BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF010O24

Length=766
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009796493.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    299   2e-92   Nicotiana sylvestris
ref|XP_009614011.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    299   2e-92   Nicotiana tomentosiformis
ref|XP_002533323.1|  leucine-rich repeat transmembrane protein ki...    291   1e-90   
gb|ABO31100.1|  ovule receptor-like kinase 28                           294   1e-90   Solanum chacoense
ref|XP_006342885.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    294   2e-90   Solanum tuberosum [potatoes]
emb|CDO97777.1|  unnamed protein product                                293   2e-90   Coffea canephora [robusta coffee]
ref|XP_004235517.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    292   8e-90   
ref|XP_004252624.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    290   4e-89   Solanum lycopersicum
ref|XP_009619763.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    288   2e-88   Nicotiana tomentosiformis
gb|KDP40614.1|  hypothetical protein JCGZ_24613                         288   2e-88   Jatropha curcas
ref|XP_008465039.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    284   4e-88   
ref|XP_006362102.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    286   9e-88   Solanum tuberosum [potatoes]
ref|XP_006369070.1|  leucine-rich repeat transmembrane protein ki...    286   9e-88   
ref|XP_008465038.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    284   2e-87   
ref|XP_008228094.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    285   3e-87   Prunus mume [ume]
ref|XP_008372915.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    285   4e-87   Malus domestica [apple tree]
ref|XP_008465036.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    283   8e-87   
ref|XP_006465790.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    284   8e-87   Citrus sinensis [apfelsine]
ref|XP_006426818.1|  hypothetical protein CICLE_v10025011mg             284   1e-86   Citrus clementina [clementine]
ref|XP_009788970.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    283   1e-86   Nicotiana sylvestris
ref|XP_007217016.1|  hypothetical protein PRUPE_ppa002092mg             284   1e-86   Prunus persica
gb|EYU21255.1|  hypothetical protein MIMGU_mgv1a002171mg                283   1e-86   Erythranthe guttata [common monkey flower]
ref|XP_009788969.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    283   1e-86   Nicotiana sylvestris
ref|XP_008465035.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    283   2e-86   Cucumis melo [Oriental melon]
gb|EYU21256.1|  hypothetical protein MIMGU_mgv1a002171mg                283   2e-86   Erythranthe guttata [common monkey flower]
ref|XP_008465033.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    283   2e-86   
ref|XP_004303773.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    283   3e-86   Fragaria vesca subsp. vesca
ref|NP_001241934.1|  protein STRUBBELIG-RECEPTOR FAMILY 6-like          280   3e-86   
ref|XP_004165988.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    282   6e-86   
ref|XP_004144448.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    282   6e-86   Cucumis sativus [cucumbers]
ref|XP_011048642.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    281   8e-86   Populus euphratica
ref|XP_010033635.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    281   9e-86   Eucalyptus grandis [rose gum]
ref|XP_006604929.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    281   1e-85   
gb|KHN01483.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    280   1e-85   Glycine soja [wild soybean]
ref|XP_006604928.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    281   1e-85   Glycine max [soybeans]
ref|XP_006598761.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    281   2e-85   
gb|KHN16389.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    281   2e-85   Glycine soja [wild soybean]
ref|XP_006583189.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    280   3e-85   Glycine max [soybeans]
ref|XP_004510591.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    280   4e-85   Cicer arietinum [garbanzo]
emb|CBI35784.3|  unnamed protein product                                279   6e-85   Vitis vinifera
ref|XP_007139053.1|  hypothetical protein PHAVU_009G260900g             279   8e-85   Phaseolus vulgaris [French bean]
ref|XP_010654359.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    279   8e-85   Vitis vinifera
gb|ADM07445.1|  leucine-rich repeat receptor-like protein kinase        278   1e-84   Glycine soja [wild soybean]
ref|XP_007135353.1|  hypothetical protein PHAVU_010G122100g             278   1e-84   Phaseolus vulgaris [French bean]
ref|XP_011072711.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    278   1e-84   Sesamum indicum [beniseed]
ref|XP_008462233.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    277   1e-84   Cucumis melo [Oriental melon]
ref|XP_008783430.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    278   1e-84   Phoenix dactylifera
ref|XP_008783422.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    278   2e-84   Phoenix dactylifera
ref|XP_004141737.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    276   2e-84   
gb|AFW90526.1|  strubbelig-receptor family 6-like protein               276   2e-84   Phaseolus vulgaris [French bean]
ref|XP_008462232.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    277   2e-84   
ref|XP_008462231.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    278   2e-84   Cucumis melo [Oriental melon]
gb|KEH18524.1|  strubbelig-receptor family 6 protein                    277   3e-84   Medicago truncatula
gb|KHG25534.1|  protein strubbelig-receptor family 6                    277   3e-84   Gossypium arboreum [tree cotton]
ref|XP_003627481.1|  Protein STRUBBELIG-RECEPTOR FAMILY                 276   6e-84   Medicago truncatula
ref|XP_007024796.1|  Strubbelig-receptor family 6                       276   7e-84   
ref|XP_002304260.2|  hypothetical protein POPTR_0003s07130g             276   8e-84   
ref|XP_008380807.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    276   1e-83   
ref|XP_004159012.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    275   2e-83   
gb|KGN45433.1|  hypothetical protein Csa_7G447950                       275   2e-83   Cucumis sativus [cucumbers]
ref|XP_011031832.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    275   2e-83   Populus euphratica
ref|XP_004494892.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    275   2e-83   Cicer arietinum [garbanzo]
gb|KHG18134.1|  protein strubbelig-receptor family 6                    275   4e-83   Gossypium arboreum [tree cotton]
gb|ADB93024.1|  leucine-rich repeat receptor-like protein kinase        260   9e-83   Dendrobium nobile
gb|KJB70030.1|  hypothetical protein B456_011G054100                    273   2e-82   Gossypium raimondii
gb|KHG12210.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    272   2e-82   Gossypium arboreum [tree cotton]
gb|KJB57112.1|  hypothetical protein B456_009G148500                    272   3e-82   Gossypium raimondii
gb|KHG12209.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    272   4e-82   Gossypium arboreum [tree cotton]
ref|XP_010273793.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    271   7e-82   Nelumbo nucifera [Indian lotus]
gb|KEH24658.1|  strubbelig-receptor family protein                      270   2e-81   Medicago truncatula
ref|XP_010542346.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    270   2e-81   Tarenaya hassleriana [spider flower]
ref|XP_010939842.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    267   8e-81   
emb|CAN80221.1|  hypothetical protein VITISV_027894                     267   1e-80   Vitis vinifera
ref|XP_010939841.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    267   2e-80   Elaeis guineensis
ref|XP_008800485.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    266   5e-80   
ref|XP_010685195.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    265   9e-80   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006836581.1|  hypothetical protein AMTR_s00131p00083660          264   3e-79   Amborella trichopoda
ref|XP_009777356.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    262   3e-79   Nicotiana sylvestris
ref|XP_009386772.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    264   5e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006649512.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    263   7e-79   
gb|AAC27894.1|  leucine-rich repeat transmembrane protein kinase 1      262   8e-79   Zea mays [maize]
ref|XP_004983096.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    263   8e-79   Setaria italica
ref|XP_008651696.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    263   1e-78   Zea mays [maize]
ref|XP_008651693.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    263   1e-78   
gb|KDO53740.1|  hypothetical protein CISIN_1g0080551mg                  245   2e-78   Citrus sinensis [apfelsine]
ref|XP_009777355.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    261   2e-78   Nicotiana sylvestris
ref|XP_009777352.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    261   2e-78   Nicotiana sylvestris
ref|XP_008659003.1|  PREDICTED: leucine-rich repeat transmembrane...    261   4e-78   
ref|NP_001049184.1|  Os03g0183800                                       261   5e-78   
ref|XP_004985465.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    261   5e-78   Setaria italica
ref|XP_009383597.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    261   6e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002468389.1|  hypothetical protein SORBIDRAFT_01g045010          261   7e-78   Sorghum bicolor [broomcorn]
ref|XP_006661732.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    260   1e-77   Oryza brachyantha
ref|XP_004985464.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    261   1e-77   Setaria italica
ref|NP_001167741.1|  uncharacterized protein LOC100381429 precursor     260   1e-77   Zea mays [maize]
gb|AFW89442.1|  putative STRUBBELIG family receptor protein kinase      260   1e-77   
ref|XP_006392757.1|  hypothetical protein EUTSA_v10011271mg             259   1e-77   
ref|XP_006392758.1|  hypothetical protein EUTSA_v10011271mg             259   1e-77   Eutrema salsugineum [saltwater cress]
ref|XP_003558655.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    259   2e-77   Brachypodium distachyon [annual false brome]
gb|ACG49227.1|  leucine-rich repeat transmembrane protein kinase 1      258   2e-77   Zea mays [maize]
ref|XP_006304699.1|  hypothetical protein CARUB_v10011957mg             259   3e-77   Capsella rubella
ref|NP_175777.1|  STRUBBELIG-receptor family 6                          258   4e-77   Arabidopsis thaliana [mouse-ear cress]
gb|ABB20817.1|  putative leucine-rich repeat transmembrane protei...    258   6e-77   Isatis tinctoria [woad]
gb|KFK35699.1|  hypothetical protein AALP_AA4G025700                    258   7e-77   Arabis alpina [alpine rockcress]
ref|NP_001064502.1|  Os10g0389800                                       258   7e-77   
ref|XP_010479951.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    258   8e-77   Camelina sativa [gold-of-pleasure]
gb|EPS61932.1|  ovule receptor-like kinase 28                           257   1e-76   Genlisea aurea
gb|AAK52120.1|AC079936_16  Putative leucine-rich repeat transmemb...    258   1e-76   Oryza sativa Japonica Group [Japonica rice]
gb|EEC66871.1|  hypothetical protein OsI_33412                          257   1e-76   Oryza sativa Indica Group [Indian rice]
ref|NP_001104882.1|  leucine-rich repeat transmembrane protein ki...    257   2e-76   Zea mays [maize]
gb|EMS47769.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    254   2e-76   Triticum urartu
ref|XP_010501035.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    256   3e-76   Camelina sativa [gold-of-pleasure]
ref|XP_006357429.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    256   4e-76   
emb|CDY02495.1|  BnaA08g01020D                                          256   4e-76   
ref|XP_009106960.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    256   4e-76   Brassica rapa
ref|XP_010096526.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6               255   4e-76   
emb|CDY25686.1|  BnaC03g69890D                                          255   6e-76   Brassica napus [oilseed rape]
ref|NP_001077716.1|  STRUBBELIG-receptor family 6                       255   8e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009591325.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    255   8e-76   Nicotiana tomentosiformis
ref|XP_010534992.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    253   1e-75   Tarenaya hassleriana [spider flower]
ref|XP_010462281.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    254   1e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010487232.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    250   2e-75   Camelina sativa [gold-of-pleasure]
ref|XP_002891770.1|  hypothetical protein ARALYDRAFT_474507             254   2e-75   
ref|XP_009116969.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    254   3e-75   Brassica rapa
emb|CDY39110.1|  BnaA01g29460D                                          254   3e-75   Brassica napus [oilseed rape]
gb|EMT02096.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    253   3e-75   
emb|CDX97567.1|  BnaA05g25120D                                          253   4e-75   
ref|XP_002885038.1|  hypothetical protein ARALYDRAFT_478852             253   6e-75   
ref|XP_009146380.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    253   6e-75   Brassica rapa
ref|XP_010937238.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    251   8e-75   
ref|XP_010534991.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    252   9e-75   Tarenaya hassleriana [spider flower]
ref|XP_006845116.1|  hypothetical protein AMTR_s00005p00184950          243   1e-74   
ref|XP_006407090.1|  hypothetical protein EUTSA_v10020162mg             252   1e-74   Eutrema salsugineum [saltwater cress]
ref|XP_010937237.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    251   2e-74   Elaeis guineensis
ref|XP_011079189.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    251   2e-74   Sesamum indicum [beniseed]
ref|XP_006300068.1|  hypothetical protein CARUB_v10016296mg             251   2e-74   Capsella rubella
ref|XP_002467303.1|  hypothetical protein SORBIDRAFT_01g024160          250   3e-74   
ref|XP_010501850.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    251   3e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010465325.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    251   4e-74   Camelina sativa [gold-of-pleasure]
gb|KFK38799.1|  hypothetical protein AALP_AA3G161700                    250   5e-74   Arabis alpina [alpine rockcress]
emb|CDX98445.1|  BnaC05g39300D                                          249   1e-73   
ref|XP_006657962.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    249   2e-73   
ref|XP_004958321.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    249   2e-73   Setaria italica
ref|XP_001780717.1|  predicted protein                                  238   3e-73   
ref|NP_974312.1|  STRUBBELIG-receptor family 7 protein                  246   9e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001776313.1|  predicted protein                                  239   9e-73   
ref|NP_974311.1|  STRUBBELIG-receptor family 7 protein                  246   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009388758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    246   2e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388759.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    246   2e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_188052.2|  STRUBBELIG-receptor family 7 protein                  246   2e-72   Arabidopsis thaliana [mouse-ear cress]
emb|CAA18116.1|  serine/threonine protein kinase like protein           236   2e-72   Arabidopsis thaliana [mouse-ear cress]
gb|ACN58180.1|  leucine-rich repeat protein                             234   2e-72   Dasypyrum villosum
emb|CDY33226.1|  BnaC01g36990D                                          246   2e-72   Brassica napus [oilseed rape]
ref|XP_002461023.1|  hypothetical protein SORBIDRAFT_02g039370          246   2e-72   Sorghum bicolor [broomcorn]
ref|NP_001173462.1|  Os03g0397700                                       232   3e-72   
gb|AFQ91933.1|  leucine-rich repeat receptor-like kinase                245   3e-72   Brassica rapa subsp. oleifera [biennial turnip rape]
gb|ABQ53156.1|  leucine-rich repeat protein                             233   3e-72   Triticum aestivum [Canadian hard winter wheat]
emb|CDY36601.1|  BnaC06g06540D                                          243   1e-71   Brassica napus [oilseed rape]
ref|XP_010235400.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    243   2e-71   
dbj|BAJ87185.1|  predicted protein                                      241   2e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010686780.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    243   2e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006449793.1|  hypothetical protein CICLE_v10014418mg             243   3e-71   
ref|XP_006467381.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    242   4e-71   Citrus sinensis [apfelsine]
dbj|BAG99361.1|  unnamed protein product                                242   4e-71   Oryza sativa Japonica Group [Japonica rice]
gb|AAV64203.1|  leucine-rich repeat transmembrane protein kinase ...    242   5e-71   Zea mays [maize]
ref|XP_008653346.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    242   5e-71   
gb|EEC82450.1|  hypothetical protein OsI_26884                          242   5e-71   Oryza sativa Indica Group [Indian rice]
dbj|BAC10113.1|  putative leucine-rich repeat transmembrane prote...    242   5e-71   Oryza sativa Japonica Group [Japonica rice]
emb|CDY24077.1|  BnaA06g00750D                                          242   5e-71   Brassica napus [oilseed rape]
gb|KDO78347.1|  hypothetical protein CISIN_1g005001mg                   242   6e-71   Citrus sinensis [apfelsine]
ref|XP_006467380.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    242   6e-71   Citrus sinensis [apfelsine]
ref|NP_001060286.1|  Os07g0618400                                       242   6e-71   
ref|XP_008653345.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    242   6e-71   Zea mays [maize]
ref|XP_006449794.1|  hypothetical protein CICLE_v10014418mg             242   6e-71   Citrus clementina [clementine]
gb|KJB67279.1|  hypothetical protein B456_010G183400                    241   7e-71   Gossypium raimondii
ref|XP_010538738.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    241   8e-71   Tarenaya hassleriana [spider flower]
ref|XP_010928424.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    239   1e-70   
ref|XP_008355924.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    241   1e-70   
gb|KJB67276.1|  hypothetical protein B456_010G183400                    241   1e-70   Gossypium raimondii
ref|XP_007026174.1|  STRUBBELIG-receptor family 8 isoform 2             239   2e-70   
ref|XP_009357210.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    240   3e-70   Pyrus x bretschneideri [bai li]
ref|XP_002518426.1|  Serine/threonine-protein kinase PBS1, putative     239   3e-70   
ref|NP_001119030.1|  STRUBBELIG-receptor family 8 protein               237   4e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009147586.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    240   4e-70   Brassica rapa
ref|XP_010539255.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    239   5e-70   Tarenaya hassleriana [spider flower]
ref|XP_002965192.1|  hypothetical protein SELMODRAFT_83158              231   5e-70   
ref|XP_010539262.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    239   5e-70   Tarenaya hassleriana [spider flower]
ref|XP_010539270.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    239   6e-70   Tarenaya hassleriana [spider flower]
ref|XP_010928422.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    239   7e-70   
ref|XP_007026173.1|  STRUBBELIG-receptor family 8 isoform 1             239   8e-70   
ref|XP_010052885.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    237   1e-69   Eucalyptus grandis [rose gum]
ref|XP_007213628.1|  hypothetical protein PRUPE_ppa002088mg             239   1e-69   
ref|XP_008384096.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    239   1e-69   Malus domestica [apple tree]
ref|XP_002979973.1|  hypothetical protein SELMODRAFT_112070             229   1e-69   
ref|XP_009357487.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    238   1e-69   Pyrus x bretschneideri [bai li]
ref|XP_010943264.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    238   1e-69   
gb|EMT22844.1|  hypothetical protein F775_52608                         236   2e-69   
ref|XP_010052884.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    238   2e-69   Eucalyptus grandis [rose gum]
ref|XP_010244139.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    238   2e-69   Nelumbo nucifera [Indian lotus]
ref|XP_004486188.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    237   2e-69   
ref|XP_008224758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    238   2e-69   Prunus mume [ume]
gb|KDP20703.1|  hypothetical protein JCGZ_21174                         238   2e-69   Jatropha curcas
ref|XP_006284970.1|  hypothetical protein CARUB_v10006274mg             238   2e-69   Capsella rubella
ref|XP_010943263.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    238   2e-69   Elaeis guineensis
ref|XP_010099162.1|  Protein STRUBBELIG-RECEPTOR FAMILY 8               238   2e-69   
ref|XP_010448928.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    237   3e-69   Camelina sativa [gold-of-pleasure]
gb|EMS51823.1|  Protein STRUBBELIG-RECEPTOR FAMILY 8                    236   3e-69   Triticum urartu
ref|XP_010439362.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    237   3e-69   Camelina sativa [gold-of-pleasure]
ref|XP_011086205.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    236   3e-69   Sesamum indicum [beniseed]
ref|XP_008458999.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    235   3e-69   Cucumis melo [Oriental melon]
gb|KFK28787.1|  hypothetical protein AALP_AA7G048200                    237   3e-69   Arabis alpina [alpine rockcress]
emb|CDP04441.1|  unnamed protein product                                237   3e-69   Coffea canephora [robusta coffee]
ref|XP_008803525.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    238   3e-69   Phoenix dactylifera
ref|XP_011002570.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    237   4e-69   Populus euphratica
ref|XP_010434074.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    237   4e-69   Camelina sativa [gold-of-pleasure]
dbj|BAD37979.1|  putative leucine-rich repeat transmembrane prote...    234   4e-69   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006383864.1|  hypothetical protein POPTR_0004s00710g             235   4e-69   
ref|NP_193944.2|  STRUBBELIG-receptor family 8 protein                  237   4e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007147687.1|  hypothetical protein PHAVU_006G146100g             237   5e-69   Phaseolus vulgaris [French bean]
ref|XP_003562663.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    241   5e-69   Brachypodium distachyon [annual false brome]
ref|XP_010052883.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    237   5e-69   Eucalyptus grandis [rose gum]
gb|EEC72655.1|  hypothetical protein OsI_06182                          237   5e-69   Oryza sativa Indica Group [Indian rice]
ref|XP_010252506.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    237   6e-69   Nelumbo nucifera [Indian lotus]
ref|XP_011002569.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    237   6e-69   Populus euphratica
ref|XP_006348158.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    237   6e-69   Solanum tuberosum [potatoes]
ref|XP_004164349.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    235   6e-69   
ref|XP_004232684.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    237   7e-69   Solanum lycopersicum
ref|XP_001783845.1|  predicted protein                                  236   7e-69   
ref|XP_002267170.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    237   7e-69   Vitis vinifera
ref|XP_008799298.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    235   8e-69   Phoenix dactylifera
ref|XP_011046989.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    236   9e-69   Populus euphratica
ref|XP_006648399.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    236   9e-69   
ref|NP_001046150.1|  Os02g0190500                                       236   1e-68   
ref|XP_006586762.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    236   1e-68   Glycine max [soybeans]
ref|XP_011460016.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    236   1e-68   Fragaria vesca subsp. vesca
ref|XP_006413689.1|  hypothetical protein EUTSA_v10024563mg             235   1e-68   Eutrema salsugineum [saltwater cress]
ref|XP_009613682.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    236   1e-68   Nicotiana tomentosiformis
ref|XP_008458998.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    235   2e-68   Cucumis melo [Oriental melon]
ref|XP_004951618.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    236   2e-68   Setaria italica
ref|XP_009777766.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    236   2e-68   Nicotiana sylvestris
ref|XP_002869840.1|  kinase                                             235   2e-68   Arabidopsis lyrata subsp. lyrata
dbj|BAK07184.1|  predicted protein                                      235   2e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004145432.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    235   2e-68   Cucumis sativus [cucumbers]
ref|XP_008645353.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    235   3e-68   Zea mays [maize]
gb|KEH36931.1|  strubbelig-receptor family protein                      235   3e-68   Medicago truncatula
ref|XP_006435523.1|  hypothetical protein CICLE_v10010883mg             225   3e-68   
ref|XP_002451696.1|  hypothetical protein SORBIDRAFT_04g006110          234   4e-68   Sorghum bicolor [broomcorn]
gb|KJB69228.1|  hypothetical protein B456_011G011800                    234   4e-68   Gossypium raimondii
emb|CDX82908.1|  BnaC01g13580D                                          234   4e-68   
gb|KHG11352.1|  protein strubbelig-receptor family 8                    234   4e-68   Gossypium arboreum [tree cotton]
gb|EEE66066.1|  hypothetical protein OsJ_22073                          234   5e-68   Oryza sativa Japonica Group [Japonica rice]
emb|CDX79126.1|  BnaA01g11930D                                          234   5e-68   
ref|XP_009135627.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    234   5e-68   Brassica rapa
gb|EMT07607.1|  Protein STRUBBELIG-RECEPTOR FAMILY 7                    238   5e-68   
ref|XP_009108553.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    234   7e-68   Brassica rapa
ref|XP_008799289.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    234   7e-68   Phoenix dactylifera
ref|XP_004241858.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    233   7e-68   Solanum lycopersicum
emb|CDX76385.1|  BnaA08g10150D                                          233   7e-68   
gb|EEC81030.1|  hypothetical protein OsI_23812                          234   7e-68   Oryza sativa Indica Group [Indian rice]
emb|CDY27444.1|  BnaC03g64840D                                          233   8e-68   Brassica napus [oilseed rape]
ref|XP_002962278.1|  hypothetical protein SELMODRAFT_76873              233   1e-67   
ref|XP_006657163.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    232   1e-67   
ref|XP_003571057.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    233   2e-67   Brachypodium distachyon [annual false brome]
gb|EYU33875.1|  hypothetical protein MIMGU_mgv1a002066mg                233   2e-67   Erythranthe guttata [common monkey flower]
ref|XP_009385272.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    232   2e-67   
ref|XP_006597598.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    233   2e-67   Glycine max [soybeans]
ref|XP_009385265.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    233   2e-67   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAP12946.1|  putative leucine-rich repeat transmembrane protei...    233   3e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006650171.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    233   3e-67   Oryza brachyantha
gb|EAY90345.1|  hypothetical protein OsI_11922                          233   3e-67   Oryza sativa Indica Group [Indian rice]
emb|CAN77920.1|  hypothetical protein VITISV_027646                     233   4e-67   Vitis vinifera
ref|XP_006850999.1|  hypothetical protein AMTR_s00025p00216900          229   2e-66   
ref|XP_009386651.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    229   3e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003563583.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    229   5e-66   
gb|ACN34179.1|  unknown                                                 211   2e-65   Zea mays [maize]
ref|XP_001778654.1|  predicted protein                                  215   3e-65   
dbj|BAJ88293.1|  predicted protein                                      221   4e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004965804.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    225   9e-65   Setaria italica
ref|XP_006488603.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    224   1e-64   Citrus sinensis [apfelsine]
gb|EPS69681.1|  hypothetical protein M569_05081                         224   3e-64   
gb|EMS53763.1|  Protein STRUBBELIG-RECEPTOR FAMILY 8                    221   2e-63   
gb|EMT21016.1|  Protein STRUBBELIG-RECEPTOR FAMILY 8                    221   3e-63   
ref|XP_008659800.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    220   4e-63   
dbj|BAK02781.1|  predicted protein                                      221   4e-63   
gb|AFW76249.1|  putative STRUBBELIG family receptor protein kinase      217   7e-63   
gb|AFW76250.1|  putative STRUBBELIG family receptor protein kinase      217   7e-63   
gb|AFW87368.1|  putative STRUBBELIG family receptor protein kinase      220   1e-62   
ref|XP_008659801.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    220   1e-62   
gb|AFW87367.1|  putative STRUBBELIG family receptor protein kinase      220   1e-62   
ref|XP_010228525.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    219   1e-62   
ref|XP_001763842.1|  predicted protein                                  219   1e-62   
ref|XP_010228524.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    219   1e-62   
ref|XP_003557758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    219   1e-62   
ref|XP_002513297.1|  strubbelig receptor, putative                      219   2e-62   
ref|XP_008649054.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    218   5e-62   
ref|XP_008649053.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    218   5e-62   
ref|XP_002465165.1|  hypothetical protein SORBIDRAFT_01g033190          217   1e-61   
gb|KCW53999.1|  hypothetical protein EUGRSUZ_J03194                     217   1e-61   
ref|XP_010034888.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    216   2e-61   
ref|XP_009398616.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    213   3e-61   
ref|XP_009406399.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    215   8e-61   
ref|XP_009398615.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    213   1e-60   
gb|KDP25030.1|  hypothetical protein JCGZ_22565                         214   1e-60   
ref|XP_010245765.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    214   1e-60   
ref|XP_002320001.2|  leucine-rich repeat transmembrane protein ki...    213   2e-60   
ref|XP_009398614.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    213   2e-60   
ref|XP_010928729.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    213   2e-60   
ref|XP_011012291.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    212   5e-60   
ref|XP_008228078.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    211   2e-59   
ref|XP_004138532.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    209   4e-59   
ref|XP_009408730.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    210   5e-59   
emb|CAN60971.1|  hypothetical protein VITISV_032050                     206   5e-59   
emb|CDO97730.1|  unnamed protein product                                210   5e-59   
emb|CDX87418.1|  BnaA07g34550D                                          209   6e-59   
gb|KGN45936.1|  hypothetical protein Csa_6G024930                       209   7e-59   
ref|XP_008445635.1|  PREDICTED: LOW QUALITY PROTEIN: protein STRU...    209   7e-59   
ref|XP_002889223.1|  ATP binding protein                                209   1e-58   
ref|XP_008380426.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    206   1e-58   
ref|XP_007217699.1|  hypothetical protein PRUPE_ppa002458mg             208   1e-58   
ref|XP_006301930.1|  hypothetical protein CARUB_v10022406mg             208   2e-58   
emb|CDX88495.1|  BnaC06g39390D                                          208   2e-58   
gb|KFK42269.1|  hypothetical protein AALP_AA2G233600                    208   2e-58   
ref|XP_009106613.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    207   3e-58   
ref|XP_003604115.1|  Protein STRUBBELIG-RECEPTOR FAMILY                 208   3e-58   
ref|XP_006377174.1|  hypothetical protein POPTR_0011s01540g             206   3e-58   
ref|XP_004488910.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    207   3e-58   
ref|NP_178019.2|  STRUBBELIG-receptor family 5                          207   3e-58   
ref|XP_009344018.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    205   3e-58   
ref|XP_006586431.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    207   3e-58   
gb|KHN38109.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5                    207   4e-58   
ref|XP_010655241.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    205   4e-58   
ref|XP_006389935.1|  hypothetical protein EUTSA_v10019668mg             207   5e-58   
ref|XP_009391183.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    206   6e-58   
ref|XP_010417514.1|  PREDICTED: LOW QUALITY PROTEIN: protein STRU...    206   7e-58   
ref|XP_006841742.1|  hypothetical protein AMTR_s00003p00260350          207   8e-58   
ref|XP_002316561.2|  hypothetical protein POPTR_0011s01540g             206   8e-58   
ref|XP_010474484.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    206   8e-58   
ref|XP_008380425.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    206   1e-57   
ref|XP_011011656.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    206   1e-57   
ref|XP_010655239.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    205   1e-57   
emb|CBI18374.3|  unnamed protein product                                205   2e-57   
ref|XP_006357471.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    192   2e-57   
ref|XP_009344017.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    205   2e-57   
ref|XP_011031253.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    204   4e-57   
ref|XP_009346025.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    202   5e-57   
ref|XP_002310348.1|  leucine-rich repeat transmembrane protein ki...    204   5e-57   
ref|XP_009781364.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    204   7e-57   
ref|XP_009781363.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    204   8e-57   
ref|XP_009781362.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    204   8e-57   
gb|EEE67594.1|  hypothetical protein OsJ_25142                          203   9e-57   
ref|XP_010087069.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5               203   1e-56   
ref|XP_007135872.1|  hypothetical protein PHAVU_010G165200g             202   1e-56   
gb|AFW76248.1|  putative STRUBBELIG family receptor protein kinase      203   2e-56   
ref|XP_007135873.1|  hypothetical protein PHAVU_010G165200g             202   2e-56   
ref|XP_009346024.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    202   3e-56   
gb|AFW76246.1|  putative STRUBBELIG family receptor protein kinas...    203   4e-56   
ref|XP_009616311.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    202   4e-56   
ref|XP_009616310.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    202   5e-56   
ref|XP_010537759.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    200   5e-56   
ref|XP_008781708.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    199   2e-55   
ref|XP_010537758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    199   3e-55   
ref|XP_010913800.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    197   7e-55   
ref|XP_010913799.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    197   1e-54   
ref|XP_006661536.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    196   2e-54   
ref|XP_010696137.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    196   2e-54   
ref|XP_010696138.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    196   3e-54   
ref|XP_007023605.1|  Strubbelig-receptor family 5 isoform 1             197   3e-54   
ref|XP_011467514.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    196   5e-54   
dbj|BAD45956.1|  putative leucine-rich repeat transmembrane prote...    188   1e-53   
gb|KJB67278.1|  hypothetical protein B456_010G183400                    193   4e-53   
gb|KCW77015.1|  hypothetical protein EUGRSUZ_D01360                     192   8e-53   
emb|CDP19685.1|  unnamed protein product                                192   9e-53   
ref|XP_009775785.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    185   1e-52   
emb|CBI38492.3|  unnamed protein product                                182   1e-52   
gb|KJB66324.1|  hypothetical protein B456_010G135500                    186   3e-52   
emb|CDP14731.1|  unnamed protein product                                191   3e-52   
gb|AAQ54536.1|  protein kinase                                          178   4e-52   
ref|XP_010268782.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    190   6e-52   
ref|XP_010316717.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    190   8e-52   
ref|XP_010268781.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    190   9e-52   
ref|XP_011072790.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    189   9e-52   
gb|EAZ27223.1|  hypothetical protein OsJ_11161                          190   1e-51   
ref|XP_010278329.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    188   2e-51   
ref|XP_006357454.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    187   2e-51   
ref|XP_010322795.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    188   2e-51   
ref|XP_004241857.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    188   2e-51   
gb|KJB66323.1|  hypothetical protein B456_010G135500                    187   3e-51   
gb|AFW70556.1|  putative STRUBBELIG family receptor protein kinase      187   3e-51   
gb|EEE70214.1|  hypothetical protein OsJ_30326                          187   3e-51   
ref|XP_010316716.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    188   4e-51   
ref|XP_010316713.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    188   4e-51   
ref|XP_010316715.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    188   4e-51   
ref|NP_001063921.1|  Os09g0559900                                       187   5e-51   
ref|XP_010278322.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    187   5e-51   
ref|XP_009789819.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    187   5e-51   
ref|XP_009789818.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    187   6e-51   
ref|XP_010278328.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    187   6e-51   
gb|KJB69230.1|  hypothetical protein B456_011G011800                    187   6e-51   
ref|XP_009789815.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    187   6e-51   
ref|XP_006357453.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    186   8e-51   
gb|KHG16784.1|  protein strubbelig-receptor family 5                    185   8e-51   
ref|XP_010696576.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    187   1e-50   
ref|XP_002460659.1|  hypothetical protein SORBIDRAFT_02g032710          186   1e-50   
gb|EEC85048.1|  hypothetical protein OsI_32379                          186   2e-50   
ref|XP_003576835.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    185   2e-50   
gb|ACM89529.1|  leucine-rich repeat transmembrane protein kinase        177   2e-50   
ref|XP_004959657.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    185   3e-50   
ref|XP_010499921.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    184   5e-50   
gb|KJB56462.1|  hypothetical protein B456_009G120500                    184   5e-50   
ref|XP_002988579.1|  hypothetical protein SELMODRAFT_21917              178   5e-50   
ref|XP_010487048.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    184   1e-49   
ref|XP_010465107.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 4    184   1e-49   
ref|XP_002979273.1|  hypothetical protein SELMODRAFT_110362             179   1e-49   
ref|NP_001167726.1|  uncharacterized protein LOC100381414               179   1e-49   
ref|XP_009625937.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    184   1e-49   
gb|ACN31809.1|  unknown                                                 172   3e-49   
gb|EPS68087.1|  hypothetical protein M569_06686                         182   3e-49   
ref|XP_009593738.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    182   5e-49   
ref|XP_009593450.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    182   5e-49   
ref|XP_009593677.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    182   5e-49   
ref|XP_006300119.1|  hypothetical protein CARUB_v10016348mg             182   5e-49   
ref|XP_006447319.1|  hypothetical protein CICLE_v10014768mg             179   1e-48   
ref|XP_008668240.1|  PREDICTED: uncharacterized protein LOC100381...    180   2e-48   
gb|KHG30272.1|  protein strubbelig-receptor family 3                    177   2e-48   
gb|ABI81608.1|  strubbelig receptor family 1 protein isoform a          180   3e-48   
ref|XP_008668239.1|  PREDICTED: uncharacterized protein LOC100381...    179   3e-48   
gb|EMS56044.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5                    179   4e-48   
ref|XP_002517969.1|  lrr receptor-linked protein kinase, putative       179   5e-48   
ref|XP_006491630.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    179   5e-48   
ref|XP_009124712.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    178   7e-48   
ref|XP_010313855.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    178   8e-48   
ref|XP_009124710.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    178   9e-48   
ref|XP_008341914.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    178   1e-47   
emb|CDX79278.1|  BnaC06g20250D                                          174   1e-47   
ref|XP_008341912.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    178   1e-47   
ref|NP_001141597.1|  uncharacterized protein LOC100273714               172   1e-47   
emb|CDY43376.1|  BnaA01g30070D                                          177   1e-47   
ref|XP_004155578.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    178   1e-47   
dbj|BAK05038.1|  predicted protein                                      177   1e-47   
ref|XP_004251794.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    178   2e-47   
ref|XP_009767606.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3    177   2e-47   
ref|XP_011096273.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 1    177   2e-47   
ref|XP_010323714.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    177   3e-47   
dbj|BAF00067.1|  SRF3                                                   171   3e-47   
ref|XP_008224986.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3    177   3e-47   
gb|AAL07025.1|  putative LRR receptor protein kinase                    177   3e-47   
ref|XP_011085359.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    177   3e-47   
ref|NP_565489.2|  strubbelig-receptor family 1 protein                  177   3e-47   
gb|KHG09080.1|  protein strubbelig-receptor family 5                    176   3e-47   
ref|XP_004134722.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    176   4e-47   
ref|XP_008371312.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3    176   4e-47   
ref|XP_006350044.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    176   5e-47   
ref|XP_006371595.1|  hypothetical protein POPTR_0019s13490g             176   5e-47   
ref|XP_006407265.1|  hypothetical protein EUTSA_v10020193mg             176   6e-47   
gb|EMT01284.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5                    176   6e-47   
ref|XP_006371594.1|  leucine-rich repeat transmembrane protein ki...    176   7e-47   
ref|XP_006376519.1|  hypothetical protein POPTR_0013s14080g             175   9e-47   
ref|NP_001275442.1|  LRR receptor-like kinase precursor                 176   9e-47   
ref|XP_007159275.1|  hypothetical protein PHAVU_002G224200g             175   1e-46   
ref|XP_010689690.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    176   1e-46   
ref|XP_010689695.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    176   1e-46   
ref|XP_010689694.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    176   1e-46   
ref|XP_008439889.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    175   1e-46   
ref|XP_006594861.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    176   1e-46   
ref|XP_002319371.2|  hypothetical protein POPTR_0013s14080g             175   1e-46   
gb|KJB31725.1|  hypothetical protein B456_005G204500                    174   1e-46   
ref|XP_009350757.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    175   2e-46   
ref|XP_011039760.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    174   2e-46   
ref|XP_009350761.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    174   2e-46   
gb|KHN36613.1|  Protein STRUBBELIG-RECEPTOR FAMILY 3                    175   2e-46   
ref|XP_007043518.1|  Strubbelig-receptor family 3 isoform 1             175   2e-46   
ref|XP_010552382.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 4    174   2e-46   
ref|XP_009350736.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    175   2e-46   
ref|XP_011039757.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    175   2e-46   
gb|KDP24176.1|  hypothetical protein JCGZ_25833                         174   3e-46   
ref|XP_004487313.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    174   3e-46   
ref|XP_010526526.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    174   3e-46   
gb|KJB31723.1|  hypothetical protein B456_005G204500                    174   4e-46   
ref|NP_566444.4|  STRUBBELIG-receptor family 4                          173   4e-46   
gb|ACI49786.1|  At3g13065                                               173   5e-46   
ref|XP_007149883.1|  hypothetical protein PHAVU_005G106800g             174   5e-46   
ref|XP_010657277.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    174   5e-46   
ref|XP_004958054.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    174   5e-46   
ref|XP_004958051.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    174   5e-46   
ref|XP_010526524.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    173   5e-46   
gb|KHN04276.1|  Protein STRUBBELIG-RECEPTOR FAMILY 3                    173   6e-46   
emb|CDY23563.1|  BnaC05g40310D                                          173   7e-46   
ref|XP_009378447.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3    173   7e-46   
emb|CDY44024.1|  BnaA05g26190D                                          172   7e-46   
gb|KCW89495.1|  hypothetical protein EUGRSUZ_A01788                     173   8e-46   
gb|KDP20913.1|  hypothetical protein JCGZ_21384                         173   8e-46   
ref|XP_010069855.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    173   8e-46   
ref|XP_009146553.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 4    172   8e-46   
ref|XP_002882805.1|  predicted protein                                  175   9e-46   
ref|XP_009623074.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    172   1e-45   
ref|XP_004293601.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3    172   2e-45   
ref|XP_002521411.1|  lrr receptor-linked protein kinase, putative       172   2e-45   
ref|XP_008455343.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    172   2e-45   
emb|CAN75709.1|  hypothetical protein VITISV_031422                     171   2e-45   
ref|XP_008383797.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    172   2e-45   



