BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF010O17

Length=741
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP00228.1|  unnamed protein product                                329   2e-106   Coffea canephora [robusta coffee]
ref|XP_011086470.1|  PREDICTED: uncharacterized protein LOC105168199    322   2e-103   Sesamum indicum [beniseed]
ref|XP_008353107.1|  PREDICTED: uncharacterized protein LOC103416654    317   6e-103   
gb|KJB61190.1|  hypothetical protein B456_009G345200                    317   6e-103   Gossypium raimondii
gb|KHN01126.1|  hypothetical protein glysoja_008028                     320   1e-102   Glycine soja [wild soybean]
ref|XP_003517865.1|  PREDICTED: uncharacterized protein LOC100805887    319   1e-102   Glycine max [soybeans]
ref|XP_009605574.1|  PREDICTED: uncharacterized protein LOC104100114    318   3e-102   Nicotiana tomentosiformis
ref|XP_010533011.1|  PREDICTED: uncharacterized protein LOC104808873    318   4e-102   Tarenaya hassleriana [spider flower]
ref|XP_004504499.1|  PREDICTED: uncharacterized protein LOC101510072    318   4e-102   Cicer arietinum [garbanzo]
ref|XP_006660599.1|  PREDICTED: uncharacterized protein LOC102705746    315   4e-102   
gb|EYU28651.1|  hypothetical protein MIMGU_mgv1a004456mg                318   9e-102   Erythranthe guttata [common monkey flower]
ref|XP_003519794.1|  PREDICTED: uncharacterized protein LOC100779863    317   9e-102   Glycine max [soybeans]
ref|XP_004238724.1|  PREDICTED: uncharacterized protein LOC101243707    317   2e-101   Solanum lycopersicum
gb|KJB61188.1|  hypothetical protein B456_009G345200                    317   2e-101   Gossypium raimondii
ref|XP_006357209.1|  PREDICTED: uncharacterized protein LOC102581459    316   3e-101   Solanum tuberosum [potatoes]
ref|XP_008446261.1|  PREDICTED: uncharacterized protein LOC103489044    316   3e-101   Cucumis melo [Oriental melon]
ref|XP_003552001.1|  PREDICTED: uncharacterized protein LOC100815535    316   4e-101   Glycine max [soybeans]
gb|KHG00924.1|  Protein FAM69A                                          316   4e-101   Gossypium arboreum [tree cotton]
ref|XP_004297675.1|  PREDICTED: uncharacterized protein LOC101296656    315   5e-101   Fragaria vesca subsp. vesca
ref|XP_008389573.1|  PREDICTED: uncharacterized protein LOC103451910    315   7e-101   
ref|XP_009757019.1|  PREDICTED: uncharacterized protein LOC104250177    315   9e-101   Nicotiana sylvestris
gb|EAZ08986.1|  hypothetical protein OsI_31250                          315   1e-100   Oryza sativa Indica Group [Indian rice]
ref|NP_001063085.1|  Os09g0392000                                       315   1e-100   
ref|XP_008339979.1|  PREDICTED: uncharacterized protein LOC103402967    314   2e-100   
ref|XP_007222590.1|  hypothetical protein PRUPE_ppa004148mg             314   2e-100   Prunus persica
ref|XP_008244965.1|  PREDICTED: uncharacterized protein LOC103343066    314   2e-100   Prunus mume [ume]
ref|XP_004135222.1|  PREDICTED: uncharacterized protein LOC101209749    314   2e-100   Cucumis sativus [cucumbers]
gb|KDO82633.1|  hypothetical protein CISIN_1g0101752mg                  301   3e-100   Citrus sinensis [apfelsine]
ref|XP_003613417.1|  hypothetical protein MTR_5g036420                  313   4e-100   Medicago truncatula
ref|XP_007153681.1|  hypothetical protein PHAVU_003G055900g             313   6e-100   Phaseolus vulgaris [French bean]
ref|XP_006438501.1|  hypothetical protein CICLE_v10031248mg             312   6e-100   Citrus clementina [clementine]
ref|XP_010913432.1|  PREDICTED: uncharacterized protein LOC105039...    313   8e-100   Elaeis guineensis
ref|XP_006378189.1|  hypothetical protein POPTR_0010s04630g             312   1e-99    
ref|XP_011015682.1|  PREDICTED: uncharacterized protein LOC105119255    312   1e-99    Populus euphratica
ref|XP_011012739.1|  PREDICTED: uncharacterized protein LOC105116927    312   1e-99    Populus euphratica
gb|KDP21286.1|  hypothetical protein JCGZ_21757                         311   2e-99    Jatropha curcas
ref|XP_006378188.1|  hypothetical protein POPTR_0010s04630g             312   3e-99    
ref|XP_008798032.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    311   4e-99    
ref|XP_007044484.1|  Zinc finger MYND domain-containing protein 1...    310   6e-99    
ref|XP_002460179.1|  hypothetical protein SORBIDRAFT_02g024000          310   6e-99    Sorghum bicolor [broomcorn]
ref|XP_004956736.1|  PREDICTED: uncharacterized protein LOC101782072    309   2e-98    Setaria italica
ref|XP_010652908.1|  PREDICTED: uncharacterized protein LOC100251...    305   3e-98    
ref|XP_010683317.1|  PREDICTED: uncharacterized protein LOC104898021    308   4e-98    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009360447.1|  PREDICTED: uncharacterized protein LOC103950916    308   4e-98    
gb|AGV54795.1|  hypothetical protein                                    308   4e-98    Phaseolus vulgaris [French bean]
dbj|BAD94699.1|  hypothetical protein                                   298   7e-98    Arabidopsis thaliana [mouse-ear cress]
gb|EPS61168.1|  hypothetical protein M569_13630                         298   8e-98    Genlisea aurea
ref|XP_006390921.1|  hypothetical protein EUTSA_v10018393mg             307   1e-97    Eutrema salsugineum [saltwater cress]
ref|XP_010415693.1|  PREDICTED: uncharacterized protein LOC104701657    307   1e-97    Camelina sativa [gold-of-pleasure]
ref|XP_010913435.1|  PREDICTED: uncharacterized protein LOC105039...    305   1e-97    
ref|XP_010471012.1|  PREDICTED: uncharacterized protein LOC104750861    307   1e-97    Camelina sativa [gold-of-pleasure]
ref|XP_010512094.1|  PREDICTED: uncharacterized protein LOC104788107    307   1e-97    Camelina sativa [gold-of-pleasure]
ref|XP_006300446.1|  hypothetical protein CARUB_v10020126mg             307   1e-97    Capsella rubella
ref|XP_002887283.1|  hypothetical protein ARALYDRAFT_476140             306   2e-97    
ref|XP_009105692.1|  PREDICTED: uncharacterized protein LOC103831561    306   3e-97    Brassica rapa
ref|XP_009127775.1|  PREDICTED: uncharacterized protein LOC103852633    305   6e-97    Brassica rapa
emb|CDY03761.1|  BnaA02g14760D                                          305   7e-97    
ref|XP_002270582.1|  PREDICTED: uncharacterized protein LOC100251...    305   7e-97    Vitis vinifera
ref|NP_001142383.1|  uncharacterized protein LOC100274556 precursor     305   8e-97    Zea mays [maize]
emb|CDY38797.1|  BnaA07g28690D                                          305   9e-97    Brassica napus [oilseed rape]
tpg|DAA61320.1|  TPA: hypothetical protein ZEAMMB73_635026              305   1e-96    
ref|XP_010272086.1|  PREDICTED: uncharacterized protein LOC104607...    305   1e-96    Nelumbo nucifera [Indian lotus]
ref|XP_009419908.1|  PREDICTED: uncharacterized protein LOC103999...    305   1e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002520208.1|  conserved hypothetical protein                     304   1e-96    Ricinus communis
gb|EMS45474.1|  hypothetical protein TRIUR3_21271                       301   1e-96    Triticum urartu
gb|ACG40083.1|  hypothetical protein                                    304   3e-96    Zea mays [maize]
emb|CDY42991.1|  BnaC02g19650D                                          303   4e-96    Brassica napus [oilseed rape]
emb|CDY11612.1|  BnaC06g31270D                                          303   6e-96    Brassica napus [oilseed rape]
ref|XP_003578075.1|  PREDICTED: uncharacterized protein LOC100824338    301   3e-95    Brachypodium distachyon [annual false brome]
ref|NP_564985.1|  uncharacterized protein                               301   3e-95    Arabidopsis thaliana [mouse-ear cress]
gb|EEC83605.1|  hypothetical protein OsI_29292                          301   3e-95    Oryza sativa Indica Group [Indian rice]
ref|NP_001061835.1|  Os08g0425000                                       301   3e-95    
gb|AAB61100.1|  ESTs gb|R30459,gb|N38441 come from this gene            301   4e-95    Arabidopsis thaliana [mouse-ear cress]
gb|KFK41436.1|  hypothetical protein AALP_AA2G130200                    300   7e-95    Arabis alpina [alpine rockcress]
ref|XP_010043827.1|  PREDICTED: uncharacterized protein LOC104432932    300   7e-95    Eucalyptus grandis [rose gum]
dbj|BAJ97125.1|  predicted protein                                      298   3e-94    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACN36261.1|  unknown                                                 294   3e-94    Zea mays [maize]
dbj|BAJ99018.1|  predicted protein                                      297   7e-94    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002444358.1|  hypothetical protein SORBIDRAFT_07g020660          297   9e-94    
ref|XP_004973463.1|  PREDICTED: uncharacterized protein LOC101781133    297   1e-93    Setaria italica
ref|XP_006659410.1|  PREDICTED: uncharacterized protein LOC102708916    292   2e-93    
dbj|BAJ91369.1|  predicted protein                                      295   4e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001143255.1|  uncharacterized protein LOC100275783 precursor     293   2e-92    
dbj|BAJ33873.1|  unnamed protein product                                293   2e-92    Eutrema halophilum
ref|XP_008676929.1|  PREDICTED: uncharacterized protein LOC100275...    293   2e-92    
ref|XP_006856897.1|  hypothetical protein AMTR_s00055p00212390          293   4e-92    Amborella trichopoda
ref|XP_003574496.1|  PREDICTED: uncharacterized protein LOC100845920    293   4e-92    Brachypodium distachyon [annual false brome]
ref|XP_010445104.1|  PREDICTED: uncharacterized protein LOC104727724    280   9e-91    Camelina sativa [gold-of-pleasure]
gb|EMS65818.1|  hypothetical protein TRIUR3_10678                       283   2e-90    Triticum urartu
ref|XP_006858155.1|  hypothetical protein AMTR_s00062p00137330          287   4e-90    Amborella trichopoda
gb|EAZ42788.1|  hypothetical protein OsJ_27372                          284   2e-89    Oryza sativa Japonica Group [Japonica rice]
gb|ABK24649.1|  unknown                                                 285   3e-89    Picea sitchensis
ref|XP_010276049.1|  PREDICTED: uncharacterized protein LOC104610902    284   1e-88    Nelumbo nucifera [Indian lotus]
emb|CDY17285.1|  BnaA10g09190D                                          284   1e-88    Brassica napus [oilseed rape]
gb|KCW70170.1|  hypothetical protein EUGRSUZ_F03459                     281   2e-88    Eucalyptus grandis [rose gum]
ref|XP_010267678.1|  PREDICTED: uncharacterized protein LOC104604833    283   2e-88    Nelumbo nucifera [Indian lotus]
ref|XP_009120015.1|  PREDICTED: uncharacterized protein LOC103844940    283   2e-88    Brassica rapa
emb|CDY19873.1|  BnaC09g31390D                                          283   4e-88    Brassica napus [oilseed rape]
gb|EMT12587.1|  hypothetical protein F775_11937                         279   8e-88    
ref|XP_006401517.1|  hypothetical protein EUTSA_v10013232mg             281   9e-88    Eutrema salsugineum [saltwater cress]
ref|XP_010433417.1|  PREDICTED: uncharacterized protein LOC104717532    280   2e-87    Camelina sativa [gold-of-pleasure]
ref|XP_002867528.1|  hypothetical protein ARALYDRAFT_913846             280   3e-87    Arabidopsis lyrata subsp. lyrata
ref|XP_010448765.1|  PREDICTED: uncharacterized protein LOC104731172    280   3e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010438669.1|  PREDICTED: uncharacterized protein LOC104722227    280   3e-87    Camelina sativa [gold-of-pleasure]
emb|CDY29265.1|  BnaC01g19170D                                          280   3e-87    Brassica napus [oilseed rape]
ref|XP_002864361.1|  hypothetical protein ARALYDRAFT_331828             280   3e-87    Arabidopsis lyrata subsp. lyrata
ref|XP_009143005.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    280   3e-87    Brassica rapa
ref|XP_006280251.1|  hypothetical protein CARUB_v10026167mg             281   3e-87    
gb|KFK29208.1|  hypothetical protein AALP_AA7G103200                    280   3e-87    Arabis alpina [alpine rockcress]
ref|XP_009127046.1|  PREDICTED: uncharacterized protein LOC103851917    280   3e-87    Brassica rapa
emb|CDX89285.1|  BnaA01g16080D                                          278   5e-87    
ref|XP_006413116.1|  hypothetical protein EUTSA_v10024847mg             280   6e-87    Eutrema salsugineum [saltwater cress]
ref|XP_010482896.1|  PREDICTED: uncharacterized protein LOC104761505    280   6e-87    Camelina sativa [gold-of-pleasure]
ref|NP_200298.1|  uncharacterized protein                               279   7e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010446119.1|  PREDICTED: uncharacterized protein LOC104728896    282   3e-86    
gb|ABR17461.1|  unknown                                                 276   5e-86    Picea sitchensis
ref|XP_010448183.1|  PREDICTED: uncharacterized protein LOC104730687    277   8e-86    
ref|XP_006283454.1|  hypothetical protein CARUB_v10004499mg             277   9e-86    
gb|KCW67126.1|  hypothetical protein EUGRSUZ_F00907                     265   2e-85    Eucalyptus grandis [rose gum]
ref|XP_008371266.1|  PREDICTED: uncharacterized protein LOC103434697    275   2e-85    
gb|KHG29749.1|  Transcription activator gutR                            275   4e-85    Gossypium arboreum [tree cotton]
gb|KHN38290.1|  hypothetical protein glysoja_003955                     271   7e-85    Glycine soja [wild soybean]
ref|XP_004252023.1|  PREDICTED: uncharacterized protein LOC101252754    274   8e-85    Solanum lycopersicum
ref|XP_006367536.1|  PREDICTED: uncharacterized protein LOC102597542    273   2e-84    Solanum tuberosum [potatoes]
ref|XP_006452283.1|  hypothetical protein CICLE_v10008210mg             271   2e-84    Citrus clementina [clementine]
ref|XP_002522970.1|  conserved hypothetical protein                     272   3e-84    Ricinus communis
gb|KJB62763.1|  hypothetical protein B456_009G435000                    272   3e-84    Gossypium raimondii
ref|NP_194432.1|  uncharacterized protein                               272   4e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003519567.1|  PREDICTED: uncharacterized protein LOC100789...    271   5e-84    Glycine max [soybeans]
ref|XP_011097895.1|  PREDICTED: uncharacterized protein LOC105176701    272   5e-84    
gb|KDP39105.1|  hypothetical protein JCGZ_00862                         271   8e-84    Jatropha curcas
ref|XP_007142263.1|  hypothetical protein PHAVU_008G266000g             271   9e-84    Phaseolus vulgaris [French bean]
gb|ACF87807.1|  unknown                                                 266   1e-83    Zea mays [maize]
ref|XP_006475148.1|  PREDICTED: uncharacterized protein LOC102609098    271   1e-83    Citrus sinensis [apfelsine]
ref|XP_009334822.1|  PREDICTED: uncharacterized protein LOC103927611    270   2e-83    Pyrus x bretschneideri [bai li]
ref|XP_010064377.1|  PREDICTED: uncharacterized protein LOC104451417    265   2e-83    
ref|XP_001775460.1|  predicted protein                                  270   2e-83    
ref|XP_010545218.1|  PREDICTED: uncharacterized protein LOC104817662    270   3e-83    Tarenaya hassleriana [spider flower]
ref|NP_001044498.2|  Os01g0793500                                       270   4e-83    
dbj|BAB89049.1|  unknown protein                                        270   5e-83    Oryza sativa Japonica Group [Japonica rice]
gb|EYU19247.1|  hypothetical protein MIMGU_mgv1a004499mg                269   7e-83    Erythranthe guttata [common monkey flower]
emb|CDY20800.1|  BnaA02g09400D                                          271   8e-83    Brassica napus [oilseed rape]
gb|KJB13649.1|  hypothetical protein B456_002G087800                    268   1e-82    Gossypium raimondii
ref|XP_011095372.1|  PREDICTED: uncharacterized protein LOC105174849    268   1e-82    Sesamum indicum [beniseed]
ref|XP_008349941.1|  PREDICTED: uncharacterized protein LOC103413239    268   1e-82    
gb|KHG01773.1|  Tryptophan synthase alpha chain                         268   1e-82    Gossypium arboreum [tree cotton]
ref|XP_009769049.1|  PREDICTED: uncharacterized protein LOC104219979    268   1e-82    Nicotiana sylvestris
ref|XP_007211818.1|  hypothetical protein PRUPE_ppa004230mg             268   2e-82    Prunus persica
ref|XP_004970230.1|  PREDICTED: uncharacterized protein LOC101777...    268   2e-82    Setaria italica
ref|XP_004970229.1|  PREDICTED: uncharacterized protein LOC101777...    268   2e-82    Setaria italica
ref|XP_007020905.1|  Inositol-1,4,5-trisphosphate 5-phosphatase 4...    269   2e-82    
ref|XP_004491367.1|  PREDICTED: uncharacterized protein LOC101492149    267   3e-82    Cicer arietinum [garbanzo]
ref|XP_001781611.1|  predicted protein                                  266   3e-82    
gb|KCW67034.1|  hypothetical protein EUGRSUZ_F00801                     263   3e-82    Eucalyptus grandis [rose gum]
ref|XP_008385988.1|  PREDICTED: uncharacterized protein LOC103448506    268   4e-82    
gb|KCW67171.1|  hypothetical protein EUGRSUZ_F00962                     263   5e-82    Eucalyptus grandis [rose gum]
ref|XP_008226932.1|  PREDICTED: uncharacterized protein LOC103326477    266   5e-82    Prunus mume [ume]
ref|XP_009378549.1|  PREDICTED: uncharacterized protein LOC103967027    266   6e-82    Pyrus x bretschneideri [bai li]
ref|XP_009599364.1|  PREDICTED: uncharacterized protein LOC104095030    266   6e-82    Nicotiana tomentosiformis
emb|CDY06624.1|  BnaC02g13480D                                          268   7e-82    
ref|XP_003617489.1|  hypothetical protein MTR_5g092140                  266   9e-82    Medicago truncatula
ref|XP_010675677.1|  PREDICTED: uncharacterized protein LOC104891653    266   1e-81    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008654687.1|  PREDICTED: uncharacterized protein LOC100275...    266   1e-81    Zea mays [maize]
ref|XP_002280959.1|  PREDICTED: uncharacterized protein LOC100267...    266   1e-81    Vitis vinifera
gb|KHN11935.1|  hypothetical protein glysoja_019908                     264   1e-81    Glycine soja [wild soybean]
ref|XP_009420606.1|  PREDICTED: uncharacterized protein LOC104000320    265   2e-81    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001143111.1|  uncharacterized protein LOC100275589               266   2e-81    Zea mays [maize]
ref|XP_003544978.1|  PREDICTED: uncharacterized protein LOC100796964    265   2e-81    Glycine max [soybeans]
ref|XP_006644833.1|  PREDICTED: uncharacterized protein LOC102706146    265   3e-81    Oryza brachyantha
gb|ACN29289.1|  unknown                                                 265   3e-81    Zea mays [maize]
ref|XP_002316997.1|  hypothetical protein POPTR_0011s14080g             264   3e-81    
ref|XP_006346228.1|  PREDICTED: uncharacterized protein LOC102585922    264   4e-81    Solanum tuberosum [potatoes]
ref|XP_011040240.1|  PREDICTED: uncharacterized protein LOC105136541    263   7e-81    Populus euphratica
ref|XP_006370687.1|  hypothetical protein POPTR_0001s44890g             265   9e-81    
ref|XP_010060409.1|  PREDICTED: uncharacterized protein LOC104448324    263   1e-80    Eucalyptus grandis [rose gum]
ref|XP_004295816.2|  PREDICTED: uncharacterized protein LOC101297130    263   1e-80    Fragaria vesca subsp. vesca
ref|XP_004244131.1|  PREDICTED: uncharacterized protein LOC101251602    262   2e-80    Solanum lycopersicum
ref|XP_009774573.1|  PREDICTED: uncharacterized protein LOC104224588    261   4e-80    Nicotiana sylvestris
ref|XP_009607397.1|  PREDICTED: uncharacterized protein LOC104101619    261   4e-80    Nicotiana tomentosiformis
ref|XP_003564372.1|  PREDICTED: uncharacterized protein LOC100827...    262   4e-80    Brachypodium distachyon [annual false brome]
ref|XP_003564373.1|  PREDICTED: uncharacterized protein LOC100827...    261   5e-80    Brachypodium distachyon [annual false brome]
ref|XP_008454551.1|  PREDICTED: uncharacterized protein LOC103494941    261   6e-80    Cucumis melo [Oriental melon]
ref|XP_011030808.1|  PREDICTED: uncharacterized protein LOC105130143    261   6e-80    Populus euphratica
ref|XP_002965264.1|  hypothetical protein SELMODRAFT_143057             260   1e-79    
ref|XP_002986592.1|  hypothetical protein SELMODRAFT_124354             260   1e-79    
ref|XP_007211816.1|  hypothetical protein PRUPE_ppa004222mg             259   4e-79    Prunus persica
ref|XP_008226933.1|  PREDICTED: uncharacterized protein LOC103326478    258   1e-78    Prunus mume [ume]
ref|XP_008812430.1|  PREDICTED: uncharacterized protein LOC103723322    258   2e-78    Phoenix dactylifera
ref|XP_004151958.1|  PREDICTED: uncharacterized protein LOC101214437    257   2e-78    Cucumis sativus [cucumbers]
ref|XP_009614697.1|  PREDICTED: uncharacterized protein LOC104107...    257   3e-78    Nicotiana tomentosiformis
ref|XP_009801187.1|  PREDICTED: uncharacterized protein LOC104246...    257   3e-78    Nicotiana sylvestris
emb|CDP05764.1|  unnamed protein product                                256   3e-78    Coffea canephora [robusta coffee]
emb|CDM84540.1|  unnamed protein product                                257   4e-78    Triticum aestivum [Canadian hard winter wheat]
ref|XP_002278686.1|  PREDICTED: uncharacterized protein LOC100241...    256   5e-78    Vitis vinifera
ref|XP_004244132.1|  PREDICTED: uncharacterized protein LOC101251905    255   1e-77    Solanum lycopersicum
gb|EMT03744.1|  hypothetical protein F775_19554                         257   2e-77    
ref|XP_006346229.1|  PREDICTED: uncharacterized protein LOC102586255    254   3e-77    Solanum tuberosum [potatoes]
ref|XP_010930250.1|  PREDICTED: uncharacterized protein LOC105051...    254   6e-77    Elaeis guineensis
dbj|BAJ95380.1|  predicted protein                                      254   6e-77    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010644425.1|  PREDICTED: uncharacterized protein LOC100241...    252   3e-76    
ref|XP_009614695.1|  PREDICTED: uncharacterized protein LOC104107...    251   5e-76    Nicotiana tomentosiformis
emb|CBI26611.3|  unnamed protein product                                252   9e-76    Vitis vinifera
ref|XP_004158483.1|  PREDICTED: uncharacterized LOC101212346            241   4e-73    
ref|XP_008454552.1|  PREDICTED: uncharacterized protein LOC103494942    243   7e-73    
gb|KCW67120.1|  hypothetical protein EUGRSUZ_F00901                     238   1e-72    Eucalyptus grandis [rose gum]
ref|XP_004152029.1|  PREDICTED: uncharacterized protein LOC101212346    242   2e-72    
emb|CAN60720.1|  hypothetical protein VITISV_022056                     240   1e-71    Vitis vinifera
ref|XP_010272087.1|  PREDICTED: uncharacterized protein LOC104607...    237   6e-71    
ref|XP_009419909.1|  PREDICTED: uncharacterized protein LOC103999...    236   1e-70    
gb|KCW67113.1|  hypothetical protein EUGRSUZ_F00893                     234   5e-70    Eucalyptus grandis [rose gum]
gb|ACF81787.1|  unknown                                                 221   2e-69    Zea mays [maize]
gb|EMS49816.1|  hypothetical protein TRIUR3_06457                       226   3e-66    Triticum urartu
gb|KCW67102.1|  hypothetical protein EUGRSUZ_F00885                     216   5e-63    Eucalyptus grandis [rose gum]
ref|XP_010445105.1|  PREDICTED: uncharacterized protein LOC104727725    204   2e-62    
ref|XP_010092131.1|  hypothetical protein L484_017819                   216   6e-62    
gb|KCW67110.1|  hypothetical protein EUGRSUZ_F00891                     198   5e-60    Eucalyptus grandis [rose gum]
ref|XP_010644428.1|  PREDICTED: uncharacterized protein LOC100241...    200   1e-56    
gb|EEC71626.1|  hypothetical protein OsI_04047                          188   2e-56    Oryza sativa Indica Group [Indian rice]
ref|XP_010930259.1|  PREDICTED: uncharacterized protein LOC105051...    197   1e-55    Elaeis guineensis
ref|XP_002878755.1|  predicted protein                                  184   7e-55    
gb|KCW67111.1|  hypothetical protein EUGRSUZ_F00891                     183   2e-54    Eucalyptus grandis [rose gum]
ref|XP_010064375.1|  PREDICTED: uncharacterized protein LOC104451414    182   3e-54    
ref|XP_006438500.1|  hypothetical protein CICLE_v10031248mg             186   7e-52    
gb|KDO82634.1|  hypothetical protein CISIN_1g0101752mg                  175   1e-51    Citrus sinensis [apfelsine]
ref|XP_002872148.1|  hypothetical protein ARALYDRAFT_351537             173   2e-50    
gb|EYU33635.1|  hypothetical protein MIMGU_mgv1a018256mg                173   1e-46    Erythranthe guttata [common monkey flower]
gb|KJB62764.1|  hypothetical protein B456_009G435000                    169   1e-45    Gossypium raimondii
ref|XP_006575675.1|  PREDICTED: uncharacterized protein LOC100789...    166   2e-44    Glycine max [soybeans]
ref|XP_010644433.1|  PREDICTED: uncharacterized protein LOC100267...    166   3e-44    Vitis vinifera
ref|XP_002888842.1|  hypothetical protein ARALYDRAFT_895006             154   7e-44    
ref|XP_001449176.1|  hypothetical protein                               162   1e-42    Paramecium tetraurelia strain d4-2
ref|XP_001436259.1|  hypothetical protein                               160   1e-41    Paramecium tetraurelia strain d4-2
ref|XP_001455162.1|  hypothetical protein                               159   1e-41    Paramecium tetraurelia strain d4-2
ref|XP_010644430.1|  PREDICTED: uncharacterized protein LOC100241...    155   1e-40    
ref|XP_010644429.1|  PREDICTED: uncharacterized protein LOC100241...    155   3e-40    
gb|KCW66790.1|  hypothetical protein EUGRSUZ_F00555                     147   6e-39    Eucalyptus grandis [rose gum]
gb|KCW67105.1|  hypothetical protein EUGRSUZ_F00888                     146   2e-38    Eucalyptus grandis [rose gum]
ref|XP_004027177.1|  hypothetical protein IMG5_188030                   148   1e-37    Ichthyophthirius multifiliis
gb|EJY77500.1|  hypothetical protein OXYTRI_00869                       140   8e-35    Oxytricha trifallax
gb|EAR84506.2|  hypothetical protein TTHERM_00655340                    140   9e-35    Tetrahymena thermophila SB210
ref|XP_001032169.1|  hypothetical protein TTHERM_00655340               140   1e-34    
emb|CDW81161.1|  UNKNOWN                                                137   8e-34    Stylonychia lemnae
ref|XP_004997585.1|  hypothetical protein PTSG_01605                    137   1e-33    Salpingoeca rosetta
ref|XP_001031695.1|  hypothetical protein TTHERM_00760790               135   4e-33    Tetrahymena thermophila SB210
ref|XP_004346245.1|  hypothetical protein CAOG_05572                    135   7e-33    Capsaspora owczarzaki ATCC 30864
emb|CDW76296.1|  UNKNOWN                                                131   2e-31    Stylonychia lemnae
ref|XP_010064383.1|  PREDICTED: uncharacterized protein LOC104451423    123   2e-30    
ref|XP_001749148.1|  hypothetical protein                               125   1e-29    Monosiga brevicollis MX1
gb|KDO49372.1|  hypothetical protein CISIN_1g038412mg                   117   2e-29    Citrus sinensis [apfelsine]
gb|EJY88389.1|  hypothetical protein OXYTRI_16548                       125   4e-29    Oxytricha trifallax
emb|CDW80089.1|  UNKNOWN                                                125   4e-29    Stylonychia lemnae
gb|EJY86845.1|  hypothetical protein OXYTRI_09854                       122   3e-28    Oxytricha trifallax
emb|CDW73981.1|  UNKNOWN                                                116   4e-26    Stylonychia lemnae
gb|KCW66787.1|  hypothetical protein EUGRSUZ_F005521                    104   8e-25    Eucalyptus grandis [rose gum]
gb|KJB13651.1|  hypothetical protein B456_002G087800                    108   1e-23    Gossypium raimondii
emb|CDW85293.1|  UNKNOWN                                                105   2e-22    Stylonychia lemnae
ref|XP_008245164.1|  PREDICTED: uncharacterized protein LOC103343273  99.0    1e-20    
ref|XP_009405675.1|  PREDICTED: uncharacterized protein LOC103988768  97.1    5e-20    
ref|XP_002677023.1|  predicted protein                                94.7    2e-19    Naegleria gruberi strain NEG-M
gb|EWM29091.1|  hypothetical protein Naga_100024g11                   95.1    2e-18    Nannochloropsis gaditana
emb|CDY23519.1|  BnaC06g24880D                                        83.2    6e-17    Brassica napus [oilseed rape]
gb|AFA26195.1|  hypothetical protein                                  85.9    2e-16    Lolium perenne [perennial ryegrass]
emb|CBI33030.3|  unnamed protein product                              81.6    2e-16    Vitis vinifera
gb|AGW24477.1|  chloroplast 20 kDa chaperonin                         75.1    6e-14    Avicennia marina subsp. marina
ref|XP_010100527.1|  hypothetical protein L484_027842                 77.4    6e-13    
gb|KCW66786.1|  hypothetical protein EUGRSUZ_F005522                  74.7    2e-12    Eucalyptus grandis [rose gum]
gb|KDO82636.1|  hypothetical protein CISIN_1g0101752mg                64.3    2e-10    Citrus sinensis [apfelsine]
gb|KDO82635.1|  hypothetical protein CISIN_1g0101752mg                63.5    5e-10    Citrus sinensis [apfelsine]
ref|XP_010064275.1|  PREDICTED: uncharacterized protein LOC104451268  67.8    1e-09    
gb|EAY76121.1|  hypothetical protein OsI_04050                        65.5    6e-09    Oryza sativa Indica Group [Indian rice]
ref|XP_004509910.1|  PREDICTED: uncharacterized protein LOC101495828  62.4    6e-08    
ref|XP_002773717.1|  conserved hypothetical protein                   62.4    7e-08    Perkinsus marinus ATCC 50983
ref|XP_002780228.1|  conserved hypothetical protein                   62.0    1e-07    Perkinsus marinus ATCC 50983
ref|XP_009801253.1|  PREDICTED: uncharacterized protein LOC104246...  61.2    2e-07    Nicotiana sylvestris
gb|EJY76018.1|  hypothetical protein OXYTRI_02478                     60.8    3e-07    Oxytricha trifallax
ref|XP_002458625.1|  hypothetical protein SORBIDRAFT_03g036905        55.5    5e-07    
ref|XP_002780230.1|  conserved hypothetical protein                   52.0    2e-04    Perkinsus marinus ATCC 50983
ref|XP_002780229.1|  conserved hypothetical protein                   50.8    6e-04    Perkinsus marinus ATCC 50983



>emb|CDP00228.1| unnamed protein product [Coffea canephora]
Length=520

 Score =   329 bits (844),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV+SVMSMWTR+QPTYAANMWNEALNKRL TE L+LYEILAETERRGL+FDQLLT
Sbjct  347  PLDAHLVMSVMSMWTRVQPTYAANMWNEALNKRLETEELNLYEILAETERRGLSFDQLLT  406

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYKE+GVFG +A+SIQVTEFTIRDAYMLKI+ENNQTR
Sbjct  407  IPEQDEWVYSDGKSTTCVAFILAMYKEAGVFGPIADSIQVTEFTIRDAYMLKIFENNQTR  466

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCNSG+D LPFCQI+GEYRMELP YNTLEPYANMNENCPSLPP+Y RP+ C
Sbjct  467  LPKWCNSGDDMLPFCQILGEYRMELPQYNTLEPYANMNENCPSLPPTYERPVRC  520



