hypothetical protein AMTR_s00003p00196730 [Amborella trichopoda]
Length=409

 Score =   323 bits (828),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 161/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYT+AID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTSAIDIWSTGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFH+RMP EAVDLVSRLLQYSPNLRCSALDA  HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHRRMPAEAVDLVSRLLQYSPNLRCSALDACVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFNFKP ELKGVP+E + +L+PEHARKQC FLGL
Sbjct  358  DELRDPNTRLPNGRPLPPLFNFKPQELKGVPSEILVRLIPEHARKQCSFLGL  409



>emb|CAA04265.1| shaggy-like kinase alpha [Arabidopsis thaliana]
Length=405

 Score =   322 bits (826),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 161/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLV IIKVLGTPTREE
Sbjct  234  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVHIIKVLGTPTREE  293

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HPFF
Sbjct  294  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHPFF  353

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PP F+FKPH LKGVP E + KLVPEHARKQCP+LGL
Sbjct  354  DELRDPNARLPNGRFLPPAFHFKPHGLKGVPLEMVAKLVPEHARKQCPWLGL  405



>ref|XP_011087528.1| PREDICTED: shaggy-related protein kinase alpha isoform X2 [Sesamum 
indicum]
Length=388

 Score =   322 bits (825),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTT ID+WSAGCV+AELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  217  YYRAPELIFGATEYTTNIDIWSAGCVIAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  276

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFP+IKAHPWHKIFHKRMPPEA+DLVSR+LQYSPNLRCSALDALTHPFF
Sbjct  277  IKCMNPNYTEFKFPEIKAHPWHKIFHKRMPPEAIDLVSRVLQYSPNLRCSALDALTHPFF  336

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            +ELRDP+ RLPNGR +PPLFNFKP ELK VP ET+ KL+PEHARK CP LGL
Sbjct  337  NELRDPNTRLPNGRSLPPLFNFKPQELKNVPEETLTKLIPEHARKHCPSLGL  388



>ref|XP_007031507.1| Shaggy-like kinase 13 isoform 4 [Theobroma cacao]
 gb|EOY02433.1| Shaggy-like kinase 13 isoform 4 [Theobroma cacao]
Length=347

 Score =   320 bits (821),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 153/172 (89%), Positives = 160/172 (93%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  176  YYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  235

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HPFF
Sbjct  236  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIHPFF  295

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFNFKP ELKGV  E + KL+PEHARKQCPFLG 
Sbjct  296  DELRDPNARLPNGRPLPPLFNFKPQELKGVSLELLAKLIPEHARKQCPFLGF  347



>ref|XP_010070081.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070082.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070083.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070084.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070085.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070086.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070087.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070088.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
Length=412

 Score =   323 bits (827),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 153/172 (89%), Positives = 161/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+ALDAL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALDALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNG F+PPLF+FK +ELKGVP E + KL+PEHARKQC  LG 
Sbjct  358  DELRDPNARLPNGLFLPPLFSFKSNELKGVPVEVLAKLIPEHARKQCSSLGF  409



>gb|AAB61055.1| Similar to shaggy related protein kinase. Belongs to the CDC2/CDKX 
subfamily [Arabidopsis thaliana]
Length=447

 Score =   324 bits (830),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 164/180 (91%), Gaps = 9/180 (5%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  268  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  327

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALD L HPFF
Sbjct  328  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHPFF  387

Query  410  DELRDPSIRLPNGRFVPPLFNFKPH--------ELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPH        ELKGVP E + KLVPEHARKQCP+LGL
Sbjct  388  DELRDPNARLPNGRFLPPLFNFKPHGTTSPFPNELKGVPLEMVAKLVPEHARKQCPWLGL  447



>ref|NP_001288361.1| uncharacterized protein LOC103641344 [Zea mays]
 gb|ACF80579.1| unknown [Zea mays]
Length=410

 Score =   322 bits (826),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 154/171 (90%), Positives = 160/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP LR +AL+AL HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPKLRSTALEALVHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFKPHELK VP + M KLVPEHARKQC F+G
Sbjct  359  DELRDPNTRLPNGRFLPPLFNFKPHELKNVPADFMVKLVPEHARKQCAFVG  409



>ref|XP_010674528.1| PREDICTED: shaggy-related protein kinase alpha [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010674529.1| PREDICTED: shaggy-related protein kinase alpha [Beta vulgaris 
subsp. vulgaris]
Length=407

 Score =   322 bits (826),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 160/172 (93%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  236  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  295

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF
Sbjct  296  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  355

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGV-PTETMKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGRF+PPLFNFKPHELK V P   ++L PEH RKQ P  GL
Sbjct  356  DELRDPNTRLPNGRFLPPLFNFKPHELKDVNPDTVVRLNPEHMRKQSPGTGL  407



>ref|XP_007031504.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
 ref|XP_007031505.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
 gb|EOY02430.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
 gb|EOY02431.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
Length=412

 Score =   322 bits (825),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 153/172 (89%), Positives = 160/172 (93%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  241  YYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  300

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HPFF
Sbjct  301  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIHPFF  360

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFNFKP ELKGV  E + KL+PEHARKQCPFLG 
Sbjct  361  DELRDPNARLPNGRPLPPLFNFKPQELKGVSLELLAKLIPEHARKQCPFLGF  412



>gb|KDO66104.1| hypothetical protein CISIN_1g0141742mg, partial [Citrus sinensis]
 gb|KDO66105.1| hypothetical protein CISIN_1g0141742mg, partial [Citrus sinensis]
 gb|KDO66106.1| hypothetical protein CISIN_1g0141742mg, partial [Citrus sinensis]
Length=185

 Score =   314 bits (804),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 158/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTA+D+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  14   YYRAPELIFGATEYTTAVDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  73

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HPFF
Sbjct  74   IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIHPFF  133

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR  PPLFNFKP ELKG   E + KL+PEHARKQCPFLG 
Sbjct  134  DELRDPNARLPNGRPFPPLFNFKPQELKGASKELLSKLIPEHARKQCPFLGF  185



>ref|NP_001150105.1| LOC100283734 [Zea mays]
 gb|ACG37853.1| glycogen synthase kinase-3 MsK-3 [Zea mays]
Length=408

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 163/171 (95%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  237  YYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTREE  296

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHK+F+KRMPPEAVDLVS LLQYSPNLRC+A++AL HPFF
Sbjct  297  IKCMNPNYTEFKFPQIKAHPWHKVFNKRMPPEAVDLVSWLLQYSPNLRCTAVEALVHPFF  356

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP + + KLVPEHA+KQC ++G
Sbjct  357  DELRDPNTRLPNGRFLPPLFNFKPHELKGVPADIVAKLVPEHAKKQCSYVG  407



>ref|XP_010248490.1| PREDICTED: shaggy-related protein kinase epsilon [Nelumbo nucifera]
 ref|XP_010248491.1| PREDICTED: shaggy-related protein kinase epsilon [Nelumbo nucifera]
 ref|XP_010248492.1| PREDICTED: shaggy-related protein kinase epsilon [Nelumbo nucifera]
Length=408

 Score =   321 bits (822),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/172 (89%), Positives = 159/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  237  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  296

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDLVSRLLQYSPNLRC+AL+A  HPFF
Sbjct  297  IKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLVSRLLQYSPNLRCTALEACVHPFF  356

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDPS RLPNGR +PPLFNFKP ELKG   E + KL+PEHARKQCPFLG 
Sbjct  357  DELRDPSTRLPNGRPLPPLFNFKPQELKGATLELLAKLIPEHARKQCPFLGF  408



>ref|XP_002440537.1| hypothetical protein SORBIDRAFT_09g002710 [Sorghum bicolor]
 gb|EES18967.1| hypothetical protein SORBIDRAFT_09g002710 [Sorghum bicolor]
Length=412

 Score =   321 bits (822),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/171 (89%), Positives = 160/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  241  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  300