>ref|XP_009796493.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Nicotiana 
sylvestris]
Length=718

 Score =   299 bits (765),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/172 (83%), Positives = 153/172 (89%), Gaps = 0/172 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E NPHLSD GLASLI D DQALN N+ SG GAPEVAMSGQ+TIKSDVYSFGV 
Sbjct  546  ANILLDAELNPHLSDCGLASLIADVDQALNHNTGSGYGAPEVAMSGQFTIKSDVYSFGVV  605

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFD  R R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVI
Sbjct  606  MLELLTGRKPFDGGRSRSEQSLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVI  665

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  251
            ALCVQPEPEFRPPMSEVVEALVRLVQRANMS+RTFG D  +  G AD+Q+YE
Sbjct  666  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSKRTFGVDQASPRGEADAQDYE  717



>ref|XP_009614011.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Nicotiana tomentosiformis]
Length=717

 Score =   299 bits (765),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/172 (83%), Positives = 153/172 (89%), Gaps = 0/172 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E NPHLSD GLASLI D DQALN N+ SG GAPEVAMSGQ+TIKSDVYSFGV 
Sbjct  545  ANILLDAELNPHLSDCGLASLIADVDQALNHNTGSGYGAPEVAMSGQFTIKSDVYSFGVV  604

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFD  R R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVI
Sbjct  605  MLELLTGRKPFDGGRTRSEQSLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVI  664

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  251
            ALCVQPEPEFRPPMSEVVEALVRLVQRANMS+RTFG D  +  G AD+Q+YE
Sbjct  665  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSKRTFGVDQASPRGEADAQDYE  716



>ref|XP_002533323.1| leucine-rich repeat transmembrane protein kinase, putative [Ricinus 
communis]
 gb|EEF29059.1| leucine-rich repeat transmembrane protein kinase, putative [Ricinus 
communis]
Length=607

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 155/173 (90%), Gaps = 2/173 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E NPHLSDSGLAS +P+ +QALN N+ SG GAPEVAMSGQYT+KSDVYSFGV 
Sbjct  434  ANILLDTELNPHLSDSGLASFLPNAEQALNNNAGSGYGAPEVAMSGQYTLKSDVYSFGVV  493

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDSSRPR EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI
Sbjct  494  MLELLTGRKPFDSSRPRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  553

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQEY  254
            ALCVQPEPEFRPPMSEVV+ALVRLVQRANMS+RT G D  +  +  +AD+ +Y
Sbjct  554  ALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTVGNDQGASRQVDNADAHDY  606



>gb|ABO31100.1| ovule receptor-like kinase 28 [Solanum chacoense]
Length=711

 Score =   294 bits (752),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN++LD+E NPHLSD GLASLI D DQALN N+ SG GAPEVAMSG  TIKSDVYSFGV 
Sbjct  539  ANIVLDAELNPHLSDCGLASLIADADQALNHNTGSGYGAPEVAMSGLCTIKSDVYSFGVV  598

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVI
Sbjct  599  MLELLTGRKPFDSARTRSEQSLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVI  658

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  251
            ALCVQPEPEFRPPMSEVVEALVRLVQRANMS+RTFGAD  T  G  D  +YE
Sbjct  659  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSKRTFGADQGTSRGETDGPDYE  710



>ref|XP_006342885.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Solanum 
tuberosum]
Length=711

 Score =   294 bits (752),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN++LD+E NPHLSD GLASLI D DQALN N+ SG GAPEVAMSG  TIKSDVYSFGV 
Sbjct  539  ANIVLDAELNPHLSDCGLASLIADADQALNHNTGSGYGAPEVAMSGLCTIKSDVYSFGVV  598

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVI
Sbjct  599  MLELLTGRKPFDSARTRSEQSLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVI  658

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  251
            ALCVQPEPEFRPPMSEVVEALVRLVQRANMS+RTFGAD  T  G  D  +YE
Sbjct  659  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSKRTFGADQGTSRGETDGPDYE  710



>emb|CDO97777.1| unnamed protein product [Coffea canephora]
Length=712

 Score =   293 bits (751),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 153/172 (89%), Gaps = 2/172 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD E NPHLSD GLASL+ D DQALNQN+ SG GAPEV+MSGQYTIKSDVYSFGV 
Sbjct  540  ANILLDMELNPHLSDCGLASLVHDIDQALNQNAGSGYGAPEVSMSGQYTIKSDVYSFGVV  599

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDSSR R EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADVI
Sbjct  600  MLELLTGRQPFDSSRARSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVI  659

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQE  257
            ALCVQPEPEFRPPMSEVV+ALVRLVQRANMSRRT G D  S  RS ++D Q+
Sbjct  660  ALCVQPEPEFRPPMSEVVQALVRLVQRANMSRRTLGNDQGSSVRSNNSDDQD  711



>ref|XP_004235517.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Solanum lycopersicum]
Length=710

 Score =   292 bits (747),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN++LD+E NPHLSD GLASLI D DQALN N+ SG GAPEVAMSG  TIKSDVYSFGV 
Sbjct  538  ANIVLDAELNPHLSDCGLASLIADADQALNHNTGSGYGAPEVAMSGLCTIKSDVYSFGVV  597

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQ LVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVI
Sbjct  598  MLELLTGRKPFDSARTRSEQDLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVI  657

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  251
            ALCVQPEPEFRPPMSEVVEALVRLVQRANMS+RTFGAD  T  G  D  +YE
Sbjct  658  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSKRTFGADQGTSRGETDGPDYE  709



>ref|XP_004252624.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Solanum lycopersicum]
Length=706

 Score =   290 bits (742),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 151/172 (88%), Gaps = 1/172 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD E NPHLSDSGLASLI D DQALN N+ SG GAPEVAM GQ TIKSDVYSFGV 
Sbjct  535  ANILLDLELNPHLSDSGLASLINDADQALNHNTGSGYGAPEVAMYGQCTIKSDVYSFGVV  594

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGRTPFDS RPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKS+SRFADVI
Sbjct  595  MLELLTGRTPFDSERPRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSISRFADVI  654

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  251
            ALCVQ EPEFRPPMSEVVEALVRLVQRANMS+RT+  D R+  G  DSQ+ +
Sbjct  655  ALCVQSEPEFRPPMSEVVEALVRLVQRANMSKRTYSID-RSSRGETDSQDNQ  705



>ref|XP_009619763.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Nicotiana 
tomentosiformis]
Length=707

 Score =   288 bits (738),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 150/172 (87%), Gaps = 1/172 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD E NPHLSDSGLASLI D DQALN N+ SG GAPE AM GQ TIKSDVYSFGV 
Sbjct  536  ANILLDMELNPHLSDSGLASLIDDADQALNHNTGSGYGAPEGAMYGQCTIKSDVYSFGVV  595

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS RPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKS+SRFADVI
Sbjct  596  MLELLTGRKPFDSERPRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSISRFADVI  655

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  251
            ALCVQPEPEFRPPMSEVVEALVRLVQRANMS+RTF  D R+  G  D+Q+ +
Sbjct  656  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSKRTFSLD-RSSRGETDAQDNQ  706



>gb|KDP40614.1| hypothetical protein JCGZ_24613 [Jatropha curcas]
Length=714

 Score =   288 bits (738),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E NPHLSDSGLAS +P+ DQALN +SASG GAPEVAMSGQYT+KSDVYSFGV 
Sbjct  541  ANILLDAELNPHLSDSGLASFLPNADQALNNDSASGYGAPEVAMSGQYTLKSDVYSFGVV  600

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADVI
Sbjct  601  MLELLTGRKPFDSSRPRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVI  660

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            ALCVQ EPEFRPPMSEVV+ALVRLVQRANMS+RT G D
Sbjct  661  ALCVQSEPEFRPPMSEVVQALVRLVQRANMSKRTVGND  698



>ref|XP_008465039.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 isoform X5 [Cucumis 
melo]
Length=584

 Score =   284 bits (727),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E NPHLSD GLAS I + DQAL+Q + SG  APEV MSGQYT+KSDVYSFGV 
Sbjct  411  ANILLDAEMNPHLSDCGLASFITNLDQALDQQTGSGYSAPEVTMSGQYTLKSDVYSFGVV  470

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADV+
Sbjct  471  MLELLSGRKPFDSSRPRAEQSLVRWATPQLHDIDALTKMVDPALKGLYPVKSLSRFADVV  530

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            ALCVQPEPEFRPPMSEVVEALVRLVQR+NMSRRTFG+D
Sbjct  531  ALCVQPEPEFRPPMSEVVEALVRLVQRSNMSRRTFGSD  568



>ref|XP_006362102.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Solanum 
tuberosum]
Length=706

 Score =   286 bits (733),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 150/171 (88%), Gaps = 2/171 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD E NPHLSDSGLASLI D DQALN N+ SG GAPEVAM GQ TIKSDVYSFGV 
Sbjct  535  ANILLDLELNPHLSDSGLASLINDADQALNHNTGSGYGAPEVAMYGQCTIKSDVYSFGVV  594

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGRTPFDS RPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKS+SRFADVI
Sbjct  595  MLELLTGRTPFDSERPRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSISRFADVI  654

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQ  260
            ALCVQ EPEFRPPMSEVVEALVRLVQRANMS+RT+  D  SR  + + D+Q
Sbjct  655  ALCVQSEPEFRPPMSEVVEALVRLVQRANMSKRTYSIDRGSRGETDALDNQ  705



>ref|XP_006369070.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|ERP65639.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=715

 Score =   286 bits (733),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 151/173 (87%), Gaps = 2/173 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E NPHLSDSGLAS +P  DQ LNQN+ SG GAPEVAMSG YT+KSDVYSFG  
Sbjct  541  ANILLDTELNPHLSDSGLASCLPHADQVLNQNAGSGYGAPEVAMSGHYTLKSDVYSFGAV  600

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDSSRPR EQSLVRWATPQLHDIDALSKMVDP LKGLYPVKSLSRFADVI
Sbjct  601  MLELLTGRKPFDSSRPRSEQSLVRWATPQLHDIDALSKMVDPELKGLYPVKSLSRFADVI  660

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRT--RSGSADSQEY  254
            ALCVQPEPEFRPPMSEVV+ALVRLVQRANMS+RT G +     R+ + D+Q+Y
Sbjct  661  ALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTIGNEQGETPRAVNPDTQDY  713



>ref|XP_008465038.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 isoform X4 [Cucumis 
melo]
Length=637

 Score =   284 bits (726),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E NPHLSD GLAS I + DQAL+Q + SG  APEV MSGQYT+KSDVYSFGV 
Sbjct  464  ANILLDAEMNPHLSDCGLASFITNLDQALDQQTGSGYSAPEVTMSGQYTLKSDVYSFGVV  523

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADV+
Sbjct  524  MLELLSGRKPFDSSRPRAEQSLVRWATPQLHDIDALTKMVDPALKGLYPVKSLSRFADVV  583

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            ALCVQPEPEFRPPMSEVVEALVRLVQR+NMSRRTFG+D
Sbjct  584  ALCVQPEPEFRPPMSEVVEALVRLVQRSNMSRRTFGSD  621



>ref|XP_008228094.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Prunus mume]
Length=717

 Score =   285 bits (730),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 149/172 (87%), Gaps = 2/172 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD E NPHLSD+GLAS IP+ DQAL  N+ SG  APEVAMSGQYT+KSDVY FGV 
Sbjct  543  ANILLDVELNPHLSDTGLASFIPNADQALEHNAGSGYSAPEVAMSGQYTLKSDVYGFGVV  602

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLEL++GR PFDSS+PR EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI
Sbjct  603  MLELISGRKPFDSSKPRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  662

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQE  257
            ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRT G D     R  +A+ Q+
Sbjct  663  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTIGNDQGGSQRGDNANGQD  714



>ref|XP_008372915.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Malus domestica]
 ref|XP_008372916.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Malus domestica]
Length=714

 Score =   285 bits (729),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 150/172 (87%), Gaps = 2/172 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
             N+LLD E NPHLSDSGLAS IP+ DQAL+ N+ SG  APEVAMSGQYT+KSDVY FGV 
Sbjct  540  TNILLDVELNPHLSDSGLASSIPNADQALDHNAGSGYSAPEVAMSGQYTLKSDVYCFGVV  599

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR PFD+S+PR EQSLVRWATPQLHDIDALSKMVDP LKGLYPVKSLSRFADVI
Sbjct  600  MLELLSGRKPFDNSKPRSEQSLVRWATPQLHDIDALSKMVDPELKGLYPVKSLSRFADVI  659

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQE  257
            ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRT G D  S    G+AD+Q+
Sbjct  660  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTVGNDQGSSHGGGNADAQD  711



>ref|XP_008465036.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X3 [Cucumis 
melo]
 ref|XP_008465037.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X3 [Cucumis 
melo]
Length=686

 Score =   283 bits (725),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E NPHLSD GLAS I + DQAL+Q + SG  APEV MSGQYT+KSDVYSFGV 
Sbjct  513  ANILLDAEMNPHLSDCGLASFITNLDQALDQQTGSGYSAPEVTMSGQYTLKSDVYSFGVV  572

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADV+
Sbjct  573  MLELLSGRKPFDSSRPRAEQSLVRWATPQLHDIDALTKMVDPALKGLYPVKSLSRFADVV  632

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            ALCVQPEPEFRPPMSEVVEALVRLVQR+NMSRRTFG+D
Sbjct  633  ALCVQPEPEFRPPMSEVVEALVRLVQRSNMSRRTFGSD  670



>ref|XP_006465790.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Citrus 
sinensis]
Length=723

 Score =   284 bits (727),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 152/174 (87%), Gaps = 3/174 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E NP LSD GLAS +P+ D+ALN ++ SG GAPEVAMSGQY IKSDVYSFGV 
Sbjct  549  ANILLDNELNPQLSDCGLASNMPNADEALNNDAGSGYGAPEVAMSGQYNIKSDVYSFGVV  608

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADVI
Sbjct  609  MLELLTGRKPFDSSRPRLEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVI  668

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD---SRTRSGSADSQEY  254
            ALCVQPEPEFRPPMSEVV+ALVRLVQRANMS+RT G D   +  R  + D+Q+Y
Sbjct  669  ALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTIGNDQGPTTPRGDNQDTQDY  722



>ref|XP_006426818.1| hypothetical protein CICLE_v10025011mg [Citrus clementina]
 gb|ESR40058.1| hypothetical protein CICLE_v10025011mg [Citrus clementina]
Length=723

 Score =   284 bits (727),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 152/174 (87%), Gaps = 3/174 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E NP LSD GLAS +P+ D+ALN ++ SG GAPEVAMSGQY IKSDVYSFGV 
Sbjct  549  ANILLDNELNPQLSDCGLASNMPNADEALNNDAGSGYGAPEVAMSGQYNIKSDVYSFGVV  608

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADVI
Sbjct  609  MLELLTGRKPFDSSRPRLEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVI  668

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD---SRTRSGSADSQEY  254
            ALCVQPEPEFRPPMSEVV+ALVRLVQRANMS+RT G D   +  R  + D+Q+Y
Sbjct  669  ALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTIGNDQGPTTPRGDNQDTQDY  722



>ref|XP_009788970.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009788971.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Nicotiana sylvestris]
Length=698

 Score =   283 bits (725),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 148/172 (86%), Gaps = 1/172 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD E NPHLSDSGLA LI D DQA N N+ SG GAPE AM GQ TIKSDVYSFGV 
Sbjct  527  ANILLDMELNPHLSDSGLAILIDDADQARNHNTGSGYGAPEGAMYGQCTIKSDVYSFGVV  586

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS RPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKS+SRFADVI
Sbjct  587  MLELLTGRKPFDSERPRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSISRFADVI  646

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  251
            ALCVQPEPEFRPPMSEVVEALVRLVQRANMS+RTF  D R+  G  D+Q+ +
Sbjct  647  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSKRTFSLD-RSSRGETDAQDNQ  697



>ref|XP_007217016.1| hypothetical protein PRUPE_ppa002092mg [Prunus persica]
 gb|EMJ18215.1| hypothetical protein PRUPE_ppa002092mg [Prunus persica]
Length=717

 Score =   284 bits (726),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 148/172 (86%), Gaps = 2/172 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD E NPHLSD+GLAS IP+ DQAL  N  SG  APEVAMSGQYT+KSDVY FGV 
Sbjct  543  ANILLDVELNPHLSDTGLASFIPNADQALEHNVGSGYSAPEVAMSGQYTLKSDVYGFGVV  602

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLEL++GR PFDSS+PR EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI
Sbjct  603  MLELISGRKPFDSSKPRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  662

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQE  257
            ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRT G D     R  +A+ Q+
Sbjct  663  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTVGNDQGGSQRGDNANGQD  714



>gb|EYU21255.1| hypothetical protein MIMGU_mgv1a002171mg [Erythranthe guttata]
Length=705

 Score =   283 bits (725),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 149/171 (87%), Gaps = 5/171 (3%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD E NPHLSD  LASL+ D DQ      ASG  APEVAMSGQYTIKSDVYSFGV 
Sbjct  538  ANILLDIELNPHLSDCVLASLVRDPDQV-----ASGYSAPEVAMSGQYTIKSDVYSFGVV  592

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGRTPFDS+R R EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI
Sbjct  593  MLELLTGRTPFDSARQRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  652

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            ALCVQPEPEFRPPMSEVV+ALVRLVQRANMS+RTFG +   RS SAD++EY
Sbjct  653  ALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTFGNEGAARSDSADAEEY  703



>ref|XP_009788969.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
Length=705

 Score =   283 bits (725),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 148/172 (86%), Gaps = 1/172 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD E NPHLSDSGLA LI D DQA N N+ SG GAPE AM GQ TIKSDVYSFGV 
Sbjct  534  ANILLDMELNPHLSDSGLAILIDDADQARNHNTGSGYGAPEGAMYGQCTIKSDVYSFGVV  593

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS RPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKS+SRFADVI
Sbjct  594  MLELLTGRKPFDSERPRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSISRFADVI  653

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  251
            ALCVQPEPEFRPPMSEVVEALVRLVQRANMS+RTF  D R+  G  D+Q+ +
Sbjct  654  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSKRTFSLD-RSSRGETDAQDNQ  704



>ref|XP_008465035.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X2 [Cucumis 
melo]
Length=722

 Score =   283 bits (725),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E NPHLSD GLAS I + DQAL+Q + SG  APEV MSGQYT+KSDVYSFGV 
Sbjct  549  ANILLDAEMNPHLSDCGLASFITNLDQALDQQTGSGYSAPEVTMSGQYTLKSDVYSFGVV  608