>ref|XP_011086470.1| PREDICTED: uncharacterized protein LOC105168199 [Sesamum indicum]
Length=528

 Score =   322 bits (824),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTRMQP YAANMWNEALN RLGTEGLDL++ILAETE RG+TFDQLLT
Sbjct  355  PLDAHLVISVMSMWTRMQPAYAANMWNEALNMRLGTEGLDLHDILAETETRGVTFDQLLT  414

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYK +GVFG L+ SIQVTEFTIRDAYMLKIYENN TR
Sbjct  415  IPEQDEWVYSDGKSTTCVAFILAMYKAAGVFGPLSNSIQVTEFTIRDAYMLKIYENNVTR  474

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+ +D+LPFCQI+GEY+MELP YNTLEPY NMNENCPSLPP+Y RP+ C
Sbjct  475  LPSWCNNSDDQLPFCQILGEYKMELPYYNTLEPYTNMNENCPSLPPTYERPVRC  528



>ref|XP_008353107.1| PREDICTED: uncharacterized protein LOC103416654 [Malus domestica]
Length=416

 Score =   317 bits (812),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+D HLV+SVMSMWTRMQP YAANMWNEALNKRLGTEGLDLYEILAE E R + FD LLT
Sbjct  243  PLDTHLVVSVMSMWTRMQPAYAANMWNEALNKRLGTEGLDLYEILAEVESREMAFDHLLT  302

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYKE+G+FG ++ SIQVTEFTIRDAYMLKI+E+NQTR
Sbjct  303  IPEQDEWVYSDGKSTTCVAFILAMYKEAGIFGPISNSIQVTEFTIRDAYMLKIFEDNQTR  362

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN  ++KLPFCQI+GEYRMELP YNTLEPYANMNE+CPSLPP+Y RP  C
Sbjct  363  LPSWCNGKDEKLPFCQILGEYRMELPLYNTLEPYANMNEHCPSLPPTYDRPTRC  416



>gb|KJB61190.1| hypothetical protein B456_009G345200 [Gossypium raimondii]
Length=409

 Score =   317 bits (811),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL ETERRG+TFDQLLT
Sbjct  236  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYRILEETERRGITFDQLLT  295

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFIL MYKE+GVFG L+ SIQVTEFTIRDAYMLKI+ENNQT 
Sbjct  296  IPEQDEWVYSDGKSTTCVAFILEMYKEAGVFGPLSNSIQVTEFTIRDAYMLKIFENNQTN  355

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+G+ +LPFCQI+GEY MELP YN+LEPYANMNENCPSLPP Y RP  C
Sbjct  356  LPSWCNNGDGRLPFCQILGEYWMELPFYNSLEPYANMNENCPSLPPIYDRPTRC  409



>gb|KHN01126.1| hypothetical protein glysoja_008028 [Glycine soja]
Length=518

 Score =   320 bits (819),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTRMQP YAANMWNEALNKRLGTE LDL++IL ETE+RG+ FDQLLT
Sbjct  345  PLDAHLVISVMSMWTRMQPAYAANMWNEALNKRLGTEDLDLHDILIETEKRGIAFDQLLT  404

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFIL+MYK +G+FG ++ SIQVTEFTIRDAYML+I+E+NQTR
Sbjct  405  IPEQDEWVYSDGKSTTCVAFILSMYKAAGIFGPISSSIQVTEFTIRDAYMLRIFEDNQTR  464

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN+ ND+LPFCQI+GEYRMELPGYNTL+PYANMNE+CPSLPP+Y RP+ C
Sbjct  465  LPRWCNNENDRLPFCQILGEYRMELPGYNTLDPYANMNEHCPSLPPTYDRPLKC  518



>ref|XP_003517865.1| PREDICTED: uncharacterized protein LOC100805887 [Glycine max]
Length=518

 Score =   319 bits (818),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTRMQP YAANMWNEALNKRLGTE LDL++IL ETE+RG+ FDQLLT
Sbjct  345  PLDAHLVISVMSMWTRMQPAYAANMWNEALNKRLGTEDLDLHDILIETEKRGIAFDQLLT  404

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFIL+MYK +G+FG ++ SIQVTEFTIRDAYML+I+E+NQTR
Sbjct  405  IPEQDEWVYSDGKSTTCVAFILSMYKAAGIFGPISSSIQVTEFTIRDAYMLRIFEDNQTR  464

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN+ ND+LPFCQI+GEYRMELPGYNTL+PYANMNE+CPSLPP+Y RP+ C
Sbjct  465  LPRWCNNENDRLPFCQILGEYRMELPGYNTLDPYANMNEHCPSLPPTYDRPLKC  518



>ref|XP_009605574.1| PREDICTED: uncharacterized protein LOC104100114 [Nicotiana tomentosiformis]
Length=523

 Score =   318 bits (816),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY ILAETE+RG+TFDQLLT
Sbjct  350  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILAETEKRGITFDQLLT  409

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYKE+GVFG ++ SIQVTEFTI+DAY LKI+E+NQTR
Sbjct  410  IPEQDEWVYSDGKSTTCVAFILAMYKEAGVFGPISNSIQVTEFTIKDAYTLKIFEDNQTR  469

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCNSG++K+ FCQI+GEY+MELP YNTLEPYANMNENCPSLPP+Y RP+ C
Sbjct  470  LPSWCNSGDNKVSFCQILGEYQMELPQYNTLEPYANMNENCPSLPPNYERPMRC  523



>ref|XP_010533011.1| PREDICTED: uncharacterized protein LOC104808873 [Tarenaya hassleriana]
Length=530

 Score =   318 bits (816),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHL+ISVMSMWTR+QPTYAANMWNEALNKRLGTEGLDLYEILAETERRG+TFD+LLT
Sbjct  357  PLDAHLLISVMSMWTRVQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGMTFDELLT  416

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPE+DEWVYSDGKSTTCVAFIL MYK +GVFG LA+ IQVTEFTIRDAY L+IYE+NQTR
Sbjct  417  IPERDEWVYSDGKSTTCVAFILQMYKAAGVFGPLADHIQVTEFTIRDAYALRIYEDNQTR  476

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN    KLPFCQI+G YRMELPGYN++EPYANMNE+CPSLPP YGRP  C
Sbjct  477  LPSWCNDEEGKLPFCQILGGYRMELPGYNSVEPYANMNEHCPSLPPDYGRPSKC  530



>ref|XP_004504499.1| PREDICTED: uncharacterized protein LOC101510072 [Cicer arietinum]
Length=520

 Score =   318 bits (815),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTRMQP+YAANMWNEALNKRLGTE LDL++IL ETE+RG+ FD+LL 
Sbjct  347  PLDAHLVISVMSMWTRMQPSYAANMWNEALNKRLGTEDLDLHDILLETEKRGIAFDELLA  406

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFIL+MYKE+G+FG +  SIQVTEFTIRDAYML+I+E+NQTR
Sbjct  407  IPEQDEWVYSDGKSTTCVAFILSMYKEAGIFGPVTSSIQVTEFTIRDAYMLRIFEDNQTR  466

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN+ NDKLPFCQI+GEYRMELPGYNTL+PYANMNE+CPSLPP+Y RP  C
Sbjct  467  LPRWCNNANDKLPFCQILGEYRMELPGYNTLDPYANMNEHCPSLPPTYDRPSKC  520



>ref|XP_006660599.1| PREDICTED: uncharacterized protein LOC102705746 [Oryza brachyantha]
Length=420

 Score =   315 bits (807),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+LV++VMSMWTR+QP YAANMWNEALNKRLGTEGLDL+ I+ ETERRG++FDQLLT
Sbjct  247  PLDANLVMAVMSMWTRLQPLYAANMWNEALNKRLGTEGLDLHGIIVETERRGMSFDQLLT  306

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYKE+G+F   AESIQVTEFTIRDAYMLKI+E+NQ R
Sbjct  307  IPEQDEWVYSDGKSTTCVAFILAMYKEAGIFAPFAESIQVTEFTIRDAYMLKIFEDNQAR  366

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+  DKLPFCQI+GEYRMELP YNT+EPYA MNENCPSLPP+Y RP  C
Sbjct  367  LPSWCNTEADKLPFCQILGEYRMELPEYNTIEPYAKMNENCPSLPPTYKRPARC  420



>gb|EYU28651.1| hypothetical protein MIMGU_mgv1a004456mg [Erythranthe guttata]
Length=526

 Score =   318 bits (814),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTRMQP YAANMWNEALN RLGTE LDLY ILAETERRG+TFDQLLT
Sbjct  353  PLDAHLVISVMSMWTRMQPAYAANMWNEALNMRLGTEDLDLYGILAETERRGITFDQLLT  412

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYK +GVFG +  SIQVTEFTI+DAYMLKI+ENN T+
Sbjct  413  IPEQDEWVYSDGKSTTCVAFILAMYKAAGVFGPVTNSIQVTEFTIKDAYMLKIFENNMTQ  472

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP+WCN+G+DKLPFCQI+GEY+MELP YNTLEPY NMNENCPSLPP+Y RP  C
Sbjct  473  LPNWCNNGDDKLPFCQILGEYKMELPYYNTLEPYTNMNENCPSLPPTYERPARC  526



>ref|XP_003519794.1| PREDICTED: uncharacterized protein LOC100779863 [Glycine max]
 gb|KHN28683.1| hypothetical protein glysoja_025417 [Glycine soja]
Length=520

 Score =   317 bits (813),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTRMQP YAANMWNEALNKRLGTE LDL++IL ETE+RG+ FDQLLT
Sbjct  347  PLDAHLVISVMSMWTRMQPAYAANMWNEALNKRLGTEDLDLHDILIETEKRGIAFDQLLT  406

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFIL+MYK +G+FG ++ SIQVTEFTIRDAYML+I+E+NQTR
Sbjct  407  IPEQDEWVYSDGKSTTCVAFILSMYKAAGIFGPISSSIQVTEFTIRDAYMLRIFEDNQTR  466

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN+ ND+ PFCQI+GEYRMELPGYNTL+PYANMNE+CPSLPP+Y RP+ C
Sbjct  467  LPRWCNNENDRHPFCQILGEYRMELPGYNTLDPYANMNEHCPSLPPTYDRPLKC  520



>ref|XP_004238724.1| PREDICTED: uncharacterized protein LOC101243707 [Solanum lycopersicum]
Length=524

 Score =   317 bits (811),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY ILAETERRG+TFDQLLT
Sbjct  351  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILAETERRGITFDQLLT  410

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDG+STTCVAFILAMYKE+GVFG ++ SIQVTEFTIRDAYMLKI+E+NQTR
Sbjct  411  IPEQDEWVYSDGQSTTCVAFILAMYKEAGVFGPISNSIQVTEFTIRDAYMLKIFEDNQTR  470

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN G++K+ FCQI+GEY+MELP YNTL+PYANMNENCPSLPP Y RP  C
Sbjct  471  LPSWCNGGDNKVSFCQILGEYQMELPEYNTLDPYANMNENCPSLPPHYERPRRC  524



>gb|KJB61188.1| hypothetical protein B456_009G345200 [Gossypium raimondii]
Length=527

 Score =   317 bits (811),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL ETERRG+TFDQLLT
Sbjct  354  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYRILEETERRGITFDQLLT  413

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFIL MYKE+GVFG L+ SIQVTEFTIRDAYMLKI+ENNQT 
Sbjct  414  IPEQDEWVYSDGKSTTCVAFILEMYKEAGVFGPLSNSIQVTEFTIRDAYMLKIFENNQTN  473

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+G+ +LPFCQI+GEY MELP YN+LEPYANMNENCPSLPP Y RP  C
Sbjct  474  LPSWCNNGDGRLPFCQILGEYWMELPFYNSLEPYANMNENCPSLPPIYDRPTRC  527



>ref|XP_006357209.1| PREDICTED: uncharacterized protein LOC102581459 [Solanum tuberosum]
Length=524

 Score =   316 bits (810),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGT+ LDLY ILAETERRG+TFDQLLT
Sbjct  351  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTKDLDLYGILAETERRGITFDQLLT  410

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEW+YSDG+STTCVAFILAMYKE+GVFG ++ SIQVTEFTIRDAYMLKI+E+NQTR
Sbjct  411  IPEQDEWIYSDGQSTTCVAFILAMYKEAGVFGPISNSIQVTEFTIRDAYMLKIFEDNQTR  470

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCNSG++K  FCQI+GEY+MELP YNTL+PYANMNENCPSLPP Y RP  C
Sbjct  471  LPSWCNSGDNKFSFCQILGEYQMELPQYNTLDPYANMNENCPSLPPHYERPGRC  524



>ref|XP_008446261.1| PREDICTED: uncharacterized protein LOC103489044 [Cucumis melo]
Length=524

 Score =   316 bits (809),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDL++IL ETE+RG+ FD+LLT
Sbjct  351  PLDAHLVISVMSMWTRLQPAYAANMWNEALNKRLGTEDLDLHDILVETEKRGIPFDELLT  410

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYKE+G+FG ++ SIQVTEFTIRDAYMLKI+E+N TR
Sbjct  411  IPEQDEWVYSDGKSTTCVAFILAMYKEAGIFGPVSSSIQVTEFTIRDAYMLKIFEDNHTR  470

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP+WCN+ +DKLPFCQI+GEY+MELP YNTLEPYANMNENCPSLPP+Y RP  C
Sbjct  471  LPTWCNNESDKLPFCQILGEYKMELPQYNTLEPYANMNENCPSLPPTYDRPTQC  524



>ref|XP_003552001.1| PREDICTED: uncharacterized protein LOC100815535 [Glycine max]
 gb|KHN28269.1| hypothetical protein glysoja_040924 [Glycine soja]
Length=531

 Score =   316 bits (810),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP Y+ANMWNEALNKRLGTEGLDL++IL ETE+RG+ FD+LLT
Sbjct  358  PLDAHLVISVMSMWTRLQPAYSANMWNEALNKRLGTEGLDLHDILVETEKRGIPFDELLT  417

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFIL+MYKE+ VFG +A SIQVTEFTIRDAYML+I+E+NQTR
Sbjct  418  IPEQDEWVYSDGKSTTCVAFILSMYKEAEVFGPIANSIQVTEFTIRDAYMLRIFEDNQTR  477

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+ ND++PFCQI+GEY+MELPGYNTLEPYANMNE CPSLPP+Y RP  C
Sbjct  478  LPSWCNNENDRIPFCQILGEYKMELPGYNTLEPYANMNEYCPSLPPTYDRPSRC  531



>gb|KHG00924.1| Protein FAM69A [Gossypium arboreum]
Length=527

 Score =   316 bits (809),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL ETERRG+TFDQLLT
Sbjct  354  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILEETERRGITFDQLLT  413

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFIL MYKE+GVFG L+ SIQVTEFTIRDAYMLKI+ENNQT 
Sbjct  414  IPEQDEWVYSDGKSTTCVAFILEMYKEAGVFGPLSNSIQVTEFTIRDAYMLKIFENNQTN  473

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+G+ +LPFCQI+GEY MELP YN+LEPYANMNENCPSLPP Y RP  C
Sbjct  474  LPSWCNNGDGRLPFCQILGEYWMELPFYNSLEPYANMNENCPSLPPIYDRPTRC  527



>ref|XP_004297675.1| PREDICTED: uncharacterized protein LOC101296656 [Fragaria vesca 
subsp. vesca]
Length=516

 Score =   315 bits (808),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+D HLV+SVMSMWTR+QP YAANMWNEALNKRL TEGLDLYEILAE E RG++ D LLT
Sbjct  343  PLDTHLVVSVMSMWTRVQPAYAANMWNEALNKRLSTEGLDLYEILAEVENRGISVDHLLT  402

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYKE+G+FG ++ SIQVTEFTIRDAYMLKI+ENNQTR
Sbjct  403  IPEQDEWVYSDGKSTTCVAFILAMYKEAGIFGPISNSIQVTEFTIRDAYMLKIFENNQTR  462

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN G++KLPFCQI+GEYRMELP YNT+EPYANMNE+CPSLPP+Y RP  C
Sbjct  463  LPSWCNLGDEKLPFCQILGEYRMELPEYNTIEPYANMNEHCPSLPPTYIRPSQC  516



>ref|XP_008389573.1| PREDICTED: uncharacterized protein LOC103451910 [Malus domestica]
Length=526

 Score =   315 bits (808),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+D HLV+SVMSMWTR+QP YAANMWNEALNKRLGTEGLDLYEILAE E R + FD LLT
Sbjct  353  PLDTHLVVSVMSMWTRIQPAYAANMWNEALNKRLGTEGLDLYEILAEVESREMAFDHLLT  412

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYKE+G+FG ++ SIQVTEFTIRDAYMLKI+E+NQTR
Sbjct  413  IPEQDEWVYSDGKSTTCVAFILAMYKEAGIFGPISNSIQVTEFTIRDAYMLKIFEDNQTR  472

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN  ++KLPFCQI+GEYRMELP YNTLEPYANMNE+CPSLPP+Y RP  C
Sbjct  473  LPSWCNGKDEKLPFCQILGEYRMELPLYNTLEPYANMNEHCPSLPPTYDRPTRC  526



>ref|XP_009757019.1| PREDICTED: uncharacterized protein LOC104250177 [Nicotiana sylvestris]
Length=523

 Score =   315 bits (806),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY ILAETE+RG+TFDQLLT
Sbjct  350  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILAETEKRGITFDQLLT  409

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYKE+GVFG ++ SIQVTEFTI+DAY LKI+E+NQTR
Sbjct  410  IPEQDEWVYSDGKSTTCVAFILAMYKEAGVFGPISNSIQVTEFTIKDAYTLKIFEDNQTR  469

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCNS  +K+ FCQI+GEY MELP YNTLEPYANMNENCPSLPP+Y RP+ C
Sbjct  470  LPSWCNSRENKVSFCQILGEYEMELPQYNTLEPYANMNENCPSLPPNYERPVRC  523



>gb|EAZ08986.1| hypothetical protein OsI_31250 [Oryza sativa Indica Group]
Length=546

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+LV++VMSMWTR+QP YAANMWNEALNKRLGTEGLDL+ I+ ETERRG++FDQLLT
Sbjct  373  PLDANLVMAVMSMWTRLQPLYAANMWNEALNKRLGTEGLDLHGIIVETERRGMSFDQLLT  432

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYKE+G+F   AESIQVTEFTIRDAYMLKI+E+NQ R
Sbjct  433  IPEQDEWVYSDGKSTTCVAFILAMYKEAGIFTPFAESIQVTEFTIRDAYMLKIFEDNQAR  492

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+ +DKLPFCQI+GEYRMELP YNT+EPYA MNENCPSLPP+Y RP  C
Sbjct  493  LPSWCNTESDKLPFCQILGEYRMELPEYNTIEPYAKMNENCPSLPPTYKRPARC  546



>ref|NP_001063085.1| Os09g0392000 [Oryza sativa Japonica Group]
 dbj|BAD26533.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF24999.1| Os09g0392000 [Oryza sativa Japonica Group]
 gb|EAZ44615.1| hypothetical protein OsJ_29237 [Oryza sativa Japonica Group]
 dbj|BAG99992.1| unnamed protein product [Oryza sativa Japonica Group]
Length=546

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+LV++VMSMWTR+QP YAANMWNEALNKRLGTEGLDL+ I+ ETERRG++FDQLLT
Sbjct  373  PLDANLVMAVMSMWTRLQPLYAANMWNEALNKRLGTEGLDLHGIIVETERRGMSFDQLLT  432

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYKE+G+F   AESIQVTEFTIRDAYMLKI+E+NQ R
Sbjct  433  IPEQDEWVYSDGKSTTCVAFILAMYKEAGIFTPFAESIQVTEFTIRDAYMLKIFEDNQAR  492

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+ +DKLPFCQI+GEYRMELP YNT+EPYA MNENCPSLPP+Y RP  C
Sbjct  493  LPSWCNTESDKLPFCQILGEYRMELPEYNTIEPYAKMNENCPSLPPTYKRPARC  546



>ref|XP_008339979.1| PREDICTED: uncharacterized protein LOC103402967 [Malus domestica]
Length=526

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+D HLV+SVMSMWTRMQP YAANMWNEALNKRLGTEGLDLYEILAE E R + FD LLT
Sbjct  353  PLDTHLVVSVMSMWTRMQPAYAANMWNEALNKRLGTEGLDLYEILAEVESREMAFDHLLT  412

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYKE+G+FG ++ SIQVTEFTIRDAYMLKI+E+N TR
Sbjct  413  IPEQDEWVYSDGKSTTCVAFILAMYKEAGIFGPISNSIQVTEFTIRDAYMLKIFEDNXTR  472

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN  ++KLPFCQI+GEYRMELP YNTLEPYANMNE+CPSLPP+Y RP  C
Sbjct  473  LPSWCNGKDEKLPFCQILGEYRMELPLYNTLEPYANMNEHCPSLPPTYDRPTRC  526



>ref|XP_007222590.1| hypothetical protein PRUPE_ppa004148mg [Prunus persica]
 gb|EMJ23789.1| hypothetical protein PRUPE_ppa004148mg [Prunus persica]
Length=526

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+D HLV+SVMSMWTRMQP YAANMWNEALNKRLGTEGLDLYEIL E E R + FD LLT
Sbjct  353  PLDTHLVVSVMSMWTRMQPAYAANMWNEALNKRLGTEGLDLYEILTEVENREIAFDHLLT  412

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYKE+G+FG ++ SIQVTEFTIRDAYMLKI+E+NQTR
Sbjct  413  IPEQDEWVYSDGKSTTCVAFILAMYKEAGIFGPISNSIQVTEFTIRDAYMLKIFEDNQTR  472

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN  ++KLPFCQI+GEYRMELP YNT+EPY NMNE+CPSLPP+Y RP+ C
Sbjct  473  LPSWCNGKDEKLPFCQILGEYRMELPEYNTIEPYTNMNEHCPSLPPTYDRPLRC  526



>ref|XP_008244965.1| PREDICTED: uncharacterized protein LOC103343066 [Prunus mume]
Length=526

 Score =   314 bits (804),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+D HLV+SVMSMWTRMQP YAANMWNEALNKRLGTEGLDLYEIL E E R + FD LLT
Sbjct  353  PLDTHLVVSVMSMWTRMQPAYAANMWNEALNKRLGTEGLDLYEILTEVENREIAFDHLLT  412

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPE+DEWVYSDGKSTTCVAFILAMYKE+G+FG ++ SIQVTEFTIRDAYMLKI+E+NQTR
Sbjct  413  IPEKDEWVYSDGKSTTCVAFILAMYKEAGIFGPISNSIQVTEFTIRDAYMLKIFEDNQTR  472

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN  N+KLPFCQI+GEYRMELP YNT+EPY NMNE+CPSLPP+Y RP+ C
Sbjct  473  LPSWCNGKNEKLPFCQILGEYRMELPEYNTIEPYTNMNEHCPSLPPTYDRPLRC  526



>ref|XP_004135222.1| PREDICTED: uncharacterized protein LOC101209749 [Cucumis sativus]
 ref|XP_004155340.1| PREDICTED: uncharacterized LOC101209749 [Cucumis sativus]
 gb|KGN51842.1| hypothetical protein Csa_5G603390 [Cucumis sativus]
Length=524

 Score =   314 bits (804),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDL++IL ETE+RG+ FD+LLT
Sbjct  351  PLDAHLVISVMSMWTRLQPAYAANMWNEALNKRLGTEDLDLHDILVETEKRGIPFDELLT  410

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVYSDGKSTTCVAFILAMYKE+G+FG ++ SIQVTEFTIRDAYMLKI+E+N TR
Sbjct  411  IPEQDDWVYSDGKSTTCVAFILAMYKEAGIFGPVSSSIQVTEFTIRDAYMLKIFEDNHTR  470

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP+WCN+ +DKLPFCQI+GEY+MELP +NTLEPYANMNENCPSLPP+Y RP  C
Sbjct  471  LPTWCNNESDKLPFCQILGEYKMELPQFNTLEPYANMNENCPSLPPTYDRPTQC  524



>gb|KDO82633.1| hypothetical protein CISIN_1g0101752mg, partial [Citrus sinensis]
Length=168

 Score =   301 bits (771),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = -1

Query  723  VISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDE  544
            V+SVMSMWTR+QP YAANMWNEALNKRLGTE LDL+ IL E E+RG++FDQLLTIPEQDE
Sbjct  1    VVSVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLHGILDEIEKRGISFDQLLTIPEQDE  60

Query  543  WVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCN  364
            WVYSDGKSTTCVAFIL MYKE+GVFG ++ SIQVTEFTIRDAYMLKI+ENNQTRLPSWCN
Sbjct  61   WVYSDGKSTTCVAFILEMYKEAGVFGPISNSIQVTEFTIRDAYMLKIFENNQTRLPSWCN  120

Query  363  SGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            +   KLPFCQI+GEYRMELP YNT+EPYANMNENCPSLPPSY RP  C
Sbjct  121  NEEAKLPFCQILGEYRMELPQYNTIEPYANMNENCPSLPPSYERPQRC  168



>ref|XP_003613417.1| hypothetical protein MTR_5g036420 [Medicago truncatula]
 gb|AES96375.1| plant/F10M23-360 protein [Medicago truncatula]
Length=522

 Score =   313 bits (802),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTRMQP YAANMWNEALNKRLGTE LDL++I+ ETE+RG+ FD+LL 
Sbjct  349  PLDAHLVISVMSMWTRMQPAYAANMWNEALNKRLGTEDLDLHDIILETEKRGIAFDELLA  408

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVYSDGKSTTCVAFIL+MYKE+G+FG ++ SIQVTEFTIRDAYML+I+E+NQTR
Sbjct  409  IPEQDDWVYSDGKSTTCVAFILSMYKEAGIFGPISSSIQVTEFTIRDAYMLRIFEDNQTR  468

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN+ NDKLPFCQI+GEYRME PGYNTL PYANMNE+CPSLPP+Y RP  C
Sbjct  469  LPRWCNNENDKLPFCQILGEYRMEFPGYNTLVPYANMNEHCPSLPPTYDRPSQC  522



>ref|XP_007153681.1| hypothetical protein PHAVU_003G055900g [Phaseolus vulgaris]
 gb|ESW25675.1| hypothetical protein PHAVU_003G055900g [Phaseolus vulgaris]
Length=522

 Score =   313 bits (801),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP Y+ANMWNEALNKRLGTEGLDL++I+ ETE+RG+ FD+LLT
Sbjct  349  PLDAHLVISVMSMWTRLQPAYSANMWNEALNKRLGTEGLDLHDIIVETEKRGIPFDELLT  408

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFIL+MYKE+GVFG ++ SIQVTEFTIRDAYML+I+E+NQTR
Sbjct  409  IPEQDEWVYSDGKSTTCVAFILSMYKEAGVFGPVSSSIQVTEFTIRDAYMLRIFEDNQTR  468

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN+ ND+L FCQI+GEYRMELPGYNTLEPYANMNE CPSLPP Y RP  C
Sbjct  469  LPRWCNNENDQLSFCQILGEYRMELPGYNTLEPYANMNEYCPSLPPIYDRPSQC  522



>ref|XP_006438501.1| hypothetical protein CICLE_v10031248mg [Citrus clementina]
 ref|XP_006483762.1| PREDICTED: uncharacterized protein LOC102615522 [Citrus sinensis]
 gb|ESR51741.1| hypothetical protein CICLE_v10031248mg [Citrus clementina]
Length=518

 Score =   312 bits (800),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV+SVMSMWTR+QP YAANMWNEALNKRLGTE LDL+ IL E E+RG++FDQLLT
Sbjct  345  PLDAHLVVSVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLHGILDEIEKRGISFDQLLT  404

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFIL MYKE+GVFG ++ SIQVTEFTIRDAYMLKI+ENNQTR
Sbjct  405  IPEQDEWVYSDGKSTTCVAFILEMYKEAGVFGPISNSIQVTEFTIRDAYMLKIFENNQTR  464

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+   KLPFCQI+GEYRMELP YNT+EPYANMNENCPSLPPSY RP  C
Sbjct  465  LPSWCNNEEAKLPFCQILGEYRMELPQYNTIEPYANMNENCPSLPPSYERPQRC  518



>ref|XP_010913432.1| PREDICTED: uncharacterized protein LOC105039122 isoform X1 [Elaeis 
guineensis]
Length=534

 Score =   313 bits (801),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+LV+S+MSMWTR+QP YAANMWNEALNKRLGTEGLDL++I+ ETERRG+TFDQLLT
Sbjct  361  PLDANLVMSIMSMWTRLQPAYAANMWNEALNKRLGTEGLDLHDIIIETERRGMTFDQLLT  420

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEW YSDGKSTTCVAFIL MYKE+G+FG +A SIQVTEFTIRDAYMLKI+ENN TR
Sbjct  421  IPEQDEWEYSDGKSTTCVAFILEMYKEAGIFGPIANSIQVTEFTIRDAYMLKIFENNGTR  480

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+  +KLPFCQI+GEYRMELP YNT+EPYA MNENCPSLPP+Y RP+ C
Sbjct  481  LPSWCNAEEEKLPFCQILGEYRMELPEYNTIEPYARMNENCPSLPPTYERPVSC  534



>ref|XP_006378189.1| hypothetical protein POPTR_0010s04630g [Populus trichocarpa]
 gb|ERP55986.1| hypothetical protein POPTR_0010s04630g [Populus trichocarpa]
Length=514

 Score =   312 bits (799),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL ETERRG+ FD+LLT
Sbjct  329  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILGETERRGIAFDELLT  388

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PE DEWVYSDG+STTCVAFILAMYK +GVFG ++ S+QVTEFTIRDAYMLKI+ENNQTR
Sbjct  389  VPEHDEWVYSDGQSTTCVAFILAMYKAAGVFGPVSSSVQVTEFTIRDAYMLKIFENNQTR  448

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIH  223
            LPSWCN+GN +LPFCQI+GEY+MELP YN++EPYANMNENCPSLPP Y RPI 
Sbjct  449  LPSWCNNGNVQLPFCQILGEYQMELPEYNSVEPYANMNENCPSLPPVYDRPIQ  501



>ref|XP_011015682.1| PREDICTED: uncharacterized protein LOC105119255 [Populus euphratica]
Length=540

 Score =   312 bits (800),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL ETERRG+ FD+LLT
Sbjct  367  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILGETERRGIAFDELLT  426

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PE DEWVYSDG+STTCVAFILAMYK +GVFG ++ S+QVTEFTIRDAYMLKI+ENNQTR
Sbjct  427  VPEHDEWVYSDGQSTTCVAFILAMYKAAGVFGPVSSSVQVTEFTIRDAYMLKIFENNQTR  486

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN+GN +LPFCQI+GEY+MELP YN++EPYANMNENCPSLPP Y RPI C
Sbjct  487  LPRWCNNGNVQLPFCQILGEYQMELPEYNSVEPYANMNENCPSLPPVYERPIQC  540



>ref|XP_011012739.1| PREDICTED: uncharacterized protein LOC105116927 [Populus euphratica]
Length=540

 Score =   312 bits (800),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL ETERRG+ FD+LLT
Sbjct  367  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILGETERRGIAFDELLT  426

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PE DEWVYSDG+STTCVAFILAMYK +GVFG ++ S+QVTEFTIRDAYMLKI+ENNQTR
Sbjct  427  VPEHDEWVYSDGQSTTCVAFILAMYKAAGVFGPVSSSVQVTEFTIRDAYMLKIFENNQTR  486

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN+GN +LPFCQI+GEY+MELP YN++EPYANMNENCPSLPP Y RPI C
Sbjct  487  LPRWCNNGNVQLPFCQILGEYQMELPEYNSVEPYANMNENCPSLPPVYERPIQC  540



>gb|KDP21286.1| hypothetical protein JCGZ_21757 [Jatropha curcas]
Length=529

 Score =   311 bits (798),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY ILAE E+RG+ FD+LLT
Sbjct  356  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILAEIEKRGIAFDELLT  415

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
             PEQDEW+YSDGKSTTCVAFILAMYKE+GVFG ++ SIQVTEFTIRDAYMLKI+ENNQTR
Sbjct  416  APEQDEWIYSDGKSTTCVAFILAMYKEAGVFGPISSSIQVTEFTIRDAYMLKIFENNQTR  475

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN+ N +LPFCQI+GEY MELP YNT+EPYANMNENCPSLPPSY RP  C
Sbjct  476  LPGWCNNDNGRLPFCQILGEYWMELPEYNTVEPYANMNENCPSLPPSYDRPGRC  529



>ref|XP_006378188.1| hypothetical protein POPTR_0010s04630g [Populus trichocarpa]
 gb|ERP55985.1| hypothetical protein POPTR_0010s04630g [Populus trichocarpa]
Length=552

 Score =   312 bits (799),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL ETERRG+ FD+LLT
Sbjct  367  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILGETERRGIAFDELLT  426

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PE DEWVYSDG+STTCVAFILAMYK +GVFG ++ S+QVTEFTIRDAYMLKI+ENNQTR
Sbjct  427  VPEHDEWVYSDGQSTTCVAFILAMYKAAGVFGPVSSSVQVTEFTIRDAYMLKIFENNQTR  486