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP LR +AL+AL HPFF
Sbjct  301  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPKLRSTALEALIHPFF  360

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTE-TMKLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFKPHELK VP +  +KL+PEHARKQC F+G
Sbjct  361  DELRDPNTRLPNGRFLPPLFNFKPHELKSVPMDFLVKLIPEHARKQCAFVG  411



>ref|XP_006654010.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Oryza brachyantha]
 ref|XP_006654011.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Oryza brachyantha]
Length=410

 Score =   320 bits (821),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 152/171 (89%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPG+SGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP LR +AL+AL HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPYLRSTALEALIHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTE-TMKLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFKPHELKG+P E  +KL+PEHARKQC F+G
Sbjct  359  DELRDPNTRLPNGRFLPPLFNFKPHELKGMPMEFLVKLIPEHARKQCAFVG  409



>ref|XP_004960405.1| PREDICTED: shaggy-related protein kinase alpha-like [Setaria 
italica]
Length=410

 Score =   320 bits (820),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPG+SGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPNLRSTALEALIHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTE-TMKLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFKPHELK +P +  +KL+PEHARKQC F+G
Sbjct  359  DELRDPNTRLPNGRFLPPLFNFKPHELKSMPMDFLVKLIPEHARKQCAFVG  409



>ref|XP_009384996.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   320 bits (819),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 161/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIK+LGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKILGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFP IK HPWHKIFHKR P EAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  298  IKCMNPNYTEFKFPHIKTHPWHKIFHKRTPREAVDLVSRLLQYSPNLRSTALEALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            +ELRDPS RLPNGR++PPLFNFKP+ELKGVPTE + KL+PEHARKQC FLGL
Sbjct  358  EELRDPSARLPNGRYLPPLFNFKPNELKGVPTEIVSKLIPEHARKQCAFLGL  409



>emb|CDM82575.1| unnamed protein product [Triticum aestivum]
Length=406

 Score =   320 bits (819),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 159/168 (95%), Gaps = 1/168 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  237  YYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTREE  296

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSPNLRC+A++AL HPFF
Sbjct  297  IKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCTAVEALVHPFF  356

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTE-TMKLVPEHARKQCP  270
            DELRDP  RLPNGRF+PPLFNFKP+ELKG+P +   KL+PEHARKQ P
Sbjct  357  DELRDPGTRLPNGRFLPPLFNFKPNELKGIPADVAAKLIPEHARKQSP  404



>ref|XP_003569078.1| PREDICTED: shaggy-related protein kinase alpha-like [Brachypodium 
distachyon]
Length=411

 Score =   320 bits (819),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTREE
Sbjct  240  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREE  299

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP+LR +AL+AL HPFF
Sbjct  300  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPSLRSTALEALIHPFF  359

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFK HELKGVP + + KLVPEHARKQC F+G
Sbjct  360  DELRDPNTRLPNGRFLPPLFNFKAHELKGVPMDILVKLVPEHARKQCTFVG  410



>gb|AAM77397.1| GSK-like kinase [Triticum aestivum]
Length=381

 Score =   318 bits (816),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTREE
Sbjct  210  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREE  269

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP+LR +AL+AL HPFF
Sbjct  270  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPSLRSTALEALIHPFF  329

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP + + KL+PEHARK C F+G
Sbjct  330  DELRDPNTRLPNGRFLPPLFNFKPHELKGVPMDILVKLIPEHARKNCAFVG  380



>ref|XP_010091400.1| Glycogen synthase kinase-3-MsK-3-like protein [Morus notabilis]
 gb|EXB44437.1| Glycogen synthase kinase-3-MsK-3-like protein [Morus notabilis]
Length=412

 Score =   319 bits (818),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 162/171 (95%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEY+TAID+WSAGCVLAEL+LGQ LFPG+SGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYSTAIDIWSAGCVLAELMLGQPLFPGDSGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNP+YTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  299  IKCMNPHYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALVHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGR++PPLFNFK HELKGVP E + KL+P+HA+KQC FLG
Sbjct  359  DELRDPNTRLPNGRYLPPLFNFKSHELKGVPAEMLVKLIPDHAKKQCGFLG  409



>gb|ABG29422.1| GSK-like kinase 1A [Triticum aestivum]
Length=410

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP+LR +AL+AL HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPSLRSTALEALIHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP + + KL+PEHARK C F+G
Sbjct  359  DELRDPNTRLPNGRFLPPLFNFKPHELKGVPMDILVKLIPEHARKNCAFVG  409



>gb|EMS50777.1| Glycogen synthase kinase-3-like protein MsK-3 [Triticum urartu]
Length=397

 Score =   318 bits (816),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTREE
Sbjct  226  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREE  285

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP+LR +AL+AL HPFF
Sbjct  286  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPSLRSTALEALIHPFF  345

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP + + KL+PEHARK C F+G
Sbjct  346  DELRDPNTRLPNGRFLPPLFNFKPHELKGVPMDILVKLIPEHARKNCAFVG  396



>emb|CDP17018.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   318 bits (814),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 159/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            +YRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  215  FYRAPELIFGATEYTTAIDIWSTGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  274

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSP+LR +AL+AL HPFF
Sbjct  275  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPSLRSTALEALIHPFF  334

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+  LPNGRF+PPLFNF+PHEL GVP E M KL+PEHARKQC FL  
Sbjct  335  DELRDPNTHLPNGRFLPPLFNFRPHELNGVPMEIMVKLIPEHARKQCSFLNF  386



>gb|ABK24355.1| unknown [Picea sitchensis]
Length=370

 Score =   317 bits (812),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 159/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  199  YYRAPELIFGATEYTTAIDIWSMGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  258

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HPFF
Sbjct  259  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIHPFF  318

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKG-VPTETMKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFNFKP ELKG  P   +KL+PEHARKQCPFL L
Sbjct  319  DELRDPNTRLPNGRPLPPLFNFKPQELKGATPDLLIKLIPEHARKQCPFLNL  370



>dbj|BAF36565.1| Shaggy-like kinase [Triticum aestivum]
Length=406

 Score =   318 bits (815),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 158/166 (95%), Gaps = 1/166 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  237  YYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTREE  296

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSPNLRC+A++AL HPFF
Sbjct  297  IKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCTAVEALVHPFF  356

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTE-TMKLVPEHARKQ  276
            DELRDP  RLPNGRF+PPLFNFKP+ELKG+P +   KL+PEHARKQ
Sbjct  357  DELRDPGTRLPNGRFLPPLFNFKPNELKGIPADVAAKLIPEHARKQ  402



>ref|NP_001054564.1| Os05g0134000 [Oryza sativa Japonica Group]
 gb|AAT94043.1| putative glycogen synthase kinase [Oryza sativa Japonica Group]
 dbj|BAF16478.1| Os05g0134000 [Oryza sativa Japonica Group]
 dbj|BAG86642.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62230.1| hypothetical protein OsJ_17017 [Oryza sativa Japonica Group]
Length=411

 Score =   318 bits (815),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 160/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPG+SGVDQLVEIIKVLGTPTREE
Sbjct  240  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTREE  299

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP LR +A +AL HPFF
Sbjct  300  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPYLRSTASEALIHPFF  359

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTE-TMKLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFKPHELKG+P E  +KL+PEHARKQC F+G
Sbjct  360  DELRDPNTRLPNGRFLPPLFNFKPHELKGMPMEFLVKLIPEHARKQCAFVG  410



>ref|XP_006470301.1| PREDICTED: shaggy-related protein kinase epsilon-like [Citrus 
sinensis]
Length=429

 Score =   318 bits (816),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 158/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTA+D+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  258  YYRAPELIFGATEYTTAVDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  317

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HPFF
Sbjct  318  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIHPFF  377

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR  PPLFNFKP ELKG   E + KL+PEHARKQCPFLG 
Sbjct  378  DELRDPNARLPNGRPFPPLFNFKPQELKGASKELLSKLIPEHARKQCPFLGF  429