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADV+
Sbjct  609  MLELLSGRKPFDSSRPRAEQSLVRWATPQLHDIDALTKMVDPALKGLYPVKSLSRFADVV  668

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            ALCVQPEPEFRPPMSEVVEALVRLVQR+NMSRRTFG+D
Sbjct  669  ALCVQPEPEFRPPMSEVVEALVRLVQRSNMSRRTFGSD  706



>gb|EYU21256.1| hypothetical protein MIMGU_mgv1a002171mg [Erythranthe guttata]
Length=704

 Score =   283 bits (723),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 149/171 (87%), Gaps = 6/171 (4%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD E NPHLSD  LASL+ D DQA      SG  APEVAMSGQYTIKSDVYSFGV 
Sbjct  538  ANILLDIELNPHLSDCVLASLVRDPDQA------SGYSAPEVAMSGQYTIKSDVYSFGVV  591

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGRTPFDS+R R EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI
Sbjct  592  MLELLTGRTPFDSARQRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  651

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            ALCVQPEPEFRPPMSEVV+ALVRLVQRANMS+RTFG +   RS SAD++EY
Sbjct  652  ALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTFGNEGAARSDSADAEEY  702



>ref|XP_008465033.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Cucumis 
melo]
 ref|XP_008465034.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Cucumis 
melo]
Length=726

 Score =   283 bits (724),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E NPHLSD GLAS I + DQAL+Q + SG  APEV MSGQYT+KSDVYSFGV 
Sbjct  553  ANILLDAEMNPHLSDCGLASFITNLDQALDQQTGSGYSAPEVTMSGQYTLKSDVYSFGVV  612

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADV+
Sbjct  613  MLELLSGRKPFDSSRPRAEQSLVRWATPQLHDIDALTKMVDPALKGLYPVKSLSRFADVV  672

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            ALCVQPEPEFRPPMSEVVEALVRLVQR+NMSRRTFG+D
Sbjct  673  ALCVQPEPEFRPPMSEVVEALVRLVQRSNMSRRTFGSD  710



>ref|XP_004303773.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Fragaria vesca 
subsp. vesca]
Length=717

 Score =   283 bits (723),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 150/172 (87%), Gaps = 2/172 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            +N+LLD E NPHLSDSGLAS IP+ DQAL+ N+ SG  APEVAMSGQYT+KSDVYSFGV 
Sbjct  543  SNILLDVELNPHLSDSGLASSIPNADQALDHNAGSGYSAPEVAMSGQYTLKSDVYSFGVV  602

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLEL++GR PFDSS+ R EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI
Sbjct  603  MLELISGRKPFDSSKSRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  662

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQE  257
            ALCVQPEPEFRPPMSEVV+ALVRLVQRANMSRRT G D     R  S D+Q+
Sbjct  663  ALCVQPEPEFRPPMSEVVQALVRLVQRANMSRRTVGNDQGGSQRGDSTDAQD  714



>ref|NP_001241934.1| protein STRUBBELIG-RECEPTOR FAMILY 6-like [Glycine max]
 gb|ACM89564.1| leucine-rich repeat transmembrane protein kinase [Glycine max]
Length=603

 Score =   280 bits (715),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 150/171 (88%), Gaps = 1/171 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD++FNPHLSDSGLAS IP+ +Q LN N+ SG  APEV +SG YT+KSDVYSFGV 
Sbjct  429  ANILLDTDFNPHLSDSGLASYIPNANQVLNNNAGSGYEAPEVGLSGHYTLKSDVYSFGVV  488

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR PFDSSRPR EQ+LVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVI
Sbjct  489  MLELLSGRKPFDSSRPRSEQALVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVI  548

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD-SRTRSGSADSQE  257
            ALCVQPEPEFRPPMSEVV+ALVRLVQR NMS+RTFG D   +  G  D+Q+
Sbjct  549  ALCVQPEPEFRPPMSEVVQALVRLVQRTNMSKRTFGTDQGGSNRGGDDNQD  599



>ref|XP_004165988.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Cucumis 
sativus]
Length=726

 Score =   282 bits (721),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E NPHLSD GLAS I + D AL+Q + SG  APEV MSGQYT+KSDVYSFGV 
Sbjct  553  ANILLDAEMNPHLSDCGLASFITNLDHALDQQAGSGYSAPEVTMSGQYTLKSDVYSFGVV  612

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADV+
Sbjct  613  MLELLSGRKPFDSSRPRAEQSLVRWATPQLHDIDALTKMVDPALKGLYPVKSLSRFADVV  672

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            ALCVQPEPEFRPPMSEVVEALVRLVQR+NMSRRTFG+D
Sbjct  673  ALCVQPEPEFRPPMSEVVEALVRLVQRSNMSRRTFGSD  710



>ref|XP_004144448.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Cucumis 
sativus]
Length=726

 Score =   282 bits (721),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E NPHLSD GLAS I + D AL+Q + SG  APEV MSGQYT+KSDVYSFGV 
Sbjct  553  ANILLDAEMNPHLSDCGLASFITNLDHALDQQAGSGYSAPEVTMSGQYTLKSDVYSFGVV  612

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADV+
Sbjct  613  MLELLSGRKPFDSSRPRAEQSLVRWATPQLHDIDALTKMVDPALKGLYPVKSLSRFADVV  672

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            ALCVQPEPEFRPPMSEVVEALVRLVQR+NMSRRTFG+D
Sbjct  673  ALCVQPEPEFRPPMSEVVEALVRLVQRSNMSRRTFGSD  710



>ref|XP_011048642.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Populus euphratica]
Length=715

 Score =   281 bits (720),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 137/173 (79%), Positives = 149/173 (86%), Gaps = 2/173 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
             N+LLD+E NPHLSDSGLAS +P  DQ LNQN+ SG  APEVAMSG YT+KSDVYSFG  
Sbjct  541  VNILLDTELNPHLSDSGLASCLPHADQVLNQNAGSGYVAPEVAMSGHYTLKSDVYSFGAV  600

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDSSRPR EQSLVRWATPQLHDIDALSKMVDP LKGLYPVKSLSRFADVI
Sbjct  601  MLELLTGRKPFDSSRPRSEQSLVRWATPQLHDIDALSKMVDPELKGLYPVKSLSRFADVI  660

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADS--RTRSGSADSQEY  254
            ALCVQPEPEFRPPMSEVV+ALVRLVQRANMS+RT G +     R+ + D+Q+Y
Sbjct  661  ALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTIGNEQGETPRAVNPDTQDY  713



>ref|XP_010033635.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Eucalyptus 
grandis]
 gb|KCW53334.1| hypothetical protein EUGRSUZ_J02582 [Eucalyptus grandis]
Length=728

 Score =   281 bits (720),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E NPHLSD GLAS +P+ +Q LNQN  SG  APEVAMSGQYT+KSDVY FGV 
Sbjct  554  ANILLDAELNPHLSDCGLASYLPNAEQILNQNMGSGYSAPEVAMSGQYTLKSDVYGFGVV  613

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDSS+ R EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADVI
Sbjct  614  MLELLTGRQPFDSSKGRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVI  673

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  251
            ALCVQ EPEFRPPMSEVV+ALVRLVQRANMS+RTFG + R      D+  YE
Sbjct  674  ALCVQAEPEFRPPMSEVVQALVRLVQRANMSKRTFGNEHRASQKFDDADAYE  725



>ref|XP_006604929.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Glycine max]
Length=708

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E NPHLSDSGLAS IP+ DQ LN N  SG  APEVA+SGQYT+KSDVYSFGV 
Sbjct  534  ANILLDTELNPHLSDSGLASYIPNADQILNHNVGSGYDAPEVALSGQYTLKSDVYSFGVV  593

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDPA+KGLYPVKSLSRFADVI
Sbjct  594  MLELLSGRNPFDSSRPRSEQSLVRWATPQLHDIDALAKMVDPAMKGLYPVKSLSRFADVI  653

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGA  296
            ALCVQPEPEFRPPMSEVV+ALVRLVQRANMS+RTF +
Sbjct  654  ALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTFSS  690



>gb|KHN01483.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja]
Length=675

 Score =   280 bits (716),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 148/172 (86%), Gaps = 0/172 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD++FNPHLSDSGLAS IP+ +Q LN N+ SG  APEV +SG YT+KSDVYSFGV 
Sbjct  502  ANILLDTDFNPHLSDSGLASYIPNANQVLNNNAGSGYEAPEVGLSGHYTLKSDVYSFGVV  561

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR PFDSSRPR EQ+LVRWATPQLHDIDAL+KMVDP L+GLYPVKSLSRFADVI
Sbjct  562  MLELLSGRKPFDSSRPRSEQALVRWATPQLHDIDALAKMVDPTLEGLYPVKSLSRFADVI  621

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  251
            ALCVQPEPEFRPPMSEVV+ALVRLVQR NMS+RTFG D    +   D Q+ +
Sbjct  622  ALCVQPEPEFRPPMSEVVQALVRLVQRTNMSKRTFGTDQGGSNRGGDDQDTQ  673



>ref|XP_006604928.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Glycine max]
 gb|KHN11358.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja]
Length=721

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E NPHLSDSGLAS IP+ DQ LN N  SG  APEVA+SGQYT+KSDVYSFGV 
Sbjct  547  ANILLDTELNPHLSDSGLASYIPNADQILNHNVGSGYDAPEVALSGQYTLKSDVYSFGVV  606

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDPA+KGLYPVKSLSRFADVI
Sbjct  607  MLELLSGRNPFDSSRPRSEQSLVRWATPQLHDIDALAKMVDPAMKGLYPVKSLSRFADVI  666

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGA  296
            ALCVQPEPEFRPPMSEVV+ALVRLVQRANMS+RTF +
Sbjct  667  ALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTFSS  703



>ref|XP_006598761.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Glycine max]
 gb|KHN15854.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja]
Length=715

 Score =   281 bits (718),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 151/173 (87%), Gaps = 1/173 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD++FNPHLSDSGLAS IP+ +Q LN N+ SG  APEV +SG YT+KSDVYSFGV 
Sbjct  541  ANILLDTDFNPHLSDSGLASYIPNANQVLNNNAGSGYEAPEVGLSGHYTLKSDVYSFGVV  600

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR PFDSSRPR EQ+LVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVI
Sbjct  601  MLELLSGRKPFDSSRPRSEQALVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVI  660

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD-SRTRSGSADSQEYE  251
            ALCVQPEPEFRPPMSEVV+ALVRLVQR NMS+RTFG D   +  G  D+Q+ +
Sbjct  661  ALCVQPEPEFRPPMSEVVQALVRLVQRTNMSKRTFGTDQGGSNRGGDDNQDTQ  713



>gb|KHN16389.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja]
Length=722

 Score =   281 bits (718),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E NPHLSDSGLAS IP+ DQ LN N  SG  APEVA+SGQYT+KSDVYSFGV 
Sbjct  548  ANILLDTELNPHLSDSGLASYIPNADQILNHNVGSGYDAPEVALSGQYTLKSDVYSFGVV  607

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDPA+KGLYPVKSLSRFADVI
Sbjct  608  MLELLSGRKPFDSSRPRSEQSLVRWATPQLHDIDALAKMVDPAMKGLYPVKSLSRFADVI  667

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGA  296
            ALCVQPEPEFRPPMSEVV+ALVRLVQRANMS+RTF +
Sbjct  668  ALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTFSS  704



>ref|XP_006583189.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Glycine 
max]
Length=713

 Score =   280 bits (716),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 148/172 (86%), Gaps = 0/172 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD++FNPHLSDSGLAS IP+ +Q LN N+ SG  APEV +SG YT+KSDVYSFGV 
Sbjct  540  ANILLDTDFNPHLSDSGLASYIPNANQVLNNNAGSGYEAPEVGLSGHYTLKSDVYSFGVV  599

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR PFDSSRPR EQ+LVRWATPQLHDIDAL+KMVDP L+GLYPVKSLSRFADVI
Sbjct  600  MLELLSGRKPFDSSRPRSEQALVRWATPQLHDIDALAKMVDPTLEGLYPVKSLSRFADVI  659

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  251
            ALCVQPEPEFRPPMSEVV+ALVRLVQR NMS+RTFG D    +   D Q+ +
Sbjct  660  ALCVQPEPEFRPPMSEVVQALVRLVQRTNMSKRTFGTDQGGSNRGGDDQDTQ  711



>ref|XP_004510591.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Cicer arietinum]
Length=711

 Score =   280 bits (715),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 148/172 (86%), Gaps = 1/172 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD +FNPHLSDSGLAS IP+ +Q LN N+ SG  APEV +SGQYT KSDVYSFGV 
Sbjct  539  ANILLDVDFNPHLSDSGLASYIPNANQVLNNNAGSGYDAPEVGLSGQYTFKSDVYSFGVV  598

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR PFDSSR R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVI
Sbjct  599  MLELLSGRKPFDSSRSRFEQSLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVI  658

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  251
            ALCVQPEPEFRPPMSEVV+ALVRLVQR NMS+RTFG D +  S   D QE +
Sbjct  659  ALCVQPEPEFRPPMSEVVQALVRLVQRTNMSKRTFGTD-QGGSNRGDDQETQ  709



>emb|CBI35784.3| unnamed protein product [Vitis vinifera]
Length=708

 Score =   279 bits (713),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 150/173 (87%), Gaps = 2/173 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E NPHL+D GLAS IP+ DQ LN N+ SG  APEVAMSGQYT+KSDVYSFGV 
Sbjct  534  ANILLDTELNPHLTDCGLASFIPNADQVLNHNAGSGYSAPEVAMSGQYTLKSDVYSFGVV  593

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR PFDSSR R EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADVI
Sbjct  594  MLELLSGRKPFDSSRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVI  653

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQEY  254
            ALCVQPEPEFRPPMSEVV+ALVRLVQRANMS+RT   +  +  R  + D+Q++
Sbjct  654  ALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTISNEQGASPRGDNPDTQDH  706



>ref|XP_007139053.1| hypothetical protein PHAVU_009G260900g [Phaseolus vulgaris]
 gb|ESW11047.1| hypothetical protein PHAVU_009G260900g [Phaseolus vulgaris]
Length=720

 Score =   279 bits (713),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E NPHLSDSGLAS IP+ DQ L+ N  SG  APEVA+SGQYT++SDVYSFGV 
Sbjct  546  ANILLDAELNPHLSDSGLASYIPNADQILSHNVGSGYDAPEVALSGQYTLQSDVYSFGVV  605

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR PFDSSRPR EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI
Sbjct  606  MLELLSGRKPFDSSRPRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  665

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGA  296
            ALCVQPEPEFRPPMSEVV+ALVRLVQRANMS+RTF +
Sbjct  666  ALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTFSS  702



>ref|XP_010654359.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Vitis vinifera]
Length=714

 Score =   279 bits (713),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 150/173 (87%), Gaps = 2/173 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E NPHL+D GLAS IP+ DQ LN N+ SG  APEVAMSGQYT+KSDVYSFGV 
Sbjct  540  ANILLDTELNPHLTDCGLASFIPNADQVLNHNAGSGYSAPEVAMSGQYTLKSDVYSFGVV  599

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR PFDSSR R EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADVI
Sbjct  600  MLELLSGRKPFDSSRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVI  659

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQEY  254
            ALCVQPEPEFRPPMSEVV+ALVRLVQRANMS+RT   +  +  R  + D+Q++
Sbjct  660  ALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTISNEQGASPRGDNPDTQDH  712



>gb|ADM07445.1| leucine-rich repeat receptor-like protein kinase [Glycine soja]
Length=714

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 150/173 (87%), Gaps = 1/173 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD++FNPHLSDSGLAS IP+ +Q LN N+ SG  APEV +SG YT+KSDVYSFGV 
Sbjct  540  ANILLDTDFNPHLSDSGLASYIPNANQVLNNNAGSGYEAPEVGLSGHYTLKSDVYSFGVV  599

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR PFDSSRPR EQ+LVRWA PQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVI
Sbjct  600  MLELLSGRKPFDSSRPRSEQALVRWAAPQLHDIDALAKMVDPALEGLYPVKSLSRFADVI  659

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD-SRTRSGSADSQEYE  251
            ALCVQPEPEFRPPMSEVV+ALVRLVQR NMS+RTFG D   +  G  D+Q+ +
Sbjct  660  ALCVQPEPEFRPPMSEVVQALVRLVQRTNMSKRTFGTDQGGSNRGGDDNQDTQ  712



>ref|XP_007135353.1| hypothetical protein PHAVU_010G122100g [Phaseolus vulgaris]
 gb|ESW07347.1| hypothetical protein PHAVU_010G122100g [Phaseolus vulgaris]
Length=718

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 148/171 (87%), Gaps = 1/171 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD++ NPHLSDSGLAS IP+ +Q LN NS SG  APEV MSGQYT+KSDV+SFGV 
Sbjct  544  ANILLDTDLNPHLSDSGLASYIPNANQVLNNNSGSGYEAPEVGMSGQYTLKSDVFSFGVI  603

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR PFDSSRPR EQ LVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVI
Sbjct  604  MLELLSGRKPFDSSRPRSEQGLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVI  663

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR-TFGADSRTRSGSADSQE  257
            ALCVQPEPEFRPPMSEVV+ALVRLVQR NMS+R TFG D    +   D+QE
Sbjct  664  ALCVQPEPEFRPPMSEVVQALVRLVQRTNMSKRTTFGTDQGGSNRGGDNQE  714



>ref|XP_011072711.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Sesamum indicum]
Length=712

 Score =   278 bits (711),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 151/171 (88%), Gaps = 7/171 (4%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD E NPHLSD GLA+L+ + DQA      SG  APEVAMSGQYTIKSD+YSFGV 
Sbjct  547  ANILLDMELNPHLSDCGLANLVREPDQA------SGYSAPEVAMSGQYTIKSDLYSFGVV  600

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDSSRPR EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI
Sbjct  601  MLELLTGRKPFDSSRPRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  660

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            ALCVQPEPEFRPPMSEVV+ALVRLVQRANMS+RTFG ++ +R+ SAD ++Y
Sbjct  661  ALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTFGNEA-SRAESADGEDY  710



>ref|XP_008462233.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X3 [Cucumis melo]
Length=655

 Score =   277 bits (708),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E +PHLSDSGL S IP+ DQAL+ + +SG  APEV MSGQYT+KSDVYSFGV 
Sbjct  483  ANILLDAELSPHLSDSGLESFIPNTDQALDGSGSSGYTAPEVTMSGQYTLKSDVYSFGVV  542

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDP LKGLYPVKSLSRFADVI
Sbjct  543  MLELLTGRKPFDSSRPRSEQSLVRWATPQLHDIDALTKMVDPELKGLYPVKSLSRFADVI  602

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRT  284
            ALCVQ EPEFRPPMSEVVEALVRLVQRANMS+RT+G+D+ T
Sbjct  603  ALCVQTEPEFRPPMSEVVEALVRLVQRANMSKRTYGSDNAT  643



>ref|XP_008783430.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X2 [Phoenix 
dactylifera]
Length=700

 Score =   278 bits (711),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 151/175 (86%), Gaps = 4/175 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLD+E NPHLSD GLA+LIPD E QA +QN +SG GAPEVAMSGQYT+KSDVYSFGV
Sbjct  525  SNILLDTELNPHLSDCGLANLIPDAEFQASDQNMSSGYGAPEVAMSGQYTLKSDVYSFGV  584

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDSSR R EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV
Sbjct  585  VMLELLTGRMPFDSSRSRTEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADV  644

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD---SRTRSGSADSQEY  254
            IALCVQPEPEFRPPMSEVV+ALVRLVQRANMS+R  G D   +  RS   D+Q+Y
Sbjct  645  IALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRMLGGDMQETARRSDDPDTQDY  699



>ref|XP_008783422.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Phoenix 
dactylifera]
Length=724

 Score =   278 bits (711),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 151/175 (86%), Gaps = 4/175 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLD+E NPHLSD GLA+LIPD E QA +QN +SG GAPEVAMSGQYT+KSDVYSFGV
Sbjct  549  SNILLDTELNPHLSDCGLANLIPDAEFQASDQNMSSGYGAPEVAMSGQYTLKSDVYSFGV  608

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDSSR R EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV
Sbjct  609  VMLELLTGRMPFDSSRSRTEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADV  668

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD---SRTRSGSADSQEY  254
            IALCVQPEPEFRPPMSEVV+ALVRLVQRANMS+R  G D   +  RS   D+Q+Y
Sbjct  669  IALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRMLGGDMQETARRSDDPDTQDY  723



>ref|XP_004141737.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Cucumis 
sativus]
Length=621

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E +PHLSDSGL S IP+ DQA++ + +SG  APEV MSGQYT+KSDVYSFGV 
Sbjct  449  ANILLDAELSPHLSDSGLESFIPNADQAMDGSGSSGYTAPEVTMSGQYTLKSDVYSFGVV  508

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDP LKGLYPVKS+SRFADVI
Sbjct  509  MLELLTGRKPFDSSRPRSEQSLVRWATPQLHDIDALTKMVDPELKGLYPVKSISRFADVI  568

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRT  284
            ALCVQ EPEFRPPMSEVVEALVRLVQRANMS+RT+G D+ T
Sbjct  569  ALCVQTEPEFRPPMSEVVEALVRLVQRANMSKRTYGNDNAT  609



>gb|AFW90526.1| strubbelig-receptor family 6-like protein [Phaseolus vulgaris]
Length=662

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E NPHLSDSGLAS IP+ DQ L+ N  SG  APEVA+SGQYT++SDVYSFGV 
Sbjct  488  ANILLDAELNPHLSDSGLASYIPNADQILSHNVGSGYDAPEVALSGQYTLQSDVYSFGVV  547

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR PFDSSRPR EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI
Sbjct  548  MLELLSGRKPFDSSRPRFEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  607

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGA  296
            ALCVQPEPEFRPPMSEVV+ALVRLVQRANMS+RTF +
Sbjct  608  ALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTFSS  644



>ref|XP_008462232.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X2 [Cucumis melo]
Length=692

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E +PHLSDSGL S IP+ DQAL+ + +SG  APEV MSGQYT+KSDVYSFGV 
Sbjct  520  ANILLDAELSPHLSDSGLESFIPNTDQALDGSGSSGYTAPEVTMSGQYTLKSDVYSFGVV  579

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDP LKGLYPVKSLSRFADVI
Sbjct  580  MLELLTGRKPFDSSRPRSEQSLVRWATPQLHDIDALTKMVDPELKGLYPVKSLSRFADVI  639

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRT  284
            ALCVQ EPEFRPPMSEVVEALVRLVQRANMS+RT+G+D+ T
Sbjct  640  ALCVQTEPEFRPPMSEVVEALVRLVQRANMSKRTYGSDNAT  680



>ref|XP_008462231.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X1 [Cucumis melo]
Length=716

 Score =   278 bits (710),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E +PHLSDSGL S IP+ DQAL+ + +SG  APEV MSGQYT+KSDVYSFGV 
Sbjct  544  ANILLDAELSPHLSDSGLESFIPNTDQALDGSGSSGYTAPEVTMSGQYTLKSDVYSFGVV  603

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDP LKGLYPVKSLSRFADVI
Sbjct  604  MLELLTGRKPFDSSRPRSEQSLVRWATPQLHDIDALTKMVDPELKGLYPVKSLSRFADVI  663

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRT  284
            ALCVQ EPEFRPPMSEVVEALVRLVQRANMS+RT+G+D+ T
Sbjct  664  ALCVQTEPEFRPPMSEVVEALVRLVQRANMSKRTYGSDNAT  704



>gb|KEH18524.1| strubbelig-receptor family 6 protein [Medicago truncatula]
Length=685

 Score =   277 bits (708),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD++ NPHLSDSGLAS IP+ +Q LN NS SG  APEV ++GQYT+KSDVYSFGV 
Sbjct  512  ANILLDADLNPHLSDSGLASYIPNTNQVLNNNSGSGYDAPEVGLTGQYTLKSDVYSFGVV  571

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR PFDSSR R EQSLVRWATPQLHDIDAL+KMVDPAL+G+YPVKSLSRFADVI
Sbjct  572  MLELLSGRKPFDSSRSRFEQSLVRWATPQLHDIDALAKMVDPALEGMYPVKSLSRFADVI  631

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQE  257
            ALCVQ EPEFRPPMSEVV+ALVRLVQR NMS+RTFGAD    +   D Q+
Sbjct  632  ALCVQSEPEFRPPMSEVVQALVRLVQRTNMSKRTFGADQGGSNRGGDDQD  681



>gb|KHG25534.1| protein strubbelig-receptor family 6 [Gossypium arboreum]
Length=724

 Score =   277 bits (709),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 148/172 (86%), Gaps = 6/172 (3%)
 Frame = -1

Query  763  NVLLDSEFNPHLSDSGLASLIPDEDQALNQN--SASG*GAPEVAMSGQYTIKSDVYSFGV  590
            N+LLD+E NPHLSDSGLA+  P+ DQ LN +  + SG GAPEV MSGQY++KSDVYSFGV
Sbjct  546  NILLDAELNPHLSDSGLATFFPNADQVLNHDDVTMSGYGAPEVTMSGQYSLKSDVYSFGV  605

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDS+RPR EQSLVRWATPQLHDIDALSKMVDPAL+GLYPVKSLSRFADV
Sbjct  606  VMLELLTGRKPFDSTRPRLEQSLVRWATPQLHDIDALSKMVDPALEGLYPVKSLSRFADV  665

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD----SRTRSGSAD  266
            IALCVQPEPEFRPPMSEVVEALVRLVQRANMS+RT G D     RT +  AD
Sbjct  666  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSKRTIGTDQGASQRTDNAVAD  717



>ref|XP_003627481.1| Protein STRUBBELIG-RECEPTOR FAMILY [Medicago truncatula]
 gb|AET01957.1| strubbelig-receptor family 6 protein [Medicago truncatula]
Length=716

 Score =   276 bits (707),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD++ NPHLSDSGLAS IP+ +Q LN NS SG  APEV ++GQYT+KSDVYSFGV 
Sbjct  543  ANILLDADLNPHLSDSGLASYIPNTNQVLNNNSGSGYDAPEVGLTGQYTLKSDVYSFGVV  602

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR PFDSSR R EQSLVRWATPQLHDIDAL+KMVDPAL+G+YPVKSLSRFADVI
Sbjct  603  MLELLSGRKPFDSSRSRFEQSLVRWATPQLHDIDALAKMVDPALEGMYPVKSLSRFADVI  662

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQE  257
            ALCVQ EPEFRPPMSEVV+ALVRLVQR NMS+RTFGAD    +   D Q+
Sbjct  663  ALCVQSEPEFRPPMSEVVQALVRLVQRTNMSKRTFGADQGGSNRGGDDQD  712



>ref|XP_007024796.1| Strubbelig-receptor family 6 [Theobroma cacao]
 gb|EOY27418.1| Strubbelig-receptor family 6 [Theobroma cacao]
Length=721

 Score =   276 bits (707),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 144/159 (91%), Gaps = 1/159 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNS-ASG*GAPEVAMSGQYTIKSDVYSFGV  590
            AN+LLD+E NPHLSDSGLA+ IPD DQ LN++   SG  APEVAMSG Y++KSDVYSFGV
Sbjct  545  ANILLDAELNPHLSDSGLATFIPDADQVLNRDDVGSGYSAPEVAMSGLYSLKSDVYSFGV  604

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDS+RPR EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV
Sbjct  605  VMLELLTGRKPFDSTRPRLEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  664

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            IALCVQPEPEFRPPMSEVV+ALVRLVQRANMS+RT G D
Sbjct  665  IALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTIGTD  703



>ref|XP_002304260.2| hypothetical protein POPTR_0003s07130g [Populus trichocarpa]
 gb|EEE79239.2| hypothetical protein POPTR_0003s07130g [Populus trichocarpa]
Length=716

 Score =   276 bits (706),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 149/173 (86%), Gaps = 2/173 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E NPHLSD+GLAS + + DQ LN N+ SG  APEVAMSG YT+KSDVYSFG  
Sbjct  542  ANILLDTELNPHLSDAGLASSLHNADQVLNYNAGSGYSAPEVAMSGHYTLKSDVYSFGAV  601

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDSSRPR EQSLVRWATPQLHDID+LSKMVDP LKGLYPVKSLSRFADVI
Sbjct  602  MLELLTGRKPFDSSRPRSEQSLVRWATPQLHDIDSLSKMVDPELKGLYPVKSLSRFADVI  661

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRT--RSGSADSQEY  254
            ALCVQPEPEFRPPMSEVV+ALVRLVQRANMS+RT G +     R+ + D+Q+Y
Sbjct  662  ALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTIGNEQGETPRADNPDTQDY  714



>ref|XP_008380807.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Malus domestica]
Length=740