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIH  223
            LPSWCN+GN +LPFCQI+GEY+MELP YN++EPYANMNENCPSLPP Y RPI 
Sbjct  487  LPSWCNNGNVQLPFCQILGEYQMELPEYNSVEPYANMNENCPSLPPVYDRPIQ  539



>ref|XP_008798032.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103713048 
[Phoenix dactylifera]
Length=539

 Score =   311 bits (796),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+LV+S+MSMWTR+QP YAANMWNEALNKRLGTEGLDL++I+ ETERRG+TFDQLLT
Sbjct  366  PLDANLVMSIMSMWTRLQPAYAANMWNEALNKRLGTEGLDLHDIIIETERRGMTFDQLLT  425

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEW YSDGKSTTCVAFIL MYKE+G+FG +A SIQVTEFTIRDAYMLKI+ENN+TR
Sbjct  426  IPEQDEWEYSDGKSTTCVAFILEMYKEAGIFGPIANSIQVTEFTIRDAYMLKIFENNRTR  485

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+  +KLPFCQI+G+Y+MELP YNT+EPYA+MNENCPSLPP+Y RP+ C
Sbjct  486  LPSWCNADEEKLPFCQILGDYQMELPDYNTIEPYAHMNENCPSLPPTYERPVIC  539



>ref|XP_007044484.1| Zinc finger MYND domain-containing protein 15 isoform 1 [Theobroma 
cacao]
 gb|EOY00316.1| Zinc finger MYND domain-containing protein 15 isoform 1 [Theobroma 
cacao]
Length=527

 Score =   310 bits (795),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL ETERRG+ FDQLLT
Sbjct  354  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILDETERRGIAFDQLLT  413

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFIL MYKE+GVFG +A SIQVTEFTIRDAYMLKI+ENNQTR
Sbjct  414  IPEQDEWVYSDGKSTTCVAFILEMYKEAGVFGPIANSIQVTEFTIRDAYMLKIFENNQTR  473

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN  +   PFCQI+GEY MELP YNT+EPYANMNENCPSLPP Y RP  C
Sbjct  474  LPSWCNYKDGGFPFCQILGEYWMELPHYNTIEPYANMNENCPSLPPIYDRPTRC  527



>ref|XP_002460179.1| hypothetical protein SORBIDRAFT_02g024000 [Sorghum bicolor]
 gb|EER96700.1| hypothetical protein SORBIDRAFT_02g024000 [Sorghum bicolor]
Length=537

 Score =   310 bits (795),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+LV++VMSMWTR+QP YAANMWNEALNKRLGTEGLDL  I+ ETERRG++FDQLLT
Sbjct  364  PLDANLVMAVMSMWTRLQPVYAANMWNEALNKRLGTEGLDLQGIIIETERRGMSFDQLLT  423

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYKE+G+F   +ESIQVTEFTIRDAYMLKI+E+N  R
Sbjct  424  IPEQDEWVYSDGKSTTCVAFILAMYKEAGIFAPFSESIQVTEFTIRDAYMLKIFEDNPAR  483

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+  DKLPFCQI+GEYRMELP YNT+EPYA MNENCPSLPP+Y RP  C
Sbjct  484  LPSWCNTDTDKLPFCQILGEYRMELPEYNTIEPYAKMNENCPSLPPTYKRPARC  537



>ref|XP_004956736.1| PREDICTED: uncharacterized protein LOC101782072 [Setaria italica]
Length=538

 Score =   309 bits (792),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+LV++VMSMWTR+QP YAANMWNEALNKRLGTEGLDL  I+ ETERRG++FDQLLT
Sbjct  365  PLDANLVMTVMSMWTRVQPLYAANMWNEALNKRLGTEGLDLKGIIMETERRGMSFDQLLT  424

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEW+YSDGKSTTCVAFILAMYKE+G+FG  AESIQVTEFTIRDAYMLKI+E++  R
Sbjct  425  IPEQDEWIYSDGKSTTCVAFILAMYKEAGIFGPFAESIQVTEFTIRDAYMLKIFEDSLAR  484

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+ +DKLPFCQI+GEYRMELP YNT+EPYA MNENCPSLPP+Y RP  C
Sbjct  485  LPSWCNTESDKLPFCQILGEYRMELPEYNTVEPYAKMNENCPSLPPTYKRPARC  538



>ref|XP_010652908.1| PREDICTED: uncharacterized protein LOC100251867 isoform X2 [Vitis 
vinifera]
Length=430

 Score =   305 bits (782),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTRMQP YA NMWNEALNKRL TE LDL  ILAETE+RGLTFDQLLT
Sbjct  257  PLDAHLVISVMSMWTRMQPAYAENMWNEALNKRLETEDLDLLGILAETEKRGLTFDQLLT  316

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFIL MYKE+G+FG  + SIQVTEFTIRDAYMLKI+ENNQ+R
Sbjct  317  IPEQDEWVYSDGKSTTCVAFILEMYKEAGIFGPASSSIQVTEFTIRDAYMLKIFENNQSR  376

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWC   + +L FCQI+GEYRMELP YNT+EPYA+MNENCPSLPP+Y RP+ C
Sbjct  377  LPSWCGDEDGRLQFCQILGEYRMELPQYNTIEPYAHMNENCPSLPPTYERPVGC  430



>ref|XP_010683317.1| PREDICTED: uncharacterized protein LOC104898021 [Beta vulgaris 
subsp. vulgaris]
Length=531

 Score =   308 bits (790),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTEGLDL+EIL E E RG+ F+QLLT
Sbjct  358  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEGLDLHEILIEIEDRGIAFEQLLT  417

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W+YSDGKSTTCVAFILAMYKE+G+F  L+ESIQVTEFTIRDAYMLKI+E+N TR
Sbjct  418  IPEQDDWIYSDGKSTTCVAFILAMYKEAGIFNPLSESIQVTEFTIRDAYMLKIFEDNTTR  477

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWC + N  +PFCQI+GEYRMELP YNT+EPYA+MNENCPSLPP Y RPI C
Sbjct  478  LPSWCTTENGHVPFCQILGEYRMELPEYNTVEPYAHMNENCPSLPPHYQRPIKC  531



>ref|XP_009360447.1| PREDICTED: uncharacterized protein LOC103950916 [Pyrus x bretschneideri]
Length=527

 Score =   308 bits (789),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 157/175 (90%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+D HLV+SVMSMWTRMQP YAANMWNEALNKRLGTEGLDLYEILAE E R + FD LLT
Sbjct  353  PLDTHLVVSVMSMWTRMQPAYAANMWNEALNKRLGTEGLDLYEILAEVESREMAFDHLLT  412

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPE DEWVYSDGKSTTCVAFILAMYKE+G+FG ++ SIQVTEFTIRDAYMLKI+E+NQ R
Sbjct  413  IPEHDEWVYSDGKSTTCVAFILAMYKEAGIFGPISNSIQVTEFTIRDAYMLKIFEDNQPR  472

Query  381  LPS-WCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPS WCN  ++KLPFCQI+GEYRMELP YNTLEPYANMNE+CPSLPP+Y RP  C
Sbjct  473  LPSCWCNGKDEKLPFCQILGEYRMELPLYNTLEPYANMNEHCPSLPPTYDRPTRC  527



>gb|AGV54795.1| hypothetical protein [Phaseolus vulgaris]
Length=522

 Score =   308 bits (788),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  732  AHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPE  553
            AHLVISVMSMWTR+QP Y+ANMWNEALNKRLGTEGLDL++I+ ETE+RG+ FD+LLTIPE
Sbjct  352  AHLVISVMSMWTRLQPAYSANMWNEALNKRLGTEGLDLHDIIVETEKRGIPFDELLTIPE  411

Query  552  QDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPS  373
            QDEWVYSDGKSTTCVAFIL+MYKE+GVFG ++ SIQVTEFTIRDAYML+I+E+NQTRLP 
Sbjct  412  QDEWVYSDGKSTTCVAFILSMYKEAGVFGPVSSSIQVTEFTIRDAYMLRIFEDNQTRLPR  471

Query  372  WCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            WCN+ ND+L FCQI+GEYRMELPGYNTLEPYANMNE CPSLPP Y RP  C
Sbjct  472  WCNNENDQLSFCQILGEYRMELPGYNTLEPYANMNEYCPSLPPIYDRPSQC  522



>dbj|BAD94699.1| hypothetical protein [Arabidopsis thaliana]
Length=258

 Score =   298 bits (764),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLT
Sbjct  85   PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLT  144

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYK +G+F  LA+ IQVTEFTIRDAY LK++E+NQTR
Sbjct  145  IPEQDEWVYSDGKSTTCVAFILAMYKAAGIFDPLADHIQVTEFTIRDAYTLKLFESNQTR  204

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+   KL FCQI+GEYRMELPGYNT+ PY NMN+NCPSLPP+Y RP  C
Sbjct  205  LPSWCNTEEGKLDFCQILGEYRMELPGYNTIYPYPNMNQNCPSLPPNYERPSKC  258



>gb|EPS61168.1| hypothetical protein M569_13630, partial [Genlisea aurea]
Length=249

 Score =   298 bits (763),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV+SVMSMW RMQP YAANMWNEALN RLGT+ LDLYEIL ETERRG+TFDQLLT
Sbjct  76   PLDAHLVVSVMSMWARMQPAYAANMWNEALNMRLGTKDLDLYEILFETERRGITFDQLLT  135

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEW+YSDGKSTTCVAFIL+MYK +GVF   ++S+QVTEFTI+DAYMLKI+E+N TR
Sbjct  136  IPEQDEWIYSDGKSTTCVAFILSMYKAAGVFSPFSDSVQVTEFTIKDAYMLKIFEDNATR  195

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WC +  D L FCQI+GE+RMELP YNTL+PYANMNENCPSLPP+Y RP  C
Sbjct  196  LPGWCQNEKDGLSFCQILGEFRMELPYYNTLDPYANMNENCPSLPPTYERPPRC  249



>ref|XP_006390921.1| hypothetical protein EUTSA_v10018393mg [Eutrema salsugineum]
 gb|ESQ28207.1| hypothetical protein EUTSA_v10018393mg [Eutrema salsugineum]
Length=529

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP+YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLT
Sbjct  356  PLDAHLVISVMSMWTRVQPSYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLT  415

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYK +GVFG LA+ IQVTEFTIRDAY L+++E NQTR
Sbjct  416  IPEQDEWVYSDGKSTTCVAFILAMYKAAGVFGPLADHIQVTEFTIRDAYTLRLFEENQTR  475

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+   KL FCQI+GEYRMELPGYNT++PYANMNENCPSLPP Y RP  C
Sbjct  476  LPSWCNTEEGKLEFCQILGEYRMELPGYNTIQPYANMNENCPSLPPDYERPSKC  529



>ref|XP_010415693.1| PREDICTED: uncharacterized protein LOC104701657 [Camelina sativa]
Length=531

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLT
Sbjct  358  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLT  417

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYK +GVF  LA+ IQVTEFTIRDAY LK+YENNQTR
Sbjct  418  IPEQDEWVYSDGKSTTCVAFILAMYKAAGVFDPLADHIQVTEFTIRDAYTLKLYENNQTR  477

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+   KL FCQI+GEYRMELPGYNT++PY NMNENCPSLPP+Y RP  C
Sbjct  478  LPSWCNTEEGKLEFCQILGEYRMELPGYNTIDPYPNMNENCPSLPPNYERPSKC  531



>ref|XP_010913435.1| PREDICTED: uncharacterized protein LOC105039122 isoform X2 [Elaeis 
guineensis]
Length=453

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = -1

Query  723  VISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDE  544
            V+S+MSMWTR+QP YAANMWNEALNKRLGTEGLDL++I+ ETERRG+TFDQLLTIPEQDE
Sbjct  286  VMSIMSMWTRLQPAYAANMWNEALNKRLGTEGLDLHDIIIETERRGMTFDQLLTIPEQDE  345

Query  543  WVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCN  364
            W YSDGKSTTCVAFIL MYKE+G+FG +A SIQVTEFTIRDAYMLKI+ENN TRLPSWCN
Sbjct  346  WEYSDGKSTTCVAFILEMYKEAGIFGPIANSIQVTEFTIRDAYMLKIFENNGTRLPSWCN  405

Query  363  SGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            +  +KLPFCQI+GEYRMELP YNT+EPYA MNENCPSLPP+Y RP+ C
Sbjct  406  AEEEKLPFCQILGEYRMELPEYNTIEPYARMNENCPSLPPTYERPVSC  453



>ref|XP_010471012.1| PREDICTED: uncharacterized protein LOC104750861 [Camelina sativa]
Length=532

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLT
Sbjct  359  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLT  418

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYK +GVF  LA+ IQVTEFTIRDAY LK+YENNQTR
Sbjct  419  IPEQDEWVYSDGKSTTCVAFILAMYKAAGVFDPLADHIQVTEFTIRDAYTLKLYENNQTR  478

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+   KL FCQI+GEYRMELPGYNT++PY NMNENCPSLPP+Y RP  C
Sbjct  479  LPSWCNTEEGKLEFCQILGEYRMELPGYNTIDPYPNMNENCPSLPPNYERPSKC  532



>ref|XP_010512094.1| PREDICTED: uncharacterized protein LOC104788107 [Camelina sativa]
Length=531

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLT
Sbjct  358  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLT  417

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYK +GVF  LA+ IQVTEFTIRDAY LK+YENNQTR
Sbjct  418  IPEQDEWVYSDGKSTTCVAFILAMYKAAGVFDPLADHIQVTEFTIRDAYTLKLYENNQTR  477

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+   KL FCQI+GEYRMELPGYNT++PY NMNENCPSLPP+Y RP  C
Sbjct  478  LPSWCNTEEGKLEFCQILGEYRMELPGYNTIDPYPNMNENCPSLPPNYERPSKC  531



>ref|XP_006300446.1| hypothetical protein CARUB_v10020126mg [Capsella rubella]
 gb|EOA33344.1| hypothetical protein CARUB_v10020126mg [Capsella rubella]
Length=531

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLT
Sbjct  358  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLT  417

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYK +GVFG LA++IQVTEFTIRDAY LK+YE+NQTR
Sbjct  418  IPEQDEWVYSDGKSTTCVAFILAMYKAAGVFGPLADNIQVTEFTIRDAYALKLYESNQTR  477

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+   KL FCQI+GEYRMELPGYNT++PY NMN+NCPSLPP+Y RP  C
Sbjct  478  LPSWCNTEEGKLDFCQILGEYRMELPGYNTIDPYPNMNQNCPSLPPNYERPSKC  531



>ref|XP_002887283.1| hypothetical protein ARALYDRAFT_476140 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63542.1| hypothetical protein ARALYDRAFT_476140 [Arabidopsis lyrata subsp. 
lyrata]
Length=525

 Score =   306 bits (785),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLT
Sbjct  352  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLT  411

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYK +GVFG LA+ IQVTEFTIRDAY LK++E+NQTR
Sbjct  412  IPEQDEWVYSDGKSTTCVAFILAMYKAAGVFGPLADHIQVTEFTIRDAYTLKLFESNQTR  471

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+  +KL FCQI+GEYRMELPGYNT++PY NMN+NCPSLPP+Y RP  C
Sbjct  472  LPSWCNTEEEKLDFCQILGEYRMELPGYNTIDPYPNMNQNCPSLPPNYERPSKC  525



>ref|XP_009105692.1| PREDICTED: uncharacterized protein LOC103831561 [Brassica rapa]
Length=526

 Score =   306 bits (784),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLT
Sbjct  353  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEELDLYGILEETARRGMSFDELLT  412

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYK +GVFG LA+ IQVTEFTIRDAY L+++E+NQTR
Sbjct  413  IPEQDEWVYSDGKSTTCVAFILAMYKAAGVFGPLADHIQVTEFTIRDAYTLRLFEDNQTR  472

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+   KL FCQI+GE+RMELPGYNT+EPY NMNENCPSLPP Y RP  C
Sbjct  473  LPSWCNTEKGKLEFCQILGEFRMELPGYNTIEPYPNMNENCPSLPPDYERPSKC  526



>ref|XP_009127775.1| PREDICTED: uncharacterized protein LOC103852633 [Brassica rapa]
Length=526

 Score =   305 bits (781),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLT
Sbjct  353  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLT  412

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYK +GVFG LA+ IQVTEFTIRDAY L+++E+NQTR
Sbjct  413  IPEQDEWVYSDGKSTTCVAFILAMYKAAGVFGPLADHIQVTEFTIRDAYTLRLFEDNQTR  472

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+   KL FCQI+GEYRMELPGYNT++PY NMNENCPSLPP Y RP  C
Sbjct  473  LPSWCNTEKGKLEFCQILGEYRMELPGYNTIDPYPNMNENCPSLPPYYERPSKC  526



>emb|CDY03761.1| BnaA02g14760D [Brassica napus]
Length=526

 Score =   305 bits (781),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLT
Sbjct  353  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLT  412

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYK +GVFG LA+ IQVTEFTIRDAY L+++E+NQTR
Sbjct  413  IPEQDEWVYSDGKSTTCVAFILAMYKAAGVFGPLADHIQVTEFTIRDAYTLRLFEDNQTR  472

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+   KL FCQI+GEYRMELPGYNT++PY NMNENCPSLPP Y RP  C
Sbjct  473  LPSWCNTEKGKLEFCQILGEYRMELPGYNTIDPYPNMNENCPSLPPYYERPSKC  526



>ref|XP_002270582.1| PREDICTED: uncharacterized protein LOC100251867 isoform X1 [Vitis 
vinifera]
 emb|CBI32078.3| unnamed protein product [Vitis vinifera]
Length=520

 Score =   305 bits (780),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTRMQP YA NMWNEALNKRL TE LDL  ILAETE+RGLTFDQLLT
Sbjct  347  PLDAHLVISVMSMWTRMQPAYAENMWNEALNKRLETEDLDLLGILAETEKRGLTFDQLLT  406

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFIL MYKE+G+FG  + SIQVTEFTIRDAYMLKI+ENNQ+R
Sbjct  407  IPEQDEWVYSDGKSTTCVAFILEMYKEAGIFGPASSSIQVTEFTIRDAYMLKIFENNQSR  466

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWC   + +L FCQI+GEYRMELP YNT+EPYA+MNENCPSLPP+Y RP+ C
Sbjct  467  LPSWCGDEDGRLQFCQILGEYRMELPQYNTIEPYAHMNENCPSLPPTYERPVGC  520



>ref|NP_001142383.1| uncharacterized protein LOC100274556 precursor [Zea mays]
 gb|ACF88369.1| unknown [Zea mays]
Length=536

 Score =   305 bits (781),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+LV++VMSMWTR+QP YAANMWNEALNKRLGTE  DL  I+ E ERRG++FDQLLT
Sbjct  363  PLDANLVMAVMSMWTRLQPVYAANMWNEALNKRLGTEDFDLQGIIMEIERRGMSFDQLLT  422

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYKE+G+F   +ESIQVTEFTIRDAYMLKI+E+N  R
Sbjct  423  IPEQDEWVYSDGKSTTCVAFILAMYKEAGIFTPFSESIQVTEFTIRDAYMLKIFEDNPAR  482

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN+G DKLPFCQI+GEYRMELP YNT+EPYA MNENCPSLPP+Y RP  C
Sbjct  483  LPGWCNAGTDKLPFCQILGEYRMELPEYNTIEPYAKMNENCPSLPPTYKRPARC  536



>emb|CDY38797.1| BnaA07g28690D [Brassica napus]
Length=523

 Score =   305 bits (780),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLT
Sbjct  350  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEELDLYGILEETARRGMSFDELLT  409

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYK +GVFG LA+ IQVTEFTIRDAY L+++E+NQTR
Sbjct  410  IPEQDEWVYSDGKSTTCVAFILAMYKAAGVFGPLADHIQVTEFTIRDAYTLRLFEDNQTR  469

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+   KL FCQI+GE+RMELPGYNT++PY NMNENCPSLPP Y RP  C
Sbjct  470  LPSWCNTEKGKLEFCQILGEFRMELPGYNTIDPYPNMNENCPSLPPDYERPSKC  523



>tpg|DAA61320.1| TPA: hypothetical protein ZEAMMB73_635026 [Zea mays]
Length=536

 Score =   305 bits (781),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+LV++VMSMWTR+QP YAANMWNEALNKRLGTE  DL  I+ E ERRG++FDQLLT
Sbjct  363  PLDANLVMAVMSMWTRLQPVYAANMWNEALNKRLGTEDFDLQGIIMEIERRGMSFDQLLT  422

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYKE+G+F   +ESIQVTEFTIRDAYMLKI+E+N  R
Sbjct  423  IPEQDEWVYSDGKSTTCVAFILAMYKEAGIFTPFSESIQVTEFTIRDAYMLKIFEDNPAR  482

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN+G DKLPFCQI+GEYRMELP YNT+EPYA MNENCPSLPP+Y RP  C
Sbjct  483  LPGWCNAGTDKLPFCQILGEYRMELPEYNTIEPYAKMNENCPSLPPTYKRPARC  536



>ref|XP_010272086.1| PREDICTED: uncharacterized protein LOC104607980 isoform X1 [Nelumbo 
nucifera]
Length=531

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV+SVM MWTR+QP YAANMWNEALNKRLGT+GLDL  ILAE+ERRG++FDQLL 
Sbjct  358  PLDAHLVLSVMFMWTRLQPAYAANMWNEALNKRLGTDGLDLPGILAESERRGISFDQLLI  417

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFIL MYKE+G+F  ++ SIQVTEFTIRDAYMLKI+ENN+TR
Sbjct  418  IPEQDEWVYSDGKSTTCVAFILEMYKEAGIFYPISSSIQVTEFTIRDAYMLKIFENNRTR  477

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWC++ + +LPFCQI+GEY+MELP YNT+EPYANMNENCPSLPP+Y RP+ C
Sbjct  478  LPSWCSNADGELPFCQILGEYQMELPQYNTIEPYANMNENCPSLPPTYERPVRC  531



>ref|XP_009419908.1| PREDICTED: uncharacterized protein LOC103999784 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=537

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+LV+SVMSMWTR+QP+YAANMWNEALNKRLGTE LDL+EI+ ET+R+G+TFDQLLT
Sbjct  364  PLDANLVMSVMSMWTRLQPSYAANMWNEALNKRLGTEDLDLHEIIVETQRQGMTFDQLLT  423

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQDEW+YSDGKSTTCVAF+L +YKE+G+ G LA SIQVTEFTIRDAYML I+ENNQTR
Sbjct  424  MPEQDEWIYSDGKSTTCVAFVLELYKEAGILGPLANSIQVTEFTIRDAYMLNIFENNQTR  483

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+  +KLPFCQI+G YRMELP YNT+EPYA+MNENCPSLPP+Y RP  C
Sbjct  484  LPSWCNALEEKLPFCQILGYYRMELPQYNTIEPYAHMNENCPSLPPAYTRPERC  537



>ref|XP_002520208.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42263.1| conserved hypothetical protein [Ricinus communis]
Length=527

 Score =   304 bits (779),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHL++SVMSMWTR+QP YAANMWNEALNKRL TE LDLY ILAE E+RG+TFD+LLT
Sbjct  354  PLDAHLIVSVMSMWTRVQPAYAANMWNEALNKRLDTEDLDLYGILAEIEKRGVTFDELLT  413

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
             PEQD+W+YSDGKSTTCVAFILAMYKE+GVFG ++ SIQVTEFTIRDAYMLKI+ENNQTR
Sbjct  414  APEQDDWIYSDGKSTTCVAFILAMYKEAGVFGPISSSIQVTEFTIRDAYMLKIFENNQTR  473

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+ N +L FCQI+GEY MELP YN+LEPYANMNENCPSLPP+Y RP  C
Sbjct  474  LPSWCNNDNGRLLFCQILGEYWMELPDYNSLEPYANMNENCPSLPPNYDRPGRC  527



>gb|EMS45474.1| hypothetical protein TRIUR3_21271 [Triticum urartu]
Length=435

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+LV++VMSMWTR+QP YAANMWNEALNKRLGTEGLDL  I+ ETE+RG++FDQLLT
Sbjct  262  PLDANLVMAVMSMWTRLQPLYAANMWNEALNKRLGTEGLDLQGIILETEKRGMSFDQLLT  321

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCV+FILAMYKE+GVF    ESIQVTEFTIRDAYMLKI+E+++TR
Sbjct  322  IPEQDEWVYSDGKSTTCVSFILAMYKEAGVFAPFTESIQVTEFTIRDAYMLKIFEDDRTR  381

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWC +  DK PFCQI+GEYRMELP YNT+EPYA MNENCPSLPP+Y RP  C
Sbjct  382  LPSWCRTEADKPPFCQILGEYRMELPEYNTIEPYAKMNENCPSLPPTYKRPSRC  435



>gb|ACG40083.1| hypothetical protein [Zea mays]
Length=537

 Score =   304 bits (778),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+LV++VMSMWTR+QP YAANMWNEALNKRLGTE LDL  I+ E ERRG++FDQLLT
Sbjct  364  PLDANLVMAVMSMWTRLQPVYAANMWNEALNKRLGTEDLDLQGIIMEIERRGMSFDQLLT  423

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYKE+G+F   +ESIQVTEFTIRDAYMLKI+E+N  R
Sbjct  424  IPEQDEWVYSDGKSTTCVAFILAMYKEAGIFTPFSESIQVTEFTIRDAYMLKIFEDNPAR  483

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN+  DKLPFCQI+GEYRMELP YNT+EPYA MNENCPSLPP+Y RP  C
Sbjct  484  LPGWCNADTDKLPFCQILGEYRMELPEYNTIEPYAKMNENCPSLPPTYKRPARC  537



>emb|CDY42991.1| BnaC02g19650D [Brassica napus]
Length=529

 Score =   303 bits (776),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLT
Sbjct  356  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLT  415

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYK +GVFG LA+ IQVTEFTIRDAY L+++E+NQTR
Sbjct  416  IPEQDEWVYSDGKSTTCVAFILAMYKAAGVFGPLADHIQVTEFTIRDAYTLRLFEDNQTR  475

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+   KL FCQI+GEYRMELPGYNT+ PY NMNENCPSLPP Y RP  C
Sbjct  476  LPSWCNTEKGKLEFCQILGEYRMELPGYNTIYPYPNMNENCPSLPPYYERPSKC  529



>emb|CDY11612.1| BnaC06g31270D [Brassica napus]
Length=525

 Score =   303 bits (775),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLT
Sbjct  352  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEELDLYGILEETARRGMSFDELLT  411

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYK +GVFG LA+ IQVTEFTIRDAY L+++E+NQTR
Sbjct  412  IPEQDEWVYSDGKSTTCVAFILAMYKAAGVFGPLADHIQVTEFTIRDAYTLRMFEDNQTR  471

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+   KL  CQI+GE+RMELPGYNT++PY NMNENCPSLPP+Y RP  C
Sbjct  472  LPSWCNTEKGKLELCQILGEFRMELPGYNTIDPYPNMNENCPSLPPTYERPSKC  525



>ref|XP_003578075.1| PREDICTED: uncharacterized protein LOC100824338 [Brachypodium 
distachyon]
Length=536

 Score =   301 bits (771),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+LV++VMSMWTR+QP YAANMWNEALNKRLGTEGLDL+ I+ ETERRG++FDQLLT
Sbjct  363  PLDANLVMAVMSMWTRLQPLYAANMWNEALNKRLGTEGLDLHGIIVETERRGMSFDQLLT  422

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCV+FILAMYKE+GVF    ESIQVTEFTIRDAYMLKI++N+Q R
Sbjct  423  IPEQDEWVYSDGKSTTCVSFILAMYKEAGVFAPFTESIQVTEFTIRDAYMLKIFQNDQAR  482

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWC +  DK  FCQI+GEY+MELP YNT+EPYA MNENCPSLPP+Y RP  C
Sbjct  483  LPSWCQTEADKPTFCQILGEYKMELPEYNTIEPYAKMNENCPSLPPTYKRPSRC  536



>ref|NP_564985.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK25910.1|AF360200_1 unknown protein [Arabidopsis thaliana]
 gb|AAK93691.1| unknown protein [Arabidopsis thaliana]
 gb|AEE35026.1| uncharacterized protein AT1G70160 [Arabidopsis thaliana]
Length=523

 Score =   301 bits (770),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLT
Sbjct  350  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLT  409

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYK +G+F  LA+ IQVTEFTIRDAY LK++E+NQTR
Sbjct  410  IPEQDEWVYSDGKSTTCVAFILAMYKAAGIFDPLADHIQVTEFTIRDAYTLKLFESNQTR  469

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+   KL FCQI+GEYRMELPGYNT+ PY NMN+NCPSLPP+Y RP  C
Sbjct  470  LPSWCNTEEGKLDFCQILGEYRMELPGYNTIYPYPNMNQNCPSLPPNYERPSKC  523



>gb|EEC83605.1| hypothetical protein OsI_29292 [Oryza sativa Indica Group]
Length=547

 Score =   301 bits (771),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+LV++VMSMWTR+QP YA+NMWNEALNKRLGTE LDL+ I+ ET +RG++F+QLLT
Sbjct  374  PLDANLVMAVMSMWTRLQPLYASNMWNEALNKRLGTEKLDLHGIITETGKRGMSFNQLLT  433

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W YSDGKSTTCVAFIL+MYK++GVF    ESIQVTEFTIRDAYMLKI+E+NQTR
Sbjct  434  IPEQDDWEYSDGKSTTCVAFILSMYKKAGVFAPFTESIQVTEFTIRDAYMLKIFEDNQTR  493

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCNSG D+LPFCQI+GEY+MELP YNT+EPYANMNENCPS PP+Y RP+ C
Sbjct  494  LPSWCNSGADRLPFCQILGEYKMELPEYNTIEPYANMNENCPSSPPTYTRPLGC  547



>ref|NP_001061835.1| Os08g0425000 [Oryza sativa Japonica Group]
 dbj|BAC98558.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAC99810.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23749.1| Os08g0425000 [Oryza sativa Japonica Group]
 dbj|BAG97186.1| unnamed protein product [Oryza sativa Japonica Group]
Length=547

 Score =   301 bits (771),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+LV++VMSMWTR+QP YA+NMWNEALNKRLGTE LDL+ I+ ET +RG++F+QLLT
Sbjct  374  PLDANLVMAVMSMWTRLQPLYASNMWNEALNKRLGTEKLDLHGIITETGKRGMSFNQLLT  433

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W YSDGKSTTCVAFIL+MYK++GVF    ESIQVTEFTIRDAYMLKI+E+NQTR
Sbjct  434  IPEQDDWEYSDGKSTTCVAFILSMYKKAGVFAPFTESIQVTEFTIRDAYMLKIFEDNQTR  493

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCNSG D+LPFCQI+GEY+MELP YNT+EPYANMNENCPS PP+Y RP+ C
Sbjct  494  LPSWCNSGADRLPFCQILGEYKMELPEYNTIEPYANMNENCPSSPPTYTRPLGC  547



>gb|AAB61100.1| ESTs gb|R30459,gb|N38441 come from this gene [Arabidopsis thaliana]
Length=551

 Score =   301 bits (771),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLT
Sbjct  378  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLT  437

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYK +G+F  LA+ IQVTEFTIRDAY LK++E+NQTR
Sbjct  438  IPEQDEWVYSDGKSTTCVAFILAMYKAAGIFDPLADHIQVTEFTIRDAYTLKLFESNQTR  497

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+   KL FCQI+GEYRMELPGYNT+ PY NMN+NCPSLPP+Y RP  C
Sbjct  498  LPSWCNTEEGKLDFCQILGEYRMELPGYNTIYPYPNMNQNCPSLPPNYERPSKC  551



>gb|KFK41436.1| hypothetical protein AALP_AA2G130200 [Arabis alpina]
Length=527

 Score =   300 bits (767),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLT
Sbjct  354  PLDAHLVISVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLT  413

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYK +GVFG +A+ IQVTEFTIRDAY L+I++ NQTR
Sbjct  414  IPEQDEWVYSDGKSTTCVAFILAMYKAAGVFGPIADQIQVTEFTIRDAYTLRIFDENQTR  473

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+   KL FCQI+GEYRMELPGYNT+ PY NMNENCPSLP  Y RP  C
Sbjct  474  LPSWCNTEEGKLNFCQILGEYRMELPGYNTIHPYPNMNENCPSLPSDYERPSKC  527



>ref|XP_010043827.1| PREDICTED: uncharacterized protein LOC104432932 [Eucalyptus grandis]
 gb|KCW85832.1| hypothetical protein EUGRSUZ_B02569 [Eucalyptus grandis]
Length=534

 Score =   300 bits (768),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV+SVMSMWTR+QP YAANMWNEALNKRLGTE LDL+ I+ ETE+RG++FD+LLT
Sbjct  361  PLDAHLVVSVMSMWTRLQPAYAANMWNEALNKRLGTEELDLHGIIQETEQRGMSFDELLT  420

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
             PEQD+W+YSDGKSTTCVAFILAMYKE+GVFG ++ SIQVTEFTIRDAYMLKI+EN+QTR
Sbjct  421  TPEQDDWMYSDGKSTTCVAFILAMYKEAGVFGPISSSIQVTEFTIRDAYMLKIFENSQTR  480

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWC++   +LP+CQI+GEY MELP YNT+EPYANMNENCPSLPPSY RP  C
Sbjct  481  LPSWCSNKGGQLPYCQILGEYWMELPEYNTIEPYANMNENCPSLPPSYERPKRC  534