>ref|XP_007031506.1| Shaggy-like kinase 13 isoform 3 [Theobroma cacao]
 gb|EOY02432.1| Shaggy-like kinase 13 isoform 3 [Theobroma cacao]
Length=413

 Score =   318 bits (814),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 153/173 (88%), Positives = 160/173 (92%), Gaps = 2/173 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKV-LGTPTRE  594
            YYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKV LGTPTRE
Sbjct  241  YYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVVLGTPTRE  300

Query  593  EIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPF  414
            EIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HPF
Sbjct  301  EIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIHPF  360

Query  413  FDELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            FDELRDP+ RLPNGR +PPLFNFKP ELKGV  E + KL+PEHARKQCPFLG 
Sbjct  361  FDELRDPNARLPNGRPLPPLFNFKPQELKGVSLELLAKLIPEHARKQCPFLGF  413



>gb|ABC94949.1| GSK-like kinase [Aegilops tauschii]
 gb|ABG29427.1| GSK-like kinase 1 [Aegilops tauschii]
Length=410

 Score =   317 bits (813),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKR+P EAVDLVSRLLQYSP+LR +AL+AL HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRVPAEAVDLVSRLLQYSPSLRSTALEALIHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP + + KL+PEHARK C F+G
Sbjct  359  DELRDPNTRLPNGRFLPPLFNFKPHELKGVPMDILVKLIPEHARKNCAFVG  409



>ref|XP_009403747.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403755.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
Length=412

 Score =   317 bits (813),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 160/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNY EFKFPQIK HPWHKIFHK+MP EAVDLVSRLLQYSP+LRC+AL+AL HPFF
Sbjct  298  IKCMNPNYNEFKFPQIKVHPWHKIFHKQMPLEAVDLVSRLLQYSPSLRCTALEALIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELR+ S RLPNGRF+PPLFNFKPHELKGVPTE + KL+PEHARKQC  LG
Sbjct  358  DELRNQSTRLPNGRFLPPLFNFKPHELKGVPTEMVAKLIPEHARKQCVGLG  408



>ref|XP_004141099.1| PREDICTED: shaggy-related protein kinase epsilon-like [Cucumis 
sativus]
Length=410

 Score =   317 bits (813),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 158/170 (93%), Gaps = 1/170 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEAFIHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFL  264
            DELRDP+ RLPNGR +PPLFNFKP ELKG   E + KL+PEHARKQC FL
Sbjct  359  DELRDPNTRLPNGRPLPPLFNFKPQELKGATLELLSKLIPEHARKQCSFL  408



>ref|XP_010251219.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X3 [Nelumbo nucifera]
Length=382

 Score =   316 bits (810),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 157/172 (91%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  211  YYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  270

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSR LQYSPNLRC+AL+A  HPFF
Sbjct  271  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRFLQYSPNLRCTALEACVHPFF  330

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDPS RLPNGR +PPLFNFKP ELKG   E + +L+PEHARKQCPFL  
Sbjct  331  DELRDPSTRLPNGRPLPPLFNFKPQELKGATLELVARLIPEHARKQCPFLSF  382



>gb|AAY98510.1| glycogen synthase kinase [Oryza sativa Japonica Group]
Length=411

 Score =   317 bits (812),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 160/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPG+SGVDQLVEIIKVLGTPTREE
Sbjct  240  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTREE  299

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP LR +A +AL HPFF
Sbjct  300  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPYLRSTAPEALIHPFF  359

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTE-TMKLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFKPHELKG+P E  +KL+PEHARKQC F+G
Sbjct  360  DELRDPNTRLPNGRFLPPLFNFKPHELKGMPMEFLVKLIPEHARKQCAFVG  410



>ref|XP_004164819.1| PREDICTED: shaggy-related protein kinase epsilon-like [Cucumis 
sativus]
Length=410

 Score =   317 bits (812),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 158/170 (93%), Gaps = 1/170 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFL  264
            DELRDP+ RLPNGR +PPLFNFKP ELKG   E + KL+PEHARKQC FL
Sbjct  359  DELRDPNTRLPNGRPLPPLFNFKPQELKGATLELLSKLIPEHARKQCSFL  408



>gb|KGN59685.1| hypothetical protein Csa_3G838640 [Cucumis sativus]
Length=410

 Score =   317 bits (811),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 158/170 (93%), Gaps = 1/170 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFL  264
            DELRDP+ RLPNGR +PPLFNFKP ELKG   E + KL+PEHARKQC FL
Sbjct  359  DELRDPNTRLPNGRPLPPLFNFKPQELKGATLELLSKLIPEHARKQCSFL  408



>ref|XP_010660897.1| PREDICTED: shaggy-related protein kinase epsilon isoform X2 [Vitis 
vinifera]
Length=393

 Score =   316 bits (810),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 158/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  222  YYRAPELIFGATEYTTAIDMWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  281

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HPFF
Sbjct  282  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIHPFF  341

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRD + RLPNGR +PPLFNFKP ELKG   E + KL+PEHARKQCPFLG 
Sbjct  342  DELRDQNSRLPNGRPLPPLFNFKPQELKGASLELLAKLIPEHARKQCPFLGF  393



>ref|XP_010251217.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X1 [Nelumbo nucifera]
Length=409

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 157/172 (91%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSR LQYSPNLRC+AL+A  HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRFLQYSPNLRCTALEACVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDPS RLPNGR +PPLFNFKP ELKG   E + +L+PEHARKQCPFL  
Sbjct  358  DELRDPSTRLPNGRPLPPLFNFKPQELKGATLELVARLIPEHARKQCPFLSF  409



>gb|ABC94948.1| GSK-like kinase [Aegilops speltoides]
Length=381

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 159/171 (93%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTREE
Sbjct  210  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREE  269

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP+LR +AL+AL HPFF
Sbjct  270  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPSLRSTALEALIHPFF  329

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFN KPHELKGVP   + KL+PEHARK C F+G
Sbjct  330  DELRDPNTRLPNGRFLPPLFNLKPHELKGVPMGILVKLIPEHARKNCAFVG  380



>gb|ABG29424.1| GSK-like kinase 1D [Triticum aestivum]
Length=410

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 160/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVS LLQYSP+LR +AL+AL HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSGLLQYSPSLRSTALEALIHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP + + KL+PEHARK C F+G
Sbjct  359  DELRDPNTRLPNGRFLPPLFNFKPHELKGVPMDILVKLIPEHARKNCAFVG  409



>ref|XP_010660896.1| PREDICTED: shaggy-related protein kinase epsilon isoform X1 [Vitis 
vinifera]
 emb|CBI34900.3| unnamed protein product [Vitis vinifera]
Length=412

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 158/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  241  YYRAPELIFGATEYTTAIDMWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  300

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HPFF
Sbjct  301  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIHPFF  360

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRD + RLPNGR +PPLFNFKP ELKG   E + KL+PEHARKQCPFLG 
Sbjct  361  DELRDQNSRLPNGRPLPPLFNFKPQELKGASLELLAKLIPEHARKQCPFLGF  412



>ref|XP_003518657.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Glycine 
max]
Length=409

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 158/171 (92%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVL ELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLGELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKR+PPEAVDLVSRLLQYSPNLRC+AL+AL HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRLPPEAVDLVSRLLQYSPNLRCTALEALAHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGR++PPLFNF+ +ELKGVP E + KL+P HARKQC    
Sbjct  358  DELRDPNTRLPNGRYLPPLFNFRANELKGVPPEMLVKLIPSHARKQCALFA  408



>gb|ABG29426.1| GSK-like kinase 1 [Aegilops speltoides]
Length=410

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 159/171 (93%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP+LR +AL+AL HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPSLRSTALEALIHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFN KPHELKGVP   + KL+PEHARK C F+G
Sbjct  359  DELRDPNTRLPNGRFLPPLFNLKPHELKGVPMGILVKLIPEHARKNCAFVG  409



>gb|EAY96448.1| hypothetical protein OsI_18343 [Oryza sativa Indica Group]
Length=411