 Score =   276 bits (707),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 148/172 (86%), Gaps = 2/172 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
             N+LLD E NPHLSD+GLAS IP+ DQAL+ N+ SG  APEVAMSGQYT+KSDVY FGV 
Sbjct  566  TNILLDVELNPHLSDAGLASSIPNADQALDHNAGSGYSAPEVAMSGQYTLKSDVYGFGVV  625

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR  FD+ +PR EQSLVRWATPQLHDIDALSKMVDP LKGLYPVKSLSRFADVI
Sbjct  626  MLELLSGRKAFDNLKPRSEQSLVRWATPQLHDIDALSKMVDPELKGLYPVKSLSRFADVI  685

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQE  257
            ALCVQPEPEFRPPMSEVV+ALVRLVQRANMSRRT G D  S    G+AD+Q+
Sbjct  686  ALCVQPEPEFRPPMSEVVQALVRLVQRANMSRRTVGNDQGSSHGGGNADAQD  737



>ref|XP_004159012.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Cucumis 
sativus]
Length=715

 Score =   275 bits (704),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E +PHLSDSGL S IP+ DQA++ + +SG  APEV MSGQYT+KSDVYSFGV 
Sbjct  543  ANILLDAELSPHLSDSGLESFIPNADQAMDGSGSSGYTAPEVTMSGQYTLKSDVYSFGVV  602

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDP LKGLYPVKS+SRFADVI
Sbjct  603  MLELLTGRKPFDSSRPRSEQSLVRWATPQLHDIDALTKMVDPELKGLYPVKSISRFADVI  662

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRT  284
            ALCVQ EPEFRPPMSEVVEALVRLVQRANMS+RT+G D+ T
Sbjct  663  ALCVQTEPEFRPPMSEVVEALVRLVQRANMSKRTYGNDNAT  703



>gb|KGN45433.1| hypothetical protein Csa_7G447950 [Cucumis sativus]
Length=715

 Score =   275 bits (703),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E +PHLSDSGL S IP+ DQA++ + +SG  APEV MSGQYT+KSDVYSFGV 
Sbjct  543  ANILLDAELSPHLSDSGLESFIPNADQAMDGSGSSGYTAPEVTMSGQYTLKSDVYSFGVV  602

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDP LKGLYPVKS+SRFADVI
Sbjct  603  MLELLTGRKPFDSSRPRSEQSLVRWATPQLHDIDALTKMVDPELKGLYPVKSISRFADVI  662

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRT  284
            ALCVQ EPEFRPPMSEVVEALVRLVQRANMS+RT+G D+ T
Sbjct  663  ALCVQTEPEFRPPMSEVVEALVRLVQRANMSKRTYGNDNAT  703



>ref|XP_011031832.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Populus 
euphratica]
Length=716

 Score =   275 bits (703),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 149/173 (86%), Gaps = 2/173 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E NPHLSD+GLAS + + DQ LN N+ SG  APEVAMSG YT+KSDVYSFGV 
Sbjct  542  ANILLDTELNPHLSDAGLASSLHNADQVLNYNAGSGYSAPEVAMSGHYTLKSDVYSFGVV  601

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDSSRPR EQSLVRWATPQLHDID+LSKMVDP LKGLYPVKSLSRFADVI
Sbjct  602  MLELLTGRKPFDSSRPRSEQSLVRWATPQLHDIDSLSKMVDPELKGLYPVKSLSRFADVI  661

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRT--RSGSADSQEY  254
            ALCVQPEPEFRPPMSEVV+AL RLVQRANMS+RT G +     ++ + D+Q+Y
Sbjct  662  ALCVQPEPEFRPPMSEVVQALFRLVQRANMSKRTIGNEQGETPKADNPDTQDY  714



>ref|XP_004494892.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Cicer arietinum]
Length=722

 Score =   275 bits (703),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
             N+LLD+E NPHLSD GLAS +P+ +Q LN N  SG  APEVA+SGQYT KSDVYSFGV 
Sbjct  549  GNILLDAELNPHLSDCGLASYVPNAEQILNHNVGSGYDAPEVALSGQYTFKSDVYSFGVV  608

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR PFDSSR R EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADVI
Sbjct  609  MLELLSGRKPFDSSRLRAEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVI  668

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            ALCVQ EPEFRPPMSEVV+A+VRLVQRANMSRRTFG+D
Sbjct  669  ALCVQSEPEFRPPMSEVVQAMVRLVQRANMSRRTFGSD  706



>gb|KHG18134.1| protein strubbelig-receptor family 6 [Gossypium arboreum]
Length=721

 Score =   275 bits (702),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 143/159 (90%), Gaps = 1/159 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNS-ASG*GAPEVAMSGQYTIKSDVYSFGV  590
            AN+LLD+E NPHLSDSGLA+ IP+ D+ LN++   SG  APEV MSGQY++KSDVY FGV
Sbjct  545  ANILLDAELNPHLSDSGLATFIPNADEVLNRDDVGSGYSAPEVTMSGQYSLKSDVYGFGV  604

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDS+RPR EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV
Sbjct  605  VMLELLTGRKPFDSTRPRLEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  664

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            IALCVQPEPEFRPPMSEVVEALVRLVQRANMS+RT G D
Sbjct  665  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSKRTTGTD  703



>gb|ADB93024.1| leucine-rich repeat receptor-like protein kinase [Dendrobium 
nobile]
Length=255

 Score =   260 bits (665),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 144/175 (82%), Gaps = 4/175 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            AN+L+D+E NPHLSD GLA LIP+ E Q  + N +SG  APEV+MSGQYT+KSDVYSFGV
Sbjct  76   ANILMDAELNPHLSDCGLACLIPNAEYQGAHHNLSSGYSAPEVSMSGQYTLKSDVYSFGV  135

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDS+RPR EQ LVRWATPQLHDIDAL KMVDP L+GLYP KSLSRFADV
Sbjct  136  VMLELLTGRKPFDSARPRSEQYLVRWATPQLHDIDALDKMVDPQLQGLYPAKSLSRFADV  195

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGA---DSRTRSGSADSQEY  254
            IALCVQPEPEFRPPMSEVV+ALVRLVQRA M+++       D+  R+   D+Q+Y
Sbjct  196  IALCVQPEPEFRPPMSEVVQALVRLVQRAKMNKKVLAGDVQDANRRADDRDAQDY  250



>gb|KJB70030.1| hypothetical protein B456_011G054100 [Gossypium raimondii]
Length=709

 Score =   273 bits (697),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 148/170 (87%), Gaps = 3/170 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNS-ASG*GAPEVAMSGQYTIKSDVYSFGV  590
            AN+LLD+E NPHLSDSGLA+ IP+ D+ LN++   SG  APEV MSGQY++KSDVY FGV
Sbjct  533  ANILLDAELNPHLSDSGLATFIPNADEVLNRDDVGSGYSAPEVTMSGQYSLKSDVYGFGV  592

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDS+R R EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV
Sbjct  593  VMLELLTGRKPFDSTRHRLEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  652

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSAD  266
            IALCVQPEPEFRPPMSEVVEALVRLVQRANMS+RT G D  +  R+G+ D
Sbjct  653  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSKRTTGTDQGASPRTGNPD  702



>gb|KHG12210.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Gossypium arboreum]
Length=689

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 148/173 (86%), Gaps = 3/173 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNS-ASG*GAPEVAMSGQYTIKSDVYSFGV  590
            AN+LLD+E NPHLSDSGLA+ IP+ DQ LN++   SG  APEV MS QY++KSDVYSFGV
Sbjct  513  ANILLDAELNPHLSDSGLATFIPNADQLLNRDDVGSGYCAPEVTMSSQYSLKSDVYSFGV  572

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDS+RPR EQSLVRWATPQLHDIDALSKMVDPALKGLYP+KSLSRFADV
Sbjct  573  VMLELLTGRKPFDSTRPRLEQSLVRWATPQLHDIDALSKMVDPALKGLYPIKSLSRFADV  632

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQE  257
            IALCVQ EPEFRPPMSEVV+ALVRLVQRANMS+RT G D  +  R+ + D Q 
Sbjct  633  IALCVQSEPEFRPPMSEVVQALVRLVQRANMSKRTIGTDQGASPRTNNTDEQH  685



>gb|KJB57112.1| hypothetical protein B456_009G148500 [Gossypium raimondii]
 gb|KJB57113.1| hypothetical protein B456_009G148500 [Gossypium raimondii]
Length=728

 Score =   272 bits (696),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 148/173 (86%), Gaps = 3/173 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNS-ASG*GAPEVAMSGQYTIKSDVYSFGV  590
            AN+LLD+E NPHLSDSGLA+ IP+ DQ LN++   SG  APEV MS QY++KSDVYSFGV
Sbjct  552  ANILLDAELNPHLSDSGLATFIPNADQLLNRDDMGSGYCAPEVTMSSQYSLKSDVYSFGV  611

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDS+RPR EQSLVRWATPQLHDIDALSKMVDPALKGLYP+KSLSRFADV
Sbjct  612  VMLELLTGRKPFDSTRPRLEQSLVRWATPQLHDIDALSKMVDPALKGLYPIKSLSRFADV  671

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQE  257
            IALCVQ EPEFRPPMSEVV+ALVRLVQRANMS+RT G D  +  R+ + D Q 
Sbjct  672  IALCVQSEPEFRPPMSEVVQALVRLVQRANMSKRTIGTDQGASPRTNNTDEQH  724



>gb|KHG12209.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Gossypium arboreum]
Length=728

 Score =   272 bits (695),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 148/173 (86%), Gaps = 3/173 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNS-ASG*GAPEVAMSGQYTIKSDVYSFGV  590
            AN+LLD+E NPHLSDSGLA+ IP+ DQ LN++   SG  APEV MS QY++KSDVYSFGV
Sbjct  552  ANILLDAELNPHLSDSGLATFIPNADQLLNRDDVGSGYCAPEVTMSSQYSLKSDVYSFGV  611

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDS+RPR EQSLVRWATPQLHDIDALSKMVDPALKGLYP+KSLSRFADV
Sbjct  612  VMLELLTGRKPFDSTRPRLEQSLVRWATPQLHDIDALSKMVDPALKGLYPIKSLSRFADV  671

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQE  257
            IALCVQ EPEFRPPMSEVV+ALVRLVQRANMS+RT G D  +  R+ + D Q 
Sbjct  672  IALCVQSEPEFRPPMSEVVQALVRLVQRANMSKRTIGTDQGASPRTNNTDEQH  724



>ref|XP_010273793.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Nelumbo nucifera]
Length=725

 Score =   271 bits (694),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 145/175 (83%), Gaps = 3/175 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
             N+LLD E NPHLSD GLAS I + DQALN N+ SG  APEVAMSGQYT+KSDVYSFGV 
Sbjct  552  VNILLDIELNPHLSDCGLASFI-NADQALNHNAGSGYDAPEVAMSGQYTLKSDVYSFGVV  610

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDSSR R EQSLVRWATPQLHDIDAL KMVDPALKGLYP KSLSRFAD+I
Sbjct  611  MLELLTGRKPFDSSRQRSEQSLVRWATPQLHDIDALDKMVDPALKGLYPAKSLSRFADII  670

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQEYEL  248
            ALCVQPEPEFRPPMSEVV+ALVRLVQRANMS+RT G +     R+   D Q+Y  
Sbjct  671  ALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTTGDEQGGSRRADEPDVQDYTF  725



>gb|KEH24658.1| strubbelig-receptor family protein [Medicago truncatula]
Length=723

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 141/160 (88%), Gaps = 2/160 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E NPHLSD GLAS IP+ +Q LN N  SG  APEVA+SGQYT KSD+YSFGV 
Sbjct  548  ANILLDAELNPHLSDCGLASYIPNAEQILNHNVGSGYDAPEVALSGQYTFKSDIYSFGVV  607

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR PFDSSR R EQSLVRWATPQLHDIDAL+KMVDP LKGLYPVKSLSRFADVI
Sbjct  608  MLELLSGRRPFDSSRARQEQSLVRWATPQLHDIDALAKMVDPTLKGLYPVKSLSRFADVI  667

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR--TFGAD  293
            ALCVQPEPEFRP MSEVV+ALVRLVQRANMSRR  TFG+D
Sbjct  668  ALCVQPEPEFRPQMSEVVQALVRLVQRANMSRRTFTFGSD  707



>ref|XP_010542346.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Tarenaya hassleriana]
Length=716

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 151/172 (88%), Gaps = 1/172 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN-SASG*GAPEVAMSGQYTIKSDVYSFGV  590
            AN+LLDSE NPHLSDSGLAS +P  D+ LNQN   SG  APEV+MSGQY+++SDVYSFGV
Sbjct  544  ANILLDSELNPHLSDSGLASFLPTADEVLNQNDEGSGYSAPEVSMSGQYSMQSDVYSFGV  603

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDS+RPR EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV
Sbjct  604  VMLELLTGRKPFDSARPRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  663

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            IALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT G D   RSGS ++ +Y
Sbjct  664  IALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTIGVDQSQRSGSNEANDY  715



>ref|XP_010939842.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Elaeis guineensis]
Length=664

 Score =   267 bits (683),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLD E NPHLSD GLA+LIPD E QAL+QN  SG  +PEV MSGQYT+KSDVYSFGV
Sbjct  502  SNILLDMELNPHLSDCGLANLIPDAEFQALDQNMGSGYTSPEVTMSGQYTLKSDVYSFGV  561

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFD SR R EQSLV+WATPQLHDIDAL +MVDPALKGLYP KSLSRFADV
Sbjct  562  VMLELLTGRKPFDDSRLRAEQSLVQWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADV  621

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSR  287
            IALCVQPEPEFRPPMSEVV+ALVRLVQRANMS+R  G D++
Sbjct  622  IALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRMLGGDTQ  662



>emb|CAN80221.1| hypothetical protein VITISV_027894 [Vitis vinifera]
Length=672

 Score =   267 bits (683),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 150/194 (77%), Gaps = 23/194 (12%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD+E NPHL+D GLAS IP+ DQ LN N+ SG  APEVAMSGQYT+KSDVYSFGV 
Sbjct  477  ANILLDTELNPHLTDCGLASFIPNADQVLNHNAGSGYSAPEVAMSGQYTLKSDVYSFGVV  536

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GR PFDSSR R EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADVI
Sbjct  537  MLELLSGRKPFDSSRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVI  596

Query  406  ALCVQ---------------------PEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD-  293
            ALCVQ                     PEPEFRPPMSEVV+ALVRLVQRANMS+RT   + 
Sbjct  597  ALCVQVRCLVKVKSADGFIILFQLLMPEPEFRPPMSEVVQALVRLVQRANMSKRTISNEQ  656

Query  292  -SRTRSGSADSQEY  254
             +  R  + D+Q++
Sbjct  657  GASPRGDNPDTQDH  670



>ref|XP_010939841.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Elaeis guineensis]
Length=699

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLD E NPHLSD GLA+LIPD E QAL+QN  SG  +PEV MSGQYT+KSDVYSFGV
Sbjct  537  SNILLDMELNPHLSDCGLANLIPDAEFQALDQNMGSGYTSPEVTMSGQYTLKSDVYSFGV  596

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFD SR R EQSLV+WATPQLHDIDAL +MVDPALKGLYP KSLSRFADV
Sbjct  597  VMLELLTGRKPFDDSRLRAEQSLVQWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADV  656

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSR  287
            IALCVQPEPEFRPPMSEVV+ALVRLVQRANMS+R  G D++
Sbjct  657  IALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRMLGGDTQ  697



>ref|XP_008800485.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Phoenix 
dactylifera]
Length=725

 Score =   266 bits (681),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLD E NP+LSD GLA+LIPD E QAL+ N  SG  APEVAMSGQYT+KSDVYSFGV
Sbjct  549  SNILLDMELNPYLSDCGLANLIPDAEFQALDLNMGSGYSAPEVAMSGQYTLKSDVYSFGV  608

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTG  PFDSSR R EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV
Sbjct  609  VMLELLTGWKPFDSSRLRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADV  668

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSAD  266
            IALCVQPEPEFRPPMSEVV+ALVRLVQRANMS+R  G D++  +  AD
Sbjct  669  IALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRMLGRDTQETARRAD  716



>ref|XP_010685195.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Beta vulgaris 
subsp. vulgaris]
Length=707

 Score =   265 bits (678),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 147/169 (87%), Gaps = 5/169 (3%)
 Frame = -1

Query  763  NVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVAM  584
            N+LLD+E NPHLSD GLASL P+ +QA+N N+     APEVA SGQYT+KSDVYSFGV M
Sbjct  541  NILLDTELNPHLSDCGLASLHPNGNQAINHNAC----APEVADSGQYTLKSDVYSFGVVM  596

Query  583  LELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIA  404
            LELL+GR PFDSS PR EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVIA
Sbjct  597  LELLSGRKPFDSSFPRAEQSLVRWATPQLHDIDALTKMVDPALEGLYPVKSLSRFADVIA  656

Query  403  LCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQE  257
            LCVQPEPEFRPPMSEVV+ALVRLVQRANMS+RT G  +R +S S D+ +
Sbjct  657  LCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTVGNAAR-QSESMDAND  704



>ref|XP_006836581.1| hypothetical protein AMTR_s00131p00083660 [Amborella trichopoda]
 gb|ERM99434.1| hypothetical protein AMTR_s00131p00083660 [Amborella trichopoda]
Length=721

 Score =   264 bits (675),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 146/176 (83%), Gaps = 3/176 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDED-QALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            AN+LLD+EFNPHLSD GL   + + D +A NQN  SG  APEVAMSG YT+KSDVYSFGV
Sbjct  546  ANILLDNEFNPHLSDCGLGDFVANPDSEASNQNQGSGYSAPEVAMSGVYTMKSDVYSFGV  605

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
            AMLELLTGR PFDSS+ R EQSLVRWATPQLHDIDALSKMVDP LK LYPVKSLSRFADV
Sbjct  606  AMLELLTGRKPFDSSKARSEQSLVRWATPQLHDIDALSKMVDPGLKELYPVKSLSRFADV  665

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRT--RSGSADSQEYEL  248
            +ALCVQPEPEFRPPMSEVV+ALVRLVQRA+MS+RT   DS    ++   D+ EY L
Sbjct  666  VALCVQPEPEFRPPMSEVVQALVRLVQRASMSKRTNSEDSGASRKAEEHDNHEYSL  721



>ref|XP_009777356.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X3 [Nicotiana sylvestris]
Length=611

 Score =   262 bits (669),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  763  NVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVAM  584
            N+LLD++ NPHLSDSGLA+L+ D DQ LN N+ SG GAPE A+SG+ T KSDVYSFGV M
Sbjct  453  NILLDTDLNPHLSDSGLANLVADVDQGLNHNTESGYGAPEAAISGKCTAKSDVYSFGVVM  512

Query  583  LELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIA  404
            LEL +GR PFDSSRPR EQSLVRWATPQLHDIDAL ++VDPAL GLY VKSLSRFADVIA
Sbjct  513  LELFSGRKPFDSSRPRSEQSLVRWATPQLHDIDALEQIVDPALDGLYSVKSLSRFADVIA  572

Query  403  LCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            LCVQPEPEFRPPMSEVV+ALVRLVQRAN+S+R  G D
Sbjct  573  LCVQPEPEFRPPMSEVVQALVRLVQRANLSKRLHGID  609



>ref|XP_009386772.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Musa acuminata 
subsp. malaccensis]
Length=731

 Score =   264 bits (674),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLD + NPHLSD GL SL+PD E QA +QN ASG   PEV+MSGQYT+KSDVY+FG+
Sbjct  547  SNILLDVDLNPHLSDCGLESLVPDAEFQASDQNMASGYDPPEVSMSGQYTLKSDVYNFGI  606

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDSSRPRPEQSLV+WATPQLHDIDAL +MVDP LKGLYP KSLSRFADV
Sbjct  607  VMLELLTGRKPFDSSRPRPEQSLVQWATPQLHDIDALDRMVDPVLKGLYPAKSLSRFADV  666

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRS  278
            IALCVQPEPEFRPPMSEVV+ALVRLVQRANMS+R  G + +  S
Sbjct  667  IALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRMVGGEMQETS  710



>ref|XP_006649512.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Oryza brachyantha]
Length=717

 Score =   263 bits (672),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 142/167 (85%), Gaps = 1/167 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            +N+LLDSEFNPHLSD+GLAS I D +    Q SA G  APEV M+GQYT+KSDVYSFGV 
Sbjct  548  SNILLDSEFNPHLSDAGLASFISDAEFQAAQQSA-GCTAPEVDMTGQYTLKSDVYSFGVV  606

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS++PRPEQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV+
Sbjct  607  MLELLTGRRPFDSTKPRPEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVL  666

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSAD  266
            ALCVQPEPEFRPPMSEVV+ALVRLVQRANM++R    DS  R+   D
Sbjct  667  ALCVQPEPEFRPPMSEVVQALVRLVQRANMTKRMLDGDSSRRADDQD  713



>gb|AAC27894.1| leucine-rich repeat transmembrane protein kinase 1 [Zea mays]
Length=684

 Score =   262 bits (670),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 141/163 (87%), Gaps = 3/163 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLDSEFNPHLSD+GLAS IPD E QA  Q  ++G  APEV M+GQYT KSDVYSFGV
Sbjct  515  SNILLDSEFNPHLSDAGLASFIPDAEFQAAEQ--SAGYTAPEVDMTGQYTFKSDVYSFGV  572

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDSSRPR EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV
Sbjct  573  VMLELLTGRRPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADV  632

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTR  281
            +ALCVQPEPEFRPPMSEVV+ALVRLVQRANM++R    D+  R
Sbjct  633  LALCVQPEPEFRPPMSEVVQALVRLVQRANMTKRMLDGDTSRR  675



>ref|XP_004983096.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Setaria 
italica]
Length=719

 Score =   263 bits (672),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 145/172 (84%), Gaps = 3/172 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLD+E NPH+SD+GL+S +PD E QA +Q   SG GAPEV M+GQYT+KSDVYSFGV
Sbjct  549  SNILLDTELNPHISDAGLSSFVPDAEFQASDQ--GSGYGAPEVDMTGQYTLKSDVYSFGV  606

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDSSRPR EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV
Sbjct  607  VMLELLTGRKPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADV  666

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            +ALCVQPEPEFRPPMSEVV+ALVRLVQRANM+RR    +  +R      QE+
Sbjct  667  VALCVQPEPEFRPPMSEVVQALVRLVQRANMTRRMLDGEEASRRPDDQDQEF  718



>ref|XP_008651696.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X2 [Zea 
mays]
Length=712

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 142/163 (87%), Gaps = 3/163 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLDSEFNPHLSD+GLAS IPD E QA  Q  ++G  APEV M+GQYT+KSDVYSFGV
Sbjct  543  SNILLDSEFNPHLSDAGLASFIPDAEFQAAEQ--SAGYTAPEVDMTGQYTLKSDVYSFGV  600

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDSSRPR EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV
Sbjct  601  VMLELLTGRRPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADV  660

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTR  281
            +ALCVQPEPEFRPPMSEVV+ALVRLVQRANM++R    D+  R
Sbjct  661  LALCVQPEPEFRPPMSEVVQALVRLVQRANMTKRMLDGDTSRR  703



>ref|XP_008651693.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Zea 
mays]
 tpg|DAA43732.1| TPA: putative STRUBBELIG family receptor protein kinase [Zea 
mays]
Length=736

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 142/163 (87%), Gaps = 3/163 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLDSEFNPHLSD+GLAS IPD E QA  Q  ++G  APEV M+GQYT+KSDVYSFGV
Sbjct  567  SNILLDSEFNPHLSDAGLASFIPDAEFQAAEQ--SAGYTAPEVDMTGQYTLKSDVYSFGV  624

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDSSRPR EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV
Sbjct  625  VMLELLTGRRPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADV  684

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTR  281
            +ALCVQPEPEFRPPMSEVV+ALVRLVQRANM++R    D+  R
Sbjct  685  LALCVQPEPEFRPPMSEVVQALVRLVQRANMTKRMLDGDTSRR  727



>gb|KDO53740.1| hypothetical protein CISIN_1g0080551mg, partial [Citrus sinensis]
Length=148

 Score =   245 bits (626),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 130/147 (88%), Gaps = 3/147 (2%)
 Frame = -1

Query  685  ALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRPRPEQSLVRWAT  506
            ALN ++ SG GAPEVAMSGQY IKSDVYSFGV MLELLTGR PFDSSRPR EQSLVRWAT
Sbjct  1    ALNNDAGSGYGAPEVAMSGQYNIKSDVYSFGVVMLELLTGRKPFDSSRPRLEQSLVRWAT  60

Query  505  PQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVEALVRLVQR  326
            PQLHDIDAL+KMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVV+ALVRLVQR
Sbjct  61   PQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVQALVRLVQR  120

Query  325  ANMSRRTFGAD---SRTRSGSADSQEY  254
            ANMS+RT G D   +  R  + D+Q+Y
Sbjct  121  ANMSKRTIGNDQGPTTPRGDNQDTQDY  147



>ref|XP_009777355.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Nicotiana sylvestris]
Length=693

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  763  NVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVAM  584
            N+LLD++ NPHLSDSGLA+L+ D DQ LN N+ SG GAPE A+SG+ T KSDVYSFGV M
Sbjct  535  NILLDTDLNPHLSDSGLANLVADVDQGLNHNTESGYGAPEAAISGKCTAKSDVYSFGVVM  594

Query  583  LELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIA  404
            LEL +GR PFDSSRPR EQSLVRWATPQLHDIDAL ++VDPAL GLY VKSLSRFADVIA
Sbjct  595  LELFSGRKPFDSSRPRSEQSLVRWATPQLHDIDALEQIVDPALDGLYSVKSLSRFADVIA  654

Query  403  LCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            LCVQPEPEFRPPMSEVV+ALVRLVQRAN+S+R  G D
Sbjct  655  LCVQPEPEFRPPMSEVVQALVRLVQRANLSKRLHGID  691



>ref|XP_009777352.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009777353.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009777354.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
Length=697

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  763  NVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVAM  584
            N+LLD++ NPHLSDSGLA+L+ D DQ LN N+ SG GAPE A+SG+ T KSDVYSFGV M
Sbjct  539  NILLDTDLNPHLSDSGLANLVADVDQGLNHNTESGYGAPEAAISGKCTAKSDVYSFGVVM  598

Query  583  LELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIA  404
            LEL +GR PFDSSRPR EQSLVRWATPQLHDIDAL ++VDPAL GLY VKSLSRFADVIA
Sbjct  599  LELFSGRKPFDSSRPRSEQSLVRWATPQLHDIDALEQIVDPALDGLYSVKSLSRFADVIA  658

Query  403  LCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            LCVQPEPEFRPPMSEVV+ALVRLVQRAN+S+R  G D
Sbjct  659  LCVQPEPEFRPPMSEVVQALVRLVQRANLSKRLHGID  695



>ref|XP_008659003.1| PREDICTED: leucine-rich repeat transmembrane protein kinase 2 
isoform X1 [Zea mays]
Length=684

 Score =   261 bits (666),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 144/172 (84%), Gaps = 4/172 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLDSEFNPHLSD+GLAS IPD E QA  Q  ++G  APEV M+GQYT+KSDVYSFGV
Sbjct  514  SNILLDSEFNPHLSDTGLASFIPDAEFQAAEQ--SAGYTAPEVDMTGQYTLKSDVYSFGV  571

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDSSRPR EQSLVRWA PQLHDIDAL +MVDPALKGLYP KSLSRFADV
Sbjct  572  VMLELLTGRRPFDSSRPRSEQSLVRWAAPQLHDIDALDRMVDPALKGLYPAKSLSRFADV  631

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            +ALCVQPEPEFRPPMSEVV+ALVRLVQRANM++R       +R G  D  +Y
Sbjct  632  LALCVQPEPEFRPPMSEVVQALVRLVQRANMTKRMLDGGDTSR-GPDDQDQY  682



>ref|NP_001049184.1| Os03g0183800 [Oryza sativa Japonica Group]
 gb|AAK92627.1|AC079633_7 Putative leucine-rich repeat transmembrane protein kinase 1 [Oryza 
sativa Japonica Group]
 gb|ABF94338.1| leucine-rich repeat transmembrane protein kinase 1, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF11098.1| Os03g0183800 [Oryza sativa Japonica Group]
 gb|EAY88809.1| hypothetical protein OsI_10282 [Oryza sativa Indica Group]
 gb|EAZ25839.1| hypothetical protein OsJ_09681 [Oryza sativa Japonica Group]
 dbj|BAG94684.1| unnamed protein product [Oryza sativa Japonica Group]
Length=718

 Score =   261 bits (666),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            +N+LLDSEFNPHLSD+GLAS I D +    Q SA G  APEV M+GQYT+KSDVYSFGV 
Sbjct  548  SNLLLDSEFNPHLSDAGLASFISDAEFQAAQQSA-GCTAPEVDMTGQYTLKSDVYSFGVV  606