>dbj|BAJ97125.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=534

 Score =   298 bits (764),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+LV++VMSMWTR+QP YAANMWNEALNKRLGTEGLDL  I+ ETE+RG++FDQLLT
Sbjct  361  PLDANLVMAVMSMWTRLQPLYAANMWNEALNKRLGTEGLDLQGIIFETEKRGMSFDQLLT  420

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCV+FILAMYKE+GVF    ESIQVTEFTIRDAYMLKI+E+++ R
Sbjct  421  IPEQDEWVYSDGKSTTCVSFILAMYKEAGVFAPFTESIQVTEFTIRDAYMLKIFEDDRAR  480

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWC +  DK PFCQI+GEYRMELP YNT+EPYA MNENCPSLPP+Y RP  C
Sbjct  481  LPSWCLTEADKPPFCQILGEYRMELPEYNTIEPYAKMNENCPSLPPTYKRPSRC  534



>gb|ACN36261.1| unknown [Zea mays]
Length=392

 Score =   294 bits (752),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+LV+++MSMWTR+QP YA+NMWNEALNKRLGTE LDL+ I+ ETERRGL+F+QLLT
Sbjct  219  PLDANLVMAIMSMWTRLQPRYASNMWNEALNKRLGTEKLDLHGIIRETERRGLSFNQLLT  278

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PE+D+W YSDGKSTTCVAFIL+MYK +GVF    ESIQVTEFTIRDAYMLKI+E+NQTR
Sbjct  279  VPERDDWEYSDGKSTTCVAFILSMYKAAGVFAPYTESIQVTEFTIRDAYMLKIFEDNQTR  338

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+  D LPFCQI+GEY+M LP YNT+EPYANMNENCPS PP+Y RP  C
Sbjct  339  LPSWCNAAADGLPFCQILGEYKMGLPEYNTIEPYANMNENCPSAPPTYSRPSRC  392



>dbj|BAJ99018.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=534

 Score =   297 bits (761),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+LV++VMSMWTR+QP YAANMWNEALNKRLGTEGLDL  I+ ETE+RG++FDQLLT
Sbjct  361  PLDANLVMAVMSMWTRLQPLYAANMWNEALNKRLGTEGLDLQGIIFETEKRGMSFDQLLT  420

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCV+FILAMYKE+GVF    ESIQVTEFTIRDAYMLKI+E++  R
Sbjct  421  IPEQDEWVYSDGKSTTCVSFILAMYKEAGVFAPFTESIQVTEFTIRDAYMLKIFEDDGAR  480

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWC +  DK PFCQI+GEYRMELP YNT+EPYA MNENCPSLPP+Y RP  C
Sbjct  481  LPSWCLTEADKPPFCQILGEYRMELPEYNTIEPYAKMNENCPSLPPTYKRPSRC  534



>ref|XP_002444358.1| hypothetical protein SORBIDRAFT_07g020660 [Sorghum bicolor]
 gb|EES13853.1| hypothetical protein SORBIDRAFT_07g020660 [Sorghum bicolor]
Length=542

 Score =   297 bits (761),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+LV+++MSMWTR+QP YA+NMWNEALNKRLGTE LDL+ +++ETE+RGL+F+QLLT
Sbjct  369  PLDANLVMAIMSMWTRLQPHYASNMWNEALNKRLGTEKLDLHGVISETEKRGLSFNQLLT  428

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPE+D+W YSDGKSTTCVAFIL+MYK +GVF    ESIQVTEFTIRDAYMLKI+E+NQTR
Sbjct  429  IPERDDWEYSDGKSTTCVAFILSMYKAAGVFAPFTESIQVTEFTIRDAYMLKIFEDNQTR  488

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+  D+LPFCQI+GEY+M+LP YNT+EPYANMNENCPS PP+Y RP  C
Sbjct  489  LPSWCNAAADRLPFCQILGEYKMDLPEYNTIEPYANMNENCPSAPPTYNRPSRC  542



>ref|XP_004973463.1| PREDICTED: uncharacterized protein LOC101781133 [Setaria italica]
Length=546

 Score =   297 bits (760),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+LV+++MSMWTR+QP YA+NMWNEALNKRLGTE LDL+ I+ ETERRGL+F+QLLT
Sbjct  373  PLDANLVMAIMSMWTRLQPHYASNMWNEALNKRLGTEKLDLHGIITETERRGLSFNQLLT  432

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPE+D+W YSDGKSTTCVAFIL+MYK +GVF    ESIQVTEFTIRDAYMLK++E+NQTR
Sbjct  433  IPERDDWEYSDGKSTTCVAFILSMYKAAGVFAPFTESIQVTEFTIRDAYMLKVFEDNQTR  492

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN+  D+LPFCQI+GEY+M+LP YNT+EPYANMNENCPS PP+Y RP  C
Sbjct  493  LPGWCNAAADRLPFCQILGEYKMDLPEYNTIEPYANMNENCPSAPPTYSRPARC  546



>ref|XP_006659410.1| PREDICTED: uncharacterized protein LOC102708916 [Oryza brachyantha]
Length=409

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+LV++VMSMWTR+QP YA+NMWNEALNKRLGTE LDL+ I+ ET +RG++F+QLLT
Sbjct  236  PLDANLVMAVMSMWTRLQPLYASNMWNEALNKRLGTEKLDLHGIITETGKRGMSFNQLLT  295

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W YSDGKSTTCVAFIL+MYK++GVF    ESIQVTEFTIRDAYMLKI+E+N TR
Sbjct  296  IPEQDDWEYSDGKSTTCVAFILSMYKKAGVFAPFTESIQVTEFTIRDAYMLKIFEDNHTR  355

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN   D+LPFCQI+GEY+M+LP YNT+EPYANMNENCPS PP+Y RP+ C
Sbjct  356  LPSWCNHEADRLPFCQILGEYKMDLPEYNTIEPYANMNENCPSSPPTYTRPLGC  409



>dbj|BAJ91369.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92745.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=531

 Score =   295 bits (756),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+LV++ MSMWTR+QP YA+NMWNEALNKRLGTE LDL+ I++ETERRG++F+QLLT
Sbjct  358  PLDANLVMAAMSMWTRLQPHYASNMWNEALNKRLGTEQLDLHGIISETERRGMSFNQLLT  417

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEW YSDGKSTTCVAFILAMYK +GVF    ESIQVTEFTIRDAYML+I+E+N+TR
Sbjct  418  IPEQDEWEYSDGKSTTCVAFILAMYKAAGVFAPFTESIQVTEFTIRDAYMLRIFEDNRTR  477

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN   D+LPFCQ++GEY+MELP YNT++PYANMNENCPS PP+Y RP+ C
Sbjct  478  LPGWCNGDADRLPFCQVLGEYKMELPEYNTIQPYANMNENCPSSPPTYDRPLRC  531



>ref|NP_001143255.1| uncharacterized protein LOC100275783 precursor [Zea mays]
 gb|ACG30173.1| hypothetical protein [Zea mays]
Length=522

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+LV+++MSMWTR+QP YA+NMWNEALNKRLGTE LDL+ I+ ETERRGL+F+QLLT
Sbjct  349  PLDANLVMAIMSMWTRLQPRYASNMWNEALNKRLGTEKLDLHGIIRETERRGLSFNQLLT  408

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PE+D+W YSDGKSTTCVAFIL+MYK +GVF    ESIQVTEFTIRDAYMLKI+E+NQTR
Sbjct  409  VPERDDWEYSDGKSTTCVAFILSMYKAAGVFAPYTESIQVTEFTIRDAYMLKIFEDNQTR  468

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+  D LPFCQI+GEY+M LP YNT+EPYANMNENCPS PP+Y RP  C
Sbjct  469  LPSWCNAAADGLPFCQILGEYKMGLPEYNTIEPYANMNENCPSAPPTYSRPSRC  522



>dbj|BAJ33873.1| unnamed protein product [Thellungiella halophila]
Length=521

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP+YAANMWNEALNKRLGTE LDLY IL ET RRG++FD+LLT
Sbjct  356  PLDAHLVISVMSMWTRVQPSYAANMWNEALNKRLGTEDLDLYGILEETARRGMSFDELLT  415

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFILAMYK +GVFG LA+ IQVTEFTIRDAY L+++E NQTR
Sbjct  416  IPEQDEWVYSDGKSTTCVAFILAMYKAAGVFGPLADHIQVTEFTIRDAYTLRLFEENQTR  475

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSL  250
            LPSWCN+   KL FCQI+GEYRMELPGYNT++PYANMNENCPS 
Sbjct  476  LPSWCNTEEGKLEFCQILGEYRMELPGYNTIQPYANMNENCPSF  519



>ref|XP_008676929.1| PREDICTED: uncharacterized protein LOC100275783 isoform X1 [Zea 
mays]
 ref|XP_008676930.1| PREDICTED: uncharacterized protein LOC100275783 isoform X1 [Zea 
mays]
 gb|AFW62202.1| hypothetical protein ZEAMMB73_209421 [Zea mays]
Length=522

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+LV+++MSMWTR+QP YA+NMWNEALNKRLGTE LDL+ I+ ETERRGL+F+QLLT
Sbjct  349  PLDANLVMAIMSMWTRLQPRYASNMWNEALNKRLGTEKLDLHGIIRETERRGLSFNQLLT  408

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PE+D+W YSDGKSTTCVAFIL+MYK +GVF    ESIQVTEFTIRDAYMLKI+E+NQTR
Sbjct  409  VPERDDWEYSDGKSTTCVAFILSMYKAAGVFAPYTESIQVTEFTIRDAYMLKIFEDNQTR  468

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+  D LPFCQI+GEY+M LP YNT+EPYANMNENCPS PP+Y RP  C
Sbjct  469  LPSWCNAAADGLPFCQILGEYKMGLPEYNTIEPYANMNENCPSAPPTYSRPSRC  522



>ref|XP_006856897.1| hypothetical protein AMTR_s00055p00212390 [Amborella trichopoda]
 gb|ERN18364.1| hypothetical protein AMTR_s00055p00212390 [Amborella trichopoda]
Length=526

 Score =   293 bits (749),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 156/175 (89%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLVISVMSMWTR+QP YAANMWNEALNKRL TEGLDL+ IL ETE+RG++FDQLLT
Sbjct  352  PLDAHLVISVMSMWTRLQPAYAANMWNEALNKRLETEGLDLHGILLETEKRGISFDQLLT  411

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEWVYSDGKSTTCVAFIL MYKE+G+FG ++ SIQVTEFTIRDAYML+I+ENN +R
Sbjct  412  IPEQDEWVYSDGKSTTCVAFILEMYKEAGIFGPVSNSIQVTEFTIRDAYMLRIFENNSSR  471

Query  381  LPSWCNSGNDKL-PFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWC++ + K  PFCQI+GEY ME P YNT+E Y +MNENCPSLPP+Y RP+ C
Sbjct  472  LPSWCSNRDTKQPPFCQILGEYHMEFPRYNTVELYGHMNENCPSLPPNYDRPVGC  526



>ref|XP_003574496.1| PREDICTED: uncharacterized protein LOC100845920 [Brachypodium 
distachyon]
Length=536

 Score =   293 bits (749),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+L+++VMSMWTR+QP YA+NMWNEALNKRLGTE LDL+ I++ETE+RG++F+QLLT
Sbjct  363  PLDANLIMAVMSMWTRLQPQYASNMWNEALNKRLGTEKLDLHGIISETEKRGMSFNQLLT  422

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQDEW YSDGKSTTCVAFIL+MYK +GVF    ESIQVTEFTIRDAYML+I+E+N TR
Sbjct  423  VPEQDEWEYSDGKSTTCVAFILSMYKAAGVFAPFTESIQVTEFTIRDAYMLRIFEDNATR  482

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN   D LPFCQI+GEY+MELP YNT+EPYANMNENCPS PP+Y RP+ C
Sbjct  483  LPGWCNGEADGLPFCQILGEYKMELPEYNTIEPYANMNENCPSSPPTYKRPVRC  536



>ref|XP_010445104.1| PREDICTED: uncharacterized protein LOC104727724, partial [Camelina 
sativa]
Length=247

 Score =   280 bits (716),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 153/175 (87%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W+++QP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL 
Sbjct  73   PLDAHLVASVMTVWSKIQPDYAANMWNEALNKRLGTEGLDLPDVLVEVEKRGSSFDELLA  132

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD+W+YSDGKST+C+AFIL MYKE+G+F  ++ SIQVTEFTI+DAYMLK +ENN +R
Sbjct  133  VPEQDDWIYSDGKSTSCIAFILEMYKEAGLFDPISSSIQVTEFTIKDAYMLKFFENNASR  192

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
             P WCN  +D KLP+CQI+G+YRMELPGYNT+EPY +MNE+CPSLPP Y RP +C
Sbjct  193  FPKWCNDNDDVKLPYCQILGKYRMELPGYNTMEPYPHMNEHCPSLPPKYHRPKNC  247



>gb|EMS65818.1| hypothetical protein TRIUR3_10678 [Triticum urartu]
Length=353

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = -1

Query  723  VISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDE  544
            V++ MSMWTR+QP YA+NMWNEALNKRLGTE LDL+ I++ETERRG++F+QLLTIPEQDE
Sbjct  186  VMAAMSMWTRLQPHYASNMWNEALNKRLGTEQLDLHGIISETERRGMSFNQLLTIPEQDE  245

Query  543  WVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCN  364
            W YSDGKSTTCVAFILAMYK +GVF    ESIQVTEFTIRDAY L+I+E+N+TRLP WCN
Sbjct  246  WEYSDGKSTTCVAFILAMYKAAGVFAPFTESIQVTEFTIRDAYTLRIFEDNRTRLPGWCN  305

Query  363  SGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
               D LPFCQI+GEY+MELP YNT++PYANMNENCPS PP+Y RP+ C
Sbjct  306  GDADGLPFCQILGEYKMELPEYNTIQPYANMNENCPSSPPTYSRPLRC  353



>ref|XP_006858155.1| hypothetical protein AMTR_s00062p00137330 [Amborella trichopoda]
 gb|ERN19622.1| hypothetical protein AMTR_s00062p00137330 [Amborella trichopoda]
Length=526

 Score =   287 bits (735),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 155/175 (89%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM+MW ++QP YAANMWNEALNKRLGTEGLDL EIL ETER+GL+FD+LLT
Sbjct  352  PLDAHLVASVMTMWNKIQPAYAANMWNEALNKRLGTEGLDLPEILVETERQGLSFDKLLT  411

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W+Y+DGKST+CVAF+L MYK++G+F  +A+SIQVTEFTI+DAY+LK +EN+ +R
Sbjct  412  IPEQDDWLYTDGKSTSCVAFVLEMYKQAGLFDQIADSIQVTEFTIKDAYILKFFENDTSR  471

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+D KLPFCQI+G+YRMELPGYNTL+PYA MNE CPSLPP Y R   C
Sbjct  472  LPQWCNKGDDVKLPFCQILGKYRMELPGYNTLQPYAQMNERCPSLPPEYERSREC  526



>gb|EAZ42788.1| hypothetical protein OsJ_27372 [Oryza sativa Japonica Group]
Length=484

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 154/174 (89%), Gaps = 5/174 (3%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+LV++VMSMWTR+QP YA+NMWNEALNKRLGTE LDL+ I+ ET +RG++F+QLLT
Sbjct  316  PLDANLVMAVMSMWTRLQPLYASNMWNEALNKRLGTEKLDLHGIITETGKRGMSFNQLLT  375

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W YSDGKSTTCVAFIL+MYK++GVF    ESIQ     IRDAYMLKI+E+NQTR
Sbjct  376  IPEQDDWEYSDGKSTTCVAFILSMYKKAGVFAPFTESIQ-----IRDAYMLKIFEDNQTR  430

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCNSG D+LPFCQI+GEY+MELP YNT+EPYANMNENCPS PP+Y RP+ C
Sbjct  431  LPSWCNSGADRLPFCQILGEYKMELPEYNTIEPYANMNENCPSSPPTYTRPLGC  484



>gb|ABK24649.1| unknown [Picea sitchensis]
Length=521

 Score =   285 bits (730),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 155/175 (89%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV+S+M+MWTR+QP YAANMWNEALNKRLGT  LD+  +L E+E+RG+ F+QLLT
Sbjct  347  PLDAHLVLSIMAMWTRVQPNYAANMWNEALNKRLGTMDLDIRGVLIESEKRGIPFEQLLT  406

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD+W+YSDGKSTTCVAFIL MYKE+G+F S++ SIQVTEFTIRDAYM+K +E+N+T 
Sbjct  407  VPEQDDWIYSDGKSTTCVAFILEMYKEAGLFDSISSSIQVTEFTIRDAYMMKYFESNRTH  466

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN  +D KLPFCQI+GEYRMELPGYNT++PYA MNE CPSLPP+Y RP  C
Sbjct  467  LPSWCNENDDVKLPFCQILGEYRMELPGYNTIDPYAFMNEQCPSLPPAYDRPTGC  521



>ref|XP_010276049.1| PREDICTED: uncharacterized protein LOC104610902 [Nelumbo nucifera]
Length=528

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 153/175 (87%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV S M++W +MQP YAAN+WNEALNKRLGTEGLDL EIL ETERRGL+FD+LLT
Sbjct  354  PLDAHLVASGMTVWHQMQPAYAANLWNEALNKRLGTEGLDLPEILVETERRGLSFDKLLT  413

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W+YS+GKST+CVAFIL MYK++G+FG ++ SIQVTEFTI+DAY LK +ENN +R
Sbjct  414  IPEQDDWLYSNGKSTSCVAFILEMYKQAGLFGPISSSIQVTEFTIKDAYTLKFFENNSSR  473

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+D KLPFCQI G+YRMELPGYNT++PY +MNE CPSLPP Y RP  C
Sbjct  474  LPKWCNEGDDVKLPFCQIRGKYRMELPGYNTMDPYPHMNERCPSLPPQYFRPQGC  528



>emb|CDY17285.1| BnaA10g09190D [Brassica napus]
Length=541

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 152/175 (87%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV S M++W ++QP YAANMWNEALNKRLGT+GL L ++L E E+RG +FD+LLT
Sbjct  367  PIDAHLVASFMTVWNKLQPEYAANMWNEALNKRLGTKGLGLPDVLVEVEKRGSSFDKLLT  426

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD+WVYSDGKST+C+AFIL MYKE+G+FGSLA SIQVTEFT++DAYML  +ENN +R
Sbjct  427  VPEQDDWVYSDGKSTSCIAFILEMYKEAGLFGSLASSIQVTEFTLKDAYMLNFFENNTSR  486

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN  +  KLPFCQI+G+YRMELPGYNT+EPY +MNE CPSLPP Y RP++C
Sbjct  487  LPKWCNDNDSVKLPFCQILGKYRMELPGYNTMEPYTHMNEQCPSLPPKYNRPVNC  541



>gb|KCW70170.1| hypothetical protein EUGRSUZ_F03459 [Eucalyptus grandis]
Length=439

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 156/175 (89%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W +++P+YAAN+WNEALN RLGTEGLDL +IL ETE+RG +FD+LLT
Sbjct  265  PLDAHLVASVMTVWNQLRPSYAANLWNEALNLRLGTEGLDLPDILVETEKRGSSFDELLT  324

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPE+D+W+YSDGKST+C+AF+L MYKE+G+FGS+A+SIQVTEFTI+DAYML+ +ENN +R
Sbjct  325  IPEKDDWLYSDGKSTSCIAFVLEMYKEAGLFGSIADSIQVTEFTIKDAYMLRFFENNSSR  384

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN  +D KLPFCQI G+YRMELPGYNT++PY +MNE CPSLPP Y RP +C
Sbjct  385  LPKWCNDADDVKLPFCQIRGKYRMELPGYNTMDPYPHMNERCPSLPPKYLRPRNC  439



>ref|XP_010267678.1| PREDICTED: uncharacterized protein LOC104604833 [Nelumbo nucifera]
Length=528

 Score =   283 bits (724),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 151/175 (86%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W +M+P YAANMWNEALNKRLGTEGLDL EIL ETERRGL+FD+LLT
Sbjct  354  PIDAHLVASVMTIWNQMKPEYAANMWNEALNKRLGTEGLDLPEILVETERRGLSFDKLLT  413

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W+YSDGKST+CVAFIL MYK +G+F  +A SIQVTEFTI+DAY LK +ENN +R
Sbjct  414  IPEQDDWIYSDGKSTSCVAFILEMYKHAGLFDPIASSIQVTEFTIKDAYTLKFFENNSSR  473

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G++ KLPFCQI GEYRMELPGYNT++ Y +MNE CPSLPP Y RP  C
Sbjct  474  LPKWCNEGDNVKLPFCQIKGEYRMELPGYNTMDLYPHMNERCPSLPPEYYRPKGC  528



>ref|XP_009120015.1| PREDICTED: uncharacterized protein LOC103844940 [Brassica rapa]
Length=529

 Score =   283 bits (724),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 151/175 (86%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV S M++W ++QP YAANMWNEALNKRLGTEGL L ++L E E+RG +FD+LLT
Sbjct  355  PIDAHLVASFMTVWNKLQPEYAANMWNEALNKRLGTEGLGLPDVLVEVEKRGSSFDKLLT  414

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD+WVYSDGKST+C+AFIL MYKE+G+FGSLA SIQVTEFT++DAYML  +ENN +R
Sbjct  415  VPEQDDWVYSDGKSTSCIAFILEMYKEAGLFGSLASSIQVTEFTLKDAYMLNFFENNASR  474

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN  +  KLPFCQI+G+YRMELPGYNT+EPY +MNE CPSLPP Y RP +C
Sbjct  475  LPKWCNDNDSVKLPFCQILGKYRMELPGYNTMEPYTHMNEQCPSLPPKYNRPGNC  529



>emb|CDY19873.1| BnaC09g31390D [Brassica napus]
Length=541

 Score =   283 bits (723),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 151/175 (86%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV S M++W ++QP YAANMWNEALNKRLGTEGL L ++L E E+RG +FD+LLT
Sbjct  367  PIDAHLVASFMTVWNKLQPEYAANMWNEALNKRLGTEGLGLPDVLVEVEKRGSSFDKLLT  426

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD+W+YSDGKST+C+AFIL MYKE+G+FGSLA SIQVTEFT++DAYML  +ENN +R
Sbjct  427  VPEQDDWIYSDGKSTSCIAFILEMYKEAGLFGSLASSIQVTEFTLKDAYMLNFFENNASR  486

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN  +  KLPFCQI+G+YRMELPGYNT+EPY +MNE CPSLPP Y RP +C
Sbjct  487  LPKWCNDNDSVKLPFCQILGKYRMELPGYNTMEPYTHMNEQCPSLPPKYNRPGNC  541



>gb|EMT12587.1| hypothetical protein F775_11937 [Aegilops tauschii]
Length=453

 Score =   279 bits (714),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 149/174 (86%), Gaps = 6/174 (3%)
 Frame = -1

Query  723  VISVMSMWTRMQPTYAANMWNEALNKRLGTE------GLDLYEILAETERRGLTFDQLLT  562
            V++ MSMWTR+QP YA+NMWNEALNKRLGTE       LDL+ I++ETERRG++F+QLLT
Sbjct  280  VMAAMSMWTRLQPHYASNMWNEALNKRLGTERTEKLTQLDLHGIISETERRGMSFNQLLT  339

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEW YSDGKSTTCVAFILAMYK +GVF    ESIQVTEFTIRDAYML+I+E+N+TR
Sbjct  340  IPEQDEWEYSDGKSTTCVAFILAMYKAAGVFAPFTESIQVTEFTIRDAYMLRIFEDNRTR  399

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN   D LPFCQI+GEY+MELP YNT++PYANMNENCPS PP+Y RP+ C
Sbjct  400  LPGWCNGDADGLPFCQILGEYKMELPEYNTIQPYANMNENCPSSPPTYDRPLRC  453



>ref|XP_006401517.1| hypothetical protein EUTSA_v10013232mg [Eutrema salsugineum]
 gb|ESQ42970.1| hypothetical protein EUTSA_v10013232mg [Eutrema salsugineum]
Length=529

 Score =   281 bits (720),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 151/175 (86%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV S M++W++MQP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL 
Sbjct  355  PLDAHLVASFMTVWSKMQPDYAANMWNEALNKRLGTEGLDLSDVLVEVEKRGSSFDKLLA  414

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD W+YSDGKST+C+AFIL MYKE+G+FGSLA S+QVTEFTI+DAYML  +E N +R
Sbjct  415  IPEQDNWIYSDGKSTSCIAFILEMYKEAGLFGSLANSVQVTEFTIKDAYMLNFFETNASR  474

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN  +  KLP+CQI+G+YRMELPGYNT+EPY++MNE CPSLPP Y RP +C
Sbjct  475  LPEWCNDNDSVKLPYCQILGKYRMELPGYNTMEPYSHMNEQCPSLPPKYNRPENC  529



>ref|XP_010433417.1| PREDICTED: uncharacterized protein LOC104717532 [Camelina sativa]
Length=523

 Score =   280 bits (717),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 153/175 (87%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W+++QP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL 
Sbjct  349  PLDAHLVASVMTVWSKIQPDYAANMWNEALNKRLGTEGLDLPDVLVEVEKRGSSFDELLA  408

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD+W+YSDGKST+C+AFIL MYKE+G+F  ++ SIQVTEFTI+DAYMLK +ENN +R
Sbjct  409  VPEQDDWIYSDGKSTSCIAFILEMYKEAGLFDPISSSIQVTEFTIKDAYMLKFFENNASR  468

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
             P WCN  +D KLP+CQI+G+YRMELPGYNT+EPY +MNE+CPSLPP Y RP +C
Sbjct  469  FPKWCNDNDDMKLPYCQILGKYRMELPGYNTMEPYPHMNEHCPSLPPKYHRPKNC  523



>ref|XP_002867528.1| hypothetical protein ARALYDRAFT_913846 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43787.1| hypothetical protein ARALYDRAFT_913846 [Arabidopsis lyrata subsp. 
lyrata]
Length=522

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 153/175 (87%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W+++QP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL 
Sbjct  348  PLDAHLVASVMTVWSKIQPDYAANMWNEALNKRLGTEGLDLPDVLVEVEKRGSSFDELLA  407

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD+W+YSDGKST+C+AFIL MYKE+G+F  ++ SIQVTEFTI+DAYMLK +ENN +R
Sbjct  408  VPEQDDWIYSDGKSTSCIAFILEMYKEAGLFDPISSSIQVTEFTIKDAYMLKFFENNASR  467

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
             P WCN  +D KLP+CQI+G+YRMELPGYNT+EPY +MNE+CPSLPP Y RP +C
Sbjct  468  FPKWCNDNDDVKLPYCQILGKYRMELPGYNTMEPYPHMNEHCPSLPPKYHRPKNC  522



>ref|XP_010448765.1| PREDICTED: uncharacterized protein LOC104731172 [Camelina sativa]
Length=536

 Score =   280 bits (717),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 153/175 (87%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV S M++W++MQP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL 
Sbjct  362  PLDAHLVASFMTVWSKMQPDYAANMWNEALNKRLGTEGLDLSDVLVEVEKRGSSFDRLLA  421

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD+W+YSDGKST+C+AFIL MYKE+G+FG LA SIQVTEFTI+DAYML  +E N +R
Sbjct  422  VPEQDDWIYSDGKSTSCIAFILEMYKEAGLFGPLASSIQVTEFTIKDAYMLNFFETNASR  481

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP+WCN  ++ KLP+CQI+G+YRMELPGYNT+EPY++MNE CP+LPP Y RP +C
Sbjct  482  LPTWCNDNDNVKLPYCQILGKYRMELPGYNTMEPYSHMNEQCPTLPPKYNRPDNC  536



>ref|XP_010438669.1| PREDICTED: uncharacterized protein LOC104722227 [Camelina sativa]
Length=524

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 153/175 (87%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W+++QP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL 
Sbjct  350  PLDAHLVASVMTVWSKIQPDYAANMWNEALNKRLGTEGLDLPDVLVEVEKRGSSFDELLA  409

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD+W+YSDGKST+C+AFIL MYKE+G+F  ++ SIQVTEFTI+DAYMLK +ENN +R
Sbjct  410  VPEQDDWIYSDGKSTSCIAFILEMYKEAGLFDPISSSIQVTEFTIKDAYMLKFFENNASR  469

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
             P WCN  +D KLP+CQI+G+YRMELPGYNT+EPY +MNE+CPSLPP Y RP +C
Sbjct  470  FPKWCNDNDDVKLPYCQILGKYRMELPGYNTMEPYPHMNEHCPSLPPKYHRPKNC  524



>emb|CDY29265.1| BnaC01g19170D [Brassica napus]
Length=507

 Score =   280 bits (715),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 153/175 (87%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W+++QP YAAN+WNEALNKRLGTEGLDL ++L E E+RG +FD+LL 
Sbjct  333  PLDAHLVASVMTVWSKIQPDYAANIWNEALNKRLGTEGLDLPDVLVEVEKRGSSFDELLA  392

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD W+YSDGKST+C+AFIL MYKE G+F  ++ SIQVTEFTI+DAYMLK +ENN +R
Sbjct  393  VPEQDHWIYSDGKSTSCIAFILEMYKEGGLFDPISSSIQVTEFTIKDAYMLKFFENNASR  452

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP+WCN  +D KLP+CQI+G+YRMELPGYNT+EPY +MNE+CPSLPP Y RP +C
Sbjct  453  LPTWCNDNDDVKLPYCQILGKYRMELPGYNTMEPYPHMNEHCPSLPPKYHRPKNC  507



>ref|XP_002864361.1| hypothetical protein ARALYDRAFT_331828 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40620.1| hypothetical protein ARALYDRAFT_331828 [Arabidopsis lyrata subsp. 
lyrata]
Length=529

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 155/175 (89%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V S M++W++MQP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL 
Sbjct  355  PLDAHIVASFMTVWSQMQPEYAANMWNEALNKRLGTEGLDLSDVLVEVEKRGSSFDKLLA  414

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD+W+YSDGKST+C+AFIL +YKE+G+FG LA SIQVTEFTI+DAYML  +ENN +R
Sbjct  415  VPEQDDWIYSDGKSTSCIAFILELYKEAGLFGPLANSIQVTEFTIKDAYMLNFFENNASR  474

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP+WCN+ ++ KLP+CQI+G+YRMELPGYNT+EPY++MNE CP+LPP Y RP +C
Sbjct  475  LPTWCNANDNVKLPYCQILGKYRMELPGYNTMEPYSHMNEQCPTLPPKYNRPDNC  529



>ref|XP_009143005.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103866775 
[Brassica rapa]
Length=523

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 153/175 (87%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W+++QP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL 
Sbjct  349  PLDAHLVASVMTVWSKIQPDYAANMWNEALNKRLGTEGLDLPDVLVEVEKRGSSFDELLA  408

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQDEW+YSDGKST+C+AFIL MYKE G+F  ++ SIQVTEFTI+DAYMLK +ENN +R
Sbjct  409  VPEQDEWIYSDGKSTSCIAFILEMYKEGGLFDPISSSIQVTEFTIKDAYMLKFFENNASR  468

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP+WCN  +D KLP+CQI+G+YRMELP YNT+EPY +MNE+CPSLPP Y RP +C
Sbjct  469  LPTWCNDNDDVKLPYCQILGKYRMELPDYNTMEPYPHMNEHCPSLPPKYHRPKNC  523



>ref|XP_006280251.1| hypothetical protein CARUB_v10026167mg, partial [Capsella rubella]
 gb|EOA13149.1| hypothetical protein CARUB_v10026167mg, partial [Capsella rubella]
Length=563

 Score =   281 bits (719),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 154/175 (88%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV S M++W++MQP YAANMWNEALNKRLGT+GLDL ++L E E+RG +FD+LLT
Sbjct  389  PLDAHLVASFMTVWSKMQPEYAANMWNEALNKRLGTKGLDLSDVLVEVEKRGSSFDKLLT  448

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W+YSDG ST+C+AFIL MYKE+G+FG LA SIQVTEFTI+DAYML  +ENN +R
Sbjct  449  IPEQDDWIYSDGPSTSCIAFILEMYKEAGLFGPLASSIQVTEFTIKDAYMLNFFENNASR  508

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP+WCN  ++ KLP+CQI+G+YRMELPGYNT+EPY++MNE CP+LPP Y RP +C
Sbjct  509  LPTWCNDNDNVKLPYCQILGKYRMELPGYNTMEPYSHMNEQCPTLPPKYNRPDNC  563



>gb|KFK29208.1| hypothetical protein AALP_AA7G103200 [Arabis alpina]
Length=521

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 153/175 (87%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W+++QP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL 
Sbjct  347  PLDAHLVASVMTVWSKIQPDYAANMWNEALNKRLGTEGLDLPDVLVEVEKRGSSFDELLA  406

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD+W+YSDGKST+C+AFIL MYKE+G+F  ++ SIQVTEFTI+DAYMLK +ENN +R
Sbjct  407  VPEQDDWIYSDGKSTSCIAFILEMYKEAGLFDPISSSIQVTEFTIKDAYMLKFFENNASR  466

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
             P WCN  +D KLP+CQI+G+YRMELPGYNT+EPY +MNE+CPSLPP Y RP +C
Sbjct  467  FPKWCNDNDDVKLPYCQILGKYRMELPGYNTMEPYPHMNEHCPSLPPKYHRPKNC  521