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 160/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPG+SGVDQLVEIIKVLGTPTREE
Sbjct  240  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTREE  299

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIF+KRMP EAVDLVSRLLQYSP LR +A +AL HPFF
Sbjct  300  IKCMNPNYTEFKFPQIKAHPWHKIFYKRMPAEAVDLVSRLLQYSPYLRSTASEALIHPFF  359

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTE-TMKLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFKPHELKG+P E  +KL+PEHARKQC F+G
Sbjct  360  DELRDPNTRLPNGRFLPPLFNFKPHELKGMPMEFLVKLIPEHARKQCAFVG  410



>ref|XP_008443540.1| PREDICTED: shaggy-related protein kinase epsilon [Cucumis melo]
Length=410

 Score =   316 bits (809),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 158/170 (93%), Gaps = 1/170 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPG+SGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFL  264
            DELRDP+ RLPNGR +PPLFNFKP ELKG   E + KL+PEHARKQC FL
Sbjct  359  DELRDPNTRLPNGRPLPPLFNFKPQELKGATLELLSKLIPEHARKQCSFL  408



>emb|CDP02094.1| unnamed protein product [Coffea canephora]
Length=410

 Score =   316 bits (809),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 158/171 (92%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEY+TAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYSTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACVHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            +ELRDPS RLPNGR +PPLFNF+P ELKG   E + KL+PEHAR QCPF+G
Sbjct  359  NELRDPSTRLPNGRPLPPLFNFRPQELKGASLELIAKLIPEHARNQCPFIG  409



>gb|EMT00762.1| Glycogen synthase kinase-3-MsK-3-like protein [Aegilops tauschii]
Length=397

 Score =   315 bits (808),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 160/171 (94%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTREE
Sbjct  226  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREE  285

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP+LR +AL+AL HPFF
Sbjct  286  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPAEAVDLVSRLLQYSPSLRSTALEALIHPFF  345

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+  LPNGRF+PPLFNFKPHELKGVP + + KL+PEHARK C F+G
Sbjct  346  DELRDPNTCLPNGRFLPPLFNFKPHELKGVPMDILVKLIPEHARKNCAFVG  396



>gb|AFK38277.1| unknown [Medicago truncatula]
 gb|AES82238.2| glycogen synthase kinase [Medicago truncatula]
Length=412

 Score =   316 bits (809),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 157/171 (92%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVL ELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  240  YYRAPELIFGATEYTTAIDIWSAGCVLGELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  299

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HPF+
Sbjct  300  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALVHPFY  359

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFK +ELKGVP E + KLVP HARKQC    
Sbjct  360  DELRDPNTRLPNGRFLPPLFNFKVNELKGVPAEMLVKLVPPHARKQCALFA  410



>ref|XP_003626019.1| Protein kinase, putative [Medicago truncatula]
Length=411

 Score =   315 bits (808),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 157/171 (92%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVL ELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDIWSAGCVLGELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HPF+
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALVHPFY  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFK +ELKGVP E + KLVP HARKQC    
Sbjct  359  DELRDPNTRLPNGRFLPPLFNFKVNELKGVPAEMLVKLVPPHARKQCALFA  409



>ref|XP_006446534.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 ref|XP_006446536.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 gb|ESR59774.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 gb|ESR59776.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
Length=429

 Score =   316 bits (810),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 157/172 (91%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  258  YYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  317

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HPFF
Sbjct  318  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIHPFF  377

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
             ELRDP+ RLPNGR  PPLFNFKP ELKG   E + KL+PEHARKQCPFLG 
Sbjct  378  YELRDPNARLPNGRPFPPLFNFKPQELKGASKELLSKLIPEHARKQCPFLGF  429



>ref|XP_008662920.1| PREDICTED: shaggy-related protein kinase alpha-like [Zea mays]
Length=410

 Score =   315 bits (808),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 158/171 (92%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIF  +MP EAVDLVSRLLQYSP LR +AL+AL HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFRLKMPAEAVDLVSRLLQYSPKLRSTALEALVHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFKPHELK VP + M KLVPEHARKQC F+G
Sbjct  359  DELRDPNTRLPNGRFLPPLFNFKPHELKNVPADFMVKLVPEHARKQCAFVG  409



>ref|XP_006446533.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 ref|XP_006446535.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 gb|ESR59773.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 gb|ESR59775.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
Length=409

 Score =   315 bits (808),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 157/172 (91%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
             ELRDP+ RLPNGR  PPLFNFKP ELKG   E + KL+PEHARKQCPFLG 
Sbjct  358  YELRDPNARLPNGRPFPPLFNFKPQELKGASKELLSKLIPEHARKQCPFLGF  409



>emb|CAA48472.1| protein kinase [Medicago sativa]
Length=412

 Score =   315 bits (807),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 158/171 (92%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVL ELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  240  YYRAPELIFGATEYTTAIDIWSAGCVLGELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  299

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HPF+
Sbjct  300  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALVHPFY  359

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            D++RDP+ RLPNGRF+PPLFNFK +ELKGVP E + KLVP HARKQC   G
Sbjct  360  DDVRDPNTRLPNGRFLPPLFNFKVNELKGVPAEMLVKLVPPHARKQCALFG  410



>gb|ABG29423.1| GSK-like kinase 1B [Triticum aestivum]
Length=410

 Score =   315 bits (806),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 159/171 (93%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELI GATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELILGATEYTTAIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHK MP EAVDLVSRLLQYSP+LR +AL+AL HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKGMPAEAVDLVSRLLQYSPSLRSTALEALIHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFKPHELKGVP + + KL+PEHARK C F+G
Sbjct  359  DELRDPNTRLPNGRFLPPLFNFKPHELKGVPMDILVKLIPEHARKNCAFVG  409



>ref|XP_006399977.1| hypothetical protein EUTSA_v10013689mg [Eutrema salsugineum]
 gb|ESQ41430.1| hypothetical protein EUTSA_v10013689mg [Eutrema salsugineum]
Length=409

 Score =   315 bits (806),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 159/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDLVSRLLQYSPNLR +A++A+ HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLVSRLLQYSPNLRSTAMEAIVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFN+KP ELKG   E + KL+P+HARKQC FLGL
Sbjct  358  DELRDPNTRLPNGRPLPPLFNYKPQELKGASLELLSKLIPDHARKQCSFLGL  409



>sp|P51139.2|MSK3_MEDSA RecName: Full=Glycogen synthase kinase-3 homolog MsK-3 [Medicago 
sativa]
Length=411

 Score =   315 bits (806),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 158/171 (92%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVL ELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDIWSAGCVLGELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+AL HPF+
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEALVHPFY  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            D++RDP+ RLPNGRF+PPLFNFK +ELKGVP E + KLVP HARKQC   G
Sbjct  359  DDVRDPNTRLPNGRFLPPLFNFKVNELKGVPAEMLVKLVPPHARKQCALFG  409



>gb|EPS68300.1| hypothetical protein M569_06467 [Genlisea aurea]
Length=411

 Score =   314 bits (805),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 150/173 (87%), Positives = 163/173 (94%), Gaps = 2/173 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGAT+YTTAID+WSAGCVLAELLLGQ LFPG+SGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATDYTTAIDIWSAGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSR+LQYSPNLRC+A++AL HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRVLQYSPNLRCTAVEALIHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQC-PFLGL  258
            DELRDP++RLPNGRF+PPLFNFK  ELKGV  E + +L+PEHARKQ  PFLGL
Sbjct  359  DELRDPNVRLPNGRFLPPLFNFKQQELKGVAMELLERLIPEHARKQQPPFLGL  411



>ref|XP_010453592.1| PREDICTED: shaggy-related protein kinase epsilon-like [Camelina 
sativa]
Length=411

 Score =   314 bits (804),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 158/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  240  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  299

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDLVSRLLQYSPNLR +A++A+ HPFF
Sbjct  300  IKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLVSRLLQYSPNLRSTAMEAIVHPFF  359