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+RPR EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV+
Sbjct  607  MLELLTGRRPFDSTRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVL  666

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            ALCVQPEPEFRPPMSEVV+ALVRLVQRANM++R    D+ +R      Q++
Sbjct  667  ALCVQPEPEFRPPMSEVVQALVRLVQRANMTKRMLDGDTSSRRTDDQEQDF  717



>ref|XP_004985465.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Setaria italica]
Length=722

 Score =   261 bits (667),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 143/168 (85%), Gaps = 3/168 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLDSEFNPH+SD+GLAS IPD E QA  Q  ++G  APEV M+GQYT+KSDVYSFGV
Sbjct  553  SNILLDSEFNPHVSDAGLASFIPDAEFQAAEQ--SAGYTAPEVDMTGQYTLKSDVYSFGV  610

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDSSRPR EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV
Sbjct  611  VMLELLTGRRPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADV  670

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSAD  266
            +ALCVQPEPEFRPPMSEVV+ALVRLVQRANM++R    D+  R    D
Sbjct  671  LALCVQPEPEFRPPMSEVVQALVRLVQRANMTKRMLDGDTSRRPDDQD  718



>ref|XP_009383597.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Musa acuminata 
subsp. malaccensis]
Length=720

 Score =   261 bits (666),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 143/173 (83%), Gaps = 2/173 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLD E NPHLSD G  SL+PD E QA  QN ASG   PEVAMSGQYT+KSDVY+FGV
Sbjct  546  SNILLDMELNPHLSDCGFESLVPDAEFQASEQNMASGYSPPEVAMSGQYTLKSDVYNFGV  605

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDSSRPR EQSLVRWATPQLHDIDAL +M+DP LKGLYP KSLSRFADV
Sbjct  606  VMLELLTGRKPFDSSRPRSEQSLVRWATPQLHDIDALDRMIDPDLKGLYPAKSLSRFADV  665

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANM-SRRTFGADSRTRSGSADSQEY  254
            IALCVQPEPEFRPPMSEVV+ALVRLVQRANM S+RT G +      + +S +Y
Sbjct  666  IALCVQPEPEFRPPMSEVVQALVRLVQRANMSSKRTVGGEGPETRRADESDDY  718



>ref|XP_002468389.1| hypothetical protein SORBIDRAFT_01g045010 [Sorghum bicolor]
 gb|EER95387.1| hypothetical protein SORBIDRAFT_01g045010 [Sorghum bicolor]
Length=730

 Score =   261 bits (666),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 142/168 (85%), Gaps = 3/168 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLDSEFNPHLSD+GLAS IPD E QA  Q  ++G  APEV M+GQY +KSDVYSFGV
Sbjct  561  SNILLDSEFNPHLSDAGLASFIPDAEFQAAEQ--SAGYTAPEVDMTGQYNLKSDVYSFGV  618

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDSSRPR EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV
Sbjct  619  VMLELLTGRRPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADV  678

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSAD  266
            +ALCVQPEPEFRPPMSEVV+ALVRLVQRANM++R    D+  R    D
Sbjct  679  LALCVQPEPEFRPPMSEVVQALVRLVQRANMTKRMLDGDTSRRPDDQD  726



>ref|XP_006661732.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Oryza brachyantha]
Length=717

 Score =   260 bits (664),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 144/172 (84%), Gaps = 3/172 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLD+EFNPH+SD+GLAS +PD E QA +Q   SG  APEV M+GQYT+KSDVYSFGV
Sbjct  547  SNILLDTEFNPHVSDAGLASFVPDSEFQASDQ--GSGYSAPEVDMTGQYTLKSDVYSFGV  604

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDSSR R EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV
Sbjct  605  VMLELLTGRKPFDSSRQRTEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADV  664

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            +ALCVQPEPEFRPPMSEVV+ALVRLVQRANM+RR    +  +R      QE+
Sbjct  665  VALCVQPEPEFRPPMSEVVQALVRLVQRANMTRRMIDGEEGSRRPDDQDQEF  716



>ref|XP_004985464.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Setaria italica]
Length=752

 Score =   261 bits (666),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 143/168 (85%), Gaps = 3/168 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLDSEFNPH+SD+GLAS IPD E QA  Q  ++G  APEV M+GQYT+KSDVYSFGV
Sbjct  583  SNILLDSEFNPHVSDAGLASFIPDAEFQAAEQ--SAGYTAPEVDMTGQYTLKSDVYSFGV  640

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDSSRPR EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV
Sbjct  641  VMLELLTGRRPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADV  700

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSAD  266
            +ALCVQPEPEFRPPMSEVV+ALVRLVQRANM++R    D+  R    D
Sbjct  701  LALCVQPEPEFRPPMSEVVQALVRLVQRANMTKRMLDGDTSRRPDDQD  748



>ref|NP_001167741.1| uncharacterized protein LOC100381429 precursor [Zea mays]
 gb|ACN25932.1| unknown [Zea mays]
Length=720

 Score =   260 bits (664),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 143/172 (83%), Gaps = 3/172 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLD+E NPH+SD+G +S +PD E QA +Q   SG  APEV MSGQYT+KSDVYSFGV
Sbjct  550  SNILLDTELNPHISDAGHSSFVPDAEFQASDQ--GSGYSAPEVEMSGQYTLKSDVYSFGV  607

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDSSRPR EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV
Sbjct  608  VMLELLTGRKPFDSSRPRSEQSLVRWATPQLHDIDALDQMVDPALKGLYPAKSLSRFADV  667

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            IALCVQPEPEFRPPMSEVV+ALVRLVQRANM+RR    +  +R      QE+
Sbjct  668  IALCVQPEPEFRPPMSEVVQALVRLVQRANMTRRMLDGEEASRRPDDQEQEF  719



>gb|AFW89442.1| putative STRUBBELIG family receptor protein kinase [Zea mays]
Length=725

 Score =   260 bits (664),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 144/172 (84%), Gaps = 4/172 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLDSEFNPHLSD+GLAS IPD E QA  Q  ++G  APEV M+GQYT+KSDVYSFGV
Sbjct  555  SNILLDSEFNPHLSDTGLASFIPDAEFQAAEQ--SAGYTAPEVDMTGQYTLKSDVYSFGV  612

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDSSRPR EQSLVRWA PQLHDIDAL +MVDPALKGLYP KSLSRFADV
Sbjct  613  VMLELLTGRRPFDSSRPRSEQSLVRWAAPQLHDIDALDRMVDPALKGLYPAKSLSRFADV  672

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            +ALCVQPEPEFRPPMSEVV+ALVRLVQRANM++R       +R G  D  +Y
Sbjct  673  LALCVQPEPEFRPPMSEVVQALVRLVQRANMTKRMLDGGDTSR-GPDDQDQY  723



>ref|XP_006392757.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
 gb|ESQ30043.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
Length=717

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSDSGLAS +P  ++ LNQ +  G  APEV+MSGQY++KSDVYSFGV 
Sbjct  546  ANILLDSELNPHLSDSGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVV  604

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVI
Sbjct  605  MLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVI  664

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  263
            ALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT G D   RSGSAD+
Sbjct  665  ALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTVGVDPSQRSGSADT  712



>ref|XP_006392758.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
 gb|ESQ30044.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
Length=719

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSDSGLAS +P  ++ LNQ +  G  APEV+MSGQY++KSDVYSFGV 
Sbjct  548  ANILLDSELNPHLSDSGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVV  606

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVI
Sbjct  607  MLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVI  666

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  263
            ALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT G D   RSGSAD+
Sbjct  667  ALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTVGVDPSQRSGSADT  714



>ref|XP_003558655.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Brachypodium 
distachyon]
Length=720

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 146/174 (84%), Gaps = 6/174 (3%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLDSEFNPHLSD+GLAS IPD E QA  Q  ++G  APEV M+GQYT+KSDVYSFGV
Sbjct  551  SNILLDSEFNPHLSDAGLASFIPDAEFQAAEQ--SAGCTAPEVDMTGQYTLKSDVYSFGV  608

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDSS+ R EQSLVRWA+PQLHDIDAL +MVDPALKGLYP KSLSRFADV
Sbjct  609  VMLELLTGRKPFDSSKSRSEQSLVRWASPQLHDIDALDRMVDPALKGLYPAKSLSRFADV  668

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYEL  248
            +ALCVQPEPEFRPPMSEVV+ALVRLVQRANM++R    D+   SG  D Q+ + 
Sbjct  669  LALCVQPEPEFRPPMSEVVQALVRLVQRANMTKRMLDGDT---SGRGDDQDQDF  719



>gb|ACG49227.1| leucine-rich repeat transmembrane protein kinase 1 [Zea mays]
Length=676

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 142/172 (83%), Gaps = 3/172 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLD+E NPH+SD+G +S +PD E QA +Q   SG  APEV MSGQYT+KSDVYSFGV
Sbjct  506  SNILLDTELNPHISDAGHSSFVPDAEFQASDQ--GSGYSAPEVEMSGQYTLKSDVYSFGV  563

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDS RPR EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV
Sbjct  564  VMLELLTGRKPFDSXRPRSEQSLVRWATPQLHDIDALDQMVDPALKGLYPAKSLSRFADV  623

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            IALCVQPEPEFRPPMSEVV+ALVRLVQRANM+RR    +  +R      QE+
Sbjct  624  IALCVQPEPEFRPPMSEVVQALVRLVQRANMTRRMLDGEEASRRPDDQEQEF  675



>ref|XP_006304699.1| hypothetical protein CARUB_v10011957mg [Capsella rubella]
 gb|EOA37597.1| hypothetical protein CARUB_v10011957mg [Capsella rubella]
Length=719

 Score =   259 bits (661),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSDSGLAS +P  ++ LNQ +  G  APEV+MSGQY++KSDVYSFGV 
Sbjct  548  ANILLDSELNPHLSDSGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVV  606

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVI
Sbjct  607  MLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVI  666

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  263
            ALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT G D   R+GSAD+
Sbjct  667  ALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTVGVDPSQRTGSADA  714



>ref|NP_175777.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
 sp|Q9C8M9.1|SRF6_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY 6; AltName: 
Full=Leucine-rich repeat receptor kinase-like protein SRF6; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51974.1|AC024260_12 leucine-rich repeat transmembrane protein kinase 1, putative; 
10414-6710 [Arabidopsis thaliana]
 gb|AAQ89622.1| At1g53730 [Arabidopsis thaliana]
 gb|AAR99874.1| strubbelig receptor family 6 [Arabidopsis thaliana]
 dbj|BAE99117.1| LRR receptor-like protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59255.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE32990.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
Length=719

 Score =   258 bits (660),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSDSGLAS +P  ++ LNQ +  G  APEV+MSGQY++KSD+YSFGV 
Sbjct  548  ANILLDSELNPHLSDSGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDIYSFGVV  606

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADVI
Sbjct  607  MLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVI  666

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  263
            ALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT G D   R+GSAD+
Sbjct  667  ALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTVGVDPSQRAGSADT  714



>gb|ABB20817.1| putative leucine-rich repeat transmembrane protein kinase [Isatis 
tinctoria]
 gb|ABF50792.1| leucine-rich repeat transmembrane protein kinase [Isatis tinctoria]
Length=719

 Score =   258 bits (659),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSDSGLAS +P  ++ LNQ +  G  APEV+MSGQY++KSDVYSFGV 
Sbjct  548  ANILLDSELNPHLSDSGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVV  606

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVI
Sbjct  607  MLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALEGLYPVKSLSRFADVI  666

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  263
            ALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT G D   RSGSAD+
Sbjct  667  ALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTVGVDPSQRSGSADT  714



>gb|KFK35699.1| hypothetical protein AALP_AA4G025700 [Arabis alpina]
Length=721

 Score =   258 bits (659),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSDSGLAS +P  ++ LNQ +  G  APEV+MSGQY++KSD+YSFGV 
Sbjct  550  ANILLDSEMNPHLSDSGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDIYSFGVV  608

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI
Sbjct  609  MLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  668

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  263
            ALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT G D   R+GSA++
Sbjct  669  ALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTVGVDPSQRAGSAET  716



>ref|NP_001064502.1| Os10g0389800 [Oryza sativa Japonica Group]
 gb|AAO72637.1| putative leucine-rich repeat transmembrane protein kinase [Oryza 
sativa Japonica Group]
 gb|ABB47491.1| leucine-rich repeat transmembrane protein kinase, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26416.1| Os10g0389800 [Oryza sativa Japonica Group]
 gb|EEE50892.1| hypothetical protein OsJ_31383 [Oryza sativa Japonica Group]
Length=719

 Score =   258 bits (658),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 144/172 (84%), Gaps = 3/172 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLD+EFNPH+SD+GLAS +PD E QA +Q   SG  APEV M+GQYT+KSDVYSFGV
Sbjct  549  SNILLDTEFNPHVSDAGLASSVPDSEFQASDQ--GSGYSAPEVDMTGQYTLKSDVYSFGV  606

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV
Sbjct  607  VMLELLTGRKPFDSARLRTEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADV  666

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            IALCVQPEPEFRPPMSEVV+ALVRLVQRANM+RR    +  +R      QE+
Sbjct  667  IALCVQPEPEFRPPMSEVVQALVRLVQRANMTRRMIDGEEGSRRPDDQDQEF  718



>ref|XP_010479951.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Camelina 
sativa]
Length=721

 Score =   258 bits (658),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSDSGLAS +P  D+ +NQ +  G  APEV+MSGQYT+KSDVYSFGV 
Sbjct  550  ANILLDSELNPHLSDSGLASFLPTADELINQ-TDEGYSAPEVSMSGQYTLKSDVYSFGVV  608

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVI
Sbjct  609  MLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVI  668

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  263
            ALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT G D   RSG+ D+
Sbjct  669  ALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTVGVDPPQRSGNPDT  716



>gb|EPS61932.1| ovule receptor-like kinase 28, partial [Genlisea aurea]
Length=704

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 142/172 (83%), Gaps = 8/172 (5%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            AN+LLD E NP LSD GLA LI +  DQ       SG  APEVAMSGQYT+KSDVYSFGV
Sbjct  539  ANILLDDELNPRLSDCGLARLISEPADQG------SGYVAPEVAMSGQYTVKSDVYSFGV  592

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLEL++GR PFDSS+PR EQSLVRWATPQLHDIDALSKMVDP+LKGLYP KSLS+FAD+
Sbjct  593  VMLELISGRKPFDSSKPRSEQSLVRWATPQLHDIDALSKMVDPSLKGLYPAKSLSQFADI  652

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRS-GSADSQE  257
            IALCVQ EPEFRP MSEVVEA+VRLVQRANMSRRTFG +   RS GS+D  E
Sbjct  653  IALCVQAEPEFRPSMSEVVEAIVRLVQRANMSRRTFGNEGSNRSAGSSDGNE  704



>gb|AAK52120.1|AC079936_16 Putative leucine-rich repeat transmembrane protein kinase 1 [Oryza 
sativa Japonica Group]
Length=736

 Score =   258 bits (658),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 144/172 (84%), Gaps = 3/172 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLD+EFNPH+SD+GLAS +PD E QA +Q   SG  APEV M+GQYT+KSDVYSFGV
Sbjct  566  SNILLDTEFNPHVSDAGLASSVPDSEFQASDQ--GSGYSAPEVDMTGQYTLKSDVYSFGV  623

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV
Sbjct  624  VMLELLTGRKPFDSARLRTEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADV  683

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            IALCVQPEPEFRPPMSEVV+ALVRLVQRANM+RR    +  +R      QE+
Sbjct  684  IALCVQPEPEFRPPMSEVVQALVRLVQRANMTRRMIDGEEGSRRPDDQDQEF  735



>gb|EEC66871.1| hypothetical protein OsI_33412 [Oryza sativa Indica Group]
Length=719

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 144/172 (84%), Gaps = 3/172 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLD+EFNPH+SD+GLAS +PD E QA +Q   SG  APEV M+GQYT+KSDVYSFGV
Sbjct  549  SNILLDTEFNPHVSDAGLASNVPDSEFQASDQ--GSGYSAPEVDMTGQYTLKSDVYSFGV  606

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV
Sbjct  607  VMLELLTGRKPFDSARLRTEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADV  666

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            IALCVQPEPEFRPPMSEVV+ALVRLVQRANM+RR    +  +R      QE+
Sbjct  667  IALCVQPEPEFRPPMSEVVQALVRLVQRANMTRRMIDGEEGSRRPDDQDQEF  718



>ref|NP_001104882.1| leucine-rich repeat transmembrane protein kinase 2 precursor 
[Zea mays]
 gb|AAC27895.1| leucine-rich repeat transmembrane protein kinase 2 [Zea mays]
Length=725

 Score =   257 bits (656),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 143/172 (83%), Gaps = 4/172 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLDSEFNPHLSD+GLAS IP  E QA  Q  ++G  APEV M+GQYT+KSDVYSFGV
Sbjct  555  SNILLDSEFNPHLSDTGLASFIPGAEFQAAEQ--SAGYTAPEVDMTGQYTLKSDVYSFGV  612

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDSSRPR EQSLVRWA PQLHDIDAL +MVDPALKGLYP KSLSRFADV
Sbjct  613  VMLELLTGRRPFDSSRPRSEQSLVRWAAPQLHDIDALDRMVDPALKGLYPAKSLSRFADV  672

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            +ALCVQPEPEFRPPMSEVV+ALVRLVQRANM++R       +R G  D  +Y
Sbjct  673  LALCVQPEPEFRPPMSEVVQALVRLVQRANMTKRMLDGGDTSR-GPDDQDQY  723



>gb|EMS47769.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Triticum urartu]
Length=619

 Score =   254 bits (650),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 144/171 (84%), Gaps = 2/171 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            +N+LLDSE+NPH+SD+GLAS IPD +    + SA G  APEV M+GQYT+KSDVYSFGV 
Sbjct  450  SNILLDSEYNPHVSDAGLASFIPDAEFQTAEQSA-GCTAPEVDMTGQYTMKSDVYSFGVV  508

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDSS+PR EQSLVRWA+PQLHDIDAL +MVDPALKGLYP KSLSRFADV+
Sbjct  509  MLELLTGRKPFDSSKPRSEQSLVRWASPQLHDIDALDRMVDPALKGLYPAKSLSRFADVL  568

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            ALCVQ EPEFRPPMSEVV+ALVRLVQRANM+++    D+ +R G    Q++
Sbjct  569  ALCVQAEPEFRPPMSEVVQALVRLVQRANMTKKMLDGDA-SRRGDDQDQDF  618



>ref|XP_010501035.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Camelina sativa]
Length=721

 Score =   256 bits (654),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSDSGLAS +P  D+ +NQ +  G  APEV+MSGQY++KSDVYSFGV 
Sbjct  550  ANILLDSELNPHLSDSGLASFLPTADELINQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVV  608

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVI
Sbjct  609  MLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVI  668

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  263
            ALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT G D   RSG+ D+
Sbjct  669  ALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTVGVDPPQRSGNPDT  716



>ref|XP_006357429.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Solanum 
tuberosum]
Length=716

 Score =   256 bits (653),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  763  NVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVAM  584
            N+LLD++ NPHLSDSGLA+L+ D DQ LN N  SG GAPE A+SG+ T KSDVYSFGV M
Sbjct  558  NILLDADLNPHLSDSGLANLMADADQGLNHNIESGYGAPEAAISGKCTTKSDVYSFGVVM  617

Query  583  LELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIA  404
            LEL TGR PFDSSR R EQSLVRWATPQLHDIDAL KMVDPAL GLY VKSLSRFADVIA
Sbjct  618  LELCTGRKPFDSSRSRSEQSLVRWATPQLHDIDALEKMVDPALSGLYSVKSLSRFADVIA  677

Query  403  LCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            LCVQ EPEFRPPMSEVV+ALVRLVQRANMS+R    D
Sbjct  678  LCVQLEPEFRPPMSEVVQALVRLVQRANMSKRLHNND  714



>emb|CDY02495.1| BnaA08g01020D [Brassica napus]
Length=716

 Score =   256 bits (653),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSD+GLAS +P  ++ LNQ +  G  APEV+MSGQY++KSDVYSFGV 
Sbjct  545  ANILLDSEMNPHLSDTGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVV  603

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVI
Sbjct  604  MLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALEGLYPVKSLSRFADVI  663

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  263
            ALCVQPEPEFRPPMSEVV++LV LVQRANMS+RT G D   RSGSA++
Sbjct  664  ALCVQPEPEFRPPMSEVVQSLVVLVQRANMSKRTVGVDPSQRSGSAET  711



>ref|XP_009106960.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Brassica rapa]
Length=716

 Score =   256 bits (653),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSD+GLAS +P  ++ LNQ +  G  APEV+MSGQY++KSDVYSFGV 
Sbjct  545  ANILLDSEMNPHLSDTGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVV  603

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVI
Sbjct  604  MLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALEGLYPVKSLSRFADVI  663

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  263
            ALCVQPEPEFRPPMSEVV++LV LVQRANMS+RT G D   RSGSA++
Sbjct  664  ALCVQPEPEFRPPMSEVVQSLVVLVQRANMSKRTVGVDPSQRSGSAET  711



>ref|XP_010096526.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Morus notabilis]
 gb|EXB64646.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Morus notabilis]
Length=689

 Score =   255 bits (652),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 141/170 (83%), Gaps = 1/170 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
             N+LLD+E NPHLSD GLA+ IP   + L+ +   G  APE+ M+GQY++KSDVYSFGV 
Sbjct  518  GNILLDAELNPHLSDCGLANFIPRAKEYLSSHVEVGFNAPEILMAGQYSVKSDVYSFGVI  577

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS RPR EQSLV+WA+PQLHDIDALSKMVDPAL+GLYPVKSLSRFADVI
Sbjct  578  MLELLTGRKPFDSLRPRSEQSLVQWASPQLHDIDALSKMVDPALEGLYPVKSLSRFADVI  637

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQE  257
            ALC+Q EPEFRPPMSEVV+ALV LVQRANMS+RT G D  T S   DSQ+
Sbjct  638  ALCIQAEPEFRPPMSEVVQALVLLVQRANMSKRTIGVDQGT-SRRGDSQD  686



>emb|CDY25686.1| BnaC03g69890D [Brassica napus]
Length=716

 Score =   255 bits (652),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 149/172 (87%), Gaps = 2/172 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSD+GLAS +P  ++ LNQ +  G  APEV+MSGQY++KSDVYSFGV 
Sbjct  545  ANILLDSEMNPHLSDTGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVV  603

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVI
Sbjct  604  MLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALEGLYPVKSLSRFADVI  663

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSAD-SQEY  254
            ALCVQPEPEFRPPMSEVV++LV LVQRANMS+RT G D   RSGSA+ S +Y
Sbjct  664  ALCVQPEPEFRPPMSEVVQSLVVLVQRANMSKRTVGVDPSQRSGSAEPSNDY  715



>ref|NP_001077716.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
 gb|AEE32991.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
Length=720

 Score =   255 bits (652),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 148/169 (88%), Gaps = 2/169 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSDSGLAS +P  ++ LNQ +  G  APEV+MSGQY++KSD+YSFGV 
Sbjct  548  ANILLDSELNPHLSDSGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDIYSFGVV  606

Query  586  MLELLTGRTPFDSS-RPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
            MLELLTGR PFDSS R R EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADV
Sbjct  607  MLELLTGRKPFDSSTRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADV  666

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  263
            IALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT G D   R+GSAD+
Sbjct  667  IALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTVGVDPSQRAGSADT  715



>ref|XP_009591325.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Nicotiana 
tomentosiformis]
Length=701

 Score =   255 bits (651),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 135/157 (86%), Gaps = 2/157 (1%)
 Frame = -1

Query  763  NVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVAM  584
            N+LLD++ NPHLSDSGLA+LI D DQ LN  + SG GAPE A+SG+ + KSDVYSFGV M
Sbjct  545  NILLDTDLNPHLSDSGLANLIADTDQGLN--TESGYGAPEAAISGKCSTKSDVYSFGVVM  602

Query  583  LELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIA  404
            LEL +GR PFD SRPR EQSLVRWATPQLHDIDAL KMVDPAL GLY VKSLSRFADVIA
Sbjct  603  LELFSGRKPFDCSRPRSEQSLVRWATPQLHDIDALEKMVDPALVGLYSVKSLSRFADVIA  662

Query  403  LCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            LCVQPEPEFRPPMSEVV+ALVRLVQRAN+S+R  G D
Sbjct  663  LCVQPEPEFRPPMSEVVQALVRLVQRANLSKRLHGID  699



>ref|XP_010534992.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 isoform X2 [Tarenaya 
hassleriana]
Length=641

 Score =   253 bits (646),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 145/172 (84%), Gaps = 1/172 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQ-NSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLDSE NPHLSDSGL   +P  D+ LNQ +  +G  APEV+MSGQY+ KSDVYSFGV
Sbjct  469  SNILLDSELNPHLSDSGLTCFLPMADELLNQSDEGTGYSAPEVSMSGQYSTKSDVYSFGV  528

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDS+RPR EQSLVRWATPQLHDI+AL KMVDP+LK LYPVKSLSRFADV
Sbjct  529  VMLELLTGRKPFDSTRPRSEQSLVRWATPQLHDINALGKMVDPSLKRLYPVKSLSRFADV  588

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            IALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT G D   RS SA+  +Y
Sbjct  589  IALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTIGVDQSQRSSSAEVNDY  640



>ref|XP_010462281.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Camelina 
sativa]
Length=721

 Score =   254 bits (650),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSDSGLAS +P  D+ +NQ +  G  APEV+MSGQY++KSDVYSFGV 
Sbjct  550  ANILLDSELNPHLSDSGLASFLPAADELINQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVV  608

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS++ R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVI
Sbjct  609  MLELLTGRKPFDSTKSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVI  668

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  263
            ALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT G D   RSG+ D+
Sbjct  669  ALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTVGVDPPQRSGNPDT  716



>ref|XP_010487232.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Camelina 
sativa]
Length=554

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 145/171 (85%), Gaps = 5/171 (3%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSDSGLAS +P  ++ LNQN   G  APE +MSGQY++KSDVYSFGV 
Sbjct  388  ANILLDSELNPHLSDSGLASFLPTANELLNQND-EGYSAPETSMSGQYSLKSDVYSFGVV  446

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVI
Sbjct  447  MLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVI  506

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            ALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  507  ALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  553



>ref|XP_002891770.1| hypothetical protein ARALYDRAFT_474507 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68029.1| hypothetical protein ARALYDRAFT_474507 [Arabidopsis lyrata subsp. 
lyrata]
Length=721

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 148/169 (88%), Gaps = 2/169 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSDSGLAS +P  ++ LNQ +  G  APEV+MSGQY++KSDVYSFGV 
Sbjct  549  ANILLDSELNPHLSDSGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVV  607

Query  586  MLELLTGRTPFDSS-RPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
            MLELLTGR PFDSS R R EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADV
Sbjct  608  MLELLTGRKPFDSSKRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADV  667

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  263
            IALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT G D   R+G+AD+
Sbjct  668  IALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTVGVDPSQRAGNADT  716



>ref|XP_009116969.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Brassica 
rapa]
Length=723

 Score =   254 bits (648),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 147/171 (86%), Gaps = 5/171 (3%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSD+GLAS +P  ++ LNQN   G GAPEV+MSGQY++KSDVYSFGV 
Sbjct  557  ANILLDSELNPHLSDAGLASFLPTANELLNQND-EGYGAPEVSMSGQYSLKSDVYSFGVV  615

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVI
Sbjct  616  MLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVI  675

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            ALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  676  ALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  722



>emb|CDY39110.1| BnaA01g29460D [Brassica napus]
Length=724

 Score =   254 bits (648),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 147/171 (86%), Gaps = 5/171 (3%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSD+GLAS +P  ++ LNQN   G GAPEV+MSGQY++KSDVYSFGV 
Sbjct  558  ANILLDSELNPHLSDAGLASFLPTANELLNQND-EGYGAPEVSMSGQYSLKSDVYSFGVV  616

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVI
Sbjct  617  MLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVI  676

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            ALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  677  ALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  723



>gb|EMT02096.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Aegilops tauschii]
Length=690

 Score =   253 bits (646),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 144/171 (84%), Gaps = 2/171 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            +N+LLDSE+NPH+SD+GLAS IPD +    + SA G  APEV M+GQYT+KSDVYSFGV 
Sbjct  521  SNILLDSEYNPHVSDAGLASFIPDAEFQTAEQSA-GCTAPEVDMTGQYTMKSDVYSFGVV  579

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PF+SS+PR EQSLVRWA+PQLHDIDAL +MVDPALKGLYP KSLSRFADV+
Sbjct  580  MLELLTGRKPFESSKPRSEQSLVRWASPQLHDIDALDRMVDPALKGLYPAKSLSRFADVL  639

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            ALCVQ EPEFRPPMSEVV+ALVRLVQRANM+++    D+ +R G    Q++
Sbjct  640  ALCVQAEPEFRPPMSEVVQALVRLVQRANMTKKMLDGDA-SRRGDDQDQDF  689