>ref|XP_009127046.1| PREDICTED: uncharacterized protein LOC103851917 [Brassica rapa]
Length=529

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 151/175 (86%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+D+HLV S M++W++MQP YAANMWNEALNKRLGT+GLDL ++L E E+RG +FD+LL 
Sbjct  355  PLDSHLVASFMTVWSKMQPDYAANMWNEALNKRLGTKGLDLSDVLVEVEKRGSSFDKLLA  414

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVYSDGKST+C+AFIL MYKE G+FGSLA+S+QVTEFTI+DAYML  +E N +R
Sbjct  415  IPEQDDWVYSDGKSTSCIAFILEMYKEGGLFGSLADSVQVTEFTIKDAYMLNFFETNASR  474

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN  +  KLP+CQI+G+YRM+LPGYNT+EPY +MNE CPSLPP Y RP +C
Sbjct  475  LPKWCNDNDSVKLPYCQILGKYRMQLPGYNTMEPYTHMNEQCPSLPPKYNRPDNC  529



>emb|CDX89285.1| BnaA01g16080D [Brassica napus]
Length=475

 Score =   278 bits (711),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 151/175 (86%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W+++QP YAANMWNEALNKRLGTEGLDL  +L E E+RG +FD+LL 
Sbjct  301  PLDAHLVASVMTVWSKIQPDYAANMWNEALNKRLGTEGLDLPGVLVEVEKRGSSFDELLA  360

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQDEW+YSDGKST+C+AFIL MYKE G+F  ++ SIQVTEFTI+DAYMLK +ENN +R
Sbjct  361  VPEQDEWIYSDGKSTSCIAFILEMYKEGGLFDPVSSSIQVTEFTIKDAYMLKFFENNASR  420

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN  +D KLP+CQI+G+YRMELP YNT+EPY +MNE+CPSLPP Y RP +C
Sbjct  421  LPKWCNDNDDVKLPYCQILGKYRMELPDYNTMEPYPHMNEHCPSLPPKYHRPKNC  475



>ref|XP_006413116.1| hypothetical protein EUTSA_v10024847mg [Eutrema salsugineum]
 gb|ESQ54569.1| hypothetical protein EUTSA_v10024847mg [Eutrema salsugineum]
Length=546

 Score =   280 bits (716),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 154/175 (88%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W+++QP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL 
Sbjct  372  PLDAHLVASVMTVWSKIQPDYAANMWNEALNKRLGTEGLDLPDVLVEVEKRGSSFDELLA  431

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD+W+YSDGKST+C+AFIL MYKE+G+F  ++ SIQVTEFTI+DAY+LK +ENN +R
Sbjct  432  VPEQDDWIYSDGKSTSCIAFILEMYKEAGLFDPISSSIQVTEFTIKDAYILKFFENNASR  491

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN  +D KLP+CQI+G+YRMELPGYNT+EPY +MNE+CPSLPP Y RP +C
Sbjct  492  LPKWCNDNDDVKLPYCQILGKYRMELPGYNTMEPYPHMNEHCPSLPPKYHRPSNC  546



>ref|XP_010482896.1| PREDICTED: uncharacterized protein LOC104761505 [Camelina sativa]
Length=534

 Score =   280 bits (715),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 152/175 (87%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHL  S M++W++MQP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL 
Sbjct  360  PLDAHLAASFMTVWSKMQPDYAANMWNEALNKRLGTEGLDLSDVLVEVEKRGSSFDRLLA  419

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD+W+YSDGKST+C+AFIL MYKE+G+FG LA SIQVTEFTI+DAYML  +ENN +R
Sbjct  420  VPEQDDWIYSDGKSTSCIAFILEMYKEAGLFGPLASSIQVTEFTIKDAYMLNFFENNASR  479

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP+WCN  ++ KLP+CQI+G+YRMELPGYNT+ PY++MNE CP+LPP Y RP +C
Sbjct  480  LPTWCNDNDNVKLPYCQILGKYRMELPGYNTMAPYSHMNEQCPTLPPKYNRPDNC  534



>ref|NP_200298.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB08766.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96551.1| uncharacterized protein AT5G54870 [Arabidopsis thaliana]
Length=531

 Score =   279 bits (714),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 152/175 (87%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV S M++W++MQP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL 
Sbjct  357  PLDAHLVASFMTVWSQMQPEYAANMWNEALNKRLGTEGLDLSDVLVEVEKRGSSFDKLLA  416

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PE D+W+YSDGKST+C+AFIL MYKE+G+FG LA SIQVTEFTI+DAYML  +ENN +R
Sbjct  417  VPELDDWIYSDGKSTSCIAFILEMYKEAGLFGPLASSIQVTEFTIKDAYMLNFFENNASR  476

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP+WCN  +  KLP+CQI+G+YRMELPGYNT+EPY++MNE CP+LPP Y RP +C
Sbjct  477  LPTWCNDNDSVKLPYCQILGKYRMELPGYNTMEPYSHMNEQCPTLPPKYNRPDNC  531



>ref|XP_010446119.1| PREDICTED: uncharacterized protein LOC104728896 [Camelina sativa]
Length=697

 Score =   282 bits (721),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 153/175 (87%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV S M++W++MQP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL 
Sbjct  523  PLDAHLVASFMTVWSKMQPDYAANMWNEALNKRLGTEGLDLSDVLVEVEKRGSSFDRLLA  582

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD+W+YSDGKST+C+AFIL +YKE+G+FG LA SIQVTEFTI+DAYML  +ENN +R
Sbjct  583  VPEQDDWIYSDGKSTSCIAFILEIYKEAGLFGPLASSIQVTEFTIKDAYMLNFFENNASR  642

Query  381  LPSWCNSG-NDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP+WCN   N KLP+CQI+G+YRMELPGYNT+EPY++MNE CP+LPP Y RP +C
Sbjct  643  LPTWCNDNDNVKLPYCQILGKYRMELPGYNTMEPYSHMNEQCPTLPPKYNRPDNC  697



>gb|ABR17461.1| unknown [Picea sitchensis]
Length=520

 Score =   276 bits (707),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 152/175 (87%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV+SVM++W RMQP YAANMWNEALNKRLGT+ LDL  IL ETE+RG++F+ LL 
Sbjct  346  PLDAHLVVSVMTIWNRMQPDYAANMWNEALNKRLGTKDLDLPSILIETEQRGISFEDLLK  405

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPE+D+W YSDGKSTTC+AFIL MYKE+G+F  ++ SIQVTEFTIRDAYML+ +++N T 
Sbjct  406  IPEKDDWFYSDGKSTTCIAFILEMYKEAGLFDPISNSIQVTEFTIRDAYMLRFFDDNITN  465

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN  ++ +LPFCQI+GEYRMELPGYNT++PY +MNENCPSLPP+Y RP  C
Sbjct  466  LPSWCNENDEVQLPFCQILGEYRMELPGYNTIDPYPHMNENCPSLPPAYHRPKKC  520



>ref|XP_010448183.1| PREDICTED: uncharacterized protein LOC104730687 [Camelina sativa]
Length=561

 Score =   277 bits (709),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 152/175 (87%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W+++QP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL 
Sbjct  387  PLDAHLVASVMTVWSKIQPDYAANMWNEALNKRLGTEGLDLPDVLVEVEKRGSSFDELLA  446

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD+W+YSDGKST+C+AFIL MYKE+G+F  ++ SIQVTEFTI+DAYMLK +ENN +R
Sbjct  447  VPEQDDWIYSDGKSTSCIAFILEMYKEAGLFDPISSSIQVTEFTIKDAYMLKFFENNASR  506

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
             P WCN  +D KLP+CQI+G+YRMELP YNT+EPY +MNE+CPSLPP Y RP +C
Sbjct  507  FPKWCNDNDDAKLPYCQILGKYRMELPDYNTMEPYPHMNEHCPSLPPKYHRPKNC  561



>ref|XP_006283454.1| hypothetical protein CARUB_v10004499mg, partial [Capsella rubella]
 gb|EOA16352.1| hypothetical protein CARUB_v10004499mg, partial [Capsella rubella]
Length=557

 Score =   277 bits (708),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 151/175 (86%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W+++QP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FDQLL 
Sbjct  383  PLDAHLVASVMTVWSKIQPDYAANMWNEALNKRLGTEGLDLPDVLVEVEKRGSSFDQLLA  442

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD+W+YSDGKST+C+AFIL MYKE+G+F  ++ SIQVTEFTI+DAYMLK +ENN +R
Sbjct  443  VPEQDDWIYSDGKSTSCIAFILEMYKEAGLFDPISSSIQVTEFTIKDAYMLKFFENNASR  502

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
             P WCN  +D  LP+CQI+G+YRMELP YNT+EPY +MNE+CPSLPP Y RP +C
Sbjct  503  FPKWCNDNDDVNLPYCQILGKYRMELPSYNTMEPYPHMNEHCPSLPPKYHRPKNC  557



>gb|KCW67126.1| hypothetical protein EUGRSUZ_F00907 [Eucalyptus grandis]
Length=216

 Score =   265 bits (678),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 145/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V SVM++W +MQP YAANMWNEALNKRLGTEGLDL ++L ETE RG +F +LLT
Sbjct  42   PLDAHVVASVMTVWNQMQPAYAANMWNEALNKRLGTEGLDLPDLLVETEMRGSSFAELLT  101

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVYSDGKS +CVAF+L MYK +G+F  ++ S+QVTEFTI+DAY LK +ENN +R
Sbjct  102  IPEQDDWVYSDGKSASCVAFVLEMYKAAGLFDPISSSVQVTEFTIKDAYSLKFFENNSSR  161

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+D +LPFCQI G YRMELP YNT++ Y +MNE CPSLPP Y RP  C
Sbjct  162  LPKWCNDGDDVELPFCQIRGRYRMELPRYNTMDLYPHMNERCPSLPPKYSRPSDC  216



>ref|XP_008371266.1| PREDICTED: uncharacterized protein LOC103434697 [Malus domestica]
Length=522

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W R+QP YAANMWNEALNKRLGT+ L   +IL E E+ G +FDQLLT
Sbjct  348  PLDAHLVASVMTVWNRIQPAYAANMWNEALNKRLGTQNLSFXDILVEVEKSGSSFDQLLT  407

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVYSDGKST+CVAFIL MYKE+G+F  +A SIQVTEFTI+DAYML I+ENN +R
Sbjct  408  IPEQDDWVYSDGKSTSCVAFILEMYKEAGLFDPIAGSIQVTEFTIKDAYMLNIFENNSSR  467

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+  KLPFCQI G+YRMELP YNT+EPY +MNE CPSLPP Y RP +C
Sbjct  468  LPKWCNDGDTVKLPFCQIKGKYRMELPLYNTMEPYPHMNERCPSLPPKYSRPRNC  522



>gb|KHG29749.1| Transcription activator gutR [Gossypium arboreum]
Length=531

 Score =   275 bits (702),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 154/175 (88%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W+++QP YAANMWNEALNKRLGT+GL+L +IL ETE+RG +FD+LLT
Sbjct  357  PLDAHLVASVMTVWSKIQPEYAANMWNEALNKRLGTQGLNLSDILVETEKRGSSFDELLT  416

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD W+YSDGKST+C+AF+L +YKE+G+F  +A+SIQVTEFTI+DAY LK +E++ +R
Sbjct  417  IPEQDNWIYSDGKSTSCIAFVLELYKEAGLFDPIADSIQVTEFTIKDAYSLKFFESDSSR  476

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN  +D KLP+CQI G+YRMELPGYN++EPYA+MNE CPS+PP Y RP +C
Sbjct  477  LPKWCNDADDVKLPYCQIKGKYRMELPGYNSMEPYAHMNERCPSMPPKYFRPQNC  531



>gb|KHN38290.1| hypothetical protein glysoja_003955 [Glycine soja]
Length=439

 Score =   271 bits (694),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 151/175 (86%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA++V  VM++W+++QP YAANMWNEALNKRLGT+GLDL E+L E E+RG +FD+LLT
Sbjct  265  PLDANVVACVMTIWSQLQPEYAANMWNEALNKRLGTKGLDLSEVLVEVEKRGSSFDELLT  324

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W+YSDGKST+C+AFIL MYKE+G+F  +A S+QVTEFTI+DAY+L  +ENN TR
Sbjct  325  IPEQDDWIYSDGKSTSCIAFILEMYKEAGLFDPVASSVQVTEFTIKDAYILNFFENNSTR  384

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+  KLP+CQI G+YRM+LPGYNT++PY +MNE CPSLPP Y RP +C
Sbjct  385  LPKWCNDGDTVKLPYCQIKGKYRMDLPGYNTMQPYPHMNERCPSLPPKYSRPQNC  439



>ref|XP_004252023.1| PREDICTED: uncharacterized protein LOC101252754 [Solanum lycopersicum]
Length=523

 Score =   274 bits (700),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 148/175 (85%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W  +QP YAANMWNEALNKRLGT GLDL +IL E E+RG +F +LLT
Sbjct  349  PLDAHLVASVMTVWNHLQPAYAANMWNEALNKRLGTRGLDLPDILVEIEKRGSSFAKLLT  408

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVYSDGKST+C+AF+L MYKE+G+FG LA SIQVTEFTI+DAY LK +ENN  R
Sbjct  409  IPEQDDWVYSDGKSTSCIAFVLEMYKEAGLFGPLASSIQVTEFTIKDAYSLKFFENNTNR  468

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN+ +  KLPFCQI+G+YRMELPGYNT++ YA+MNE CPS+PP Y RP  C
Sbjct  469  LPMWCNADDTVKLPFCQILGKYRMELPGYNTMDVYAHMNEKCPSMPPKYYRPQSC  523



>ref|XP_006367536.1| PREDICTED: uncharacterized protein LOC102597542 [Solanum tuberosum]
Length=537

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 149/175 (85%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W  +QP YAANMWNEALNKRLGT+GLDL +IL E E+RG +F +LLT
Sbjct  363  PLDAHLVASVMTVWNHLQPAYAANMWNEALNKRLGTQGLDLPDILVEVEKRGSSFAKLLT  422

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVYSDGKST+C+AF+L MYKE+G+FG LA SIQVTEFTI+DAY LK +EN+  R
Sbjct  423  IPEQDDWVYSDGKSTSCIAFVLEMYKEAGLFGPLASSIQVTEFTIKDAYSLKFFENDTNR  482

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN+ +  KLPFCQI+G+YRMELPGYNT++ YA+MNE CPS+PP Y RP  C
Sbjct  483  LPKWCNADDTVKLPFCQILGKYRMELPGYNTMDIYAHMNEKCPSMPPIYYRPQSC  537



>ref|XP_006452283.1| hypothetical protein CICLE_v10008210mg [Citrus clementina]
 gb|ESR65523.1| hypothetical protein CICLE_v10008210mg [Citrus clementina]
Length=463

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 145/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV S M+MW  +QP YAANMWNEALNKRLGTEGLDL +IL ETERRG  FD+LLT
Sbjct  289  PLDAHLVASGMTMWNHIQPAYAANMWNEALNKRLGTEGLDLPDILVETERRGTPFDELLT  348

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W+YSDGKST+CVAF+L MYKE+G+F  +  SIQVTEFTI+DAY L+ +ENN +R
Sbjct  349  IPEQDDWIYSDGKSTSCVAFVLEMYKEAGLFDPIGSSIQVTEFTIKDAYSLRFFENNSSR  408

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN  +  KLP+CQI G+YRMELPGYN L+PY +MNE CPS+PP Y R  +C
Sbjct  409  LPKWCNDADTVKLPYCQIRGKYRMELPGYNVLDPYPHMNERCPSMPPKYSRTANC  463



>ref|XP_002522970.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39400.1| conserved hypothetical protein [Ricinus communis]
Length=524

 Score =   272 bits (696),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 152/175 (87%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W+++QP YAANMWNEALNKRLGT+GL L +IL E E+RG +F +LL+
Sbjct  350  PLDAHLVASVMTVWSQIQPAYAANMWNEALNKRLGTQGLGLPDILVEVEKRGSSFGELLS  409

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD+W+Y+DGKST+C+AF+LAMYKE+G+F  +A SIQVTEFTI+DAY L+ +EN+ +R
Sbjct  410  VPEQDDWLYTDGKSTSCIAFVLAMYKEAGLFDPIASSIQVTEFTIKDAYALRFFENDSSR  469

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+D KLPFCQI G+YRMELPGYNT++PY +MNE CPSLPP Y RP +C
Sbjct  470  LPKWCNDGDDVKLPFCQIKGKYRMELPGYNTMDPYPHMNEMCPSLPPKYSRPRNC  524



>gb|KJB62763.1| hypothetical protein B456_009G435000 [Gossypium raimondii]
Length=524

 Score =   272 bits (695),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 153/175 (87%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W+++QP YAANMWNEALNKRLGT+GL+L +IL ETE+RG +FD+LLT
Sbjct  350  PLDAHLVASVMTVWSKIQPEYAANMWNEALNKRLGTQGLNLSDILVETEKRGSSFDELLT  409

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD W+YSDGKST+C+AF+L +YKE+G+F  +A+SIQVTEFTI+DAY LK +EN+ +R
Sbjct  410  IPEQDNWIYSDGKSTSCIAFVLELYKEAGLFDPIADSIQVTEFTIKDAYSLKFFENDSSR  469

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN  ++ KLP+CQI G+YRMELPGYN+++PY +MNE CPS+PP Y RP +C
Sbjct  470  LPKWCNDADNVKLPYCQIKGKYRMELPGYNSMDPYVHMNERCPSMPPKYFRPQNC  524



>ref|NP_194432.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB36548.1| putative protein [Arabidopsis thaliana]
 emb|CAB79557.1| putative protein [Arabidopsis thaliana]
 gb|AAL75889.1| AT4g27020/F10M23_360 [Arabidopsis thaliana]
 gb|AAN28849.1| At4g27020/F10M23_360 [Arabidopsis thaliana]
 gb|AEE85285.1| uncharacterized protein AT4G27020 [Arabidopsis thaliana]
Length=523

 Score =   272 bits (695),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 152/176 (86%), Gaps = 3/176 (2%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA LV SVM++W+++QP YAANMWNEALNKRLGTEGLDL ++L E E+RG +FD+LL 
Sbjct  349  PLDAQLVASVMTVWSKIQPDYAANMWNEALNKRLGTEGLDLPDVLVEVEKRGSSFDELLA  408

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD+W+YSDGKST+C+AFIL MYKE+G+F  ++ SIQVTEFTI+DAYMLK +E+N +R
Sbjct  409  VPEQDDWIYSDGKSTSCIAFILEMYKEAGLFDPISSSIQVTEFTIKDAYMLKFFESNASR  468

Query  381  LPSWCNSGND--KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
             P WCN  ND  KLP+CQI+G+YRMELPGYNT+EPY +MNE+CPSLPP Y RP +C
Sbjct  469  FPKWCND-NDVVKLPYCQILGKYRMELPGYNTMEPYPHMNEHCPSLPPKYHRPKNC  523



>ref|XP_003519567.1| PREDICTED: uncharacterized protein LOC100789468 isoform X1 [Glycine 
max]
Length=519

 Score =   271 bits (694),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 151/175 (86%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA++V  VM++W+++QP YAANMWNEALNKRLGT+GLDL E+L E E+RG +FD+LLT
Sbjct  345  PLDANVVACVMTIWSQLQPEYAANMWNEALNKRLGTKGLDLSEVLVEVEKRGSSFDELLT  404

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W+YSDGKST+C+AFIL MYKE+G+F  +A S+QVTEFTI+DAY+L  +ENN TR
Sbjct  405  IPEQDDWIYSDGKSTSCIAFILEMYKEAGLFDPVASSVQVTEFTIKDAYILNFFENNSTR  464

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+  KLP+CQI G+YRM+LPGYNT++PY +MNE CPSLPP Y RP +C
Sbjct  465  LPKWCNDGDTVKLPYCQIKGKYRMDLPGYNTMQPYPHMNERCPSLPPKYSRPQNC  519



>ref|XP_011097895.1| PREDICTED: uncharacterized protein LOC105176701 [Sesamum indicum]
Length=533

 Score =   272 bits (695),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 148/175 (85%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++WT+MQP YA NMWNEALNKRLG++ L L E+L E E+RG +F +LL 
Sbjct  359  PLDAHLVASVMTVWTQMQPAYAGNMWNEALNKRLGSQNLSLSEVLVEVEKRGSSFGELLA  418

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVY+DGKST+CVAF+  +YKE+G+FG LA SIQVTEFTI+DAY LK +ENN +R
Sbjct  419  IPEQDDWVYADGKSTSCVAFVFELYKEAGLFGKLASSIQVTEFTIKDAYSLKFFENNSSR  478

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP+WCN  +  KLPFCQI G+YRMELPGYNT++PY++MNE CPSLPP Y RP+ C
Sbjct  479  LPTWCNDVDTVKLPFCQIRGKYRMELPGYNTMDPYSHMNERCPSLPPKYYRPLGC  533



>gb|KDP39105.1| hypothetical protein JCGZ_00862 [Jatropha curcas]
Length=524

 Score =   271 bits (693),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 151/175 (86%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W+++QP YAANMWNEALNKRLGTEGL L +IL ETE+RG +F +LLT
Sbjct  350  PLDAHLVASVMTVWSQIQPAYAANMWNEALNKRLGTEGLALPDILVETEKRGSSFGELLT  409

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W+Y+DGKST+C+AF+L MYKE+G+F  +A S+QVTEFTI+DAY L+ +ENN +R
Sbjct  410  IPEQDDWMYTDGKSTSCIAFVLEMYKEAGLFDPIASSVQVTEFTIKDAYTLRFFENNSSR  469

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+D KLPFCQI G+YRMELP YNT++PY +MNE CPSLPP Y RP +C
Sbjct  470  LPKWCNDGDDVKLPFCQIRGKYRMELPDYNTIDPYPHMNEMCPSLPPKYFRPQNC  524



>ref|XP_007142263.1| hypothetical protein PHAVU_008G266000g [Phaseolus vulgaris]
 gb|ESW14257.1| hypothetical protein PHAVU_008G266000g [Phaseolus vulgaris]
Length=544

 Score =   271 bits (694),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 152/175 (87%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA++V  VM++W ++QP YAANMWNEALNKRLGT+GLDL E+L E E+RG +FD+LLT
Sbjct  370  PLDANVVACVMTIWNQIQPEYAANMWNEALNKRLGTKGLDLPEVLVEVEKRGSSFDELLT  429

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVY+DGKST+C+AFIL MYKE+G+FG +A S+QVTEFTI+DAY+L  +ENN +R
Sbjct  430  IPEQDDWVYTDGKSTSCIAFILEMYKEAGLFGPIASSVQVTEFTIKDAYILNFFENNSSR  489

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+  KLP+CQI G+YR+ELPGYN++EPY++MNE CPSLPP Y RP +C
Sbjct  490  LPKWCNDGDTVKLPYCQIKGKYRVELPGYNSMEPYSHMNERCPSLPPKYSRPKNC  544



>gb|ACF87807.1| unknown [Zea mays]
Length=363

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V SVM++W+++QP YAANMW EALNKRLGT+GLDL EI+ E+E+RG+TFD+LL+
Sbjct  189  PLDAHVVASVMTVWSKLQPEYAANMWKEALNKRLGTKGLDLSEIIVESEKRGITFDKLLS  248

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PE D WVY DG+S +CVAF+L MYKE+G+F  +  SI+VTEFTI+DAY+L  +E+N TR
Sbjct  249  VPENDSWVYEDGQSASCVAFVLMMYKEAGLFDPITSSIEVTEFTIKDAYILNFFEDNSTR  308

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN  +D KLPFCQI G+YRMELPGYNT++PYA+MNE CPSLPP Y R   C
Sbjct  309  LPEWCNKDDDVKLPFCQIKGKYRMELPGYNTMKPYAHMNERCPSLPPDYNRTKGC  363



>ref|XP_006475148.1| PREDICTED: uncharacterized protein LOC102609098 [Citrus sinensis]
 gb|KDO62608.1| hypothetical protein CISIN_1g009605mg [Citrus sinensis]
Length=531

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 145/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV S M+MW  +QP YAANMWNEALNKRLGTEGLDL +IL ETERRG  FD+LLT
Sbjct  357  PLDAHLVASGMTMWNHIQPAYAANMWNEALNKRLGTEGLDLPDILVETERRGTPFDELLT  416

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W+YSDGKST+CVAF+L MYKE+G+F  +  SIQVTEFTI+DAY L+ +ENN +R
Sbjct  417  IPEQDDWIYSDGKSTSCVAFVLEMYKEAGLFDPIGSSIQVTEFTIKDAYSLRFFENNSSR  476

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN  +  KLP+CQI G+YRMELPGYN L+PY +MNE CPS+PP Y R  +C
Sbjct  477  LPKWCNDADTVKLPYCQIRGKYRMELPGYNVLDPYPHMNERCPSMPPKYSRTANC  531



>ref|XP_009334822.1| PREDICTED: uncharacterized protein LOC103927611 [Pyrus x bretschneideri]
 ref|XP_009334847.1| PREDICTED: uncharacterized protein LOC103927629 [Pyrus x bretschneideri]
Length=522

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W ++QP YAANMWNEALNKRLGT+ L   +IL E E+ G +FD+LLT
Sbjct  348  PLDAHLVASVMTVWNQIQPAYAANMWNEALNKRLGTQNLSFPDILVEVEKSGSSFDRLLT  407

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVYSDGKST+CVAFIL MYKE+G+F  +A SIQVTEFTI+DAYML  +ENN +R
Sbjct  408  IPEQDDWVYSDGKSTSCVAFILEMYKEAGLFDPIASSIQVTEFTIKDAYMLNFFENNSSR  467

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+  KLPFCQI G+YRMELP YNT+EPY +MNE CPSLPP Y RP +C
Sbjct  468  LPKWCNDGDTVKLPFCQIKGKYRMELPLYNTMEPYPHMNERCPSLPPKYSRPRNC  522



>ref|XP_010064377.1| PREDICTED: uncharacterized protein LOC104451417 [Eucalyptus grandis]
Length=359

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 145/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V SVM++W +MQP YAANMWNEALNKRLGTEGLDL ++L ETE RG +F +LLT
Sbjct  185  PLDAHVVASVMTVWNQMQPAYAANMWNEALNKRLGTEGLDLPDLLVETEMRGSSFAELLT  244

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVYSDGKS +CVAF+L MYK +G+F  ++ S+QVTEFTI+DAY LK +ENN +R
Sbjct  245  IPEQDDWVYSDGKSASCVAFVLEMYKAAGLFDPISSSVQVTEFTIKDAYSLKFFENNSSR  304

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+D +LPFCQI G YRMELP YNT++ Y +MNE CPSLPP Y RP  C
Sbjct  305  LPKWCNDGDDVELPFCQIRGRYRMELPRYNTMDLYPHMNERCPSLPPKYSRPSDC  359



>ref|XP_001775460.1| predicted protein [Physcomitrella patens]
 gb|EDQ59789.1| predicted protein [Physcomitrella patens]
Length=525

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+D++LV S ++MWTR+QP +AANMWNEALNKRLGTEGLDL  ++ E+E+RG++F++LL 
Sbjct  352  PLDSNLVASAITMWTRLQPDFAANMWNEALNKRLGTEGLDLPGVMVESEKRGISFEELLA  411

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD W YSDG STTCVAFIL MYKE+G+FGS  +SIQVTEFTIRDAYMLK++E++ +R
Sbjct  412  IPEQDTWEYSDGFSTTCVAFILQMYKEAGLFGSFGDSIQVTEFTIRDAYMLKLFEDDVSR  471

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN+   K  FCQI+GEY ME+P YNT+EPYA+MNE CPSLPP+Y RP +C
Sbjct  472  LPSWCNATEGKGSFCQILGEYEMEIPDYNTIEPYAHMNERCPSLPPTYDRPKNC  525



>ref|XP_010545218.1| PREDICTED: uncharacterized protein LOC104817662 [Tarenaya hassleriana]
Length=524

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 149/175 (85%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V SVM++W+++QP YAANMWNEALN RLGT+ LDL +I+ E E+RG +FD+LLT
Sbjct  350  PLDAHVVASVMTVWSKIQPDYAANMWNEALNMRLGTKDLDLPDIMVEVEKRGSSFDELLT  409

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVYSDGKST+C+AF+L MYKE+G+F  +A S+QVTEFTI+DAYMLK +E N +R
Sbjct  410  IPEQDDWVYSDGKSTSCIAFVLEMYKEAGLFDPIASSVQVTEFTIKDAYMLKFFETNASR  469

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP+WCN  +D KLP+CQI+G+YRMELP YNT+EPY  MNE CPSLPP Y RP  C
Sbjct  470  LPNWCNDKDDVKLPYCQILGKYRMELPDYNTMEPYPRMNEQCPSLPPEYHRPDSC  524



>ref|NP_001044498.2| Os01g0793500 [Oryza sativa Japonica Group]
 dbj|BAD53001.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG94904.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55516.1| hypothetical protein OsJ_03735 [Oryza sativa Japonica Group]
 dbj|BAF06412.2| Os01g0793500 [Oryza sativa Japonica Group]
Length=539

 Score =   270 bits (689),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 149/175 (85%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V SVM+MW ++QP YAANMW EALNKRLGT+GLDL EI+ E+E+RG+TFD+LLT
Sbjct  365  PLDAHVVASVMTMWNKLQPEYAANMWKEALNKRLGTKGLDLPEIIVESEKRGMTFDKLLT  424

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD+WVY+DG+S +CVA++L MYKE+G+F  +A SI+VTEFTI+DAY L  +ENN TR
Sbjct  425  VPEQDKWVYTDGQSASCVAYVLMMYKEAGLFDPIASSIEVTEFTIKDAYSLNFFENNMTR  484

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN  +  KLPFCQI G YRMELPGYNT++PY +MNE CPSLPP+Y RP +C
Sbjct  485  LPVWCNKDDSVKLPFCQIKGRYRMELPGYNTMQPYPHMNERCPSLPPNYNRPRNC  539



>dbj|BAB89049.1| unknown protein [Oryza sativa Japonica Group]
Length=545

 Score =   270 bits (689),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 149/175 (85%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V SVM+MW ++QP YAANMW EALNKRLGT+GLDL EI+ E+E+RG+TFD+LLT
Sbjct  371  PLDAHVVASVMTMWNKLQPEYAANMWKEALNKRLGTKGLDLPEIIVESEKRGMTFDKLLT  430

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD+WVY+DG+S +CVA++L MYKE+G+F  +A SI+VTEFTI+DAY L  +ENN TR
Sbjct  431  VPEQDKWVYTDGQSASCVAYVLMMYKEAGLFDPIASSIEVTEFTIKDAYSLNFFENNMTR  490

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN  +  KLPFCQI G YRMELPGYNT++PY +MNE CPSLPP+Y RP +C
Sbjct  491  LPVWCNKDDSVKLPFCQIKGRYRMELPGYNTMQPYPHMNERCPSLPPNYNRPRNC  545



>gb|EYU19247.1| hypothetical protein MIMGU_mgv1a004499mg [Erythranthe guttata]
Length=524

 Score =   269 bits (687),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 145/176 (82%), Gaps = 2/176 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++WT+M+P YA N+WNEALNKRLGT+   L EIL E E+RG +F +LL 
Sbjct  349  PLDAHLVASVMTVWTQMKPAYAGNIWNEALNKRLGTQNFSLSEILVEVEKRGSSFGELLA  408

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W+Y DGKST+CVAFI  MYKE+G+FG LA SIQVTEFTI+DAY LK++ENN TR
Sbjct  409  IPEQDDWIYVDGKSTSCVAFIFEMYKEAGLFGELATSIQVTEFTIKDAYSLKLFENNSTR  468

Query  381  LPSWCNSGND--KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN+  D  KLPFCQI G+YRMELPGYNT++PY +MNE CPS+ P Y RP+ C
Sbjct  469  LPEWCNNDADTVKLPFCQIKGKYRMELPGYNTMDPYPHMNERCPSMTPEYSRPVGC  524



>emb|CDY20800.1| BnaA02g09400D [Brassica napus]
Length=610

 Score =   271 bits (692),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 146/167 (87%), Gaps = 1/167 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+D+HLV S M++W++MQP YAANMWNEALNKRLGT+GLDL ++L E E+RG +FD+LL 
Sbjct  355  PLDSHLVASFMTVWSKMQPDYAANMWNEALNKRLGTKGLDLSDVLVEVEKRGSSFDKLLA  414

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVYSDGKST+C+AFIL MYKE G+FGSLA+S+QVTEFTI+DAYML  +E N +R
Sbjct  415  IPEQDDWVYSDGKSTSCIAFILEMYKEGGLFGSLADSVQVTEFTIKDAYMLNFFETNASR  474

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPP  244
            LP WCN  +  KLP+CQI+G+YRM+LPGYNT+EPY +MNE CPSLPP
Sbjct  475  LPKWCNDNDSVKLPYCQILGKYRMQLPGYNTMEPYTHMNEQCPSLPP  521



>gb|KJB13649.1| hypothetical protein B456_002G087800 [Gossypium raimondii]
Length=530