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFNFKP ELKG   E + KL+P+HARKQC FL L
Sbjct  360  DELRDPNTRLPNGRPLPPLFNFKPQELKGASVELLSKLIPDHARKQCSFLAL  411



>ref|XP_010420109.1| PREDICTED: shaggy-related protein kinase epsilon-like [Camelina 
sativa]
Length=411

 Score =   314 bits (804),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 158/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  240  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  299

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDLVSRLLQYSPNLR +A++A+ HPFF
Sbjct  300  IKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLVSRLLQYSPNLRSTAMEAIVHPFF  359

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFNFKP EL+G   E + KL+P+HARKQC FL L
Sbjct  360  DELRDPNTRLPNGRPLPPLFNFKPQELRGASVELLSKLIPDHARKQCSFLAL  411



>ref|XP_010550142.1| PREDICTED: shaggy-related protein kinase epsilon [Tarenaya hassleriana]
Length=409

 Score =   314 bits (804),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 157/172 (91%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRM PEA DLVSRLLQYSPNLRC+AL+A+ HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMSPEAADLVSRLLQYSPNLRCTALEAIVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLF+FKP ELKG   E + KL+PEH RKQC FLG 
Sbjct  358  DELRDPNTRLPNGRPLPPLFSFKPQELKGASLELLAKLIPEHERKQCSFLGF  409



>ref|XP_007140965.1| hypothetical protein PHAVU_008G156000g [Phaseolus vulgaris]
 gb|ESW12959.1| hypothetical protein PHAVU_008G156000g [Phaseolus vulgaris]
Length=402

 Score =   313 bits (803),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 157/172 (91%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPG+SGVDQLVEIIKVLGTPTREE
Sbjct  231  YYRAPELIFGATEYTTAIDMWSVGCVLAELLLGQPLFPGDSGVDQLVEIIKVLGTPTREE  290

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +ALDA  HPFF
Sbjct  291  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALDACVHPFF  350

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFNFKP ELKGV  E + KLVPEHARKQCP L  
Sbjct  351  DELRDPNTRLPNGRPMPPLFNFKPQELKGVTLELLCKLVPEHARKQCPSLNF  402



>ref|XP_007215466.1| hypothetical protein PRUPE_ppa006497mg [Prunus persica]
 gb|EMJ16665.1| hypothetical protein PRUPE_ppa006497mg [Prunus persica]
Length=409

 Score =   314 bits (804),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 159/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSP+LRC+AL+A  HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPSLRCTALEACVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            D+LRDP+ RLPNGR +PPLFNFKP ELKG   E + +L+PEHARKQC FLG+
Sbjct  358  DQLRDPNARLPNGRPLPPLFNFKPQELKGATFELLSRLIPEHARKQCAFLGI  409



>ref|XP_010492276.1| PREDICTED: shaggy-related protein kinase epsilon [Camelina sativa]
 ref|XP_010492277.1| PREDICTED: shaggy-related protein kinase epsilon [Camelina sativa]
Length=411

 Score =   314 bits (804),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 158/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  240  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  299

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDLVSRLLQYSPNLR +A++A+ HPFF
Sbjct  300  IKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLVSRLLQYSPNLRSTAMEAIVHPFF  359

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFNFKP ELKG   E + KL+P+HARKQC FL L
Sbjct  360  DELRDPNTRLPNGRPLPPLFNFKPQELKGASVELLSKLLPDHARKQCSFLAL  411



>ref|NP_196968.2| Shaggy-related protein kinase 13 [Arabidopsis thaliana]
 sp|Q8VZD5.1|KSG5_ARATH RecName: Full=Shaggy-related protein kinase epsilon; AltName: 
Full=ASK-epsilon [Arabidopsis thaliana]
 gb|AAL57679.1| AT5g14640/T15N1_130 [Arabidopsis thaliana]
 gb|AAQ65089.1| At5g14640/T15N1_130 [Arabidopsis thaliana]
 gb|AED92057.1| Shaggy-related protein kinase 13 [Arabidopsis thaliana]
Length=410

 Score =   313 bits (803),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 157/172 (91%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTT ID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTTIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDLVSRLLQYSPNLR +A++A+ HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLVSRLLQYSPNLRSTAMEAIVHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFNFKP ELKG   E + KL+P+HARKQC FL L
Sbjct  359  DELRDPNTRLPNGRALPPLFNFKPQELKGASLELLSKLIPDHARKQCSFLAL  410



>ref|XP_008230580.1| PREDICTED: shaggy-related protein kinase epsilon [Prunus mume]
Length=409

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 159/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSP+LRC+AL+A  HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPSLRCTALEACVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            D+LRDP+ RLPNGR +PPLFNFKP ELKG   E + +L+PEHARKQC FLG+
Sbjct  358  DQLRDPNARLPNGRPLPPLFNFKPQELKGATFELLSRLIPEHARKQCAFLGI  409



>ref|XP_004967591.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Setaria italica]
 ref|XP_004967592.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Setaria italica]
Length=408

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 161/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTR+E
Sbjct  237  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPVFPGDSGVDQLVEIIKVLGTPTRDE  296

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IK MNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSPNLRC+AL+AL HPFF
Sbjct  297  IKRMNPNYTEFKFPQIKAHPWHKIFHKRMPSEAVDLVSRLLQYSPNLRCTALEALIHPFF  356

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTE-TMKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +P LFNFKP+EL+GVP E  MKL+P+HA+KQC FLG+
Sbjct  357  DELRDPNARLPNGRSLPHLFNFKPNELRGVPMEFLMKLIPQHAKKQCAFLGI  408



>gb|ABC94947.1| GSK-like kinase [Triticum monococcum]
 gb|ABG29425.1| GSK-like kinase 1 [Triticum monococcum]
Length=410

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 159/171 (93%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRM  EAVDLVSRLLQYSP+LR +AL+AL HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMLAEAVDLVSRLLQYSPSLRSTALEALIHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGRF+PPLFNFKPHELK VP + + KL+PEHARK C F+G
Sbjct  359  DELRDPNTRLPNGRFLPPLFNFKPHELKDVPMDILVKLIPEHARKNCAFVG  409



>ref|XP_008357735.1| PREDICTED: shaggy-related protein kinase epsilon [Malus domestica]
Length=410

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 158/171 (92%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSP+LR +AL+AL HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPSLRFTALEALVHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            D+LRDP+ RLPNGR +PPLFNFKP ELKG   E + KLVPEHARKQC FLG
Sbjct  359  DQLRDPNTRLPNGRPLPPLFNFKPQELKGATLELLSKLVPEHARKQCAFLG  409



>ref|XP_009334099.1| PREDICTED: shaggy-related protein kinase epsilon [Pyrus x bretschneideri]
 ref|XP_009334100.1| PREDICTED: shaggy-related protein kinase epsilon [Pyrus x bretschneideri]
 ref|XP_009334101.1| PREDICTED: shaggy-related protein kinase epsilon [Pyrus x bretschneideri]
Length=410

 Score =   312 bits (800),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 157/171 (92%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEY+TAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYSTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSP+LR +AL+ L HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPSLRFTALEVLVHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            D+LRDPS RLPNGR +PPLFNFKP ELKG   E + KLVPEHARKQC FLG
Sbjct  359  DQLRDPSTRLPNGRPLPPLFNFKPQELKGATLELLSKLVPEHARKQCAFLG  409



>ref|XP_006287860.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 ref|XP_006287861.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 ref|XP_006287862.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 gb|EOA20758.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 gb|EOA20759.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 gb|EOA20760.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
Length=410

 Score =   312 bits (800),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 158/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDLVSRLLQYSPNLR +A++A+ HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLVSRLLQYSPNLRSTAMEAIVHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFNFKP ELKG   E + K++P+HARKQC FL +
Sbjct  359  DELRDPNTRLPNGRPLPPLFNFKPQELKGASLELLAKIIPDHARKQCSFLAI  410