>emb|CDX97567.1| BnaA05g25120D [Brassica napus]
Length=723

 Score =   253 bits (647),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 147/171 (86%), Gaps = 5/171 (3%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSDSGLAS +P  ++ LNQN   G  APEV+MSGQY+++SDVYSFGV 
Sbjct  557  ANILLDSELNPHLSDSGLASFLPTANELLNQND-EGYSAPEVSMSGQYSLQSDVYSFGVV  615

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI
Sbjct  616  MLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  675

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            ALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  676  ALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  722



>ref|XP_002885038.1| hypothetical protein ARALYDRAFT_478852 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61297.1| hypothetical protein ARALYDRAFT_478852 [Arabidopsis lyrata subsp. 
lyrata]
Length=716

 Score =   253 bits (645),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 145/171 (85%), Gaps = 5/171 (3%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSDSGLAS +P  ++ LNQN   G  APE +MSGQY++KSDVYSFGV 
Sbjct  550  ANILLDSELNPHLSDSGLASFLPTANELLNQND-EGYSAPETSMSGQYSLKSDVYSFGVV  608

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDSSR R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVI
Sbjct  609  MLELLTGRKPFDSSRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVI  668

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            ALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT GA     SGS+   +Y
Sbjct  669  ALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTVGAG----SGSSGVNDY  715



>ref|XP_009146380.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Brassica rapa]
Length=723

 Score =   253 bits (646),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 147/171 (86%), Gaps = 5/171 (3%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSDSGLAS +P  ++ LNQN   G  APEV+MSGQY+++SDVYSFG+ 
Sbjct  557  ANILLDSELNPHLSDSGLASFLPTANELLNQND-EGYSAPEVSMSGQYSLQSDVYSFGIV  615

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI
Sbjct  616  MLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  675

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            ALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  676  ALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  722



>ref|XP_010937238.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X2 [Elaeis 
guineensis]
Length=676

 Score =   251 bits (642),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 146/175 (83%), Gaps = 4/175 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLD E NPHLSD GLA+L PD E QA +QN  SG  APEVAMSGQYT+KSDVY FGV
Sbjct  501  SNILLDMELNPHLSDCGLANLTPDAEFQASDQNMGSGYSAPEVAMSGQYTLKSDVYGFGV  560

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PF+SSR R EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV
Sbjct  561  VMLELLTGRKPFESSRSRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADV  620

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRT---RSGSADSQEY  254
            IALCVQPEPEFRPPMSEVV+ALVRLVQRANMS+R    D++    RS   D+Q+Y
Sbjct  621  IALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRVLSGDTQETARRSDDPDTQDY  675



>ref|XP_010534991.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Tarenaya 
hassleriana]
Length=718

 Score =   252 bits (644),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 145/172 (84%), Gaps = 1/172 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQ-NSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLDSE NPHLSDSGL   +P  D+ LNQ +  +G  APEV+MSGQY+ KSDVYSFGV
Sbjct  546  SNILLDSELNPHLSDSGLTCFLPMADELLNQSDEGTGYSAPEVSMSGQYSTKSDVYSFGV  605

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDS+RPR EQSLVRWATPQLHDI+AL KMVDP+LK LYPVKSLSRFADV
Sbjct  606  VMLELLTGRKPFDSTRPRSEQSLVRWATPQLHDINALGKMVDPSLKRLYPVKSLSRFADV  665

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            IALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT G D   RS SA+  +Y
Sbjct  666  IALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTIGVDQSQRSSSAEVNDY  717



>ref|XP_006845116.1| hypothetical protein AMTR_s00005p00184950 [Amborella trichopoda]
 gb|ERN06791.1| hypothetical protein AMTR_s00005p00184950 [Amborella trichopoda]
Length=381

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE AMSG YT+KSDVYSFG
Sbjct  205  ANILLDEELNPHLSDCGLAALTPNTERQVSTQMLGSFGYSAPEFAMSGIYTVKSDVYSFG  264

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPALKG+YP KSLSRFAD
Sbjct  265  VVMLELLTGRKPLDSSRQRSEQSLVRWATPQLHDIDALAKMVDPALKGIYPAKSLSRFAD  324

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRL+QRA+M++R
Sbjct  325  IIALCVQPEPEFRPPMSEVVQALVRLMQRASMNKR  359



>ref|XP_006407090.1| hypothetical protein EUTSA_v10020162mg [Eutrema salsugineum]
 gb|ESQ48543.1| hypothetical protein EUTSA_v10020162mg [Eutrema salsugineum]
Length=714

 Score =   252 bits (643),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 144/167 (86%), Gaps = 4/167 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSDSGLAS +P  ++ LNQN   G  APEV+MSGQY++KSDVYSFGV 
Sbjct  550  ANILLDSELNPHLSDSGLASFLPTANELLNQND-EGYSAPEVSMSGQYSLKSDVYSFGVV  608

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVI
Sbjct  609  MLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVI  668

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSAD  266
            ALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT G  S   SG+ D
Sbjct  669  ALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTVGVGS---SGTND  712



>ref|XP_010937237.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Elaeis 
guineensis]
Length=724

 Score =   251 bits (642),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 146/175 (83%), Gaps = 4/175 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLD E NPHLSD GLA+L PD E QA +QN  SG  APEVAMSGQYT+KSDVY FGV
Sbjct  549  SNILLDMELNPHLSDCGLANLTPDAEFQASDQNMGSGYSAPEVAMSGQYTLKSDVYGFGV  608

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PF+SSR R EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV
Sbjct  609  VMLELLTGRKPFESSRSRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADV  668

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRT---RSGSADSQEY  254
            IALCVQPEPEFRPPMSEVV+ALVRLVQRANMS+R    D++    RS   D+Q+Y
Sbjct  669  IALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRVLSGDTQETARRSDDPDTQDY  723



>ref|XP_011079189.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Sesamum 
indicum]
Length=688

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 136/151 (90%), Gaps = 5/151 (3%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+L+D EFN HLSD GLASL+    ++L+Q  ASG  APEV+MSGQYTIKSDVYSFGV 
Sbjct  543  ANILVDMEFNAHLSDCGLASLV---HESLDQ--ASGYNAPEVSMSGQYTIKSDVYSFGVV  597

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELL+GRTPFDSSRPR EQSL RWATPQLHDIDAL+KMVDPAL GLYPVKSLSRFADVI
Sbjct  598  MLELLSGRTPFDSSRPRTEQSLARWATPQLHDIDALAKMVDPALDGLYPVKSLSRFADVI  657

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMS  314
            ALCVQPEPEFRPPMSEVVE+LVRLV++ANMS
Sbjct  658  ALCVQPEPEFRPPMSEVVESLVRLVEQANMS  688



>ref|XP_006300068.1| hypothetical protein CARUB_v10016296mg [Capsella rubella]
 gb|EOA32966.1| hypothetical protein CARUB_v10016296mg [Capsella rubella]
Length=717

 Score =   251 bits (641),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 145/171 (85%), Gaps = 5/171 (3%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSDSGLAS +P  ++ LNQN   G  APE +MSGQY++KSDVYSFGV 
Sbjct  551  ANILLDSELNPHLSDSGLASFLPTANELLNQND-EGYSAPETSMSGQYSLKSDVYSFGVV  609

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVI
Sbjct  610  MLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVI  669

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            ALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  670  ALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  716



>ref|XP_002467303.1| hypothetical protein SORBIDRAFT_01g024160 [Sorghum bicolor]
 gb|EER94301.1| hypothetical protein SORBIDRAFT_01g024160 [Sorghum bicolor]
Length=698

 Score =   250 bits (639),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 140/172 (81%), Gaps = 3/172 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLD+E NPH+SD+  +  +PD E QA +Q   SG  APEV MS QY++KSDVYSFGV
Sbjct  528  SNILLDTELNPHISDAVHSCFVPDVEFQASDQ--GSGYSAPEVGMSSQYSLKSDVYSFGV  585

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFDSSRPR EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV
Sbjct  586  VMLELLTGRKPFDSSRPRSEQSLVRWATPQLHDIDALDQMVDPALKGLYPAKSLSRFADV  645

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            +ALCVQPEPEFRPPMSEVV+ALVRLVQRANM+RR    +  +R      QE+
Sbjct  646  VALCVQPEPEFRPPMSEVVQALVRLVQRANMTRRMIDGEEASRRPDDQEQEF  697



>ref|XP_010501850.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Camelina sativa]
Length=721

 Score =   251 bits (641),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 145/171 (85%), Gaps = 5/171 (3%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSDSGLAS +P  ++ LNQN   G  APE +MSGQY++KSDVYSFGV 
Sbjct  555  ANILLDSELNPHLSDSGLASFLPTANELLNQND-EGYSAPETSMSGQYSLKSDVYSFGVV  613

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVI
Sbjct  614  MLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVI  673

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            ALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  674  ALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  720



>ref|XP_010465325.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Camelina 
sativa]
Length=721

 Score =   251 bits (640),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 145/171 (85%), Gaps = 5/171 (3%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSDSGLAS +P  ++ LNQN   G  APE +MSGQY++KSDVYSFGV 
Sbjct  555  ANILLDSELNPHLSDSGLASFLPTANELLNQND-EGYSAPETSMSGQYSLKSDVYSFGVV  613

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVI
Sbjct  614  MLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVI  673

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            ALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  674  ALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  720



>gb|KFK38799.1| hypothetical protein AALP_AA3G161700 [Arabis alpina]
Length=714

 Score =   250 bits (639),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 145/171 (85%), Gaps = 5/171 (3%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD E NPHLSDSGLAS +P  ++ LNQN   G  APEV+MSGQY++KSDVYSFGV 
Sbjct  548  ANILLDLELNPHLSDSGLASFLPTANELLNQND-EGYNAPEVSMSGQYSLKSDVYSFGVV  606

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDALSKMVDP LKGLYPVKSLSRFADVI
Sbjct  607  MLELLTGRKPFDSARSRSEQSLVRWATPQLHDIDALSKMVDPTLKGLYPVKSLSRFADVI  666

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            ALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  667  ALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  713



>emb|CDX98445.1| BnaC05g39300D [Brassica napus]
Length=722

 Score =   249 bits (636),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 145/171 (85%), Gaps = 5/171 (3%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSD GLAS +P  ++ L QN   G  APEV+MSGQY+++SDVYSFGV 
Sbjct  556  ANILLDSELNPHLSDCGLASFLPTANELLTQND-EGYSAPEVSMSGQYSLQSDVYSFGVV  614

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI
Sbjct  615  MLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  674

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            ALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  675  ALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  721



>ref|XP_006657962.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Oryza brachyantha]
Length=721

 Score =   249 bits (635),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 142/174 (82%), Gaps = 5/174 (3%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLD+E NPHLSDSG   LIP+ E QA + NS  G  APEV MSGQY++KSDVYSFGV
Sbjct  550  SNILLDNELNPHLSDSGFGGLIPNQESQASDDNS--GYKAPEVTMSGQYSLKSDVYSFGV  607

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFD SRPRPEQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD 
Sbjct  608  VMLELLTGRKPFDRSRPRPEQSLVRWATPQLHDIDALDRMVDPALQGLYPSKSLSRFADA  667

Query  409  IALCVQPEPE-FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  251
            IALCVQPEPE F PPMSEVV+ LVRLVQRANM+ RT GAD  +     +S ++E
Sbjct  668  IALCVQPEPELFGPPMSEVVQLLVRLVQRANMT-RTCGADGHSWRRDGESGDHE  720



>ref|XP_004958321.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X1 [Setaria italica]
 ref|XP_004958322.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X2 [Setaria italica]
Length=714

 Score =   249 bits (635),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 141/172 (82%), Gaps = 4/172 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDED-QALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLDSE NPH+SDSG A L P+ + Q  ++NS  G  APEV MSGQY++KSDVYSFGV
Sbjct  546  SNILLDSELNPHVSDSGFADLTPNHEFQESDENS--GYRAPEVTMSGQYSLKSDVYSFGV  603

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFD +RPRPEQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD 
Sbjct  604  VMLELLTGRKPFDRTRPRPEQSLVRWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADA  663

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            IALCVQPEPEFRPPMSEVV++LVRLVQRANM+ RT  + SR    S    E+
Sbjct  664  IALCVQPEPEFRPPMSEVVQSLVRLVQRANMT-RTHESHSRRHGESGGDYEF  714



>ref|XP_001780717.1| predicted protein [Physcomitrella patens]
 gb|EDQ54501.1| predicted protein, partial [Physcomitrella patens]
Length=316

 Score =   238 bits (607),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 133/161 (83%), Gaps = 1/161 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLD E NPH+SD GLA L     ++    ++ G  APE AM G YT+KSD+YSFGV 
Sbjct  145  ANILLDDELNPHISDCGLAILASSGSES-ELTTSFGYSAPEYAMFGTYTVKSDIYSFGVV  203

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+RPR EQSLVRWATPQLHDIDAL++MVDPALKG+YP KSLSRFADV+
Sbjct  204  MLELLTGRKPFDSTRPRSEQSLVRWATPQLHDIDALARMVDPALKGMYPAKSLSRFADVV  263

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRT  284
            ALCVQPEPEFRPPMSEVV++LVRL+QRA+MS+R     ++T
Sbjct  264  ALCVQPEPEFRPPMSEVVQSLVRLIQRASMSKRGLELATQT  304



>ref|NP_974312.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
 gb|AEE75506.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
Length=689

 Score =   246 bits (629),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 137/154 (89%), Gaps = 1/154 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSDSGLAS +P  ++ LNQN   G  APE +MSGQY++KSDVYSFGV 
Sbjct  523  ANILLDSELNPHLSDSGLASFLPTANELLNQND-EGYSAPETSMSGQYSLKSDVYSFGVV  581

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVI
Sbjct  582  MLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVI  641

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRT  305
            ALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT
Sbjct  642  ALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRT  675



>ref|XP_001776313.1| predicted protein [Physcomitrella patens]
 gb|EDQ58812.1| predicted protein [Physcomitrella patens]
Length=383

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 132/156 (85%), Gaps = 3/156 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD--EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSF  596
            AN+LLD E NPH+SD GLA+L P   E Q   Q   S G  APE AMSG YT+KSDVYSF
Sbjct  210  ANILLDDELNPHVSDCGLAALAPSGSERQVSAQMLGSFGYSAPEYAMSGTYTVKSDVYSF  269

Query  595  GVAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFA  416
            GV MLELLTGR P DSSRPR EQSLVRWATPQLHDIDAL++MVDP+LKG+YP KSLSRFA
Sbjct  270  GVVMLELLTGRKPLDSSRPRSEQSLVRWATPQLHDIDALARMVDPSLKGIYPAKSLSRFA  329

Query  415  DVIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            D++ALCVQPEPEFRPPMSEVV+ALVRL+QRA++S+R
Sbjct  330  DIVALCVQPEPEFRPPMSEVVQALVRLMQRASLSKR  365



>ref|NP_974311.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
 gb|AEE75504.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
Length=680

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 137/154 (89%), Gaps = 1/154 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSDSGLAS +P  ++ LNQN   G  APE +MSGQY++KSDVYSFGV 
Sbjct  514  ANILLDSELNPHLSDSGLASFLPTANELLNQND-EGYSAPETSMSGQYSLKSDVYSFGVV  572

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVI
Sbjct  573  MLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVI  632

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRT  305
            ALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT
Sbjct  633  ALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRT  666



>ref|XP_009388758.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=705

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 137/171 (80%), Gaps = 3/171 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLD E NPHLSD GL  L+P+ E QA   N   G  APEVAMSGQYT+KSDVYSFGV
Sbjct  533  SNILLDMELNPHLSDCGLEGLVPNAEFQASELNM--GYSAPEVAMSGQYTMKSDVYSFGV  590

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLEL+TGR PFDSSRPR EQSLV+WATPQLHDIDAL +MVDPALKGLYP KSLSRFADV
Sbjct  591  VMLELMTGRKPFDSSRPRSEQSLVQWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADV  650

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQE  257
            IALCVQ EPEFRPPMSEVV+ALVRLV+R  M+ R  G D +  S  A  Q+
Sbjct  651  IALCVQSEPEFRPPMSEVVQALVRLVKRVKMNNRMAGGDGQETSRRAGDQD  701



>ref|XP_009388759.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=703

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 137/171 (80%), Gaps = 3/171 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLD E NPHLSD GL  L+P+ E QA   N   G  APEVAMSGQYT+KSDVYSFGV
Sbjct  531  SNILLDMELNPHLSDCGLEGLVPNAEFQASELNM--GYSAPEVAMSGQYTMKSDVYSFGV  588

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLEL+TGR PFDSSRPR EQSLV+WATPQLHDIDAL +MVDPALKGLYP KSLSRFADV
Sbjct  589  VMLELMTGRKPFDSSRPRSEQSLVQWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADV  648

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQE  257
            IALCVQ EPEFRPPMSEVV+ALVRLV+R  M+ R  G D +  S  A  Q+
Sbjct  649  IALCVQSEPEFRPPMSEVVQALVRLVKRVKMNNRMAGGDGQETSRRAGDQD  699



>ref|NP_188052.2| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
 sp|Q9LUL4.1|SRF7_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY 7; AltName: 
Full=Leucine-rich repeat receptor kinase-like protein SRF7; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01040.1| serine/threonine protein kinase-like protein [Arabidopsis thaliana]
 gb|AAR99875.1| strubbelig receptor family 7 [Arabidopsis thaliana]
 gb|ACI49801.1| At3g14350 [Arabidopsis thaliana]
 gb|ACN59316.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE75505.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
Length=717

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 137/154 (89%), Gaps = 1/154 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSDSGLAS +P  ++ LNQN   G  APE +MSGQY++KSDVYSFGV 
Sbjct  551  ANILLDSELNPHLSDSGLASFLPTANELLNQND-EGYSAPETSMSGQYSLKSDVYSFGVV  609

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVI
Sbjct  610  MLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVI  669

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRT  305
            ALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT
Sbjct  670  ALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRT  703



>emb|CAA18116.1| serine/threonine protein kinase like protein [Arabidopsis thaliana]
 emb|CAB79168.1| serine/threonine protein kinase like protein [Arabidopsis thaliana]
 gb|ABL66730.1| At4g22130 [Arabidopsis thaliana]
Length=338

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 132/161 (82%), Gaps = 2/161 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSDSGLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVY+FG
Sbjct  162  ANILLDEELNPHLSDSGLAALTPNTERQVSTQVVGSFGYSAPEFALSGIYTVKSDVYTFG  221

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD
Sbjct  222  VVMLELLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFAD  281

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADS  290
            +IALC+QPEPEFRPPMSEVV+ LVRLVQRA++ +R    D+
Sbjct  282  IIALCIQPEPEFRPPMSEVVQQLVRLVQRASVVKRRSSDDT  322



>gb|ACN58180.1| leucine-rich repeat protein [Dasypyrum villosum]
Length=260

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 131/160 (82%), Gaps = 2/160 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN--SASG*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E N HLSD GLA+L P+ ++ ++     + G  APE +MSG YT+KSDVYSFG
Sbjct  82   ANILLDEEHNAHLSDCGLAALTPNTERQVSTEVVGSFGYSAPEFSMSGIYTVKSDVYSFG  141

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD
Sbjct  142  VVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFAD  201

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            +IALCVQPEPEFRPPMSEVV+ LVRL+QRA++ RR  G +
Sbjct  202  IIALCVQPEPEFRPPMSEVVQQLVRLMQRASIVRRQSGEE  241



>emb|CDY33226.1| BnaC01g36990D [Brassica napus]
Length=711

 Score =   246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 145/171 (85%), Gaps = 5/171 (3%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE +PHLSD+GLAS +P  ++ LNQN   G  APEV+MS QY++KSDVYSFGV 
Sbjct  545  ANILLDSELSPHLSDAGLASFLPTANELLNQND-EGYNAPEVSMSDQYSLKSDVYSFGVV  603

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVI
Sbjct  604  MLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVI  663

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  254
            ALCVQPEPEFRPPMSEVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  664  ALCVQPEPEFRPPMSEVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  710



>ref|XP_002461023.1| hypothetical protein SORBIDRAFT_02g039370 [Sorghum bicolor]
 gb|EER97544.1| hypothetical protein SORBIDRAFT_02g039370 [Sorghum bicolor]
Length=718

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 142/174 (82%), Gaps = 6/174 (3%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDED-QALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLD E NPHLSDSG A L+ +++ Q  ++NS  G  APEV +SGQY++KSDVYSFGV
Sbjct  550  SNILLDGELNPHLSDSGFAGLLSNQEFQESDENS--GYRAPEVILSGQYSLKSDVYSFGV  607

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFD SRPRPEQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD 
Sbjct  608  VMLELLTGRKPFDRSRPRPEQSLVRWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADA  667

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYEL  248
            IALCVQPEPEFRPPMSEVV++LVRLVQRANM+R     +S++R       +YE 
Sbjct  668  IALCVQPEPEFRPPMSEVVQSLVRLVQRANMTRM---HESQSRRHGESGGDYEF  718



>ref|NP_001173462.1| Os03g0397700 [Oryza sativa Japonica Group]
 dbj|BAH92190.1| Os03g0397700, partial [Oryza sativa Japonica Group]
Length=216

 Score =   232 bits (591),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 135/163 (83%), Gaps = 3/163 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDED-QALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLD+E NPH+SD G A LIP+++ Q  ++NS  G  APEV MSGQY+ KSDVYSFGV
Sbjct  46   SNILLDNELNPHVSDCGFAELIPNQELQESDENS--GYRAPEVTMSGQYSQKSDVYSFGV  103

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR  FD S+P P+QSLVRWA+PQLHDIDAL +MVDPAL+GLYP KSLSRFAD 
Sbjct  104  VMLELLTGRKAFDRSQPWPQQSLVRWASPQLHDIDALDQMVDPALEGLYPAKSLSRFADA  163

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTR  281
            IALCVQPEPEFRPPMSEVV++LVRLVQR++M     G +S +R
Sbjct  164  IALCVQPEPEFRPPMSEVVQSLVRLVQRSSMGSVLSGGESISR  206



>gb|AFQ91933.1| leucine-rich repeat receptor-like kinase [Brassica rapa subsp. 
oleifera]
Length=707

 Score =   245 bits (626),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 138/153 (90%), Gaps = 1/153 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            AN+LLDSE NPHLSDSGLAS +P  ++ LNQN   G  APEV+MSGQY+++SDVYSFG+ 
Sbjct  553  ANILLDSELNPHLSDSGLASFLPTANELLNQND-EGYSAPEVSMSGQYSLQSDVYSFGIV  611

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI
Sbjct  612  MLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  671

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            ALCVQPEPEFRPPMSEVV+ALV LVQRANMS+R
Sbjct  672  ALCVQPEPEFRPPMSEVVQALVVLVQRANMSKR  704



>gb|ABQ53156.1| leucine-rich repeat protein [Triticum aestivum]
Length=263

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 131/160 (82%), Gaps = 2/160 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN--SASG*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E N HLSD GLA+L P+ ++ ++     + G  APE +MSG YT+KSDVYSFG
Sbjct  85   ANILLDEEHNAHLSDCGLAALTPNTERQVSTEVVGSFGYSAPEFSMSGIYTVKSDVYSFG  144

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD
Sbjct  145  VVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFAD  204

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            +IALCVQPEPEFRPPMSEVV+ LVRL+QRA++ RR  G +
Sbjct  205  IIALCVQPEPEFRPPMSEVVQQLVRLMQRASIVRRQSGEE  244



>emb|CDY36601.1| BnaC06g06540D [Brassica napus]
Length=698

 Score =   243 bits (621),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 142/168 (85%), Gaps = 5/168 (3%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            +N+LLDSE NPHLSDSGLASL+P  +  L   +  G  APEV+MSGQY++KSDVY+FGV 
Sbjct  531  SNILLDSEMNPHLSDSGLASLLPTANVQLLNQTDEGYSAPEVSMSGQYSMKSDVYTFGVV  590

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVI
Sbjct  591  MLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALEGLYPVKSLSRFADVI  650

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  263
            ALCVQ EPEFRPPMSEVV++LV LVQRANMS+RT       RSGSAD+
Sbjct  651  ALCVQAEPEFRPPMSEVVQSLVVLVQRANMSKRT-----SKRSGSADA  693



>ref|XP_010235400.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X1 [Brachypodium distachyon]
Length=712

 Score =   243 bits (620),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 140/169 (83%), Gaps = 4/169 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDED-QALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLD+E NPHLSDSG A LIP+++ Q   +NS  G  APE+ MSGQY++KSDVYSFGV
Sbjct  543  SNILLDNELNPHLSDSGYADLIPNQEFQESEENS--GYRAPELTMSGQYSLKSDVYSFGV  600

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFD SRPR EQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD 
Sbjct  601  VMLELLTGRKPFDRSRPRSEQSLVRWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADA  660

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD-SRTRSGSAD  266
            IALCVQ EPEFRPPMSEVV++LVRLVQRAN++R +   + SR  S S D
Sbjct  661  IALCVQAEPEFRPPMSEVVQSLVRLVQRANITRMSSSENYSRRHSESGD  709



>dbj|BAJ87185.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=597

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 131/153 (86%), Gaps = 3/153 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDED-QALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +NVLLDSE NPHLSDSG   LIP+++ Q   +NS  G  APEVAMSGQY++KSDVYSFGV
Sbjct  428  SNVLLDSELNPHLSDSGYGDLIPNQEFQESEENS--GYRAPEVAMSGQYSLKSDVYSFGV  485

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFD SRPR EQSLVRWA PQLHDIDAL +MVDPAL+GLY  KSLSRFAD 
Sbjct  486  VMLELLTGRKPFDRSRPRSEQSLVRWAAPQLHDIDALDQMVDPALQGLYHSKSLSRFADA  545

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSR  311
            IALCVQ EPEFRPPMSEVV++LVRLVQRANM+R
Sbjct  546  IALCVQAEPEFRPPMSEVVQSLVRLVQRANMTR  578



>ref|XP_010686780.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Beta vulgaris 
subsp. vulgaris]
Length=712

 Score =   243 bits (620),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 133/161 (83%), Gaps = 2/161 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD EFNPHLSD GLA+L P+ E Q   Q   S G  APE A+SG YT KSDVYSFG
Sbjct  536  ANILLDEEFNPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGIYTTKSDVYSFG  595

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSRPR EQSLVRWA+PQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  596  VVMLELLTGRKPLDSSRPRSEQSLVRWASPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  655

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADS  290
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA +++R    DS
Sbjct  656  IIALCVQPEPEFRPPMSEVVQALVRLVQRAGVAKRRSSDDS  696



>ref|XP_006449793.1| hypothetical protein CICLE_v10014418mg [Citrus clementina]
 gb|ESR63033.1| hypothetical protein CICLE_v10014418mg [Citrus clementina]
Length=698

 Score =   243 bits (619),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN--SASG*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ ++ ++     A G  APE A+SG YT+KSDVYSFG
Sbjct  522  ANILLDDELNPHLSDCGLAALTPNTERQVSTQMVGAFGYSAPEFALSGIYTVKSDVYSFG  581

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSRPR EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  582  VVMLELLTGRKPLDSSRPRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  641

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  642  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKR  676



>ref|XP_006467381.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Citrus sinensis]
Length=696

 Score =   242 bits (618),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN--SASG*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ ++ ++     A G  APE A+SG YT+KSDVYSFG
Sbjct  520  ANILLDDELNPHLSDCGLAALTPNTERQVSTQMVGAFGYSAPEFALSGIYTVKSDVYSFG  579

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSRPR EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  580  VVMLELLTGRKPLDSSRPRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  639

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  640  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKR  674



>dbj|BAG99361.1| unnamed protein product [Oryza sativa Japonica Group]
Length=683

 Score =   242 bits (617),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 138/172 (80%), Gaps = 4/172 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            +N+ LD+E NPHLSDSG A LIP+ +  ++ +  SG  APEV MSGQY++KSDVYSFGV 
Sbjct  512  SNIFLDNELNPHLSDSGFADLIPNRESQVS-DEDSGYRAPEVTMSGQYSVKSDVYSFGVV  570

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFD SRPR EQSLV WATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD I
Sbjct  571  MLELLTGRKPFDRSRPRSEQSLVGWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAI  630

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRT--RSGSADSQE  257
            ALCVQ EPEFRPPMSEVV+ LVRLVQRANM+R   GAD  +  R G +  QE
Sbjct  631  ALCVQSEPEFRPPMSEVVQLLVRLVQRANMTRMC-GADGHSWRRDGESRDQE  681



>gb|AAV64203.1| leucine-rich repeat transmembrane protein kinase 1-like protein 
[Zea mays]
 gb|AAV64241.1| leucine-rich repeat transmembrane protein kinase 1-like protein 
[Zea mays]
 tpg|DAA63621.1| TPA: putative STRUBBELIG family receptor protein kinase [Zea 
mays]
Length=693