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 151/175 (86%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV S M++W++MQP YAAN+WNEALNKRLGT+GLDL +IL E E+ G +FDQLLT
Sbjct  356  PLDAHLVASAMTVWSKMQPEYAANLWNEALNKRLGTKGLDLSDILVEIEKLGSSFDQLLT  415

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD+W+YSDGKST+C+AF+L MYKE+G+F  +A+SIQVTEFTI+DAY L+ +ENN ++
Sbjct  416  VPEQDDWIYSDGKSTSCIAFVLEMYKEAGLFDPIADSIQVTEFTIKDAYTLRFFENNSSQ  475

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN  ++ KLP+CQI+G+YRMELPG+N+++PY +MNE CPS PP Y RP +C
Sbjct  476  LPKWCNDADNVKLPYCQILGKYRMELPGFNSMDPYPHMNERCPSKPPKYSRPPNC  530



>ref|XP_011095372.1| PREDICTED: uncharacterized protein LOC105174849 [Sesamum indicum]
Length=533

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 144/175 (82%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++WT++ P YA NMWNEALNKRLGT+ L L EI+ E E+RG +F +LL 
Sbjct  359  PLDAHLVASVMTVWTQLAPAYAGNMWNEALNKRLGTQNLSLSEIIVEVEKRGSSFGELLA  418

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD WVY+DGKST+CVAF+  MY+E+G+FG LA SIQVTEFTI+DAY LK +ENN +R
Sbjct  419  IPEQDNWVYADGKSTSCVAFVFEMYEEAGLFGELASSIQVTEFTIKDAYSLKFFENNSSR  478

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+  KLPFCQI G+YRMELPGYNT++PY +MNE CPSLPP Y RP  C
Sbjct  479  LPKWCNDGDTVKLPFCQIRGKYRMELPGYNTMDPYPHMNERCPSLPPKYLRPAGC  533



>ref|XP_008349941.1| PREDICTED: uncharacterized protein LOC103413239 [Malus domestica]
Length=522

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V SVM++W ++QP YAANMWNEALNKRLGT+ L   +IL E E+RG +FDQLLT
Sbjct  348  PLDAHVVASVMTVWNQIQPAYAANMWNEALNKRLGTQNLTFPDILVEVEKRGSSFDQLLT  407

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W YSDGKST+CVAFIL MYKE+G+FG +A SIQVTEFTI+DAYMLK +ENN +R
Sbjct  408  IPEQDDWEYSDGKSTSCVAFILEMYKEAGLFGPIASSIQVTEFTIKDAYMLKFFENNSSR  467

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+  KLPFCQI G+YRMELP YNT+E Y +MNE CPSLPP Y R  +C
Sbjct  468  LPKWCNDGDTVKLPFCQIKGKYRMELPLYNTMETYPHMNERCPSLPPKYSRLQNC  522



>gb|KHG01773.1| Tryptophan synthase alpha chain [Gossypium arboreum]
Length=531

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 150/175 (86%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV S M++W++MQP YAAN+WNEALNKRLGT+GLDL +IL E E+ G +FDQLLT
Sbjct  357  PLDAHLVASAMTVWSKMQPEYAANLWNEALNKRLGTKGLDLSDILVEIEKHGSSFDQLLT  416

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W+YSDGKST+C+AF+L MYKE+G+F  +A+ IQVTEFTI+DAY L+ +ENN +R
Sbjct  417  IPEQDDWLYSDGKSTSCIAFVLEMYKEAGLFDPIADLIQVTEFTIKDAYTLRFFENNSSR  476

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN  ++ KLP+CQI+G+YRMELPG+N+++PY +MNE CPS PP Y RP +C
Sbjct  477  LPKWCNDADNVKLPYCQILGKYRMELPGFNSMDPYPHMNERCPSKPPKYSRPPNC  531



>ref|XP_009769049.1| PREDICTED: uncharacterized protein LOC104219979 [Nicotiana sylvestris]
Length=526

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 148/175 (85%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W ++QP YAANMWNEALNKRLGT+GL L +IL E E+RG +F +LLT
Sbjct  352  PLDAHLVASVMTVWNQLQPAYAANMWNEALNKRLGTQGLGLPDILVEVEKRGSSFAKLLT  411

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVY+DGKST+CVAFIL MYKE+G+FG LA SIQVTEFTI+DAY LK +EN+  R
Sbjct  412  IPEQDDWVYTDGKSTSCVAFILEMYKEAGLFGPLAGSIQVTEFTIKDAYSLKFFENDPNR  471

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN+ +  KLPFCQI G+YRMELPGYNT++ Y +MNE CPS+PP Y RP+ C
Sbjct  472  LPKWCNADDTVKLPFCQIRGKYRMELPGYNTMDIYPHMNEKCPSMPPKYYRPLSC  526



>ref|XP_007211818.1| hypothetical protein PRUPE_ppa004230mg [Prunus persica]
 gb|EMJ13017.1| hypothetical protein PRUPE_ppa004230mg [Prunus persica]
Length=522

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V SVM++W  +QPTYAANMWNEALNKRLGT+ L   +IL E E+RG +FD+LLT
Sbjct  348  PLDAHVVASVMTVWNHIQPTYAANMWNEALNKRLGTQNLSFPDILVEVEKRGSSFDELLT  407

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD+W+YSDGKST+CVAFIL MYKE+G+F  +A SIQVTEFTI+DAYMLK +ENN +R
Sbjct  408  VPEQDDWLYSDGKSTSCVAFILEMYKEAGLFDPIASSIQVTEFTIKDAYMLKFFENNSSR  467

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+  KLPFCQI G+YRMELP YN++EPY++MNE C SLPP Y R  +C
Sbjct  468  LPKWCNDGDSVKLPFCQIKGKYRMELPEYNSMEPYSHMNERCESLPPKYSRSRNC  522



>ref|XP_004970230.1| PREDICTED: uncharacterized protein LOC101777322 isoform X2 [Setaria 
italica]
Length=543

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V SVM++WT++QP YAAN+W EALNKRLGT+GLDL EI+ E+ERRG+TFD+LLT
Sbjct  369  PLDAHVVASVMTVWTKLQPEYAANLWKEALNKRLGTKGLDLPEIIVESERRGITFDKLLT  428

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PE+D WVY DG+S +C+AF+L MYKE+G+FG +  S++VTEFTI+DAY L  +E+N TR
Sbjct  429  VPEKDNWVYEDGQSASCIAFVLMMYKEAGLFGPITNSVEVTEFTIKDAYTLNFFEDNSTR  488

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+  KLPFCQI G YRMELPGYNT++PYA+MNE CPSLPP Y R   C
Sbjct  489  LPEWCNKGDSVKLPFCQIKGRYRMELPGYNTMKPYAHMNERCPSLPPDYKRTKGC  543



>ref|XP_004970229.1| PREDICTED: uncharacterized protein LOC101777322 isoform X1 [Setaria 
italica]
Length=554

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V SVM++WT++QP YAAN+W EALNKRLGT+GLDL EI+ E+ERRG+TFD+LLT
Sbjct  380  PLDAHVVASVMTVWTKLQPEYAANLWKEALNKRLGTKGLDLPEIIVESERRGITFDKLLT  439

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PE+D WVY DG+S +C+AF+L MYKE+G+FG +  S++VTEFTI+DAY L  +E+N TR
Sbjct  440  VPEKDNWVYEDGQSASCIAFVLMMYKEAGLFGPITNSVEVTEFTIKDAYTLNFFEDNSTR  499

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+  KLPFCQI G YRMELPGYNT++PYA+MNE CPSLPP Y R   C
Sbjct  500  LPEWCNKGDSVKLPFCQIKGRYRMELPGYNTMKPYAHMNERCPSLPPDYKRTKGC  554



>ref|XP_007020905.1| Inositol-1,4,5-trisphosphate 5-phosphatase 4 isoform 1 [Theobroma 
cacao]
 gb|EOY12430.1| Inositol-1,4,5-trisphosphate 5-phosphatase 4 isoform 1 [Theobroma 
cacao]
Length=567

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 149/175 (85%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W ++QP YAANMWNEALNKRLGTEGLDL +IL E E+RG +FD LLT
Sbjct  393  PLDAHLVASVMTVWNKIQPEYAANMWNEALNKRLGTEGLDLSDILVEVEKRGSSFDALLT  452

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD W+YSDGKS +C+AF+L MYK +G+F  +A+SI+VTEFTI+DAY L+ +ENN ++
Sbjct  453  IPEQDGWIYSDGKSASCIAFVLEMYKAAGLFDPIADSIEVTEFTIKDAYTLRFFENNSSQ  512

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN  +D KLP+CQI+G+YRMELPG+N+++PY +MNE CPS+PP Y RP +C
Sbjct  513  LPKWCNDADDVKLPYCQILGKYRMELPGFNSIDPYPHMNERCPSMPPKYSRPQNC  567



>ref|XP_004491367.1| PREDICTED: uncharacterized protein LOC101492149 [Cicer arietinum]
Length=525

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 149/175 (85%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA++V  VM++W+++QP YAANMWNEALNKRLGT+GLDL E+L E ERRG +FD+LLT
Sbjct  351  PLDANVVACVMTIWSQLQPEYAANMWNEALNKRLGTKGLDLSEVLVEVERRGSSFDELLT  410

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W+YSDGKST+CVAFILAMYK +G+F  +A SIQVTEFTI+DAY+L  +ENN +R
Sbjct  411  IPEQDDWLYSDGKSTSCVAFILAMYKAAGLFDPIASSIQVTEFTIKDAYILNFFENNASR  470

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP+WCN G+  KLP+CQI G+YRMELPGYNT++PY +MNE CPSLP  Y R   C
Sbjct  471  LPTWCNDGDTVKLPYCQIKGKYRMELPGYNTMQPYPHMNERCPSLPTKYSRTKSC  525



>ref|XP_001781611.1| predicted protein [Physcomitrella patens]
 gb|EDQ53567.1| predicted protein [Physcomitrella patens]
Length=506

 Score =   266 bits (681),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+D +LV S +++WTR+QP YA+NMWNEALNKRLGT+GLDL  ++ ETER+G+ F++LL 
Sbjct  333  PLDCNLVASAITVWTRLQPDYASNMWNEALNKRLGTKGLDLPGVMVETERQGIPFEELLA  392

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPE+D W YSDG ST+CVAF+L +YK++G+FGS+A+S+QVTEFT+RDAYMLK YE++++R
Sbjct  393  IPEKDNWKYSDGYSTSCVAFVLEIYKQAGLFGSVADSVQVTEFTVRDAYMLKFYEDDKSR  452

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP+WC + N    +CQI+GEY MELPGYNT+EPYANMNE CPSLPPSY RP  C
Sbjct  453  LPAWCGTSNTSRTYCQILGEYDMELPGYNTIEPYANMNERCPSLPPSYDRPAQC  506



>gb|KCW67034.1| hypothetical protein EUGRSUZ_F00801 [Eucalyptus grandis]
Length=390

 Score =   263 bits (672),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA++V SVM++W +MQP YAANMWNEALNKRLGTEGLDL ++L ETE RG +F +LLT
Sbjct  216  PLDAYVVASVMTVWNQMQPAYAANMWNEALNKRLGTEGLDLPDLLVETEMRGSSFAELLT  275

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVYSDGKS +CVAF+L MYK +G+F  ++ SIQVT+FTI+DAY LK +ENN +R
Sbjct  276  IPEQDDWVYSDGKSASCVAFVLEMYKAAGLFDPISSSIQVTKFTIKDAYSLKFFENNSSR  335

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+D +LPFCQI G Y+MELPGYNT++ Y +MNE CPSLPP Y RP  C
Sbjct  336  LPKWCNDGDDVELPFCQIQGRYQMELPGYNTMDLYPHMNERCPSLPPKYSRPSDC  390



>ref|XP_008385988.1| PREDICTED: uncharacterized protein LOC103448506 [Malus domestica]
Length=552

 Score =   268 bits (684),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V SVM++W ++QP YAANMWNEALNKRLGT+ L   +IL E E+RG +FDQLLT
Sbjct  378  PLDAHVVASVMTVWNQIQPAYAANMWNEALNKRLGTQNLTFPDILVEVEKRGSSFDQLLT  437

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W YSDGKST+CVAFIL MYKE+G+FG +A SIQVTEFTI+DAYMLK +ENN +R
Sbjct  438  IPEQDDWEYSDGKSTSCVAFILEMYKEAGLFGPIASSIQVTEFTIKDAYMLKFFENNSSR  497

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+  KLPFCQI G+YRMELP YNT+E Y +MNE CPSLPP Y R  +C
Sbjct  498  LPKWCNDGDTVKLPFCQIKGKYRMELPLYNTMETYPHMNERCPSLPPKYSRLQNC  552



>gb|KCW67171.1| hypothetical protein EUGRSUZ_F00962 [Eucalyptus grandis]
Length=408

 Score =   263 bits (672),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 145/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V SVM++W +MQP YAANMWNEALNKRLGTEGLDL ++L ETE RG +F +LLT
Sbjct  234  PLDAHVVASVMTVWNQMQPAYAANMWNEALNKRLGTEGLDLPDLLVETEMRGSSFAELLT  293

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVYSDGKS +CVAF+L MYK +G+F  ++ SIQVTEFTI+DAY LK +ENN +R
Sbjct  294  IPEQDDWVYSDGKSASCVAFVLEMYKAAGLFDPISSSIQVTEFTIKDAYSLKFFENNSSR  353

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G++ +LPFCQI G YRMELPGYNT++ Y +MNE CPSLPP Y R   C
Sbjct  354  LPKWCNDGDNVELPFCQIRGRYRMELPGYNTMDLYPHMNERCPSLPPKYSRLSDC  408



>ref|XP_008226932.1| PREDICTED: uncharacterized protein LOC103326477 [Prunus mume]
Length=522

 Score =   266 bits (680),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V SVM++W  +QPTYAANMWNEALNKRLGT+ L   +IL + E+RG +FD+LLT
Sbjct  348  PLDAHVVASVMTVWNHIQPTYAANMWNEALNKRLGTQNLSFPDILVDVEKRGSSFDELLT  407

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD+W+YSDGKST+CVAFIL MYKE+G+F  +A SIQVTEFTI+DAYMLK +ENN +R
Sbjct  408  VPEQDDWLYSDGKSTSCVAFILEMYKEAGLFDPIASSIQVTEFTIKDAYMLKFFENNSSR  467

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+  KLPFCQI G+YRMELP YN++EPY++MNE C SLPP Y R  +C
Sbjct  468  LPKWCNDGDTVKLPFCQIKGKYRMELPEYNSMEPYSHMNERCESLPPKYSRSRNC  522



>ref|XP_009378549.1| PREDICTED: uncharacterized protein LOC103967027 [Pyrus x bretschneideri]
Length=522

 Score =   266 bits (680),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 145/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V SVM++W ++QP YAANMWNEALN RLGT+ L   +IL E E+RG +FDQLLT
Sbjct  348  PLDAHVVASVMTVWNQIQPAYAANMWNEALNTRLGTKNLTFPDILVEVEKRGSSFDQLLT  407

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W YSDGKST+CVAFIL MYKE+G+FG +A SIQVTEFTI+DAYMLK +ENN +R
Sbjct  408  IPEQDDWEYSDGKSTSCVAFILEMYKEAGLFGPIASSIQVTEFTIKDAYMLKFFENNSSR  467

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+  KLPFCQI G+YRMELP YNT+E Y +MNE CPSLPP Y R  +C
Sbjct  468  LPKWCNDGDTVKLPFCQIKGKYRMELPLYNTMETYPHMNERCPSLPPKYSRSQNC  522



>ref|XP_009599364.1| PREDICTED: uncharacterized protein LOC104095030 [Nicotiana tomentosiformis]
Length=526

 Score =   266 bits (680),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 148/175 (85%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W ++QP YAANMWNEALNKRLGT+GLDL +IL E E+RG +F +LLT
Sbjct  352  PLDAHLVASVMTVWNQLQPAYAANMWNEALNKRLGTQGLDLPDILVEVEKRGSSFAKLLT  411

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVY+DGKST+CVAFIL MYKE+G+FG  A SIQVTEFTI+DAY LK +E++  +
Sbjct  412  IPEQDDWVYTDGKSTSCVAFILEMYKEAGLFGPFAGSIQVTEFTIKDAYSLKFFEDDPNQ  471

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN+ +  KLPFCQI G+YRMELPGYNT++ Y +MNE CPS+PP Y RP+ C
Sbjct  472  LPKWCNADDTVKLPFCQIRGKYRMELPGYNTMDIYPHMNEKCPSMPPKYYRPLSC  526



>emb|CDY06624.1| BnaC02g13480D [Brassica napus]
Length=610

 Score =   268 bits (686),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 146/167 (87%), Gaps = 1/167 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+D+HLV S M++W++MQP YAANMWNEALNKRLGT+GLDL ++L E E+RG +FD+LL 
Sbjct  355  PLDSHLVASFMTVWSKMQPDYAANMWNEALNKRLGTKGLDLSDVLVEVEKRGSSFDKLLA  414

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W+YSDGKST+C+AFIL MYKE G+FGSLA+SIQVTEFT++DAYML  +E N +R
Sbjct  415  IPEQDDWIYSDGKSTSCIAFILEMYKEGGLFGSLADSIQVTEFTLKDAYMLNFFETNASR  474

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPP  244
            LP WCN  +  KLP+CQI+G+YRM+LPGYNT+EPY +MNE CPSLPP
Sbjct  475  LPKWCNDNDSVKLPYCQILGKYRMQLPGYNTMEPYTHMNELCPSLPP  521



>ref|XP_003617489.1| hypothetical protein MTR_5g092140 [Medicago truncatula]
 gb|AET00448.1| plant/F10M23-360 protein [Medicago truncatula]
Length=525

 Score =   266 bits (679),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 149/175 (85%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA++V  VM++W+++QP YAANMWNEALNKRLGT+GLDL E+L E E+RG +F +LLT
Sbjct  351  PLDANVVACVMTIWSQLQPAYAANMWNEALNKRLGTKGLDLPEVLVEVEKRGSSFAELLT  410

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W YSDGKST+CVAFILAMYKE+G+F  +A SIQVTEFTI+DAY+L  +ENN +R
Sbjct  411  IPEQDDWTYSDGKSTSCVAFILAMYKEAGLFDPIASSIQVTEFTIKDAYLLNFFENNSSR  470

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP+WCN G+  KLP+CQI G+YRMELPGYNT++PY +MNE CPSLP  Y R  +C
Sbjct  471  LPTWCNDGDTVKLPYCQIKGKYRMELPGYNTMQPYPHMNERCPSLPTKYSRTKNC  525



>ref|XP_010675677.1| PREDICTED: uncharacterized protein LOC104891653 [Beta vulgaris 
subsp. vulgaris]
Length=523

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 144/175 (82%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W  MQP YAAN+W EALNKRLGTE L+L EIL E E+RG +FD+LLT
Sbjct  349  PLDAHLVASVMTIWYHMQPEYAANLWKEALNKRLGTEDLELPEILVEVEKRGSSFDELLT  408

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W+Y DGKS +CVA++L +YK +G+FGSL  SIQ  EFTI+DAY LK +EN+ +R
Sbjct  409  IPEQDDWIYEDGKSVSCVAYVLQIYKAAGLFGSLFSSIQANEFTIKDAYSLKFFENDPSR  468

Query  381  LPSWCNSG-NDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN G N KLPFCQI G YRMELPGYNT++PYA+MNE CPSLPP Y RP  C
Sbjct  469  LPSWCNDGDNVKLPFCQIRGRYRMELPGYNTIDPYAHMNERCPSLPPKYYRPKTC  523



>ref|XP_008654687.1| PREDICTED: uncharacterized protein LOC100275589 isoform X1 [Zea 
mays]
 gb|ACR35704.1| unknown [Zea mays]
 gb|AFW84864.1| hypothetical protein ZEAMMB73_247218 [Zea mays]
Length=542

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V SVM++W+++QP YAANMW EALNKRLGT+GLDL EI+ E+E+RG+TFD+LL+
Sbjct  368  PLDAHVVASVMTVWSKLQPEYAANMWKEALNKRLGTKGLDLSEIIVESEKRGITFDKLLS  427

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PE D WVY DG+S +CVAF+L MYKE+G+F  +  SI+VTEFTI+DAY+L  +E+N TR
Sbjct  428  VPENDSWVYEDGQSASCVAFVLMMYKEAGLFDPITSSIEVTEFTIKDAYILNFFEDNSTR  487

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN  +D KLPFCQI G+YRMELPGYNT++PYA+MNE CPSLPP Y R   C
Sbjct  488  LPEWCNKDDDVKLPFCQIKGKYRMELPGYNTMKPYAHMNERCPSLPPDYNRTKGC  542



>ref|XP_002280959.1| PREDICTED: uncharacterized protein LOC100267545 isoform X1 [Vitis 
vinifera]
 emb|CBI26614.3| unnamed protein product [Vitis vinifera]
Length=531

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 148/175 (85%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V SVM++W +M+P YAAN+WNEALNKRLGT+ L L EIL ETE+RG +FD+LLT
Sbjct  357  PLDAHVVASVMTVWNQMKPAYAANLWNEALNKRLGTQDLALPEILVETEKRGSSFDELLT  416

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVY+DGKST+CVAFIL MYKE+G+FG  A SIQVTEFTI+DAY L  +ENN +R
Sbjct  417  IPEQDDWVYTDGKSTSCVAFILEMYKEAGLFGPSASSIQVTEFTIKDAYTLNFFENNSSR  476

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G++ +LP+CQI G+YRMELP YNTL+PY +MNE CPSLPP Y R  +C
Sbjct  477  LPKWCNDGDNVQLPYCQIKGKYRMELPEYNTLDPYPHMNERCPSLPPKYLRSANC  531



>gb|KHN11935.1| hypothetical protein glysoja_019908 [Glycine soja]
Length=486

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 148/175 (85%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA++V  VM++W+++QP YAANMWNEALNKRLGT+GLDL E+L E E+RG +FD+LLT
Sbjct  312  PLDANVVACVMTIWSQLQPEYAANMWNEALNKRLGTKGLDLPEVLVEVEKRGSSFDELLT  371

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD W YSDGKST+C+AFIL MYKE+G+F  ++ S+QVTEFTI+DAY+L  +ENN +R
Sbjct  372  IPEQDYWTYSDGKSTSCIAFILEMYKEAGLFDPISSSVQVTEFTIKDAYILNFFENNSSR  431

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+  KLP+CQI G+YRMELPGYNT++PY +MNE CPSLPP Y R  +C
Sbjct  432  LPKWCNDGDTVKLPYCQIKGKYRMELPGYNTMQPYPHMNEKCPSLPPKYSRAQNC  486



>ref|XP_009420606.1| PREDICTED: uncharacterized protein LOC104000320 [Musa acuminata 
subsp. malaccensis]
Length=537

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 145/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+D+H+V SVM+MW ++QP YAANMWNEALNKRLGT+GLDL EI+ E E+ G +FD LLT
Sbjct  363  PLDSHVVASVMTMWNKIQPAYAANMWNEALNKRLGTQGLDLPEIIVEAEKNGTSFDNLLT  422

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVY+DGKST+CVAFIL MYK +G+FGS A SIQVTEFTI+DAY L  +E+N +R
Sbjct  423  IPEQDDWVYTDGKSTSCVAFILEMYKAAGLFGSNASSIQVTEFTIKDAYTLNFFESNSSR  482

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN  ++ KLP+CQI G YRMELPGYNT++PY +MNENC SLPP Y R   C
Sbjct  483  LPKWCNKDDNVKLPYCQIKGRYRMELPGYNTMQPYPHMNENCASLPPYYSRTKDC  537



>ref|NP_001143111.1| uncharacterized protein LOC100275589 [Zea mays]
 gb|ACG29052.1| hypothetical protein [Zea mays]
Length=559

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V SVM++W+++QP YAANMW EALNKRLGT+GLDL EI+ E+E+RG+TFD+LL+
Sbjct  385  PLDAHVVASVMTVWSKLQPEYAANMWKEALNKRLGTKGLDLSEIIVESEKRGITFDKLLS  444

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PE D WVY DG+S +CVAF+L MYKE+G+F  +  SI+VTEFTI+DAY+L  +E+N TR
Sbjct  445  VPENDSWVYEDGQSASCVAFVLMMYKEAGLFDPITSSIEVTEFTIKDAYILNFFEDNSTR  504

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN  +D KLPFCQI G+YRMELPGYNT++PYA+MNE CPSLPP Y R   C
Sbjct  505  LPEWCNKDDDVKLPFCQIKGKYRMELPGYNTMKPYAHMNERCPSLPPDYNRTKGC  559



>ref|XP_003544978.1| PREDICTED: uncharacterized protein LOC100796964 [Glycine max]
Length=525

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 148/175 (85%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA++V  VM++W+++QP YAANMWNEALNKRLGT+GLDL E+L E E+RG +FD+LLT
Sbjct  351  PLDANVVACVMTIWSQLQPEYAANMWNEALNKRLGTKGLDLPEVLVEVEKRGSSFDELLT  410

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD W YSDGKST+C+AFIL MYKE+G+F  ++ S+QVTEFTI+DAY+L  +ENN +R
Sbjct  411  IPEQDYWTYSDGKSTSCIAFILEMYKEAGLFDPISSSVQVTEFTIKDAYILNFFENNSSR  470

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+  KLP+CQI G+YRMELPGYNT++PY +MNE CPSLPP Y R  +C
Sbjct  471  LPKWCNDGDTVKLPYCQIKGKYRMELPGYNTMQPYPHMNEKCPSLPPKYSRAQNC  525



>ref|XP_006644833.1| PREDICTED: uncharacterized protein LOC102706146 [Oryza brachyantha]
Length=540

 Score =   265 bits (677),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 149/175 (85%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V SVM+MW ++QP YAANMW EALNKRLGT+GLDL EI+ E+E+RG TFD+LLT
Sbjct  366  PLDAHVVASVMTMWNKLQPEYAANMWEEALNKRLGTKGLDLPEIIVESEKRGTTFDKLLT  425

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVY+DG+S +CVA++L MYK++G+F  ++ SI+VTEFTI+DAY L  +E+N TR
Sbjct  426  IPEQDKWVYTDGQSASCVAYVLMMYKDAGLFDPISNSIEVTEFTIKDAYSLNFFEDNMTR  485

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN  +  +LPFCQI G YRMELPGYNT++PYA+MNE CPSLPP+Y RP +C
Sbjct  486  LPVWCNKDDSVELPFCQIKGRYRMELPGYNTMQPYAHMNEKCPSLPPNYNRPENC  540



>gb|ACN29289.1| unknown [Zea mays]
 gb|AFW84862.1| hypothetical protein ZEAMMB73_247218 [Zea mays]
Length=559

 Score =   265 bits (678),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V SVM++W+++QP YAANMW EALNKRLGT+GLDL EI+ E+E+RG+TFD+LL+
Sbjct  385  PLDAHVVASVMTVWSKLQPEYAANMWKEALNKRLGTKGLDLSEIIVESEKRGITFDKLLS  444

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PE D WVY DG+S +CVAF+L MYKE+G+F  +  SI+VTEFTI+DAY+L  +E+N TR
Sbjct  445  VPENDSWVYEDGQSASCVAFVLMMYKEAGLFDPITSSIEVTEFTIKDAYILNFFEDNSTR  504

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN  +D KLPFCQI G+YRMELPGYNT++PYA+MNE CPSLPP Y R   C
Sbjct  505  LPEWCNKDDDVKLPFCQIKGKYRMELPGYNTMKPYAHMNERCPSLPPDYNRTKGC  559



>ref|XP_002316997.1| hypothetical protein POPTR_0011s14080g [Populus trichocarpa]
 gb|EEE97609.1| hypothetical protein POPTR_0011s14080g [Populus trichocarpa]
Length=526

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 148/175 (85%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+D+H+V SVM++W  MQP YAANMWNEALNKRLGT+GLDL ++L E E+RG +F +LLT
Sbjct  352  PLDSHVVASVMTVWNHMQPEYAANMWNEALNKRLGTQGLDLPDVLVEVEKRGSSFGELLT  411

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W+Y+DGKST+C+AF+L MYKE+G+F  ++ S+QVTEFTI+DAY L+ +ENN +R
Sbjct  412  IPEQDDWLYADGKSTSCIAFVLEMYKEAGLFDPISGSVQVTEFTIKDAYTLRFFENNSSR  471

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+D KLPFCQI G+YRMELP YNT++PY +MNE CPSLPP Y R  +C
Sbjct  472  LPKWCNDGDDVKLPFCQIKGKYRMELPEYNTMDPYPHMNERCPSLPPKYYRTQNC  526



>ref|XP_006346228.1| PREDICTED: uncharacterized protein LOC102585922 [Solanum tuberosum]
Length=527

 Score =   264 bits (675),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+LV SVM++W ++QP YAANMWNEALNKRLGT+ L L ++L E E+RG +F +LL 
Sbjct  353  PLDANLVASVMTVWNQLQPAYAANMWNEALNKRLGTKNLSLPDVLVEVEKRGFSFAKLLA  412

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVYSDGKST+CVAFIL MYKE+G+FG LA SIQVTEFTI+DAY LK +ENN +R
Sbjct  413  IPEQDDWVYSDGKSTSCVAFILEMYKEAGLFGELASSIQVTEFTIKDAYSLKFFENNSSR  472

Query  381  LPSWCNS-GNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN+  N KLPFCQI G+YRMELPGYN+++ Y +MNE CPS+PP Y RP  C
Sbjct  473  LPKWCNADDNVKLPFCQIRGKYRMELPGYNSMDLYPHMNERCPSMPPKYYRPQSC  527



>ref|XP_011040240.1| PREDICTED: uncharacterized protein LOC105136541 [Populus euphratica]
Length=526

 Score =   263 bits (673),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V S M++W  +QP YAANMWNEALNKRLGT+GLDL +IL E E+RG +F +LLT
Sbjct  352  PLDAHVVASFMTVWNHIQPEYAANMWNEALNKRLGTQGLDLPDILVEVEKRGSSFGKLLT  411

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W+Y+DGKST+C+AF+L MYKE+G+F  +  S+QVTEFTI+DAY L+ +ENN +R
Sbjct  412  IPEQDDWLYTDGKSTSCIAFVLEMYKEAGLFDPITSSVQVTEFTIKDAYTLRFFENNSSR  471

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+D KLPFCQI G+YRMELP YNT++PY +MNE CPSLPP Y R  +C
Sbjct  472  LPKWCNDGDDVKLPFCQIKGQYRMELPEYNTMDPYPHMNERCPSLPPKYFRTQNC  526



>ref|XP_006370687.1| hypothetical protein POPTR_0001s44890g [Populus trichocarpa]
 gb|ERP67256.1| hypothetical protein POPTR_0001s44890g [Populus trichocarpa]
Length=585

 Score =   265 bits (677),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV S M++W  +QP YAANMWNEALNKRLGT+GLDL +IL E E+RG +F +LLT
Sbjct  411  PLDAHLVASFMTVWNHIQPEYAANMWNEALNKRLGTQGLDLPDILVEVEKRGSSFGKLLT  470

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W+Y+DGKST+C+AF+L MYKE+G+F  +  S+QVTEFTI+DAY L+ +ENN +R
Sbjct  471  IPEQDDWLYTDGKSTSCIAFVLEMYKEAGLFDPITSSVQVTEFTIKDAYTLRFFENNSSR  530

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+D KLPFCQI G+YRMELP YNT++PY +MNE CPSLPP Y R  +C
Sbjct  531  LPKWCNDGDDVKLPFCQIKGQYRMELPEYNTMDPYPHMNERCPSLPPKYFRTQNC  585



>ref|XP_010060409.1| PREDICTED: uncharacterized protein LOC104448324 [Eucalyptus grandis]
Length=523

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 145/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V SVM++W +MQP YAANMWNEALNKRLGTEGLDL ++L ETE RG +F +LLT
Sbjct  349  PLDAHVVASVMTVWNQMQPAYAANMWNEALNKRLGTEGLDLPDLLVETEMRGSSFAELLT  408

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVYSDGKS +CVAF+L MYK +G+F  ++ SIQVTEFTI+DAY LK +ENN +R
Sbjct  409  IPEQDDWVYSDGKSASCVAFVLEMYKAAGLFDPISSSIQVTEFTIKDAYSLKFFENNSSR  468

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G++ +LPFCQI G YRMELPGYNT++ Y +MNE CPSLPP Y R   C
Sbjct  469  LPKWCNDGDNVELPFCQIRGRYRMELPGYNTMDLYPHMNERCPSLPPKYSRLSDC  523



>ref|XP_004295816.2| PREDICTED: uncharacterized protein LOC101297130 [Fragaria vesca 
subsp. vesca]
Length=536

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 145/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V SVM++W +++PTYAAN+WNEALNKRL T+ L   EIL E E+RG +FDQLLT
Sbjct  362  PLDAHVVASVMTVWDQIKPTYAANLWNEALNKRLETQNLSFPEILVEVEKRGSSFDQLLT  421

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD+W+YSDGKST+CVAFIL MYKE+G+F  +  SIQVTEFTI+DAYMLK +ENN +R
Sbjct  422  VPEQDDWLYSDGKSTSCVAFILEMYKEAGLFDPIPSSIQVTEFTIKDAYMLKFFENNSSR  481