>dbj|BAG95540.1| unnamed protein product [Oryza sativa Japonica Group]
Length=292

 Score =   308 bits (788),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 158/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTREE
Sbjct  121  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPVFPGDSGVDQLVEIIKVLGTPTREE  180

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IK MNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP+LRCSAL+ L HPFF
Sbjct  181  IKHMNPNYTEFKFPQIKAHPWHKIFHKRMPSEAVDLVSRLLQYSPHLRCSALEVLIHPFF  240

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTE-TMKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFNFKP ELKG   E  +KLVP+HA+KQC FLGL
Sbjct  241  DELRDPNARLPNGRTLPPLFNFKPRELKGASMEFLVKLVPQHAKKQCAFLGL  292



>emb|CDX78587.1| BnaA03g04990D [Brassica napus]
Length=410

 Score =   312 bits (799),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 157/172 (91%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDL SRLLQYSPNLR +A++A+ HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLASRLLQYSPNLRSTAMEAIVHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFNFKP ELKG   E + KL+P+HARKQC FL +
Sbjct  359  DELRDPNTRLPNGRPLPPLFNFKPQELKGASVELLSKLIPDHARKQCSFLAV  410



>ref|XP_009131419.1| PREDICTED: shaggy-related protein kinase epsilon [Brassica rapa]
Length=410

 Score =   312 bits (799),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 157/172 (91%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDL SRLLQYSPNLR +A++A+ HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLASRLLQYSPNLRSTAMEAIVHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFNFKP ELKG   E + KL+P+HARKQC FL +
Sbjct  359  DELRDPNTRLPNGRPLPPLFNFKPQELKGASVELLSKLIPDHARKQCSFLAV  410



>ref|XP_002873682.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49941.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   311 bits (798),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 158/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDLVSRLLQYSP+LR +A++A+ HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLVSRLLQYSPSLRSTAMEAIVHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFNFKP EL G  +E + KL+P+HARKQC FL L
Sbjct  359  DELRDPNTRLPNGRPLPPLFNFKPQELNGASSELLSKLIPDHARKQCSFLAL  410



>ref|XP_002987888.1| GSK3/shaggy-like protein kinase [Selaginella moellendorffii]
 ref|XP_002994033.1| hypothetical protein SELMODRAFT_163279 [Selaginella moellendorffii]
 gb|EFJ04915.1| hypothetical protein SELMODRAFT_163279 [Selaginella moellendorffii]
 gb|EFJ10962.1| GSK3/shaggy-like protein kinase [Selaginella moellendorffii]
Length=423

 Score =   312 bits (799),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 158/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  252  YYRAPELIFGATEYTTAIDIWSMGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  311

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSPNLRCS+L+AL HPFF
Sbjct  312  IKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCSSLEALAHPFF  371

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPL+NFK  ELKG   E + +LVPEHARKQ PFL L
Sbjct  372  DELRDPNTRLPNGRPLPPLYNFKQLELKGASPELLNRLVPEHARKQVPFLAL  423



>emb|CDX70574.1| BnaC03g06580D [Brassica napus]
Length=409

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 157/172 (91%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDL SRLLQYSPNLR +A++A+ HPFF
Sbjct  298  IKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLASRLLQYSPNLRSTAMEAIVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFNFKP ELKG   E + KL+P+HARKQC FL +
Sbjct  358  DELRDPNTRLPNGRPLPPLFNFKPQELKGASVELLSKLIPDHARKQCSFLAV  409



>ref|XP_002991115.1| hypothetical protein SELMODRAFT_451471 [Selaginella moellendorffii]
 ref|XP_002991645.1| hypothetical protein SELMODRAFT_186226 [Selaginella moellendorffii]
 gb|EFJ07216.1| hypothetical protein SELMODRAFT_186226 [Selaginella moellendorffii]
 gb|EFJ07923.1| hypothetical protein SELMODRAFT_451471 [Selaginella moellendorffii]
Length=456

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 158/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGAT+YTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  285  YYRAPELIFGATDYTTAIDIWSTGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  344

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSP+LRC+AL+AL HPFF
Sbjct  345  IKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPSLRCNALEALVHPFF  404

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDPS RLPNGR +P LFNFKP ELKG   E + +L+PEHARKQ PFL L
Sbjct  405  DELRDPSTRLPNGRPLPALFNFKPLELKGASQELLERLIPEHARKQVPFLAL  456



>ref|NP_001042804.1| Os01g0296100 [Oryza sativa Japonica Group]
 dbj|BAB55743.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAF04718.1| Os01g0296100 [Oryza sativa Japonica Group]
 dbj|BAG99913.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE54392.1| hypothetical protein OsJ_01412 [Oryza sativa Japonica Group]
Length=408

 Score =   311 bits (797),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 158/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTREE
Sbjct  237  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPVFPGDSGVDQLVEIIKVLGTPTREE  296

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IK MNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP+LRCSAL+ L HPFF
Sbjct  297  IKHMNPNYTEFKFPQIKAHPWHKIFHKRMPSEAVDLVSRLLQYSPHLRCSALEVLIHPFF  356

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTE-TMKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFNFKP ELKG   E  +KLVP+HA+KQC FLGL
Sbjct  357  DELRDPNARLPNGRTLPPLFNFKPRELKGASMEFLVKLVPQHAKKQCAFLGL  408



>gb|KHN00229.1| Glycogen synthase kinase-3 like MsK-3 [Glycine soja]
Length=585

 Score =   317 bits (811),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 158/171 (92%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVL ELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  414  YYRAPELIFGATEYTTAIDIWSAGCVLGELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  473

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKR+PPEAVDLVSRLLQYSPNLRC+AL+AL HPFF
Sbjct  474  IKCMNPNYTEFKFPQIKAHPWHKIFHKRLPPEAVDLVSRLLQYSPNLRCTALEALAHPFF  533

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGR++PPLFNF+ +ELKGVP E + KL+P HARKQC    
Sbjct  534  DELRDPNTRLPNGRYLPPLFNFRANELKGVPPEMLVKLIPSHARKQCALFA  584



>ref|NP_001242506.1| uncharacterized protein LOC100817819 [Glycine max]
 gb|ACU18867.1| unknown [Glycine max]
Length=374

 Score =   309 bits (791),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 156/171 (91%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVL EL+LGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  203  YYRAPELIFGATEYTTAIDIWSAGCVLGELMLGQPLFPGESGVDQLVEIIKVLGTPTREE  262

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTE KFPQIKAHPWHKIFHKR+PPEAVDLVSRLLQYSPNLRC+AL+AL HPFF
Sbjct  263  IKCMNPNYTESKFPQIKAHPWHKIFHKRLPPEAVDLVSRLLQYSPNLRCTALEALVHPFF  322

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGR++PPLFNF+ +ELKGVP   + KL+P HARKQC    
Sbjct  323  DELRDPNTRLPNGRYLPPLFNFRANELKGVPPGMLVKLIPSHARKQCALFA  373



>ref|XP_006588498.1| PREDICTED: uncharacterized protein LOC100817819 isoform X2 [Glycine 
max]
Length=382

 Score =   309 bits (792),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 156/171 (91%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVL EL+LGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  211  YYRAPELIFGATEYTTAIDIWSAGCVLGELMLGQPLFPGESGVDQLVEIIKVLGTPTREE  270

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTE KFPQIKAHPWHKIFHKR+PPEAVDLVSRLLQYSPNLRC+AL+AL HPFF
Sbjct  271  IKCMNPNYTESKFPQIKAHPWHKIFHKRLPPEAVDLVSRLLQYSPNLRCTALEALVHPFF  330

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGR++PPLFNF+ +ELKGVP   + KL+P HARKQC    
Sbjct  331  DELRDPNTRLPNGRYLPPLFNFRANELKGVPPGMLVKLIPSHARKQCALFA  381