 Score =   242 bits (617),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 141/174 (81%), Gaps = 6/174 (3%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDED-QALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLD E  PHLSDSG A L+ +++ Q  ++NS  G  APEV ++GQY++KSDVYSFGV
Sbjct  525  SNILLDGELTPHLSDSGFAGLLANQEFQESDENS--GYRAPEVILAGQYSLKSDVYSFGV  582

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFD +RPRPEQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD 
Sbjct  583  VMLELLTGRKPFDRTRPRPEQSLVRWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADA  642

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYEL  248
            IALCVQPEPEFRPPMSEVV++LVRLVQRANM+R     +S++R       +YE 
Sbjct  643  IALCVQPEPEFRPPMSEVVQSLVRLVQRANMTRM---HESQSRRHGESGGDYEF  693



>ref|XP_008653346.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Zea mays]
Length=687

 Score =   242 bits (617),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 141/174 (81%), Gaps = 6/174 (3%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDED-QALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLD E  PHLSDSG A L+ +++ Q  ++NS  G  APEV ++GQY++KSDVYSFGV
Sbjct  519  SNILLDGELTPHLSDSGFAGLLANQEFQESDENS--GYRAPEVILAGQYSLKSDVYSFGV  576

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFD +RPRPEQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD 
Sbjct  577  VMLELLTGRKPFDRTRPRPEQSLVRWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADA  636

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYEL  248
            IALCVQPEPEFRPPMSEVV++LVRLVQRANM+R     +S++R       +YE 
Sbjct  637  IALCVQPEPEFRPPMSEVVQSLVRLVQRANMTRM---HESQSRRHGESGGDYEF  687



>gb|EEC82450.1| hypothetical protein OsI_26884 [Oryza sativa Indica Group]
Length=720

 Score =   242 bits (618),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 138/172 (80%), Gaps = 4/172 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            +N+ LD+E NPHLSDSG A LIP+ +  ++ +  SG  APEV MSGQY++KSDVYSFGV 
Sbjct  549  SNIFLDNELNPHLSDSGFADLIPNRESQVS-DEDSGYRAPEVTMSGQYSVKSDVYSFGVV  607

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFD SRPR EQSLV WATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD I
Sbjct  608  MLELLTGRKPFDRSRPRSEQSLVGWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAI  667

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRT--RSGSADSQE  257
            ALCVQ EPEFRPPMSEVV+ LVRLVQRANM+R   GAD  +  R G +  QE
Sbjct  668  ALCVQSEPEFRPPMSEVVQLLVRLVQRANMTRMC-GADGHSWRRDGESRDQE  718



>dbj|BAC10113.1| putative leucine-rich repeat transmembrane protein kinase 2 [Oryza 
sativa Japonica Group]
 dbj|BAC16030.1| putative leucine-rich repeat transmembrane protein kinase 2 [Oryza 
sativa Japonica Group]
 dbj|BAC21507.1| putative leucine-rich repeat transmembrane protein kinase 2 [Oryza 
sativa Japonica Group]
Length=720

 Score =   242 bits (618),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 138/172 (80%), Gaps = 4/172 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            +N+ LD+E NPHLSDSG A LIP+ +  ++ +  SG  APEV MSGQY++KSDVYSFGV 
Sbjct  549  SNIFLDNELNPHLSDSGFADLIPNRESQVS-DEDSGYRAPEVTMSGQYSVKSDVYSFGVV  607

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFD SRPR EQSLV WATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD I
Sbjct  608  MLELLTGRKPFDRSRPRSEQSLVGWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAI  667

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRT--RSGSADSQE  257
            ALCVQ EPEFRPPMSEVV+ LVRLVQRANM+R   GAD  +  R G +  QE
Sbjct  668  ALCVQSEPEFRPPMSEVVQLLVRLVQRANMTRMC-GADGHSWRRDGESRDQE  718



>emb|CDY24077.1| BnaA06g00750D [Brassica napus]
Length=719

 Score =   242 bits (618),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 141/168 (84%), Gaps = 5/168 (3%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            +N+LLDSE NPHLSDSGLAS +P  +  L   +  G  APEV+MSGQY++KSDVYSFGV 
Sbjct  552  SNILLDSEMNPHLSDSGLASFLPTANVQLLNQTDEGYSAPEVSMSGQYSLKSDVYSFGVV  611

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVI
Sbjct  612  MLELLTGRKPFDSTRSRAEQSLVRWATPQLHDIDALGKMVDPALEGLYPVKSLSRFADVI  671

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  263
            ALCVQ EPEFRPPMSEVV++LV LVQRANMS+RT       RSGSAD+
Sbjct  672  ALCVQAEPEFRPPMSEVVQSLVVLVQRANMSKRT-----SKRSGSADA  714



>gb|KDO78347.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
Length=720

 Score =   242 bits (618),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN--SASG*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ ++ ++     A G  APE A+SG YT+KSDVYSFG
Sbjct  544  ANILLDDELNPHLSDCGLAALTPNTERQVSTQMVGAFGYSAPEFALSGIYTVKSDVYSFG  603

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSRPR EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  604  VVMLELLTGRKPLDSSRPRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  663

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  664  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKR  698



>ref|XP_006467380.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Citrus sinensis]
Length=720

 Score =   242 bits (618),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN--SASG*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ ++ ++     A G  APE A+SG YT+KSDVYSFG
Sbjct  544  ANILLDDELNPHLSDCGLAALTPNTERQVSTQMVGAFGYSAPEFALSGIYTVKSDVYSFG  603

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSRPR EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  604  VVMLELLTGRKPLDSSRPRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  663

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  664  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKR  698



>ref|NP_001060286.1| Os07g0618400 [Oryza sativa Japonica Group]
 dbj|BAF22200.1| Os07g0618400 [Oryza sativa Japonica Group]
Length=732

 Score =   242 bits (618),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 138/172 (80%), Gaps = 4/172 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            +N+ LD+E NPHLSDSG A LIP+ +  ++ +  SG  APEV MSGQY++KSDVYSFGV 
Sbjct  561  SNIFLDNELNPHLSDSGFADLIPNRESQVS-DEDSGYRAPEVTMSGQYSVKSDVYSFGVV  619

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFD SRPR EQSLV WATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD I
Sbjct  620  MLELLTGRKPFDRSRPRSEQSLVGWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAI  679

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRT--RSGSADSQE  257
            ALCVQ EPEFRPPMSEVV+ LVRLVQRANM+R   GAD  +  R G +  QE
Sbjct  680  ALCVQSEPEFRPPMSEVVQLLVRLVQRANMTRMC-GADGHSWRRDGESRDQE  730



>ref|XP_008653345.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Zea mays]
 tpg|DAA63620.1| TPA: putative STRUBBELIG family receptor protein kinase [Zea 
mays]
Length=716

 Score =   242 bits (617),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 141/174 (81%), Gaps = 6/174 (3%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDED-QALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLD E  PHLSDSG A L+ +++ Q  ++NS  G  APEV ++GQY++KSDVYSFGV
Sbjct  548  SNILLDGELTPHLSDSGFAGLLANQEFQESDENS--GYRAPEVILAGQYSLKSDVYSFGV  605

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFD +RPRPEQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD 
Sbjct  606  VMLELLTGRKPFDRTRPRPEQSLVRWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADA  665

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYEL  248
            IALCVQPEPEFRPPMSEVV++LVRLVQRANM+R     +S++R       +YE 
Sbjct  666  IALCVQPEPEFRPPMSEVVQSLVRLVQRANMTRM---HESQSRRHGESGGDYEF  716



>ref|XP_006449794.1| hypothetical protein CICLE_v10014418mg [Citrus clementina]
 gb|ESR63034.1| hypothetical protein CICLE_v10014418mg [Citrus clementina]
Length=720

 Score =   242 bits (617),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN--SASG*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ ++ ++     A G  APE A+SG YT+KSDVYSFG
Sbjct  544  ANILLDDELNPHLSDCGLAALTPNTERQVSTQMVGAFGYSAPEFALSGIYTVKSDVYSFG  603

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSRPR EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  604  VVMLELLTGRKPLDSSRPRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  663

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  664  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKR  698



>gb|KJB67279.1| hypothetical protein B456_010G183400 [Gossypium raimondii]
Length=651

 Score =   241 bits (614),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 131/155 (85%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVYSFG
Sbjct  475  ANILLDEELNPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFG  534

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YPVKSLSRFAD
Sbjct  535  VVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPVKSLSRFAD  594

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  595  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKR  629



>ref|XP_010538738.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Tarenaya 
hassleriana]
Length=701

 Score =   241 bits (616),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 131/157 (83%), Gaps = 3/157 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G   PE A+SG YTIKSDVYSFG
Sbjct  525  ANILLDDELNPHLSDCGLAALTPNTERQVSTQMVGSFGYSPPEFALSGVYTIKSDVYSFG  584

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSRPRPEQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD
Sbjct  585  VVMLELLTGRKPLDSSRPRPEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFAD  644

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRAN-MSRRT  305
            +IALC+QPEPEFRPPMSEVV+ LVRLVQRA+ M RRT
Sbjct  645  IIALCIQPEPEFRPPMSEVVQQLVRLVQRASVMKRRT  681



>ref|XP_010928424.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Elaeis guineensis]
Length=619

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 132/158 (84%), Gaps = 2/158 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN--SASG*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ ++ ++     + G  APE AMSG YT+KSDVYSFG
Sbjct  441  ANILLDEELNPHLSDCGLAALTPNTERQVSTEVVGSFGYSAPEFAMSGIYTVKSDVYSFG  500

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  501  VVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  560

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFG  299
            +IALCVQPEPEFRPPMSEVV+ LVRL+QRA++ RR+ G
Sbjct  561  IIALCVQPEPEFRPPMSEVVQQLVRLMQRASIVRRSSG  598



>ref|XP_008355924.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Malus domestica]
Length=719

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 131/156 (84%), Gaps = 2/156 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVYSFG
Sbjct  544  ANILLDEELNPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFG  603

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD
Sbjct  604  VVMLELLTGRKPLDSSRSRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFAD  663

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRT  305
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ RR+
Sbjct  664  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVRRS  699



>gb|KJB67276.1| hypothetical protein B456_010G183400 [Gossypium raimondii]
Length=710

 Score =   241 bits (614),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 131/155 (85%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVYSFG
Sbjct  534  ANILLDEELNPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFG  593

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YPVKSLSRFAD
Sbjct  594  VVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPVKSLSRFAD  653

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  654  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKR  688



>ref|XP_007026174.1| STRUBBELIG-receptor family 8 isoform 2 [Theobroma cacao]
 gb|EOY28796.1| STRUBBELIG-receptor family 8 isoform 2 [Theobroma cacao]
Length=624

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVYSFG
Sbjct  448  ANILLDEELNPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGLYTVKSDVYSFG  507

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  508  VVMLELLTGRKPLDSSRTRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  567

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  568  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKR  602



>ref|XP_009357210.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Pyrus x 
bretschneideri]
Length=719

 Score =   240 bits (613),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 131/156 (84%), Gaps = 2/156 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVYSFG
Sbjct  544  ANILLDEELNPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFG  603

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  604  VVMLELLTGRKPLDSSRSRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  663

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRT  305
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ RR+
Sbjct  664  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVRRS  699



>ref|XP_002518426.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
 gb|EEF43813.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
Length=640

 Score =   239 bits (609),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVYSFG
Sbjct  464  ANILLDEELNPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFG  523

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  524  VVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  583

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  584  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKR  618



>ref|NP_001119030.1| STRUBBELIG-receptor family 8 protein [Arabidopsis thaliana]
 gb|AEE84561.1| STRUBBELIG-receptor family 8 protein [Arabidopsis thaliana]
Length=562

 Score =   237 bits (604),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 132/161 (82%), Gaps = 2/161 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSDSGLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVY+FG
Sbjct  386  ANILLDEELNPHLSDSGLAALTPNTERQVSTQVVGSFGYSAPEFALSGIYTVKSDVYTFG  445

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD
Sbjct  446  VVMLELLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFAD  505

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADS  290
            +IALC+QPEPEFRPPMSEVV+ LVRLVQRA++ +R    D+
Sbjct  506  IIALCIQPEPEFRPPMSEVVQQLVRLVQRASVVKRRSSDDT  546



>ref|XP_009147586.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Brassica rapa]
Length=719

 Score =   240 bits (612),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 140/168 (83%), Gaps = 5/168 (3%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            +N+LLDSE NPHLSDSGLAS +P  +  L   +  G  A EV+MSGQY++KSDVYSFGV 
Sbjct  552  SNILLDSEMNPHLSDSGLASFLPTANVQLLNQTDEGYSASEVSMSGQYSLKSDVYSFGVV  611

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR PFDS+R R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVI
Sbjct  612  MLELLTGRKPFDSTRSRAEQSLVRWATPQLHDIDALGKMVDPALEGLYPVKSLSRFADVI  671

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  263
            ALCVQ EPEFRPPMSEVV++LV LVQRANMS+RT       RSGSAD+
Sbjct  672  ALCVQAEPEFRPPMSEVVQSLVVLVQRANMSKRT-----SKRSGSADT  714



>ref|XP_010539255.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X1 [Tarenaya 
hassleriana]
Length=702

 Score =   239 bits (611),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVYSFG
Sbjct  526  ANILLDEELNPHLSDCGLAALTPNTERQVSTQVVGSFGYSAPEFALSGVYTVKSDVYSFG  585

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSRPR EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD
Sbjct  586  VVMLELLTGRKPLDSSRPRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFAD  645

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALC+QPEPEFRPPMSEVV+ LVRLVQRA++ +R
Sbjct  646  IIALCIQPEPEFRPPMSEVVQQLVRLVQRASVIKR  680



>ref|XP_002965192.1| hypothetical protein SELMODRAFT_83158 [Selaginella moellendorffii]
 gb|EFJ34030.1| hypothetical protein SELMODRAFT_83158 [Selaginella moellendorffii]
Length=362

 Score =   231 bits (589),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 130/159 (82%), Gaps = 3/159 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIP---DEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSF  596
            AN+LLD + +PHL+D GLA+L     D   A     + G  APE AMSG YT+KSDVYSF
Sbjct  187  ANILLDDDMSPHLTDCGLAALSSTSSDRQVAAQMLGSFGYSAPEFAMSGVYTVKSDVYSF  246

Query  595  GVAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFA  416
            GV MLELLTGR P DSSR R EQSLVRWATPQLHDIDALSKMVDPALKG+YP KSLSRFA
Sbjct  247  GVVMLELLTGRKPLDSSRARSEQSLVRWATPQLHDIDALSKMVDPALKGIYPAKSLSRFA  306

Query  415  DVIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFG  299
            DVI+ CVQPEPEFRPPMSEVV++LVRL+QRA++S+R+ G
Sbjct  307  DVISSCVQPEPEFRPPMSEVVQSLVRLMQRASLSKRSSG  345



>ref|XP_010539262.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X2 [Tarenaya 
hassleriana]
Length=699

 Score =   239 bits (610),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVYSFG
Sbjct  523  ANILLDEELNPHLSDCGLAALTPNTERQVSTQVVGSFGYSAPEFALSGVYTVKSDVYSFG  582

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSRPR EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD
Sbjct  583  VVMLELLTGRKPLDSSRPRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFAD  642

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALC+QPEPEFRPPMSEVV+ LVRLVQRA++ +R
Sbjct  643  IIALCIQPEPEFRPPMSEVVQQLVRLVQRASVIKR  677



>ref|XP_010539270.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X3 [Tarenaya 
hassleriana]
Length=685

 Score =   239 bits (609),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVYSFG
Sbjct  509  ANILLDEELNPHLSDCGLAALTPNTERQVSTQVVGSFGYSAPEFALSGVYTVKSDVYSFG  568

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSRPR EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD
Sbjct  569  VVMLELLTGRKPLDSSRPRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFAD  628

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALC+QPEPEFRPPMSEVV+ LVRLVQRA++ +R
Sbjct  629  IIALCIQPEPEFRPPMSEVVQQLVRLVQRASVIKR  663



>ref|XP_010928422.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010928423.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Elaeis guineensis]
Length=720

 Score =   239 bits (610),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 132/158 (84%), Gaps = 2/158 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN--SASG*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ ++ ++     + G  APE AMSG YT+KSDVYSFG
Sbjct  542  ANILLDEELNPHLSDCGLAALTPNTERQVSTEVVGSFGYSAPEFAMSGIYTVKSDVYSFG  601

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  602  VVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  661

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFG  299
            +IALCVQPEPEFRPPMSEVV+ LVRL+QRA++ RR+ G
Sbjct  662  IIALCVQPEPEFRPPMSEVVQQLVRLMQRASIVRRSSG  699



>ref|XP_007026173.1| STRUBBELIG-receptor family 8 isoform 1 [Theobroma cacao]
 gb|EOY28795.1| STRUBBELIG-receptor family 8 isoform 1 [Theobroma cacao]
Length=719

 Score =   239 bits (610),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVYSFG
Sbjct  543  ANILLDEELNPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGLYTVKSDVYSFG  602

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  603  VVMLELLTGRKPLDSSRTRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  662

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  663  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKR  697



>ref|XP_010052885.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X3 [Eucalyptus 
grandis]
Length=627

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 130/158 (82%), Gaps = 7/158 (4%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSAS-----G*GAPEVAMSGQYTIKSDVY  602
            AN+LLD E NPHLSD GLA+L P+ ++   Q SA      G  APE A+SG YT+KSDVY
Sbjct  450  ANILLDEELNPHLSDCGLAALTPNTER--QQVSAQMVGQFGYSAPEFALSGVYTVKSDVY  507

Query  601  SFGVAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSR  422
            SFGV MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSR
Sbjct  508  SFGVVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSR  567

Query  421  FADVIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            FAD+IALCVQPEPEFRPPMSEVV+ LVRLVQRA +S+R
Sbjct  568  FADIIALCVQPEPEFRPPMSEVVQQLVRLVQRAGISKR  605



>ref|XP_007213628.1| hypothetical protein PRUPE_ppa002088mg [Prunus persica]
 gb|EMJ14827.1| hypothetical protein PRUPE_ppa002088mg [Prunus persica]
Length=718

 Score =   239 bits (609),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVYSFG
Sbjct  542  ANILLDEELNPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFG  601

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  602  VVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  661

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  662  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKR  696



>ref|XP_008384096.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Malus domestica]
Length=719

 Score =   239 bits (609),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 132/156 (85%), Gaps = 2/156 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN--SASG*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ ++ ++     + G  APE A+SG YT+KSDVYSFG
Sbjct  544  ANILLDEELNPHLSDCGLAALTPNTERQVSPQMVGSFGYSAPEFALSGVYTVKSDVYSFG  603

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  604  VVMLELLTGRKPLDSSRSRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  663

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRT  305
            VIALCVQPEPEFRPPMSEVV+ALVRLVQRA++ RR+
Sbjct  664  VIALCVQPEPEFRPPMSEVVQALVRLVQRASVVRRS  699



>ref|XP_002979973.1| hypothetical protein SELMODRAFT_112070 [Selaginella moellendorffii]
 ref|XP_002991949.1| hypothetical protein SELMODRAFT_186440 [Selaginella moellendorffii]
 gb|EFJ07060.1| hypothetical protein SELMODRAFT_186440 [Selaginella moellendorffii]
 gb|EFJ18843.1| hypothetical protein SELMODRAFT_112070 [Selaginella moellendorffii]
Length=343

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 129/160 (81%), Gaps = 3/160 (2%)
 Frame = -1

Query  763  NVLLDSEFNPHLSDSGLASLIP--DEDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            N+LLD E NP +SD GLA+L P   E Q  +Q   S G  APE AMSG YT+KSDVYSFG
Sbjct  165  NILLDEELNPRVSDCGLAALAPYGAERQVSSQMLVSFGYSAPEFAMSGVYTVKSDVYSFG  224

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR   DSSR R EQSLVRWA PQLHDIDALS+MVDPALKG+YP KSLSRFAD
Sbjct  225  VVMLELLTGRKSLDSSRSRAEQSLVRWAVPQLHDIDALSRMVDPALKGIYPAKSLSRFAD  284

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            +I+ CVQPEPEFRPPMSEVV+ALVRL+QRA++S+R   AD
Sbjct  285  IISSCVQPEPEFRPPMSEVVQALVRLMQRASLSKRRLTAD  324



>ref|XP_009357487.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Pyrus x 
bretschneideri]
Length=719

 Score =   238 bits (608),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 130/156 (83%), Gaps = 2/156 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVYSFG
Sbjct  544  ANILLDEELNPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFG  603

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P D SR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  604  VVMLELLTGRKPLDCSRSRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  663

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRT  305
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ RR+
Sbjct  664  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVRRS  699



>ref|XP_010943264.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Elaeis guineensis]
Length=690

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 132/158 (84%), Gaps = 2/158 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN--SASG*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ ++ ++     + G  APE AMSG YT+KSDVYSFG
Sbjct  512  ANILLDEELNPHLSDCGLAALTPNTERQVSTEMVGSFGYSAPEFAMSGVYTVKSDVYSFG  571

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            + MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  572  IVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALAKMVDPALNGIYPAKSLSRFAD  631

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFG  299
            VIALCVQPEPEFRPPMSEVV+ LVRL+QRA++ RR+ G
Sbjct  632  VIALCVQPEPEFRPPMSEVVQQLVRLMQRASIVRRSSG  669



>gb|EMT22844.1| hypothetical protein F775_52608 [Aegilops tauschii]
Length=606

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 132/159 (83%), Gaps = 4/159 (3%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            AN+LLD E N HLSD GLA+L P+ E QA   N+++   APE +MSG YT+KSDVYSFGV
Sbjct  432  ANILLDEEHNAHLSDCGLAALTPNTERQASITNTSN---APEFSMSGIYTVKSDVYSFGV  488

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR P DSSR R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD+
Sbjct  489  VMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADI  548

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            IALCVQPEPEFRPPMSEVV+ LVRL+QRA++ RR  G +
Sbjct  549  IALCVQPEPEFRPPMSEVVQQLVRLMQRASIVRRQSGEE  587



>ref|XP_010052884.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X2 [Eucalyptus 
grandis]
 gb|KCW77014.1| hypothetical protein EUGRSUZ_D01360 [Eucalyptus grandis]
Length=720

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 129/155 (83%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSAS--G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ ++ ++       G  APE A+SG YT+KSDVYSFG
Sbjct  544  ANILLDEELNPHLSDCGLAALTPNTERQVSAQMVGQFGYSAPEFALSGVYTVKSDVYSFG  603

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  604  VVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  663

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ LVRLVQRA +S+R
Sbjct  664  IIALCVQPEPEFRPPMSEVVQQLVRLVQRAGISKR  698



>ref|XP_010244139.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Nelumbo 
nucifera]
Length=729

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 132/161 (82%), Gaps = 2/161 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE AMSG YT+KSDV+SFG
Sbjct  553  ANILLDEELNPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFAMSGIYTVKSDVHSFG  612

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  613  VVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  672

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADS  290
            +IALCVQPEPEFRPPMSEVV+ALVRL+QRA++ +R    DS
Sbjct  673  IIALCVQPEPEFRPPMSEVVQALVRLMQRASVVKRRLSDDS  713



>ref|XP_004486188.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Cicer arietinum]
Length=680

 Score =   237 bits (605),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 129/155 (83%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVYSFG
Sbjct  504  ANILLDEELNPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFG  563

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDALSKMVDP L G+YP KSLSRFAD
Sbjct  564  VVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALSKMVDPCLNGMYPAKSLSRFAD  623

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  624  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKR  658



>ref|XP_008224758.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Prunus mume]
Length=721

 Score =   238 bits (607),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVYSFG
Sbjct  545  ANILLDEELNPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFG  604

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  605  VVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  664

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  665  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKR  699



>gb|KDP20703.1| hypothetical protein JCGZ_21174 [Jatropha curcas]
Length=721

 Score =   238 bits (607),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVYSFG
Sbjct  545  ANILLDEELNPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFG  604

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  605  VVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  664

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  665  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKR  699



>ref|XP_006284970.1| hypothetical protein CARUB_v10006274mg [Capsella rubella]
 gb|EOA17868.1| hypothetical protein CARUB_v10006274mg [Capsella rubella]
Length=705

 Score =   238 bits (606),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 132/161 (82%), Gaps = 2/161 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSDSGLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVY+FG
Sbjct  529  ANILLDEELNPHLSDSGLAALTPNTERQVSTQVVGSFGYSAPEFALSGVYTVKSDVYTFG  588

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD
Sbjct  589  VVMLELLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFAD  648

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADS  290
            +IALC+QPEPEFRPPMSEVV+ LVRLVQRA++ +R    DS
Sbjct  649  IIALCIQPEPEFRPPMSEVVQQLVRLVQRASVVKRRSSDDS  689



>ref|XP_010943263.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Elaeis guineensis]
Length=742

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 132/158 (84%), Gaps = 2/158 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN--SASG*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ ++ ++     + G  APE AMSG YT+KSDVYSFG
Sbjct  564  ANILLDEELNPHLSDCGLAALTPNTERQVSTEMVGSFGYSAPEFAMSGVYTVKSDVYSFG  623

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            + MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  624  IVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALAKMVDPALNGIYPAKSLSRFAD  683

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFG  299
            VIALCVQPEPEFRPPMSEVV+ LVRL+QRA++ RR+ G
Sbjct  684  VIALCVQPEPEFRPPMSEVVQQLVRLMQRASIVRRSSG  721



>ref|XP_010099162.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Morus notabilis]
 gb|EXB77034.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Morus notabilis]
Length=728

 Score =   238 bits (607),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSAS--G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ ++ ++       G  APE A+SG YT+KSDVYSFG
Sbjct  552  ANILLDEELNPHLSDCGLAALTPNTERQVSTQMVGQFGYSAPEFALSGVYTVKSDVYSFG  611

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  612  VVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  671

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  672  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVIKR  706



>ref|XP_010448928.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Camelina 
sativa]
Length=704

 Score =   237 bits (605),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSDSGLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVY+FG
Sbjct  528  ANILLDEELNPHLSDSGLAALTPNTERQVSTQIVGSFGYSAPEFALSGVYTVKSDVYTFG  587

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD
Sbjct  588  VVMLELLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFAD  647

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALC+QPEPEFRPPMSEVV+ LVRLVQRA++ +R
Sbjct  648  IIALCIQPEPEFRPPMSEVVQQLVRLVQRASVVKR  682



>gb|EMS51823.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Triticum urartu]
Length=630

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 132/159 (83%), Gaps = 4/159 (3%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            AN+LLD E N HLSD GLA+L P+ E QA   N+++   APE +MSG YT+KSDVYSFGV
Sbjct  456  ANILLDEEHNAHLSDCGLAALTPNTERQASITNTSN---APEFSMSGIYTVKSDVYSFGV  512

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR P DSSR R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD+
Sbjct  513  VMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADI  572

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            IALCVQPEPEFRPPMSEVV+ LVRL+QRA++ RR  G +
Sbjct  573  IALCVQPEPEFRPPMSEVVQQLVRLMQRASIVRRQSGEE  611



>ref|XP_010439362.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Camelina sativa]
Length=703

 Score =   237 bits (605),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSDSGLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVY+FG
Sbjct  527  ANILLDEELNPHLSDSGLAALTPNTERQVSTQIVGSFGYSAPEFALSGVYTVKSDVYTFG  586

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD
Sbjct  587  VVMLELLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFAD  646

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALC+QPEPEFRPPMSEVV+ LVRLVQRA++ +R
Sbjct  647  IIALCIQPEPEFRPPMSEVVQQLVRLVQRASVVKR  681



>ref|XP_011086205.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Sesamum indicum]
Length=634

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 131/156 (84%), Gaps = 3/156 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN---SASG*GAPEVAMSGQYTIKSDVYSF  596
            AN+LLD E NPHLSD GLA+L P+ ++ ++      + G  APE A+SG YT+KSDVYSF
Sbjct  458  ANILLDEELNPHLSDCGLAALGPNTERQVSSTQMIGSFGYSAPEFALSGIYTVKSDVYSF  517

Query  595  GVAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFA  416
            GV MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFA
Sbjct  518  GVVMLELLTGRKPLDSSRARSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFA  577

Query  415  DVIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            DVIALCVQPEPEFRPPMSEVV+ALVRL+QRA++ +R
Sbjct  578  DVIALCVQPEPEFRPPMSEVVQALVRLMQRASIVKR  613



>ref|XP_008458999.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X2 [Cucumis 
melo]
Length=612

 Score =   235 bits (600),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN--SASG*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD + NPHLSD GLA+L P+ ++ ++     + G  APE A+SG YT+KSDVYSFG
Sbjct  436  ANILLDEDLNPHLSDCGLAALTPNTERQISTQMVGSFGYSAPEFALSGIYTVKSDVYSFG  495

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD
Sbjct  496  VVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPTLNGMYPAKSLSRFAD  555

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  556  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKR  590