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+  KLPFCQI G+YRMELP YN +EPY +MNE CPSLPP Y R  +C
Sbjct  482  LPKWCNDGDTVKLPFCQIKGKYRMELPEYNIMEPYPHMNERCPSLPPKYSRSQNC  536



>ref|XP_004244131.1| PREDICTED: uncharacterized protein LOC101251602 [Solanum lycopersicum]
Length=527

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA+LV SVM++W  +QP YAANMWNEALNKRLGT+ L L +IL E E+RG +F +LL 
Sbjct  353  PLDANLVASVMTVWNHLQPAYAANMWNEALNKRLGTKNLSLPDILVEVEKRGFSFAKLLA  412

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPE+D+WVYSDGKST+CVAFIL MYKE+G+FG  A SIQVTEFTI+DAY LK +ENN +R
Sbjct  413  IPEKDDWVYSDGKSTSCVAFILEMYKEAGLFGEFASSIQVTEFTIKDAYSLKFFENNSSR  472

Query  381  LPSWCNS-GNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN+  N  LPFCQI GEYRMELP YN+++PY +MNE CPS+PP Y RP  C
Sbjct  473  LPKWCNADDNVSLPFCQIRGEYRMELPEYNSIDPYPHMNERCPSMPPKYFRPQSC  527



>ref|XP_009774573.1| PREDICTED: uncharacterized protein LOC104224588 [Nicotiana sylvestris]
Length=525

 Score =   261 bits (668),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 145/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W ++QP YA+NMWNEALNKRLGT+ L L ++L E E+RG +F +LLT
Sbjct  351  PLDAHLVASVMTVWNQLQPAYASNMWNEALNKRLGTQNLSLPDVLVEVEKRGSSFAELLT  410

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVYSDGKST+CVAFIL MYKE+G+FG LA SIQVTEFTI+DAY LK +E N +R
Sbjct  411  IPEQDDWVYSDGKSTSCVAFILEMYKEAGLFGELASSIQVTEFTIKDAYSLKFFETNSSR  470

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN+ +  KLPFCQI G+YRMELPGYN+++ Y  MNE CPS+PP Y RP  C
Sbjct  471  LPKWCNADDSVKLPFCQIRGKYRMELPGYNSMDIYPYMNERCPSMPPKYYRPQGC  525



>ref|XP_009607397.1| PREDICTED: uncharacterized protein LOC104101619 [Nicotiana tomentosiformis]
 ref|XP_009607398.1| PREDICTED: uncharacterized protein LOC104101619 [Nicotiana tomentosiformis]
Length=525

 Score =   261 bits (668),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W ++QP YA+NMWNEALNKRLGT+ L L ++L E E+RG +F +LLT
Sbjct  351  PLDAHLVASVMTVWNQLQPAYASNMWNEALNKRLGTQNLSLPDVLVEVEKRGSSFAELLT  410

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPE+D+WVYSDGKST+CVAFIL MYKE+G+FG LA SIQVTEFTI+DAY LK +E N +R
Sbjct  411  IPEKDDWVYSDGKSTSCVAFILEMYKEAGLFGELASSIQVTEFTIKDAYSLKFFETNSSR  470

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN+ +  KLPFCQI G+YRMELPGYN+++ Y +MNE CPS+PP Y RP  C
Sbjct  471  LPKWCNADDSVKLPFCQIRGKYRMELPGYNSMDLYPHMNERCPSMPPKYYRPQGC  525



>ref|XP_003564372.1| PREDICTED: uncharacterized protein LOC100827139 isoform X1 [Brachypodium 
distachyon]
Length=542

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V SVM++W ++QP YAANMW EALNKRLGT+GLDL EI+ E+E+RG TFD+LLT
Sbjct  368  PLDAHVVASVMTVWNKLQPDYAANMWKEALNKRLGTKGLDLPEIIVESEKRGTTFDKLLT  427

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVY+DG+S +CVA++L MYKE+G+F  ++ S++VTEFTI+DAY+L  YE+N TR
Sbjct  428  IPEQDKWVYTDGQSASCVAYVLMMYKEAGLFEPISSSVEVTEFTIKDAYVLNFYEDNTTR  487

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN  +  KLPFCQI G YRMELPGYNT++PY +MNE CPSLPP Y R  +C
Sbjct  488  LPEWCNKDDSVKLPFCQIKGRYRMELPGYNTMKPYPHMNERCPSLPPDYLRTQNC  542



>ref|XP_003564373.1| PREDICTED: uncharacterized protein LOC100827139 isoform X2 [Brachypodium 
distachyon]
Length=535

 Score =   261 bits (668),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V SVM++W ++QP YAANMW EALNKRLGT+GLDL EI+ E+E+RG TFD+LLT
Sbjct  361  PLDAHVVASVMTVWNKLQPDYAANMWKEALNKRLGTKGLDLPEIIVESEKRGTTFDKLLT  420

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVY+DG+S +CVA++L MYKE+G+F  ++ S++VTEFTI+DAY+L  YE+N TR
Sbjct  421  IPEQDKWVYTDGQSASCVAYVLMMYKEAGLFEPISSSVEVTEFTIKDAYVLNFYEDNTTR  480

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN  +  KLPFCQI G YRMELPGYNT++PY +MNE CPSLPP Y R  +C
Sbjct  481  LPEWCNKDDSVKLPFCQIKGRYRMELPGYNTMKPYPHMNERCPSLPPDYLRTQNC  535



>ref|XP_008454551.1| PREDICTED: uncharacterized protein LOC103494941 [Cucumis melo]
Length=537

 Score =   261 bits (668),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++WTR++PT AAN+WNEALN RLGT+GLDL EIL E E++G +F +LL 
Sbjct  363  PLDAHLVASVMTIWTRVRPTLAANLWNEALNIRLGTKGLDLPEILVEVEKQGSSFGELLA  422

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W+Y+DGKS +CVAFIL MYKE+G+FG LA SIQVTEFTI+DAY L  YENN TR
Sbjct  423  IPEQDDWIYADGKSASCVAFILQMYKEAGLFGPLASSIQVTEFTIKDAYTLNFYENNSTR  482

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WC+  +D KLP+CQI+G+YRM+L GYN+++PY +MNE CPSLP  Y RP +C
Sbjct  483  LPKWCHGRDDVKLPYCQILGKYRMDLQGYNSIDPYKHMNERCPSLPTEYFRPKNC  537



>ref|XP_011030808.1| PREDICTED: uncharacterized protein LOC105130143 [Populus euphratica]
Length=526

 Score =   261 bits (667),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+D+H+V SVM++W  MQP YAANMWNEALNKRLGT+GLDL ++L E E+RG +F +LL 
Sbjct  352  PLDSHVVASVMTVWNHMQPEYAANMWNEALNKRLGTQGLDLPDVLVEVEKRGSSFGELLA  411

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W+Y+DGKS +C+AF+L MYKE+G+F  ++ S+QVTEFTI+DAY L+ +ENN +R
Sbjct  412  IPEQDDWLYADGKSASCIAFVLEMYKEAGLFDPISGSVQVTEFTIKDAYTLRFFENNSSR  471

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+D KLPFCQI G+YRMELP YNT++PY +MNE CPSLPP Y R  +C
Sbjct  472  LPKWCNDGDDVKLPFCQIKGKYRMELPEYNTMDPYPHMNERCPSLPPKYYRTQNC  526



>ref|XP_002965264.1| hypothetical protein SELMODRAFT_143057 [Selaginella moellendorffii]
 gb|EFJ34102.1| hypothetical protein SELMODRAFT_143057 [Selaginella moellendorffii]
Length=509

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 145/174 (83%), Gaps = 1/174 (1%)
 Frame = -1

Query  738  VDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTI  559
            +D++LV SV+++WTR+QP YAANMWNEALNKRL T+GLDL  ++ E E RG+ F++LL I
Sbjct  336  LDSNLVASVLTVWTRLQPEYAANMWNEALNKRLDTQGLDLPGVMREAEHRGIPFEELLAI  395

Query  558  PEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRL  379
            PE+D+W+YSDGKST+CVAF+L MYKE+G+FG LA SIQVTEFTIRDAYML  +E N +RL
Sbjct  396  PEKDDWIYSDGKSTSCVAFVLQMYKEAGLFGELASSIQVTEFTIRDAYMLSFFEKNSSRL  455

Query  378  PSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            P WCN+ +D  LPFCQI+G YRMELP YNTL PYA+M+E CPS+PP Y RP  C
Sbjct  456  PKWCNAHDDPPLPFCQILGTYRMELPDYNTLVPYASMDERCPSVPPDYYRPSGC  509



>ref|XP_002986592.1| hypothetical protein SELMODRAFT_124354 [Selaginella moellendorffii]
 gb|EFJ12449.1| hypothetical protein SELMODRAFT_124354 [Selaginella moellendorffii]
Length=509

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 145/174 (83%), Gaps = 1/174 (1%)
 Frame = -1

Query  738  VDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTI  559
            +D++LV SV+++WTR+QP YAANMWNEALNKRL T+GLDL  ++ E E RG+ F++LL I
Sbjct  336  LDSNLVASVLTVWTRLQPEYAANMWNEALNKRLDTQGLDLPGVMREAEHRGIPFEELLAI  395

Query  558  PEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRL  379
            PE+D+W+YSDGKST+CVAF+L MYKE+G+FG LA SIQVTEFTIRDAYML  +E N +RL
Sbjct  396  PEKDDWIYSDGKSTSCVAFVLQMYKEAGLFGELASSIQVTEFTIRDAYMLSFFEKNSSRL  455

Query  378  PSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            P WCN+ +D  LPFCQI+G YRMELP YNTL PYA+M+E CPS+PP Y RP  C
Sbjct  456  PKWCNAHDDPPLPFCQILGTYRMELPDYNTLVPYASMDERCPSVPPDYYRPSGC  509



>ref|XP_007211816.1| hypothetical protein PRUPE_ppa004222mg [Prunus persica]
 gb|EMJ13015.1| hypothetical protein PRUPE_ppa004222mg [Prunus persica]
Length=522

 Score =   259 bits (661),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            PVDAH+V SVM++W  +QP YAANMWNEALNKRLGT+ L L EIL E E+RG +FD+LLT
Sbjct  348  PVDAHMVASVMTVWNNIQPAYAANMWNEALNKRLGTQNLSLPEILVEVEKRGSSFDELLT  407

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD W+YSDGKST+ VAFIL MYK++G+F  +A SIQVTEFTI+DAYMLK +ENN  R
Sbjct  408  LPEQDYWLYSDGKSTSSVAFILEMYKQAGLFDPIASSIQVTEFTIKDAYMLKFFENNSCR  467

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+  KLPFCQI G+YRMELP YN++EPY++MNE C SLP  Y R  +C
Sbjct  468  LPKWCNDGDTVKLPFCQIKGKYRMELPEYNSMEPYSHMNERCESLPQKYSRSRNC  522



>ref|XP_008226933.1| PREDICTED: uncharacterized protein LOC103326478 [Prunus mume]
Length=522

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            PVDAH+V SVM++W  +QP YAANMWNEALNKRLGT+ L L +IL E E+RG +FD+LLT
Sbjct  348  PVDAHMVASVMTVWNNIQPAYAANMWNEALNKRLGTQNLSLPDILVEVEKRGSSFDELLT  407

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD W+YSDGKST+ VAFIL MYK++G+F  +A SIQVTEFTI+DAYMLK +ENN  R
Sbjct  408  LPEQDYWLYSDGKSTSSVAFILEMYKQAGLFDPIASSIQVTEFTIKDAYMLKFFENNSCR  467

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+  KLPFCQI G+YRMELP YN++EPY++MNE C SLP  Y R  +C
Sbjct  468  LPKWCNDGDTVKLPFCQIKGKYRMELPEYNSVEPYSHMNERCESLPQKYSRSRNC  522



>ref|XP_008812430.1| PREDICTED: uncharacterized protein LOC103723322 [Phoenix dactylifera]
Length=537

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+D+HLV S M+MW ++QP YAAN+WNEALNKRLGTEGLDL  I+ E E+ G++FD+LLT
Sbjct  363  PLDSHLVASAMTMWNKLQPAYAANLWNEALNKRLGTEGLDLPAIMVEAEKLGISFDKLLT  422

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PE D WVYSDGKS +C+ FILAMYK++G+F  +A +IQVTEFTI+DAY L  +E+N +R
Sbjct  423  VPEHDNWVYSDGKSASCIVFILAMYKDAGLFDPIASNIQVTEFTIKDAYTLNFFESNSSR  482

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN  ++ KLPFCQI+G YRMELP +NT++PY +MNE CPSLPP Y R  +C
Sbjct  483  LPEWCNKDDNVKLPFCQIMGRYRMELPEFNTIQPYPHMNERCPSLPPDYARSSYC  537



>ref|XP_004151958.1| PREDICTED: uncharacterized protein LOC101214437 [Cucumis sativus]
 ref|XP_004158470.1| PREDICTED: uncharacterized LOC101214437 [Cucumis sativus]
 gb|KGN57971.1| hypothetical protein Csa_3G416640 [Cucumis sativus]
Length=536

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++WTR++PT AAN+WNEALN RLGT+GLDL EIL E E++G +F +LL 
Sbjct  362  PLDAHLVASVMTIWTRVRPTLAANLWNEALNIRLGTKGLDLPEILVEVEKQGSSFGELLA  421

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVY+DGKS +CVAFIL MYKE+G+FG LA SIQVTEFTI+DAY L  YENN +R
Sbjct  422  IPEQDDWVYADGKSASCVAFILEMYKEAGLFGPLASSIQVTEFTIKDAYSLNFYENNSSR  481

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WC+  +D KLP+CQI+G+YRM+L GYN+++ Y +MNE CPSLP  Y RP +C
Sbjct  482  LPKWCHGRDDVKLPYCQILGKYRMDLQGYNSIDLYKHMNEKCPSLPTEYFRPKNC  536



>ref|XP_009614697.1| PREDICTED: uncharacterized protein LOC104107565 isoform X2 [Nicotiana 
tomentosiformis]
Length=528

 Score =   257 bits (656),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM+++ +++P YA+N+WNEALNKRLGT+ L L  IL E E+RG +F +LLT
Sbjct  354  PLDAHLVASVMTVFNQLKPAYASNLWNEALNKRLGTQNLSLPNILVEVEKRGSSFAELLT  413

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W YSDGKS +CVA+IL MYKE G+FG LA SIQVTEFTI+DAY LK +ENN +R
Sbjct  414  IPEQDDWDYSDGKSASCVAYILEMYKEGGLFGELASSIQVTEFTIKDAYTLKFFENNSSR  473

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN+ +  KLPFCQI G+YRMELPGYNT++PY  MNE CPS+PP Y RP  C
Sbjct  474  LPKWCNADDSVKLPFCQIRGKYRMELPGYNTMDPYPRMNERCPSMPPKYYRPQGC  528



>ref|XP_009801187.1| PREDICTED: uncharacterized protein LOC104246940 isoform X1 [Nicotiana 
sylvestris]
Length=528

 Score =   257 bits (656),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 144/175 (82%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHL+ SVM+++ +++P YA+N+WNEALNKRLGT+ L L  IL E E+RG +F +LL 
Sbjct  354  PLDAHLIASVMTVFNQLKPAYASNLWNEALNKRLGTQNLSLPNILVEVEKRGSSFAELLI  413

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVYSDGKS +CVA+I+ MYKE G+FG LA SIQVTEFTI+DAY LK +ENN +R
Sbjct  414  IPEQDDWVYSDGKSASCVAYIMEMYKEGGLFGELASSIQVTEFTIKDAYTLKFFENNSSR  473

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN+ +  KLPFCQI G+YRMELPGYNT++PY +MNE CPS+PP Y RP  C
Sbjct  474  LPKWCNADDTVKLPFCQIRGKYRMELPGYNTMDPYPHMNERCPSMPPKYYRPQGC  528



>emb|CDP05764.1| unnamed protein product [Coffea canephora]
Length=527

 Score =   256 bits (655),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 142/175 (81%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W+++QPTYAAN+WNEALNKRLGT+GL L EIL E E+RG +F +LL 
Sbjct  353  PLDAHLVASVMTVWSQLQPTYAANLWNEALNKRLGTQGLGLPEILVEVEKRGSSFAELLA  412

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPE+D W Y DGKS +CVAF+L MYKE+G+FG L  SI+VTEFTI+DAY L I+EN+ + 
Sbjct  413  IPERDNWTYVDGKSASCVAFVLEMYKEAGIFGELGNSIEVTEFTIKDAYSLNIFENDSSH  472

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WC  G+  +LPFCQI G+YRMELPGYNT+ PY +MNE CPS+PP Y RP  C
Sbjct  473  LPQWCKDGDTVELPFCQIRGKYRMELPGYNTINPYPHMNERCPSMPPEYYRPEGC  527



>emb|CDM84540.1| unnamed protein product [Triticum aestivum]
Length=539

 Score =   257 bits (656),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V SVM++W ++QP YAA+MW EALNKRLGT+GLDL EI+ E+E+RG+TFD+LLT
Sbjct  365  PLDAHVVASVMTVWNKLQPDYAASMWTEALNKRLGTKGLDLPEIIVESEKRGMTFDKLLT  424

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPE+D WVY+DG+S +CVA++L MYKE+G+F  ++ SI+VTEFTI+DAY+L  +E N TR
Sbjct  425  IPEKDNWVYTDGQSASCVAYVLMMYKEAGLFEPISSSIEVTEFTIKDAYILNFFEANMTR  484

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN  +  KLPFCQI G YRMELPGYN +EPYA+MNE C SLPP Y R  +C
Sbjct  485  LPSWCNKDDTVKLPFCQIKGRYRMELPGYNAMEPYAHMNERCASLPPDYLRDENC  539



>ref|XP_002278686.1| PREDICTED: uncharacterized protein LOC100241838 isoform X3 [Vitis 
vinifera]
Length=524

 Score =   256 bits (654),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 142/174 (82%), Gaps = 0/174 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V + M++W +M P YAAN+WNEALNKRLGT+ L L EIL ETE RG +F +LLT
Sbjct  351  PLDAHVVAAGMTVWNQMWPAYAANLWNEALNKRLGTQNLSLPEILIETETRGSSFAELLT  410

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVY+DGKST+CVAFIL MYKE+G+FG +A SIQ TEFTI+DAY L  +EN+ +R
Sbjct  411  IPEQDDWVYTDGKSTSCVAFILEMYKEAGLFGPIASSIQGTEFTIKDAYTLSFFENDSSR  470

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G+   P+CQI G+YRMELP YNTL+PY++MNE CPSLPP Y R  +C
Sbjct  471  LPKWCNDGDIVQPYCQIKGKYRMELPEYNTLDPYSHMNEKCPSLPPKYSRSANC  524



>ref|XP_004244132.1| PREDICTED: uncharacterized protein LOC101251905 [Solanum lycopersicum]
Length=528

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 142/175 (81%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            PVDAHLV SVM++W ++ P Y +N+WNEALNKRLGT+ L L +IL E E+RG +F +LL 
Sbjct  354  PVDAHLVASVMTVWNQIAPEYGSNLWNEALNKRLGTQNLSLPDILVEVEKRGSSFAKLLA  413

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVYSDGKS +CVAFIL MYKE G+FG LA SIQVTEFTI+DAY L ++ENN +R
Sbjct  414  IPEQDDWVYSDGKSASCVAFILEMYKEGGLFGELANSIQVTEFTIKDAYTLNLFENNSSR  473

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN+ +  KLPFCQI G+YRMELPGYN+++ Y +MNE CPS+PP Y RP  C
Sbjct  474  LPKWCNADDTMKLPFCQIRGKYRMELPGYNSMDLYPHMNERCPSMPPKYYRPQGC  528



>gb|EMT03744.1| hypothetical protein F775_19554 [Aegilops tauschii]
Length=637

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 145/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V SVM++W ++QP YAA+MW EALNKRLGT+GLDL EI+ E+E+RG+TFD+LLT
Sbjct  463  PLDAHVVASVMTVWNKLQPDYAASMWTEALNKRLGTKGLDLPEIIVESEKRGMTFDKLLT  522

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPE+D WVY+DG+S +CVA++L MYKE+G+F  ++ SI VTEFTI+DAY+L  +E N TR
Sbjct  523  IPEKDNWVYTDGQSASCVAYVLMMYKEAGLFEPISSSIDVTEFTIKDAYILNFFEANMTR  582

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LPSWCN  +  KLPFCQI G YRMELPGYN +EPYA+MNE C SLPP Y R  +C
Sbjct  583  LPSWCNKDDTVKLPFCQIKGRYRMELPGYNAMEPYAHMNERCASLPPDYVRDENC  637



>ref|XP_006346229.1| PREDICTED: uncharacterized protein LOC102586255 [Solanum tuberosum]
Length=528

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 140/175 (80%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            PVDAHLV SVM++W ++ P Y +N+WNEALNKRLGT+ L L  IL E E+RG +F +LL 
Sbjct  354  PVDAHLVASVMTVWNQIAPEYGSNLWNEALNKRLGTQNLSLPNILVEVEKRGSSFAKLLA  413

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVYSDGKS +CVAFIL MYKE G+FG  A SIQVTEFTIRDAY L ++ENN +R
Sbjct  414  IPEQDDWVYSDGKSASCVAFILEMYKEGGLFGEFANSIQVTEFTIRDAYTLNLFENNSSR  473

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN+ +  KLPFCQI G+YRMELPGYN+++ Y +MNE CPS+PP Y RP  C
Sbjct  474  LPKWCNADDTVKLPFCQIRGKYRMELPGYNSMDLYPHMNERCPSMPPKYYRPQGC  528



>ref|XP_010930250.1| PREDICTED: uncharacterized protein LOC105051475 isoform X1 [Elaeis 
guineensis]
Length=542

 Score =   254 bits (648),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+D+HLV S M++W+ +QP YAAN+WNEALN RLGTEGLDL  I+ E E+ G++FD+LLT
Sbjct  368  PLDSHLVASAMTVWSNIQPAYAANLWNEALNLRLGTEGLDLPAIMVEAEKLGISFDKLLT  427

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            +PEQD+WVYSDGKS +C+AF+L MYKE+G+F  +A +IQVTEFTI+DAY LK +ENN + 
Sbjct  428  VPEQDDWVYSDGKSASCIAFVLVMYKEAGLFDPIAANIQVTEFTIKDAYTLKFFENNSSH  487

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN  ++ KLP+CQI+G YRMELP YNTL+PY +MNE CPSLP  Y R  +C
Sbjct  488  LPEWCNKDDNVKLPYCQILGRYRMELPEYNTLQPYPHMNERCPSLPLDYARSSYC  542



>dbj|BAJ95380.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=541

 Score =   254 bits (648),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V SVM++W ++QP YAA+MW EALNKRLGT+GLDL EI+ E+E+RG+TFD+LLT
Sbjct  367  PLDAHVVASVMTVWNKLQPDYAASMWTEALNKRLGTKGLDLPEIIVESEKRGMTFDKLLT  426

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPE+D+WVY+DG+S +CVA++L MYKE+G+F  ++ SI+VTEFTI+DAY+L  +E N TR
Sbjct  427  IPEKDKWVYTDGQSASCVAYVLMMYKEAGLFEPISSSIEVTEFTIKDAYILNFFEANMTR  486

Query  381  LPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP+WCN  +  KLPFCQI G YRMELPGYN +E YA+MNE C SLPP Y R  +C
Sbjct  487  LPAWCNKDDTVKLPFCQIKGRYRMELPGYNAMEQYAHMNERCASLPPDYVRDENC  541



>ref|XP_010644425.1| PREDICTED: uncharacterized protein LOC100241838 isoform X1 [Vitis 
vinifera]
 ref|XP_010644426.1| PREDICTED: uncharacterized protein LOC100241838 isoform X1 [Vitis 
vinifera]
 ref|XP_010644427.1| PREDICTED: uncharacterized protein LOC100241838 isoform X1 [Vitis 
vinifera]
Length=545

 Score =   252 bits (643),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V + M++W +M P YAAN+WNEALNKRLGT+ L L EIL ETE RG +F +LLT
Sbjct  351  PLDAHVVAAGMTVWNQMWPAYAANLWNEALNKRLGTQNLSLPEILIETETRGSSFAELLT  410

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVY+DGKST+CVAFIL MYKE+G+FG +A SIQ TEFTI+DAY L  +EN+ +R
Sbjct  411  IPEQDDWVYTDGKSTSCVAFILEMYKEAGLFGPIASSIQGTEFTIKDAYTLSFFENDSSR  470

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSY  238
            LP WCN G+   P+CQI G+YRMELP YNTL+PY++MNE CPSLPP Y
Sbjct  471  LPKWCNDGDIVQPYCQIKGKYRMELPEYNTLDPYSHMNEKCPSLPPKY  518



>ref|XP_009614695.1| PREDICTED: uncharacterized protein LOC104107565 isoform X1 [Nicotiana 
tomentosiformis]
Length=533

 Score =   251 bits (641),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 143/180 (79%), Gaps = 6/180 (3%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTE-----GLDLYEILAETERRGLTF  577
            P+DAHLV SVM+++ +++P YA+N+WNEALNKRLGT+      L L  IL E E+RG +F
Sbjct  354  PLDAHLVASVMTVFNQLKPAYASNLWNEALNKRLGTQQMLMQNLSLPNILVEVEKRGSSF  413

Query  576  DQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYE  397
             +LLTIPEQD+W YSDGKS +CVA+IL MYKE G+FG LA SIQVTEFTI+DAY LK +E
Sbjct  414  AELLTIPEQDDWDYSDGKSASCVAYILEMYKEGGLFGELASSIQVTEFTIKDAYTLKFFE  473

Query  396  NNQTRLPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            NN +RLP WCN+ +  KLPFCQI G+YRMELPGYNT++PY  MNE CPS+PP Y RP  C
Sbjct  474  NNSSRLPKWCNADDSVKLPFCQIRGKYRMELPGYNTMDPYPRMNERCPSMPPKYYRPQGC  533



>emb|CBI26611.3| unnamed protein product [Vitis vinifera]
Length=590

 Score =   252 bits (643),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V + M++W +M P YAAN+WNEALNKRLGT+ L L EIL ETE RG +F +LLT
Sbjct  396  PLDAHVVAAGMTVWNQMWPAYAANLWNEALNKRLGTQNLSLPEILIETETRGSSFAELLT  455

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVY+DGKST+CVAFIL MYKE+G+FG +A SIQ TEFTI+DAY L  +EN+ +R
Sbjct  456  IPEQDDWVYTDGKSTSCVAFILEMYKEAGLFGPIASSIQGTEFTIKDAYTLSFFENDSSR  515

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSY  238
            LP WCN G+   P+CQI G+YRMELP YNTL+PY++MNE CPSLPP Y
Sbjct  516  LPKWCNDGDIVQPYCQIKGKYRMELPEYNTLDPYSHMNEKCPSLPPKY  563



>ref|XP_004158483.1| PREDICTED: uncharacterized LOC101212346 [Cucumis sativus]
Length=438

 Score =   241 bits (615),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 137/179 (77%), Gaps = 6/179 (3%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V S M++W +MQP++A  +WNEALNKRLGT+GL+L EIL E E++G +F +LL 
Sbjct  261  PLDAHMVASAMTIWNQMQPSFAGKLWNEALNKRLGTKGLELAEILVEVEKQGSSFGELLA  320

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD W YSDGKS TCVA ++ +YK +G+FG L  SIQ TEFT++DAY LK YE+N +R
Sbjct  321  IPEQDVWTYSDGKSATCVALVVEIYKVAGLFGPLTSSIQATEFTVKDAYTLKFYEDNLSR  380

Query  381  LPSWCNSGND-----KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G D     +LP+CQI+G YRMELP YNT+ PY +MNE CPSL P Y  P +C
Sbjct  381  LPKWCNDGGDNYENKQLPYCQILGNYRMELPDYNTIHPYQHMNEKCPSL-PDYAHPKNC  438



>ref|XP_008454552.1| PREDICTED: uncharacterized protein LOC103494942 [Cucumis melo]
Length=538

 Score =   243 bits (620),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 137/179 (77%), Gaps = 6/179 (3%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V S M++W +MQP++A  +WNEALNKRLGT+GL+L E+L E E++G +F +LL 
Sbjct  361  PLDAHMVASAMTIWNQMQPSFAGKLWNEALNKRLGTKGLELAEVLVEVEKKGSSFGELLA  420

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQDEW YSDGKS TCVA ++ +YK +G+FG L  SIQ TEFT++DAY LK YE+N +R
Sbjct  421  IPEQDEWTYSDGKSATCVALVVEIYKVAGLFGPLTSSIQATEFTVKDAYTLKFYEDNLSR  480

Query  381  LPSWCNSGND-----KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G D     +LP+CQI+G YRMELP YNT+ PY +MNE CPSL P Y  P  C
Sbjct  481  LPKWCNDGGDNYENKQLPYCQILGNYRMELPDYNTIHPYQHMNEKCPSL-PDYVHPKDC  538



>gb|KCW67120.1| hypothetical protein EUGRSUZ_F00901 [Eucalyptus grandis]
Length=368

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 141/184 (77%), Gaps = 11/184 (6%)
 Frame = -1

Query  738  VDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTE----------GLDLYEILAETERR  589
            +DAH+V SVM++  +MQP YAANMWNEALNKRLGTE            DL +++ +TE R
Sbjct  178  LDAHVVASVMTVCNQMQPAYAANMWNEALNKRLGTEVPSYSICNCLAWDLPDLIVKTEMR  237

Query  588  GLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYML  409
            G +F +LLTIPEQD+WVYSDG+S +CVAF+L +YK + +F  ++ SIQVTEFTI+DAY L
Sbjct  238  GSSFAELLTIPEQDDWVYSDGRSASCVAFVLEIYKAARLFDPISRSIQVTEFTIKDAYSL  297

Query  408  KIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGR  232
            + +ENN +RLP WCN G+D +  FCQI G YRMELPGYNT++PY +MNE CPSLPP Y R
Sbjct  298  RFFENNSSRLPKWCNDGDDVEFLFCQIRGRYRMELPGYNTMDPYPHMNEMCPSLPPKYSR  357

Query  231  PIHC  220
            P +C
Sbjct  358  PSNC  361



>ref|XP_004152029.1| PREDICTED: uncharacterized protein LOC101212346 [Cucumis sativus]
 gb|KGN57972.1| hypothetical protein Csa_3G416650 [Cucumis sativus]
Length=527

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 137/179 (77%), Gaps = 6/179 (3%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V S M++W +MQP++A  +WNEALNKRLGT+GL+L EIL E E++G +F +LL 
Sbjct  350  PLDAHMVASAMTIWNQMQPSFAGKLWNEALNKRLGTKGLELAEILVEVEKQGSSFGELLA  409

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD W YSDGKS TCVA ++ +YK +G+FG L  SIQ TEFT++DAY LK YE+N +R
Sbjct  410  IPEQDVWTYSDGKSATCVALVVEIYKVAGLFGPLTSSIQATEFTVKDAYTLKFYEDNLSR  469

Query  381  LPSWCNSGND-----KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            LP WCN G D     +LP+CQI+G YRMELP YNT+ PY +MNE CPSL P Y  P +C
Sbjct  470  LPKWCNDGGDNYENKQLPYCQILGNYRMELPDYNTIHPYQHMNEKCPSL-PDYAHPKNC  527



>emb|CAN60720.1| hypothetical protein VITISV_022056 [Vitis vinifera]
Length=555

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 142/205 (69%), Gaps = 31/205 (15%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTE-----------------------  631
            P+DAH+V + M++W +M P YAAN+WNEALNKRLGT+                       
Sbjct  351  PLDAHVVAAGMTVWNQMWPAYAANLWNEALNKRLGTQTALGIWDLAFKDPPKYPRSDVDI  410

Query  630  --------GLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESG  475
                     L L EIL ETE RG +F +LLTIPEQD+WVY+DGKST+CVAFIL MYKE+G
Sbjct  411  IMADLKNQNLSLPEILIETETRGSSFAELLTIPEQDDWVYTDGKSTSCVAFILEMYKEAG  470

Query  474  VFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELPGYN  295
            +FG +A SIQ TEFTI+DAY L  +EN+ +RLP WCN G+   P+CQI G+YRMELP YN
Sbjct  471  LFGPIASSIQGTEFTIKDAYTLSFFENDSSRLPKWCNDGDIVQPYCQIKGKYRMELPEYN  530

Query  294  TLEPYANMNENCPSLPPSYGRPIHC  220
            TL+PY++MNE CPSLPP Y R  +C
Sbjct  531  TLDPYSHMNEKCPSLPPKYSRSANC  555



>ref|XP_010272087.1| PREDICTED: uncharacterized protein LOC104607980 isoform X2 [Nelumbo 
nucifera]
Length=500

 Score =   237 bits (604),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -1

Query  630  GLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAES  451
            GLDL  ILAE+ERRG++FDQLL IPEQDEWVYSDGKSTTCVAFIL MYKE+G+F  ++ S
Sbjct  364  GLDLPGILAESERRGISFDQLLIIPEQDEWVYSDGKSTTCVAFILEMYKEAGIFYPISSS  423

Query  450  IQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANM  271
            IQVTEFTIRDAYMLKI+ENN+TRLPSWC++ + +LPFCQI+GEY+MELP YNT+EPYANM
Sbjct  424  IQVTEFTIRDAYMLKIFENNRTRLPSWCSNADGELPFCQILGEYQMELPQYNTIEPYANM  483