>gb|KHN00323.1| Glycogen synthase kinase-3 like MsK-2 [Glycine soja]
Length=373

 Score =   309 bits (791),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 156/171 (91%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVL EL+LGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  202  YYRAPELIFGATEYTTAIDIWSAGCVLGELMLGQPLFPGESGVDQLVEIIKVLGTPTREE  261

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTE KFPQIKAHPWHKIFHKR+PPEAVDLVSRLLQYSPNLRC+AL+AL HPFF
Sbjct  262  IKCMNPNYTESKFPQIKAHPWHKIFHKRLPPEAVDLVSRLLQYSPNLRCTALEALVHPFF  321

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGR++PPLFNF+ +ELKGVP   + KL+P HARKQC    
Sbjct  322  DELRDPNTRLPNGRYLPPLFNFRANELKGVPPGMLVKLIPSHARKQCALFA  372



>ref|XP_003591342.1| Glycogen synthase kinase-3-like protein [Medicago truncatula]
 gb|AES61593.1| glycogen synthase kinase [Medicago truncatula]
Length=293

 Score =   306 bits (784),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 154/171 (90%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYT+AID+WSAGCVL ELLLGQ LFPG SGVDQLVEIIKVLGTPTREE
Sbjct  121  YYRAPELIFGATEYTSAIDIWSAGCVLGELLLGQPLFPGASGVDQLVEIIKVLGTPTREE  180

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIF KRMPPEAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  181  IKCMNPNYTEFKFPQIKAHPWHKIFRKRMPPEAVDLVSRLLQYSPNLRSTALEALVHPFF  240

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGR +PPLFNFK +ELKGVP E + KLVP HARKQC    
Sbjct  241  DELRDPNTRLPNGRHLPPLFNFKANELKGVPAEMLVKLVPSHARKQCTLFA  291



>gb|AES61591.2| glycogen synthase kinase [Medicago truncatula]
Length=412

 Score =   310 bits (794),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 154/171 (90%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYT+AID+WSAGCVL ELLLGQ LFPG SGVDQLVEIIKVLGTPTREE
Sbjct  240  YYRAPELIFGATEYTSAIDIWSAGCVLGELLLGQPLFPGASGVDQLVEIIKVLGTPTREE  299

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIF KRMPPEAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  300  IKCMNPNYTEFKFPQIKAHPWHKIFRKRMPPEAVDLVSRLLQYSPNLRSTALEALVHPFF  359

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGR +PPLFNFK +ELKGVP E + KLVP HARKQC    
Sbjct  360  DELRDPNTRLPNGRHLPPLFNFKANELKGVPAEMLVKLVPSHARKQCTLFA  410



>ref|XP_003591339.1| Glycogen synthase kinase-3-like protein [Medicago truncatula]
Length=373

 Score =   309 bits (791),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 154/171 (90%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYT+AID+WSAGCVL ELLLGQ LFPG SGVDQLVEIIKVLGTPTREE
Sbjct  201  YYRAPELIFGATEYTSAIDIWSAGCVLGELLLGQPLFPGASGVDQLVEIIKVLGTPTREE  260

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIF KRMPPEAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  261  IKCMNPNYTEFKFPQIKAHPWHKIFRKRMPPEAVDLVSRLLQYSPNLRSTALEALVHPFF  320

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGR +PPLFNFK +ELKGVP E + KLVP HARKQC    
Sbjct  321  DELRDPNTRLPNGRHLPPLFNFKANELKGVPAEMLVKLVPSHARKQCTLFA  371



>ref|XP_003591340.1| Glycogen synthase kinase-3-like protein [Medicago truncatula]
Length=411

 Score =   310 bits (794),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 154/171 (90%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYT+AID+WSAGCVL ELLLGQ LFPG SGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTSAIDIWSAGCVLGELLLGQPLFPGASGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIF KRMPPEAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFRKRMPPEAVDLVSRLLQYSPNLRSTALEALVHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGR +PPLFNFK +ELKGVP E + KLVP HARKQC    
Sbjct  359  DELRDPNTRLPNGRHLPPLFNFKANELKGVPAEMLVKLVPSHARKQCTLFA  409



>ref|XP_006644095.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like [Oryza 
brachyantha]
Length=408

 Score =   310 bits (793),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 158/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQ +FPG+SGVDQLVEIIKVLGTPTREE
Sbjct  237  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPVFPGDSGVDQLVEIIKVLGTPTREE  296

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IK MNPNYTEFKFPQIKAHPWHKIFHKRMP EAVDLVSRLLQYSP+LRC+AL+ L HPFF
Sbjct  297  IKHMNPNYTEFKFPQIKAHPWHKIFHKRMPSEAVDLVSRLLQYSPHLRCTALEVLIHPFF  356

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTE-TMKLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFNFKP ELKG   E  +KLVP+HA+KQC FLGL
Sbjct  357  DELRDPNARLPNGRTLPPLFNFKPRELKGASMEFLVKLVPQHAKKQCAFLGL  408



>sp|P51138.1|MSK2_MEDSA RecName: Full=Glycogen synthase kinase-3 homolog MsK-2 [Medicago 
sativa]
 emb|CAA48473.1| protein kinase [Medicago sativa]
Length=411

 Score =   310 bits (794),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 154/171 (90%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYT+AID+WSAGCVL ELLLGQ LFPG SGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTSAIDIWSAGCVLGELLLGQPLFPGASGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIF KRMPPEAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFRKRMPPEAVDLVSRLLQYSPNLRSTALEALVHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGR +PPLFNFK +ELKGVP E + KLVP HARKQC    
Sbjct  359  DELRDPNTRLPNGRHLPPLFNFKANELKGVPAEMLVKLVPSHARKQCSLFA  409



>ref|XP_006588497.1| PREDICTED: uncharacterized protein LOC100817819 isoform X1 [Glycine 
max]
Length=409

 Score =   310 bits (793),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 156/171 (91%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVL EL+LGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  238  YYRAPELIFGATEYTTAIDIWSAGCVLGELMLGQPLFPGESGVDQLVEIIKVLGTPTREE  297

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTE KFPQIKAHPWHKIFHKR+PPEAVDLVSRLLQYSPNLRC+AL+AL HPFF
Sbjct  298  IKCMNPNYTESKFPQIKAHPWHKIFHKRLPPEAVDLVSRLLQYSPNLRCTALEALVHPFF  357

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGR++PPLFNF+ +ELKGVP   + KL+P HARKQC    
Sbjct  358  DELRDPNTRLPNGRYLPPLFNFRANELKGVPPGMLVKLIPSHARKQCALFA  408



>ref|XP_006338576.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X1 [Solanum tuberosum]
Length=410

 Score =   310 bits (793),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 156/172 (91%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYT AID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTNAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLV RLLQYSPNLRC+AL+AL H FF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVIRLLQYSPNLRCTALEALAHAFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+  LPNGR +PPLFNF+P ELKG  +E + KL+PEHA+KQCP LG 
Sbjct  359  DELRDPNAGLPNGRPLPPLFNFRPQELKGASSELLNKLLPEHAKKQCPLLGF  410



>ref|XP_003591341.1| Glycogen synthase kinase-3-like protein [Medicago truncatula]
 gb|AES61592.1| glycogen synthase kinase [Medicago truncatula]
Length=379

 Score =   308 bits (790),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 154/171 (90%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYT+AID+WSAGCVL ELLLGQ LFPG SGVDQLVEIIKVLGTPTREE
Sbjct  207  YYRAPELIFGATEYTSAIDIWSAGCVLGELLLGQPLFPGASGVDQLVEIIKVLGTPTREE  266

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIF KRMPPEAVDLVSRLLQYSPNLR +AL+AL HPFF
Sbjct  267  IKCMNPNYTEFKFPQIKAHPWHKIFRKRMPPEAVDLVSRLLQYSPNLRSTALEALVHPFF  326

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            DELRDP+ RLPNGR +PPLFNFK +ELKGVP E + KLVP HARKQC    
Sbjct  327  DELRDPNTRLPNGRHLPPLFNFKANELKGVPAEMLVKLVPSHARKQCTLFA  377