>gb|KFK28787.1| hypothetical protein AALP_AA7G048200 [Arabis alpina]
Length=694

 Score =   237 bits (604),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 132/161 (82%), Gaps = 2/161 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSDSGLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVY+FG
Sbjct  518  ANILLDEELNPHLSDSGLAALTPNTERQVSTQVVGSFGYSAPEFALSGVYTVKSDVYTFG  577

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD
Sbjct  578  VVMLELLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFAD  637

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADS  290
            +IALC+QPEPEFRPPMSEVV+ LVRLVQRA++ +R    D+
Sbjct  638  IIALCIQPEPEFRPPMSEVVQQLVRLVQRASVVKRRSSDDT  678



>emb|CDP04441.1| unnamed protein product [Coffea canephora]
Length=721

 Score =   237 bits (605),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 131/156 (84%), Gaps = 3/156 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN---SASG*GAPEVAMSGQYTIKSDVYSF  596
            AN+LLD E  PHLSD GLA+L P+ ++ ++      + G  APE A+SG YTIKSDVYSF
Sbjct  545  ANILLDEELTPHLSDCGLAALTPNTERQVSSTQMVGSFGYSAPEFALSGIYTIKSDVYSF  604

Query  595  GVAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFA  416
            GV MLELLTGR P DSSRPR EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFA
Sbjct  605  GVVMLELLTGRKPLDSSRPRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFA  664

Query  415  DVIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            D+IALCVQPEPEFRPPMSEVV+ALVRL+QRA++ +R
Sbjct  665  DIIALCVQPEPEFRPPMSEVVQALVRLMQRASVVKR  700



>ref|XP_008803525.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Phoenix 
dactylifera]
 ref|XP_008803526.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Phoenix 
dactylifera]
Length=739

 Score =   238 bits (606),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 132/158 (84%), Gaps = 2/158 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN--SASG*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ ++ ++     + G  APE AMSG YT+KSDVYSFG
Sbjct  561  ANILLDEELNPHLSDCGLAALTPNTERQVSTEVVGSFGYSAPEFAMSGVYTVKSDVYSFG  620

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            + MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  621  IVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  680

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFG  299
            +IALCVQPEPEFRPP+SEVV+ LVRL+QRA+M RR+ G
Sbjct  681  IIALCVQPEPEFRPPISEVVQQLVRLMQRASMVRRSSG  718



>ref|XP_011002570.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Populus euphratica]
Length=692

 Score =   237 bits (604),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVYSFG
Sbjct  516  ANILLDEELNPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGIYTVKSDVYSFG  575

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  576  VVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  635

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  636  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKR  670



>ref|XP_010434074.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Camelina 
sativa]
Length=703

 Score =   237 bits (604),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSDSGLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVY+FG
Sbjct  527  ANILLDEELNPHLSDSGLAALTPNTERQVSTQIVGSFGYSAPEFALSGVYTVKSDVYTFG  586

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD
Sbjct  587  VVMLELLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFAD  646

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALC+QPEPEFRPPMSEVV+ LVRLVQRA++ +R
Sbjct  647  IIALCIQPEPEFRPPMSEVVQQLVRLVQRASVVKR  681



>dbj|BAD37979.1| putative leucine-rich repeat transmembrane protein kinase 1 [Oryza 
sativa Japonica Group]
 dbj|BAG99301.1| unnamed protein product [Oryza sativa Japonica Group]
Length=558

 Score =   234 bits (596),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 131/160 (82%), Gaps = 2/160 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN--SASG*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E++PHLSD GLA+L P+ ++ ++     + G  APE AMSG YT+KSDVYSFG
Sbjct  381  ANILLDKEYSPHLSDCGLAALTPNPEREVSTEVFGSFGYSAPEFAMSGIYTVKSDVYSFG  440

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLT R P DSSR R EQSLV WATPQLHDIDAL+KMVDPA+ G+YP KSLSRFAD
Sbjct  441  VVMLELLTARKPLDSSRERSEQSLVTWATPQLHDIDALAKMVDPAMDGMYPAKSLSRFAD  500

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            +IALCVQPEPEFRPPMSEVV+ LVRLVQRA+M RR  G D
Sbjct  501  IIALCVQPEPEFRPPMSEVVQQLVRLVQRASMVRRQSGED  540



>ref|XP_006383864.1| hypothetical protein POPTR_0004s00710g [Populus trichocarpa]
 gb|ERP61661.1| hypothetical protein POPTR_0004s00710g [Populus trichocarpa]
Length=625

 Score =   235 bits (600),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 129/155 (83%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVYSFG
Sbjct  449  ANILLDEELNPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGIYTVKSDVYSFG  508

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD
Sbjct  509  VVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPILNGMYPAKSLSRFAD  568

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  569  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKR  603



>ref|NP_193944.2| STRUBBELIG-receptor family 8 protein [Arabidopsis thaliana]
 sp|Q6R2J8.1|SRF8_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY 8; AltName: 
Full=Leucine-rich repeat receptor kinase-like protein SRF8; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAR99876.1| strubbelig receptor family 8 [Arabidopsis thaliana]
 gb|ACN59345.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE84560.1| STRUBBELIG-receptor family 8 protein [Arabidopsis thaliana]
Length=703

 Score =   237 bits (604),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 132/161 (82%), Gaps = 2/161 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSDSGLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVY+FG
Sbjct  527  ANILLDEELNPHLSDSGLAALTPNTERQVSTQVVGSFGYSAPEFALSGIYTVKSDVYTFG  586

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD
Sbjct  587  VVMLELLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFAD  646

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADS  290
            +IALC+QPEPEFRPPMSEVV+ LVRLVQRA++ +R    D+
Sbjct  647  IIALCIQPEPEFRPPMSEVVQQLVRLVQRASVVKRRSSDDT  687



>ref|XP_007147687.1| hypothetical protein PHAVU_006G146100g [Phaseolus vulgaris]
 gb|ESW19681.1| hypothetical protein PHAVU_006G146100g [Phaseolus vulgaris]
Length=713

 Score =   237 bits (604),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 132/163 (81%), Gaps = 2/163 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVYSFG
Sbjct  537  ANILLDEELNPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFG  596

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD
Sbjct  597  VVMLELLTGRKPLDSSRIRSEQSLVRWATPQLHDIDALAKMVDPTLNGMYPAKSLSRFAD  656

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRT  284
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R    DS T
Sbjct  657  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKRRPSDDSGT  699



>ref|XP_003562663.2| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X3 [Brachypodium distachyon]
Length=1217

 Score =   241 bits (615),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 140/168 (83%), Gaps = 4/168 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDED-QALNQNSASG*GAPEVAMSGQYTIKSDVYSFGV  590
            +N+LLD+E NPHLSDSG A LIP+++ Q   +NS  G  APE+ MSGQY++KSDVYSFGV
Sbjct  551  SNILLDNELNPHLSDSGYADLIPNQEFQESEENS--GYRAPELTMSGQYSLKSDVYSFGV  608

Query  589  AMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADV  410
             MLELLTGR PFD SRPR EQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD 
Sbjct  609  VMLELLTGRKPFDRSRPRSEQSLVRWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADA  668

Query  409  IALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD-SRTRSGSA  269
            IALCVQ EPEFRPPMSEVV++LVRLVQRAN++R +   + SR  S SA
Sbjct  669  IALCVQAEPEFRPPMSEVVQSLVRLVQRANITRMSSSENYSRRHSESA  716



>ref|XP_010052883.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X1 [Eucalyptus 
grandis]
 gb|KCW77013.1| hypothetical protein EUGRSUZ_D01360 [Eucalyptus grandis]
Length=721

 Score =   237 bits (604),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 130/158 (82%), Gaps = 7/158 (4%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSAS-----G*GAPEVAMSGQYTIKSDVY  602
            AN+LLD E NPHLSD GLA+L P+ ++   Q SA      G  APE A+SG YT+KSDVY
Sbjct  544  ANILLDEELNPHLSDCGLAALTPNTER--QQVSAQMVGQFGYSAPEFALSGVYTVKSDVY  601

Query  601  SFGVAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSR  422
            SFGV MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSR
Sbjct  602  SFGVVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSR  661

Query  421  FADVIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            FAD+IALCVQPEPEFRPPMSEVV+ LVRLVQRA +S+R
Sbjct  662  FADIIALCVQPEPEFRPPMSEVVQQLVRLVQRAGISKR  699



>gb|EEC72655.1| hypothetical protein OsI_06182 [Oryza sativa Indica Group]
Length=718

 Score =   237 bits (604),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 132/160 (83%), Gaps = 2/160 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN--SASG*GAPEVAMSGQYTIKSDVYSFG  593
            +NVLLD E NPHLSD GLA+L P+ ++ ++     + G  APE AMSG YT+KSDVYSFG
Sbjct  540  SNVLLDEEHNPHLSDCGLAALTPNTERQVSTEVFGSFGYSAPEFAMSGIYTVKSDVYSFG  599

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  600  VVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  659

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            +IALCVQPEPEFRPPMSEVV+ LVRL+QRA++ RR  G +
Sbjct  660  IIALCVQPEPEFRPPMSEVVQQLVRLMQRASIVRRQSGEE  699



>ref|XP_010252506.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Nelumbo 
nucifera]
Length=730

 Score =   237 bits (604),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 132/161 (82%), Gaps = 2/161 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVYSFG
Sbjct  554  ANILLDEELNPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGIYTVKSDVYSFG  613

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  614  VVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  673

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADS  290
            +IALCVQPEPEFRPPMSEVV+ALVRL+QRA++ +R    DS
Sbjct  674  IIALCVQPEPEFRPPMSEVVQALVRLMQRASVVKRRSSDDS  714



>ref|XP_011002569.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Populus euphratica]
Length=715

 Score =   237 bits (604),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVYSFG
Sbjct  539  ANILLDEELNPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGIYTVKSDVYSFG  598

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  599  VVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  658

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  659  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKR  693



>ref|XP_006348158.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Solanum 
tuberosum]
Length=724

 Score =   237 bits (604),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 131/156 (84%), Gaps = 3/156 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN---SASG*GAPEVAMSGQYTIKSDVYSF  596
            AN+LLD E NPHLSD GLA+L P+ ++ ++      + G  APE A+SG YT+KSDVYSF
Sbjct  548  ANILLDEELNPHLSDCGLAALTPNTERQVSSTQMIGSFGYSAPEFALSGIYTVKSDVYSF  607

Query  595  GVAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFA  416
            GV MLELLTGR P DSSR R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFA
Sbjct  608  GVVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFA  667

Query  415  DVIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            D+IALCVQPEPEFRPPMSEVV+ALVRL+QRA++ +R
Sbjct  668  DIIALCVQPEPEFRPPMSEVVQALVRLMQRASVVKR  703



>ref|XP_004164349.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Cucumis 
sativus]
Length=647

 Score =   235 bits (600),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN--SASG*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD + NPHLSD GLA+L P+ ++ ++     + G  APE A+SG YT+KSDVYSFG
Sbjct  471  ANILLDEDLNPHLSDCGLAALTPNTERQISTQMVGSFGYSAPEFALSGIYTVKSDVYSFG  530

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD
Sbjct  531  VVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPTLNGMYPAKSLSRFAD  590

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  591  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKR  625



>ref|XP_004232684.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Solanum lycopersicum]
Length=724

 Score =   237 bits (604),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 131/156 (84%), Gaps = 3/156 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN---SASG*GAPEVAMSGQYTIKSDVYSF  596
            AN+LLD E NPHLSD GLA+L P+ ++ ++      + G  APE A+SG YT+KSDVYSF
Sbjct  548  ANILLDEELNPHLSDCGLAALTPNTERQVSSTQMIGSFGYSAPEFALSGIYTVKSDVYSF  607

Query  595  GVAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFA  416
            GV MLELLTGR P DSSR R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFA
Sbjct  608  GVVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFA  667

Query  415  DVIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            D+IALCVQPEPEFRPPMSEVV+ALVRL+QRA++ +R
Sbjct  668  DIIALCVQPEPEFRPPMSEVVQALVRLMQRASVVKR  703



>ref|XP_001783845.1| predicted protein [Physcomitrella patens]
 gb|EDQ51335.1| predicted protein, partial [Physcomitrella patens]
Length=700

 Score =   236 bits (602),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 135/172 (78%), Gaps = 3/172 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIP---DEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSF  596
            ANVLLD E NPHL+D G+A+L P   D   +     + G  APE AMSG YT+KSDVYSF
Sbjct  521  ANVLLDDELNPHLTDCGIAALTPLGSDRQVSTQMLGSFGYSAPEYAMSGIYTVKSDVYSF  580

Query  595  GVAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFA  416
            GV MLELLTGR P DS+R R EQSLVRWATPQLHDIDAL+KMVDPALKG+YP KSLSRFA
Sbjct  581  GVVMLELLTGRKPLDSTRLRAEQSLVRWATPQLHDIDALAKMVDPALKGIYPAKSLSRFA  640

Query  415  DVIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQ  260
            D+IALCVQPEPEFRP MSEVV+ALVRL+QRA++++R  G D    + S D Q
Sbjct  641  DIIALCVQPEPEFRPVMSEVVQALVRLMQRASLNKRRSGDDLGASNRSMDRQ  692



>ref|XP_002267170.2| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Vitis vinifera]
 emb|CBI32991.3| unnamed protein product [Vitis vinifera]
Length=729

 Score =   237 bits (604),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVYSFG
Sbjct  553  ANILLDEELNPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGIYTVKSDVYSFG  612

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDP+L G+YP KSLSRFAD
Sbjct  613  VVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPSLNGMYPAKSLSRFAD  672

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  673  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKR  707



>ref|XP_008799298.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Phoenix dactylifera]
 ref|XP_008799306.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Phoenix dactylifera]
Length=643

 Score =   235 bits (599),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 131/158 (83%), Gaps = 2/158 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN--SASG*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NP LSD GLA+L P+ ++ ++     + G  APE AMSG YT+KSDVYSFG
Sbjct  465  ANILLDEELNPRLSDCGLAALTPNTERQVSTEVVGSFGYSAPEFAMSGIYTVKSDVYSFG  524

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  525  VVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  584

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFG  299
            +IALCVQPEPEFRPPMSEVV+ LVRL+QRA++ RR+ G
Sbjct  585  IIALCVQPEPEFRPPMSEVVQQLVRLMQRASIVRRSSG  622



>ref|XP_011046989.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Populus 
euphratica]
Length=711

 Score =   236 bits (602),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 129/155 (83%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVYSFG
Sbjct  535  ANILLDEELNPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGIYTVKSDVYSFG  594

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD
Sbjct  595  VVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPTLNGIYPAKSLSRFAD  654

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  655  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKR  689



>ref|XP_006648399.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Oryza brachyantha]
Length=720

 Score =   236 bits (602),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 132/160 (83%), Gaps = 2/160 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN--SASG*GAPEVAMSGQYTIKSDVYSFG  593
            +N+LLD E NPHLSD GLA+L P+ ++ ++     + G  APE AMSG YT+KSDVYSFG
Sbjct  541  SNILLDEEHNPHLSDCGLAALTPNTERQVSTEVFGSFGYSAPEFAMSGIYTVKSDVYSFG  600

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  601  VVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  660

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            +IALCVQPEPEFRPPMSEVV+ LVRL+QRA++ RR  G +
Sbjct  661  IIALCVQPEPEFRPPMSEVVQQLVRLMQRASIVRRQSGEE  700



>ref|NP_001046150.1| Os02g0190500 [Oryza sativa Japonica Group]
 dbj|BAD16477.1| putative leucine-rich repeat transmembrane protein kinase [Oryza 
sativa Japonica Group]
 dbj|BAF08064.1| Os02g0190500 [Oryza sativa Japonica Group]
 gb|EEE56479.1| hypothetical protein OsJ_05699 [Oryza sativa Japonica Group]
Length=718

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 132/160 (83%), Gaps = 2/160 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN--SASG*GAPEVAMSGQYTIKSDVYSFG  593
            +N+LLD E NPHLSD GLA+L P+ ++ ++     + G  APE AMSG YT+KSDVYSFG
Sbjct  540  SNILLDEEHNPHLSDCGLAALTPNTERQVSTEVFGSFGYSAPEFAMSGIYTVKSDVYSFG  599

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  600  VVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  659

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            +IALCVQPEPEFRPPMSEVV+ LVRL+QRA++ RR  G +
Sbjct  660  IIALCVQPEPEFRPPMSEVVQQLVRLMQRASIVRRQSGEE  699



>ref|XP_006586762.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Glycine 
max]
 gb|KHN40858.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Glycine soja]
Length=711

 Score =   236 bits (601),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 129/155 (83%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVYSFG
Sbjct  535  ANILLDEELNPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFG  594

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD
Sbjct  595  VVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPTLNGMYPAKSLSRFAD  654

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  655  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKR  689



>ref|XP_011460016.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Fragaria vesca 
subsp. vesca]
Length=730

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 132/161 (82%), Gaps = 2/161 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E N HLSD GLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVYSFG
Sbjct  554  ANILLDEELNSHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFG  613

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDP+L G+YP KSLSRFAD
Sbjct  614  VVMLELLTGRKPLDSSRARSEQSLVRWATPQLHDIDALAKMVDPSLNGMYPAKSLSRFAD  673

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADS  290
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++++R    DS
Sbjct  674  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVAKRRSSDDS  714



>ref|XP_006413689.1| hypothetical protein EUTSA_v10024563mg [Eutrema salsugineum]
 gb|ESQ55142.1| hypothetical protein EUTSA_v10024563mg [Eutrema salsugineum]
Length=700

 Score =   235 bits (600),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSDSGLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVY+FG
Sbjct  524  ANILLDEELNPHLSDSGLAALNPNTERQVSTQVVGSFGYSAPEFALSGIYTVKSDVYTFG  583

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD
Sbjct  584  VVMLELLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFAD  643

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALC+QPEPEFRPPMSEVV+ LVRLVQRA++ +R
Sbjct  644  IIALCIQPEPEFRPPMSEVVQQLVRLVQRASVVKR  678



>ref|XP_009613682.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Nicotiana tomentosiformis]
Length=725

 Score =   236 bits (601),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 131/156 (84%), Gaps = 3/156 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN---SASG*GAPEVAMSGQYTIKSDVYSF  596
            AN+LLD E NPHLSD GLA+L P+ ++ ++      + G  APE A+SG YT+KSDVYSF
Sbjct  549  ANILLDEELNPHLSDCGLAALNPNTERPVSSTQMVGSFGYSAPEFALSGIYTVKSDVYSF  608

Query  595  GVAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFA  416
            GV MLELLTGR P DSSR R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFA
Sbjct  609  GVVMLELLTGRKPLDSSRMRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFA  668

Query  415  DVIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            D+IALCVQPEPEFRPPMSEVV+ALVRL+QRA++ +R
Sbjct  669  DIIALCVQPEPEFRPPMSEVVQALVRLMQRASVVKR  704



>ref|XP_008458998.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X1 [Cucumis 
melo]
Length=711

 Score =   235 bits (600),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN--SASG*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD + NPHLSD GLA+L P+ ++ ++     + G  APE A+SG YT+KSDVYSFG
Sbjct  535  ANILLDEDLNPHLSDCGLAALTPNTERQISTQMVGSFGYSAPEFALSGIYTVKSDVYSFG  594

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD
Sbjct  595  VVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPTLNGMYPAKSLSRFAD  654

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  655  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKR  689



>ref|XP_004951618.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Setaria 
italica]
Length=720

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 132/160 (83%), Gaps = 2/160 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN--SASG*GAPEVAMSGQYTIKSDVYSFG  593
            +N+LLD E NPHLSD GLA+L P+ ++ ++     + G  APE AMSG YT+KSDVYSFG
Sbjct  542  SNILLDEEHNPHLSDCGLAALTPNTERQVSTEVFGSFGYSAPEFAMSGIYTVKSDVYSFG  601

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD
Sbjct  602  VVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFAD  661

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            +IALCVQPEPEFRPPMSEVV+ LVRL+QRA++ RR  G +
Sbjct  662  IIALCVQPEPEFRPPMSEVVQQLVRLMQRASIVRRQSGEE  701



>ref|XP_009777766.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Nicotiana sylvestris]
Length=723

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 131/156 (84%), Gaps = 3/156 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN---SASG*GAPEVAMSGQYTIKSDVYSF  596
            AN+LLD E NPHLSD GLA+L P+ ++ ++      + G  APE A+SG YT+KSDVYSF
Sbjct  547  ANILLDEELNPHLSDCGLAALNPNTERPVSSTQMVGSFGYSAPEFALSGIYTVKSDVYSF  606

Query  595  GVAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFA  416
            GV MLELLTGR P DSSR R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFA
Sbjct  607  GVVMLELLTGRKPLDSSRMRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFA  666

Query  415  DVIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            D+IALCVQPEPEFRPPMSEVV+ALVRL+QRA++ +R
Sbjct  667  DIIALCVQPEPEFRPPMSEVVQALVRLMQRASVVKR  702



>ref|XP_002869840.1| kinase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46099.1| kinase [Arabidopsis lyrata subsp. lyrata]
Length=703

 Score =   235 bits (600),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSDSGLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVY+FG
Sbjct  527  ANILLDEELNPHLSDSGLAALTPNTERQVSTQVVGSFGYSAPEFALSGIYTVKSDVYTFG  586

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DS+R R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD
Sbjct  587  VVMLELLTGRKPLDSTRTRVEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFAD  646

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALC+QPEPEFRPPMSEVV+ LVRLVQRA++ +R
Sbjct  647  IIALCIQPEPEFRPPMSEVVQQLVRLVQRASVIKR  681



>dbj|BAK07184.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=713

 Score =   235 bits (600),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 131/160 (82%), Gaps = 2/160 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN--SASG*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E N HLSD GLA+L P+ ++ ++     + G  APE +MSG YT+KSDVYSFG
Sbjct  535  ANILLDEEHNAHLSDCGLAALTPNTERQVSTEVVGSFGYSAPEFSMSGIYTVKSDVYSFG  594

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD
Sbjct  595  VVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFAD  654

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            +IALCVQPEPEFRPPMSEVV+ LVRL+QRA++ RR  G +
Sbjct  655  IIALCVQPEPEFRPPMSEVVQQLVRLMQRASIVRRQSGEE  694



>ref|XP_004145432.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Cucumis 
sativus]
 gb|KGN66852.1| hypothetical protein Csa_1G701280 [Cucumis sativus]
Length=711

 Score =   235 bits (600),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 130/155 (84%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN--SASG*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD + NPHLSD GLA+L P+ ++ ++     + G  APE A+SG YT+KSDVYSFG
Sbjct  535  ANILLDEDLNPHLSDCGLAALTPNTERQISTQMVGSFGYSAPEFALSGIYTVKSDVYSFG  594

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD
Sbjct  595  VVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPTLNGMYPAKSLSRFAD  654

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  655  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKR  689



>ref|XP_008645353.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Zea mays]
 gb|AFW70555.1| putative STRUBBELIG family receptor protein kinase [Zea mays]
Length=717

 Score =   235 bits (599),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 132/160 (83%), Gaps = 2/160 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN--SASG*GAPEVAMSGQYTIKSDVYSFG  593
            +N+LLD E NPHLSD GLA+L P+ ++ ++     + G  APE AMSG YT+KSDVYSFG
Sbjct  539  SNILLDEEHNPHLSDCGLAALTPNTERQVSTEVFGSFGYSAPEFAMSGIYTVKSDVYSFG  598

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL++MVDPAL G+YP KSLSRFAD
Sbjct  599  VVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALARMVDPALNGMYPAKSLSRFAD  658

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            VIALCVQPEPEFRPPMSEVV+ LVRL+QRA++ RR  G +
Sbjct  659  VIALCVQPEPEFRPPMSEVVQQLVRLMQRASIVRRQSGEE  698



>gb|KEH36931.1| strubbelig-receptor family protein [Medicago truncatula]
Length=729

 Score =   235 bits (599),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 130/156 (83%), Gaps = 3/156 (2%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN---SASG*GAPEVAMSGQYTIKSDVYSF  596
            AN+LLD E NPHLSD GLA+L P+ ++ ++      + G  APE A+SG YT+KSDVYSF
Sbjct  552  ANILLDEELNPHLSDCGLAALTPNTERQVSSTQMVGSFGYSAPEFALSGVYTVKSDVYSF  611

Query  595  GVAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFA  416
            GV MLELLTGR P DSSR R EQSLVRWATPQLHDIDALSKMVDP L G+YP KSLSRFA
Sbjct  612  GVVMLELLTGRKPLDSSRVRAEQSLVRWATPQLHDIDALSKMVDPCLNGMYPAKSLSRFA  671

Query  415  DVIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            D+IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  672  DIIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKR  707



>ref|XP_006435523.1| hypothetical protein CICLE_v10010883mg, partial [Citrus clementina]
 gb|ESR48763.1| hypothetical protein CICLE_v10010883mg, partial [Citrus clementina]
Length=317

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 125/160 (78%), Gaps = 4/160 (3%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQNSASG*GAPEVAMSGQYTIKSDVYSFGVA  587
            +N+LLD E NPHLSD GLAS      Q  +QN   G  APE      YT+KSDVYSFGV 
Sbjct  155  SNILLDLELNPHLSDYGLASF----HQRTSQNLGVGYNAPECTRPSAYTVKSDVYSFGVV  210

Query  586  MLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVI  407
            MLELLTGR P+DS +P+ EQ LVRWA PQLHD DAL+KMVDPAL+GLYP KSLSRFADVI
Sbjct  211  MLELLTGRMPYDSEKPKSEQCLVRWAAPQLHDFDALAKMVDPALRGLYPPKSLSRFADVI  270

Query  406  ALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSR  287
            ALCVQPEPEFRPPMSEVVEALVRLVQR++M+ +   A SR
Sbjct  271  ALCVQPEPEFRPPMSEVVEALVRLVQRSSMNMKDDLAASR  310



>ref|XP_002451696.1| hypothetical protein SORBIDRAFT_04g006110 [Sorghum bicolor]
 gb|EES04672.1| hypothetical protein SORBIDRAFT_04g006110 [Sorghum bicolor]
Length=716

 Score =   234 bits (598),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 132/160 (83%), Gaps = 2/160 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPDEDQALNQN--SASG*GAPEVAMSGQYTIKSDVYSFG  593
            +N+LLD E NPHLSD GLA+L P+ ++ ++     + G  APE AMSG YT+KSDVYSFG
Sbjct  538  SNILLDEEHNPHLSDCGLAALTPNTERQVSTEVFGSFGYSAPEFAMSGIYTVKSDVYSFG  597

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL++MVDPAL G+YP KSLSRFAD
Sbjct  598  VVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALARMVDPALNGMYPAKSLSRFAD  657

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  293
            +IALCVQPEPEFRPPMSEVV+ LVRL+QRA++ RR  G +
Sbjct  658  IIALCVQPEPEFRPPMSEVVQQLVRLMQRASIVRRQSGEE  697



>gb|KJB69228.1| hypothetical protein B456_011G011800 [Gossypium raimondii]
Length=726

 Score =   234 bits (598),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 129/155 (83%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVYSFG
Sbjct  550  ANILLDDELNPHLSDCGLAALNPNTERQVSTQVVGSFGYSAPEFALSGIYTVKSDVYSFG  609

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD
Sbjct  610  VVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPTLNGMYPAKSLSRFAD  669

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  670  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKR  704



>emb|CDX82908.1| BnaC01g13580D [Brassica napus]
Length=706

 Score =   234 bits (597),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 131/161 (81%), Gaps = 2/161 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVY+FG
Sbjct  530  ANILLDEELNPHLSDCGLAALNPNTERQVSTQVVGSFGYSAPEFALSGIYTVKSDVYTFG  589

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD
Sbjct  590  VVMLELLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFAD  649

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADS  290
            +IALC+QPEPEFRPPMSEVV+ LVRLVQRA++ +R    D+
Sbjct  650  IIALCIQPEPEFRPPMSEVVQQLVRLVQRASVVKRRSSDDT  690



>gb|KHG11352.1| protein strubbelig-receptor family 8 [Gossypium arboreum]
Length=726

 Score =   234 bits (598),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 129/155 (83%), Gaps = 2/155 (1%)
 Frame = -1

Query  766  ANVLLDSEFNPHLSDSGLASLIPD-EDQALNQNSAS-G*GAPEVAMSGQYTIKSDVYSFG  593
            AN+LLD E NPHLSD GLA+L P+ E Q   Q   S G  APE A+SG YT+KSDVYSFG
Sbjct  550  ANILLDDELNPHLSDCGLAALNPNTERQVSTQVVGSFGYSAPEFALSGIYTVKSDVYSFG  609

Query  592  VAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFAD  413
            V MLELLTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD
Sbjct  610  VVMLELLTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPTLNGMYPAKSLSRFAD  669

Query  412  VIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRR  308
            +IALCVQPEPEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  670  IIALCVQPEPEFRPPMSEVVQALVRLVQRASVVKR  704



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1454382771890