>ref|XP_006338577.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X2 [Solanum tuberosum]
Length=404

 Score =   309 bits (791),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 156/172 (91%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYT AID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  233  YYRAPELIFGATEYTNAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  292

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLV RLLQYSPNLRC+AL+AL H FF
Sbjct  293  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVIRLLQYSPNLRCTALEALAHAFF  352

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+  LPNGR +PPLFNF+P ELKG  +E + KL+PEHA+KQCP LG 
Sbjct  353  DELRDPNAGLPNGRPLPPLFNFRPQELKGASSELLNKLLPEHAKKQCPLLGF  404



>ref|XP_004304635.1| PREDICTED: shaggy-related protein kinase epsilon [Fragaria vesca 
subsp. vesca]
Length=412

 Score =   309 bits (791),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 157/171 (92%), Gaps = 1/171 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  241  YYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  300

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDLVSRLLQYSP+LRC+AL+A  HPFF
Sbjct  301  IKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLVSRLLQYSPSLRCTALEACVHPFF  360

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLG  261
            D+LRDP+ RLPNGR +PPLFNF+P ELKG  +E + +L+P+H RKQC FLG
Sbjct  361  DQLRDPTTRLPNGRPLPPLFNFRPQELKGATSELLSRLIPDHTRKQCAFLG  411



>ref|XP_001763270.1| predicted protein [Physcomitrella patens]
 gb|AAQ23106.1| shaggy-related protein kinase 1 [Physcomitrella patens]
 gb|EDQ71800.1| predicted protein [Physcomitrella patens]
Length=422

 Score =   309 bits (792),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 157/172 (91%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WS GCV+AELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  251  YYRAPELIFGATEYTTAIDIWSMGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  310

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HPFF
Sbjct  311  IKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCNALEACVHPFF  370

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFNFKP ELKG   + + +L+PEHARKQ P L L
Sbjct  371  DELRDPNCRLPNGRPLPPLFNFKPQELKGATPDILHRLIPEHARKQNPMLAL  422



>gb|AAQ23111.1| shaggy-related protein kinase 1 [Physcomitrella patens]
Length=410

 Score =   308 bits (790),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 157/172 (91%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WS GCV+AELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTAIDIWSMGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCNALEACVHPFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFNFKP ELKG   + + +L+PEHARKQ P L L
Sbjct  359  DELRDPNCRLPNGRPLPPLFNFKPQELKGATPDILHRLIPEHARKQNPMLAL  410



>emb|CAB87631.1| protein kinase MSK-3-like [Arabidopsis thaliana]
Length=408

 Score =   307 bits (787),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 155/172 (90%), Gaps = 3/172 (2%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTT ID+WSAGCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTTTIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKR PPEAVDLVSRLLQYSPNLR +A  A+ HPFF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLVSRLLQYSPNLRSTA--AIVHPFF  356

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFNFKP ELKG   E + KL+P+HARKQC FL L
Sbjct  357  DELRDPNTRLPNGRALPPLFNFKPQELKGASLELLSKLIPDHARKQCSFLAL  408



>ref|XP_009759533.1| PREDICTED: shaggy-related protein kinase epsilon [Nicotiana sylvestris]
Length=410

 Score =   307 bits (787),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 154/172 (90%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYT AID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTFAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+A TH FF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEACTHTFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP  RLPNGR +PPLFNF+P ELKG   E + KL+PEHA+KQC  LG 
Sbjct  359  DELRDPKARLPNGRSLPPLFNFRPQELKGASAELLNKLIPEHAKKQCTSLGF  410



>gb|AAQ23107.1| shaggy-related protein kinase 2 [Physcomitrella patens]
 gb|AAQ23112.1| shaggy-related protein kinase 2 [Physcomitrella patens]
Length=423

 Score =   307 bits (787),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 156/172 (91%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WS GCV+AELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  252  YYRAPELIFGATEYTTAIDIWSMGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  311

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HPFF
Sbjct  312  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCNALEACVHPFF  371

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RL NGR +PPLFNFKP ELKG   + + +L+PEHARKQ P L L
Sbjct  372  DELRDPNCRLSNGRPLPPLFNFKPQELKGATPDILHRLIPEHARKQNPMLSL  423



>ref|XP_001763265.1| predicted protein [Physcomitrella patens]
 gb|EDQ71795.1| predicted protein [Physcomitrella patens]
Length=423

 Score =   307 bits (787),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 156/172 (91%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WS GCV+AELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  252  YYRAPELIFGATEYTTAIDIWSMGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  311

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRC+AL+A  HPFF
Sbjct  312  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCNALEACVHPFF  371

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RL NGR +PPLFNFKP ELKG   + + +L+PEHARKQ P L L
Sbjct  372  DELRDPNCRLSNGRPLPPLFNFKPQELKGATPDILHRLIPEHARKQNPMLSL  423



>ref|XP_004232308.1| PREDICTED: shaggy-related protein kinase epsilon [Solanum lycopersicum]
 ref|XP_010316289.1| PREDICTED: shaggy-related protein kinase epsilon [Solanum lycopersicum]
Length=410

 Score =   306 bits (785),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 145/172 (84%), Positives = 156/172 (91%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYT AID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  239  YYRAPELIFGATEYTNAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  298

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLV RLLQYSPNLRC+AL+AL H FF
Sbjct  299  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVIRLLQYSPNLRCTALEALGHAFF  358

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ R PNGR +P LFNF+P ELKG  +E + KL+PEHA+KQCP LG+
Sbjct  359  DELRDPNARPPNGRPLPSLFNFRPQELKGASSELLNKLLPEHAKKQCPLLGV  410



>gb|AFN42826.1| GSK3-like protein [Marsilea vestita]
 gb|AFN42827.1| gsk3-like protein [Marsilea vestita]
Length=392

 Score =   306 bits (783),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 158/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYTTAID+WSAGCVLAEL+LGQ +FPGESGVDQLVEIIKVLGTPTREE
Sbjct  220  YYRAPELIFGATEYTTAIDIWSAGCVLAELMLGQPIFPGESGVDQLVEIIKVLGTPTREE  279

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYT+FKFPQIKAHPWHK+FHKRMPPEAVDLVSRLLQYSPNLR +AL+A  HPFF
Sbjct  280  IKCMNPNYTDFKFPQIKAHPWHKMFHKRMPPEAVDLVSRLLQYSPNLRFTALEACIHPFF  339

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP+ RLPNGR +PPLFNFKP ELKG   E + KL+PEHAR+Q PFLG 
Sbjct  340  DELRDPNTRLPNGRPLPPLFNFKPPELKGATLEMIQKLIPEHARRQNPFLGF  391



>ref|XP_004252662.1| PREDICTED: shaggy-related protein kinase epsilon isoform X2 [Solanum 
lycopersicum]
 ref|XP_010314527.1| PREDICTED: shaggy-related protein kinase epsilon isoform X2 [Solanum 
lycopersicum]
Length=392

 Score =   306 bits (783),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 154/172 (90%), Gaps = 1/172 (1%)
 Frame = -1

Query  770  YYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQTLFPGESGVDQLVEIIKVLGTPTREE  591
            YYRAPELIFGATEYT AID+WS GCVLAELLLGQ LFPGESGVDQLVEIIKVLGTPTREE
Sbjct  221  YYRAPELIFGATEYTFAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREE  280

Query  590  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCSALDALTHPFF  411
            IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLR +AL+A TH FF
Sbjct  281  IKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSTALEACTHSFF  340

Query  410  DELRDPSIRLPNGRFVPPLFNFKPHELKGVPTETM-KLVPEHARKQCPFLGL  258
            DELRDP  RLPNGR +PPLFNF+P ELKG   E + KL+PEHA+KQC  LG 
Sbjct  341  DELRDPKTRLPNGRPLPPLFNFRPQELKGASAELLNKLIPEHAKKQCTSLGF  392



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1467725733100