Query  270  NENCPSLPPSYGRPIHC  220
            NENCPSLPP+Y RP+ C
Sbjct  484  NENCPSLPPTYERPVRC  500



>ref|XP_009419909.1| PREDICTED: uncharacterized protein LOC103999784 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=506

 Score =   236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = -1

Query  627  LDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESI  448
            LDL+EI+ ET+R+G+TFDQLLT+PEQDEW+YSDGKSTTCVAF+L +YKE+G+ G LA SI
Sbjct  371  LDLHEIIVETQRQGMTFDQLLTMPEQDEWIYSDGKSTTCVAFVLELYKEAGILGPLANSI  430

Query  447  QVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMN  268
            QVTEFTIRDAYML I+ENNQTRLPSWCN+  +KLPFCQI+G YRMELP YNT+EPYA+MN
Sbjct  431  QVTEFTIRDAYMLNIFENNQTRLPSWCNALEEKLPFCQILGYYRMELPQYNTIEPYAHMN  490

Query  267  ENCPSLPPSYGRPIHC  220
            ENCPSLPP+Y RP  C
Sbjct  491  ENCPSLPPAYTRPERC  506



>gb|KCW67113.1| hypothetical protein EUGRSUZ_F00893 [Eucalyptus grandis]
Length=496

 Score =   234 bits (598),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 131/169 (78%), Gaps = 13/169 (8%)
 Frame = -1

Query  723  VISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDE  544
            V SVM++W +MQP YAANMWNEALNKRLGTEGLDL ++L ETE RG +F +LLTIPEQD+
Sbjct  340  VASVMTVWNQMQPAYAANMWNEALNKRLGTEGLDLPDLLVETEMRGSSFAELLTIPEQDD  399

Query  543  WVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCN  364
            WVYSDGKS +CVAF+L +            SIQVTEFTI+DAY LK +ENN +RLP W N
Sbjct  400  WVYSDGKSASCVAFVLEI------------SIQVTEFTIKDAYSLKFFENNSSRLPKWSN  447

Query  363  SGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
             G+D +LPFCQI G YRMELPGYNT++ Y +MNE CPSLPP Y RP  C
Sbjct  448  DGDDVELPFCQIQGRYRMELPGYNTMDLYPHMNERCPSLPPKYSRPSDC  496



>gb|ACF81787.1| unknown [Zea mays]
Length=122

 Score =   221 bits (563),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -1

Query  585  LTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLK  406
            ++FDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKE+G+F   +ESIQVTEFTIRDAYMLK
Sbjct  1    MSFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKEAGIFTPFSESIQVTEFTIRDAYMLK  60

Query  405  IYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPI  226
            I+E+N  RLP WCN+G DKLPFCQI+GEYRMELP YNT+EPYA MNENCPSLPP+Y RP 
Sbjct  61   IFEDNPARLPGWCNAGTDKLPFCQILGEYRMELPEYNTIEPYAKMNENCPSLPPTYKRPA  120

Query  225  HC  220
             C
Sbjct  121  RC  122



>gb|EMS49816.1| hypothetical protein TRIUR3_06457 [Triticum urartu]
Length=589

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 138/194 (71%), Gaps = 35/194 (18%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTE-----------------------  631
            P+DAH+V SVM++W ++QP YAA+MW EALNKRLGT+                       
Sbjct  299  PLDAHVVASVMTVWNKLQPDYAASMWTEALNKRLGTKVVPGPSFGSSIHLADSLVCDNKL  358

Query  630  -----------GLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYK  484
                       GLDL EI+ E+E+RG+TFD+LLTIPE+D WVY+DG+S +CVA++L MYK
Sbjct  359  LCDHNPAGMDNGLDLPEIIVESEKRGMTFDKLLTIPEKDNWVYTDGQSASCVAYVLMMYK  418

Query  483  ESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMEL  307
            E+G+F  ++ SI+VTEFTI+DAY+L  +E N TRLPSWCN  +  KLPFCQI G YRMEL
Sbjct  419  EAGLFEPISSSIEVTEFTIKDAYILNFFEANMTRLPSWCNKDDTVKLPFCQIKGRYRMEL  478

Query  306  PGYNTLEPYANMNE  265
            PGYNT+EPYA+MNE
Sbjct  479  PGYNTMEPYAHMNE  492



>gb|KCW67102.1| hypothetical protein EUGRSUZ_F00885 [Eucalyptus grandis]
Length=484

 Score =   216 bits (549),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 122/154 (79%), Gaps = 1/154 (1%)
 Frame = -1

Query  723  VISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDE  544
            V SVM++W +MQP YAANMWNEALNKRLGTE         ETE RG +F +LLTIPEQD+
Sbjct  326  VASVMTVWNQMQPAYAANMWNEALNKRLGTEVPSHSIGNLETEMRGSSFAELLTIPEQDD  385

Query  543  WVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCN  364
            WVYSDGKS +CV F+L MYK +G F  ++ SIQVTEFTI+DAY LK +ENN +RLP WCN
Sbjct  386  WVYSDGKSASCVVFVLEMYKAAGRFDPISSSIQVTEFTIKDAYSLKFFENNSSRLPKWCN  445

Query  363  SGND-KLPFCQIVGEYRMELPGYNTLEPYANMNE  265
             G++ +LPFCQI G Y+MELPGYNT++PY +MNE
Sbjct  446  DGDNVELPFCQIRGRYQMELPGYNTMDPYPHMNE  479



>ref|XP_010445105.1| PREDICTED: uncharacterized protein LOC104727725 [Camelina sativa]
Length=131

 Score =   204 bits (518),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 110/128 (86%), Gaps = 1/128 (1%)
 Frame = -1

Query  600  TERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRD  421
             E+RG +FD+LL +PEQD+W+YSDGKST+C+AFIL MYKE+G+F  ++ SIQVTEFTI+D
Sbjct  4    VEKRGSSFDELLAVPEQDDWIYSDGKSTSCIAFILEMYKEAGLFDPISSSIQVTEFTIKD  63

Query  420  AYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPP  244
            AYMLK +ENN +R P WCN  +D KLP+CQI+G+YRMELPGYNT+EPY +MNE+CPSLPP
Sbjct  64   AYMLKFFENNASRFPKWCNDNDDVKLPYCQILGKYRMELPGYNTMEPYPHMNEHCPSLPP  123

Query  243  SYGRPIHC  220
             Y RP +C
Sbjct  124  KYHRPKNC  131



>ref|XP_010092131.1| hypothetical protein L484_017819 [Morus notabilis]
 gb|EXB50282.1| hypothetical protein L484_017819 [Morus notabilis]
Length=624

 Score =   216 bits (550),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH V SVM++W ++QP+YAAN+WNEALNKRLGTEGLDL  IL ETE++GL+FD+LLT
Sbjct  378  PLDAHAVASVMTVWNQIQPSYAANLWNEALNKRLGTEGLDLPSILVETEKQGLSFDKLLT  437

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+W+Y+DGKST+C+AF+L MYK +G+F  +A SIQVTEFTI+DAY LK ++++ +R
Sbjct  438  IPEQDDWLYADGKSTSCIAFVLEMYKAAGLFDPIASSIQVTEFTIKDAYTLKFFDDDLSR  497

Query  381  LPSWCNSGND-KLPFCQIVGEYRMEL  307
             P WCN  +D KLP+CQI+G  R EL
Sbjct  498  QPKWCNDADDVKLPYCQILGNKRAEL  523



>gb|KCW67110.1| hypothetical protein EUGRSUZ_F00891 [Eucalyptus grandis]
Length=148

 Score =   198 bits (503),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = -1

Query  633  EGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAE  454
            +GLDL ++L ETE RG +F +LLTIP+QD+WVYSDG S +CVAF+L MYK +G+F  ++ 
Sbjct  10   QGLDLPDLLLETEMRGSSFAELLTIPQQDDWVYSDGNSASCVAFVLEMYKATGLFDPISG  69

Query  453  SIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYA  277
            SIQVTEFTI+DAY LK ++NN  RLP  CN G+D +LPFCQI G YRMELPGYNT++PY 
Sbjct  70   SIQVTEFTIKDAYSLKFFKNNSRRLPKLCNDGDDAELPFCQIRGRYRMELPGYNTMDPYP  129

Query  276  NMNENCPSLPPSYGRPIHC  220
            +MNE CP+LPP Y RP  C
Sbjct  130  HMNERCPTLPPKYSRPSDC  148



>ref|XP_010644428.1| PREDICTED: uncharacterized protein LOC100241838 isoform X2 [Vitis 
vinifera]
Length=538

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V + M++W +M P YAAN+WNEALNKRLGT+ L L EIL ETE RG +F +LLT
Sbjct  351  PLDAHVVAAGMTVWNQMWPAYAANLWNEALNKRLGTQNLSLPEILIETETRGSSFAELLT  410

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            IPEQD+WVY+DGKST+CVAFIL MYKE+G+FG +A SIQ TEFTI+DAY L  +EN+ +R
Sbjct  411  IPEQDDWVYTDGKSTSCVAFILEMYKEAGLFGPIASSIQGTEFTIKDAYTLSFFENDSSR  470

Query  381  LPSWCNSGNDKLPFCQI  331
            LP WCN G+   P+CQI
Sbjct  471  LPKWCNDGDIVQPYCQI  487



>gb|EEC71626.1| hypothetical protein OsI_04047 [Oryza sativa Indica Group]
Length=123

 Score =   188 bits (477),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 103/123 (84%), Gaps = 1/123 (1%)
 Frame = -1

Query  585  LTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLK  406
            +TFD+LLT+PEQD+WVY+DG+S +CVA++L MYKE+G+F  +A SI+VTEFTI+DAY L 
Sbjct  1    MTFDKLLTVPEQDKWVYTDGQSASCVAYVLMMYKEAGLFDPIASSIEVTEFTIKDAYSLN  60

Query  405  IYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRP  229
             +ENN TRLP WCN  +  KLPFCQI G YRMELPGYNT++PY +MNE CPSLPP+Y RP
Sbjct  61   FFENNMTRLPVWCNKDDSVKLPFCQIKGRYRMELPGYNTMQPYPHMNERCPSLPPNYNRP  120

Query  228  IHC  220
             +C
Sbjct  121  RNC  123



>ref|XP_010930259.1| PREDICTED: uncharacterized protein LOC105051475 isoform X2 [Elaeis 
guineensis]
Length=511

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 111/138 (80%), Gaps = 1/138 (1%)
 Frame = -1

Query  630  GLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAES  451
            GLDL  I+ E E+ G++FD+LLT+PEQD+WVYSDGKS +C+AF+L MYKE+G+F  +A +
Sbjct  374  GLDLPAIMVEAEKLGISFDKLLTVPEQDDWVYSDGKSASCIAFVLVMYKEAGLFDPIAAN  433

Query  450  IQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYAN  274
            IQVTEFTI+DAY LK +ENN + LP WCN  ++ KLP+CQI+G YRMELP YNTL+PY +
Sbjct  434  IQVTEFTIKDAYTLKFFENNSSHLPEWCNKDDNVKLPYCQILGRYRMELPEYNTLQPYPH  493

Query  273  MNENCPSLPPSYGRPIHC  220
            MNE CPSLP  Y R  +C
Sbjct  494  MNERCPSLPLDYARSSYC  511



>ref|XP_002878755.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55014.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=114

 Score =   184 bits (466),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -1

Query  651  NKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGV  472
            NKRLGTE L+L  IL ET RRG++FD+LLTIPEQDEWVYSDGKST+CVAFILAMYK +GV
Sbjct  1    NKRLGTEDLNLCGILEETARRGISFDELLTIPEQDEWVYSDGKSTSCVAFILAMYKAAGV  60

Query  471  FGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRME  310
            FG LA  IQV EFTIRDAY  K++E+NQTRLPSWCN+  +KL FC I+GEYRME
Sbjct  61   FGPLANHIQVIEFTIRDAYTPKLFESNQTRLPSWCNTEEEKLDFCHILGEYRME  114



>gb|KCW67111.1| hypothetical protein EUGRSUZ_F00891 [Eucalyptus grandis]
Length=126

 Score =   183 bits (464),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 100/125 (80%), Gaps = 1/125 (1%)
 Frame = -1

Query  591  RGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYM  412
            RG +F +LLTIP+QD+WVYSDG S +CVAF+L MYK +G+F  ++ SIQVTEFTI+DAY 
Sbjct  2    RGSSFAELLTIPQQDDWVYSDGNSASCVAFVLEMYKATGLFDPISGSIQVTEFTIKDAYS  61

Query  411  LKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYG  235
            LK ++NN  RLP  CN G+D +LPFCQI G YRMELPGYNT++PY +MNE CP+LPP Y 
Sbjct  62   LKFFKNNSRRLPKLCNDGDDAELPFCQIRGRYRMELPGYNTMDPYPHMNERCPTLPPKYS  121

Query  234  RPIHC  220
            RP  C
Sbjct  122  RPSDC  126



>ref|XP_010064375.1| PREDICTED: uncharacterized protein LOC104451414 [Eucalyptus grandis]
Length=133

 Score =   182 bits (463),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 101/125 (81%), Gaps = 1/125 (1%)
 Frame = -1

Query  591  RGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYM  412
            RG +F +LLTIPEQD+WVYSDG+S +CVAF+L +YK + +F  ++ SIQVTEFTI+DAY 
Sbjct  2    RGSSFAELLTIPEQDDWVYSDGRSASCVAFVLEIYKAARLFDPISRSIQVTEFTIKDAYS  61

Query  411  LKIYENNQTRLPSWCNSGND-KLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYG  235
            L+ +ENN +RLP WCN G+D +  FCQI G YRMELPGYNT++PY +MNE CPSLPP Y 
Sbjct  62   LRFFENNSSRLPKWCNDGDDVEFLFCQIRGRYRMELPGYNTMDPYPHMNEMCPSLPPKYS  121

Query  234  RPIHC  220
            RP +C
Sbjct  122  RPSNC  126



>ref|XP_006438500.1| hypothetical protein CICLE_v10031248mg [Citrus clementina]
 gb|ESR51740.1| hypothetical protein CICLE_v10031248mg [Citrus clementina]
Length=473

 Score =   186 bits (472),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV+SVMSMWTR+QP YAANMWNEALNKRLGTE LDL+ IL E E+RG++FDQLLT
Sbjct  345  PLDAHLVVSVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLHGILDEIEKRGISFDQLLT  404

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTI  427
            IPEQDEWVYSDGKSTTCVAFIL MYKE+GVFG ++ SIQVTEFT+
Sbjct  405  IPEQDEWVYSDGKSTTCVAFILEMYKEAGVFGPISNSIQVTEFTV  449



>gb|KDO82634.1| hypothetical protein CISIN_1g0101752mg, partial [Citrus sinensis]
Length=123

 Score =   175 bits (444),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 98/123 (80%), Gaps = 5/123 (4%)
 Frame = -1

Query  723  VISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDE  544
            V+SVMSMWTR+QP YAANMWNEALNKRLGTE LDL+ IL E E+RG++FDQLLTIPEQDE
Sbjct  1    VVSVMSMWTRVQPAYAANMWNEALNKRLGTEDLDLHGILDEIEKRGISFDQLLTIPEQDE  60

Query  543  WVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAY-----MLKIYENNQTRL  379
            WVYSDGKSTTCVAFIL MYKE+GVFG ++ SIQVTEFT+           +I  +N   +
Sbjct  61   WVYSDGKSTTCVAFILEMYKEAGVFGPISNSIQVTEFTVSIKLFGLLCFTQIASSNSLHI  120

Query  378  PSW  370
             SW
Sbjct  121  FSW  123



>ref|XP_002872148.1| hypothetical protein ARALYDRAFT_351537 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48407.1| hypothetical protein ARALYDRAFT_351537 [Arabidopsis lyrata subsp. 
lyrata]
Length=146

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -1

Query  636  TEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLA  457
             + L+L  IL E  RRG++FD+LLTIPEQDEWVYSDGKST CVAFILAMYK +GVFG LA
Sbjct  33   VQDLNLCGILEEIARRGMSFDELLTIPEQDEWVYSDGKSTACVAFILAMYKAAGVFGPLA  92

Query  456  ESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  307
              IQVTEFTIRDAY  K++E+NQTRLPSWCN+  +KL FCQI+GEYRMEL
Sbjct  93   NHIQVTEFTIRDAYTPKLFESNQTRLPSWCNTEEEKLDFCQILGEYRMEL  142



>gb|EYU33635.1| hypothetical protein MIMGU_mgv1a018256mg, partial [Erythranthe 
guttata]
Length=505

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 92/117 (79%), Gaps = 0/117 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++WT+MQP YA NMWNEALNKRLGT+   L ++L E E+RG +F  LL 
Sbjct  389  PLDAHLVASVMTVWTQMQPAYAGNMWNEALNKRLGTQNFSLSQVLVEVEKRGSSFGALLA  448

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENN  391
             PEQD WVY+DGKS +CV F+  MYKE+G+FG L  SIQ +EFTI+DAY LK +ENN
Sbjct  449  APEQDNWVYADGKSASCVVFVFEMYKEAGLFGKLGSSIQASEFTIKDAYSLKFFENN  505



>gb|KJB62764.1| hypothetical protein B456_009G435000 [Gossypium raimondii]
Length=460

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAHLV SVM++W+++QP YAANMWNEALNKRLGT+GL+L +IL ETE+RG +FD+LLT
Sbjct  350  PLDAHLVASVMTVWSKIQPEYAANMWNEALNKRLGTQGLNLSDILVETEKRGSSFDELLT  409

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFT  430
            IPEQD W+YSDGKST+C+AF+L +YKE+G+F  +A+SIQVTEFT
Sbjct  410  IPEQDNWIYSDGKSTSCIAFVLELYKEAGLFDPIADSIQVTEFT  453



>ref|XP_006575675.1| PREDICTED: uncharacterized protein LOC100789468 isoform X2 [Glycine 
max]
Length=464

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA++V  VM++W+++QP YAANMWNEALNKRLGT+GLDL E+L E E+RG +FD+LLT
Sbjct  345  PLDANVVACVMTIWSQLQPEYAANMWNEALNKRLGTKGLDLSEVLVEVEKRGSSFDELLT  404

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTI  427
            IPEQD+W+YSDGKST+C+AFIL MYKE+G+F  +A S+QVTEFTI
Sbjct  405  IPEQDDWIYSDGKSTSCIAFILEMYKEAGLFDPVASSVQVTEFTI  449



>ref|XP_010644433.1| PREDICTED: uncharacterized protein LOC100267545 isoform X2 [Vitis 
vinifera]
Length=468

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V SVM++W +M+P YAAN+WNEALNKRLGT+ L L EIL ETE+RG +FD+LLT
Sbjct  357  PLDAHVVASVMTVWNQMKPAYAANLWNEALNKRLGTQDLALPEILVETEKRGSSFDELLT  416

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFT  430
            IPEQD+WVY+DGKST+CVAFIL MYKE+G+FG  A SIQVTEFT
Sbjct  417  IPEQDDWVYTDGKSTSCVAFILEMYKEAGLFGPSASSIQVTEFT  460



>ref|XP_002888842.1| hypothetical protein ARALYDRAFT_895006 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65101.1| hypothetical protein ARALYDRAFT_895006 [Arabidopsis lyrata subsp. 
lyrata]
Length=97

 Score =   154 bits (390),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -1

Query  585  LTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLK  406
            ++FD+LLTIPEQDEWVYSD KST CVAFIL MYK +GVFG LA +IQVTEFTIRDAY  K
Sbjct  1    MSFDELLTIPEQDEWVYSDEKSTACVAFILEMYKAAGVFGPLANNIQVTEFTIRDAYTPK  60

Query  405  IYENNQTRLPSWCNSGNDKLPFCQIVGEYRMEL  307
            ++E+NQTRLPSWCN+  +KL FCQI+GEYRMEL
Sbjct  61   LFESNQTRLPSWCNTEEEKLDFCQILGEYRMEL  93



>ref|XP_001449176.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK81779.1| unnamed protein product [Paramecium tetraurelia]
Length=552

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 107/173 (62%), Gaps = 3/173 (2%)
 Frame = -1

Query  738  VDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTI  559
            + A L   + S   +  P+ +  M  EALNKRLGTEGL + EI  E  +RG+   +L  +
Sbjct  383  LSAELATYIFSFIEKFAPSISTKMVGEALNKRLGTEGLTIPEITIEAAKRGIEIAELYAM  442

Query  558  PEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRL  379
             E+DEW+YSDG S  C +F++ +YK +G+FG     I+ TEFT +D Y +  ++ +   +
Sbjct  443  VEKDEWIYSDGPSQVCSSFVIGLYKAAGLFGEY--HIEATEFTPKDVYQMNFFDKDYV-V  499

Query  378  PSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            P  C   +  LP+CQI+G +RMEL GYNT++PY +MNE CPS  P Y RP  C
Sbjct  500  PKKCKDNDPDLPYCQIMGTHRMELEGYNTIDPYEHMNERCPSQAPDYKRPADC  552



>ref|XP_001436259.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK68862.1| unnamed protein product [Paramecium tetraurelia]
Length=552

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 105/173 (61%), Gaps = 3/173 (2%)
 Frame = -1

Query  738  VDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTI  559
            + A L   + S   +  P+ +  M  E LNKRLGTEGL + EI  E  +RG+   +L  +
Sbjct  383  LSAELATYIFSFIEKFAPSISNKMVGEGLNKRLGTEGLTIPEITIEAAKRGIEIAELYAM  442

Query  558  PEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRL  379
             E+D W+YSDG S  C +F++ +YK +G+FG     I+ TEFT +D Y +  ++ N   +
Sbjct  443  VEKDNWIYSDGPSQVCSSFVIGLYKAAGLFGEY--HIEATEFTPKDVYQMNFFDKNYV-V  499

Query  378  PSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            P  C   +  LP+CQI+G +RMEL GYNT++PY +MNE CPS  P Y RP  C
Sbjct  500  PKKCKDNDPDLPYCQIMGTHRMELEGYNTIDPYEHMNERCPSQAPDYKRPADC  552



>ref|XP_001455162.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK87765.1| unnamed protein product [Paramecium tetraurelia]
Length=553

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 108/174 (62%), Gaps = 3/174 (2%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+ A     + S + ++ P    ++  EALNKRLGTEGL + E+  E  ++G+   +L  
Sbjct  383  PLSAEFATYMFSFFEKIAPGPITSLVGEALNKRLGTEGLSVSEVAIEAAKQGIELAELYA  442

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
            + E+DEWVYSDG S  C AF+  MYK +G+F      I+  EFT +D Y LK +++N   
Sbjct  443  MVERDEWVYSDGPSQACAAFVTGMYKAAGLFKPF--HIEALEFTPKDIYQLKFFDSN-YE  499

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            +P  C   +  LP+CQ++G +R+EL GYNT+EPY NMNE CPS+ P + RP  C
Sbjct  500  VPKKCKKNDPDLPYCQLMGTHRIELEGYNTVEPYENMNERCPSVAPEFIRPDGC  553



>ref|XP_010644430.1| PREDICTED: uncharacterized protein LOC100241838 isoform X5 [Vitis 
vinifera]
 ref|XP_010644431.1| PREDICTED: uncharacterized protein LOC100241838 isoform X5 [Vitis 
vinifera]
 ref|XP_010644432.1| PREDICTED: uncharacterized protein LOC100241838 isoform X5 [Vitis 
vinifera]
Length=467

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V + M++W +M P YAAN+WNEALNKRLGT+ L L EIL ETE RG +F +LLT
Sbjct  351  PLDAHVVAAGMTVWNQMWPAYAANLWNEALNKRLGTQNLSLPEILIETETRGSSFAELLT  410

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFT  430
            IPEQD+WVY+DGKST+CVAFIL MYKE+G+FG +A SIQ TEFT
Sbjct  411  IPEQDDWVYTDGKSTSCVAFILEMYKEAGLFGPIASSIQGTEFT  454



>ref|XP_010644429.1| PREDICTED: uncharacterized protein LOC100241838 isoform X4 [Vitis 
vinifera]
Length=505

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V + M++W +M P YAAN+WNEALNKRLGT+ L L EIL ETE RG +F +LLT
Sbjct  351  PLDAHVVAAGMTVWNQMWPAYAANLWNEALNKRLGTQNLSLPEILIETETRGSSFAELLT  410

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFT  430
            IPEQD+WVY+DGKST+CVAFIL MYKE+G+FG +A SIQ TEFT
Sbjct  411  IPEQDDWVYTDGKSTSCVAFILEMYKEAGLFGPIASSIQGTEFT  454



>gb|KCW66790.1| hypothetical protein EUGRSUZ_F00555 [Eucalyptus grandis]
Length=255

 Score =   147 bits (370),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DA +V SVM++W +MQP  A NMWNEALNK+LGT+GLDL +++ E E RG +F +LLT
Sbjct  147  PLDARVVASVMTVWNQMQPACAPNMWNEALNKQLGTKGLDLPDLIVEREMRGPSFAELLT  206

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTI  427
            IPEQD+WVY+DGKST+CVAF+L +YK +G+F  ++ SIQVT+FT+
Sbjct  207  IPEQDDWVYNDGKSTSCVAFVLEIYKAAGLFDPISSSIQVTKFTV  251



>gb|KCW67105.1| hypothetical protein EUGRSUZ_F00888 [Eucalyptus grandis]
Length=296

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 89/125 (71%), Gaps = 21/125 (17%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTE---------------------GL  625
            P+DAH+V SVM++W +MQP YAANMWNEALNKRLGTE                     GL
Sbjct  159  PLDAHVVASVMTVWNQMQPAYAANMWNEALNKRLGTELPSHSICNCLCDIMHLVLHTEGL  218

Query  624  DLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQ  445
            DL +++ ETE RG +F +LLTIP+QD+WVYSDGKST+CV F+L M K +G+F  ++ SIQ
Sbjct  219  DLLDLMVETEMRGSSFAELLTIPKQDDWVYSDGKSTSCVVFVLQMDKAAGLFDPISSSIQ  278

Query  444  VTEFT  430
            VTEFT
Sbjct  279  VTEFT  283



>ref|XP_004027177.1| hypothetical protein IMG5_188030 [Ichthyophthirius multifiliis]
 gb|EGR27832.1| hypothetical protein IMG5_188030 [Ichthyophthirius multifiliis]
Length=570

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 110/175 (63%), Gaps = 7/175 (4%)
 Frame = -1

Query  738  VDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTI  559
            +D + + SV S+  +  P        EALN+RL T+ L+L EI     +R +T  QL ++
Sbjct  401  LDINFLYSVFSLLEKFLPKLVNTFLGEALNQRLKTKDLNLGEIYTVMSQRNITLSQLFSM  460

Query  558  PEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRL  379
            PEQD W+YSDG+S  C +F+ A++K  G+F +L   I  TEFT RD Y    ++ N  + 
Sbjct  461  PEQDSWIYSDGQSMVCSSFVAAVWKAGGIFENL--EINATEFTPRDIYQTNFFDLNYKK-  517

Query  378  PSWCNSGNDKLPFCQIVGEYRMEL--PGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            P+ C   ND LP+CQI+G+++M++   GY+T++PY++MNE CPS+PP Y R   C
Sbjct  518  PAKC--LNDGLPYCQIMGKFKMDITSDGYSTIDPYSHMNEKCPSVPPLYSRTKGC  570



>gb|EJY77500.1| hypothetical protein OXYTRI_00869 [Oxytricha trifallax]
Length=566

 Score =   140 bits (353),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 105/174 (60%), Gaps = 7/174 (4%)
 Frame = -1

Query  726  LVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQD  547
            ++ +V S++  + P  A    N+ALNKRLGT GL++ EI  E   R LT D ++ +PE +
Sbjct  395  ILSNVFSIFETVMPEVADIFMNQALNKRLGTHGLNMAEIANEAALRNLTVDDVIAMPEIE  454

Query  546  EWVYS-----DGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
             W Y      DG+S  C  ++ A+YK +G+FG++  S    E T +D Y+LKIY++   +
Sbjct  455  GWEYEGIKPRDGRSYVCSTYLTAVYKAAGLFGNM--SFNPGEQTPKDLYLLKIYDDKPDQ  512

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
                C   +   P+CQ++G+YRM+ PGYNT+ PY NMNE CPS+ P Y R   C
Sbjct  513  RNKECLKYDPGQPYCQLLGKYRMKFPGYNTIVPYPNMNERCPSIAPEYERTDGC  566



>gb|EAR84506.2| hypothetical protein TTHERM_00655340 [Tetrahymena thermophila 
SB210]
Length=570

 Score =   140 bits (353),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 108/175 (62%), Gaps = 7/175 (4%)
 Frame = -1

Query  738  VDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTI  559
            +D + V S +++  +  P+   ++ NE LN RLGT+ L+L ++     ++ LT  ++  I
Sbjct  401  LDVNFVYSALTLVEKFYPSIPKSIINEGLNHRLGTQDLNLVQLYEVMYQKNLTIAEVFAI  460

Query  558  PEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRL  379
            PEQD W+YS G S  C AF+  +++  G+FG L   I V+EFT RD Y +K ++ N  + 
Sbjct  461  PEQDSWLYSYGHSLVCSAFVAGVWRAGGLFGDL--QINVSEFTPRDVYQMKFFDKNFKK-  517

Query  378  PSWCNSGNDKLPFCQIVGEYRMEL--PGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            P  C+   D LP+CQI+G++ M++   GYN++ PY +MNE+CPS PP Y R   C
Sbjct  518  PEKCHK--DGLPYCQIMGKFVMDVITDGYNSITPYEHMNEHCPSQPPFYLRTQGC  570



>ref|XP_001032169.1| hypothetical protein TTHERM_00655340 [Tetrahymena thermophila]
Length=583

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 108/175 (62%), Gaps = 7/175 (4%)
 Frame = -1

Query  738  VDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTI  559
            +D + V S +++  +  P+   ++ NE LN RLGT+ L+L ++     ++ LT  ++  I
Sbjct  414  LDVNFVYSALTLVEKFYPSIPKSIINEGLNHRLGTQDLNLVQLYEVMYQKNLTIAEVFAI  473

Query  558  PEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRL  379
            PEQD W+YS G S  C AF+  +++  G+FG L   I V+EFT RD Y +K ++ N  + 
Sbjct  474  PEQDSWLYSYGHSLVCSAFVAGVWRAGGLFGDL--QINVSEFTPRDVYQMKFFDKNFKK-  530

Query  378  PSWCNSGNDKLPFCQIVGEYRMEL--PGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            P  C+   D LP+CQI+G++ M++   GYN++ PY +MNE+CPS PP Y R   C
Sbjct  531  PEKCHK--DGLPYCQIMGKFVMDVITDGYNSITPYEHMNEHCPSQPPFYLRTQGC  583



>emb|CDW81161.1| UNKNOWN [Stylonychia lemnae]
Length=581

 Score =   137 bits (346),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 104/173 (60%), Gaps = 8/173 (5%)
 Frame = -1

Query  726  LVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQD  547
            LV  V S+  +  P+     +N+ALN RL T GL++  I AE  +R LT +QL+   E +
Sbjct  413  LVPVVFSVLEKFTPSTVDIFFNQALNHRLNTTGLNIEGIAAEAAQRNLTVEQLMAQVEVE  472

Query  546  EWVYS----DGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRL  379
             W Y+    DG++  C A++ A+Y+ +G+F      I   EFT RD Y L +Y+ N  R 
Sbjct  473  GWNYTGLQNDGRAYVCSAYVAALYQAAGLFPG---KINGPEFTPRDVYTLNVYDLNYNR-  528

Query  378  PSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
            P  C   +  LP+CQ++G+YRM LPGY+T+ PYA+M+E CP++ P + RP  C
Sbjct  529  PDACVKADPTLPYCQLLGKYRMTLPGYSTISPYAHMSEKCPTIAPDFVRPDKC  581



>ref|XP_004997585.1| hypothetical protein PTSG_01605 [Salpingoeca rosetta]
 gb|EGD78627.1| hypothetical protein PTSG_01605 [Salpingoeca rosetta]
Length=489

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 93/160 (58%), Gaps = 2/160 (1%)
 Frame = -1

Query  696  RMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVYSDGKST  517
            ++    AA MW  ALNKRLGT  L + E+      R ++F  L  +PEQD W Y DG S 
Sbjct  331  KVDADIAAMMWTMALNKRLGTANLTVAEVYDTAASRNISFTTLFAMPEQDSWQYVDGYSM  390

Query  516  TCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGNDKLPFC  337
             C   +   +K +G+ G+L + IQ TEFT  DAY L I+++   R P+ C + +  LPFC
Sbjct  391  VCDVLVCETWKAAGLMGALTDKIQCTEFTNWDAYTLNIFDSTTPR-PAACKAADPDLPFC  449

Query  336  QIVGEYRMELPGYNTLEPYANMNENCP-SLPPSYGRPIHC  220
            QI+G+YRM+LP YN+     +M E CP   PP + +P  C
Sbjct  450  QILGKYRMDLPFYNSRPMVPHMAERCPRGPPPHFPKPSGC  489



>ref|XP_001031695.1| hypothetical protein TTHERM_00760790 [Tetrahymena thermophila]
 gb|EAR84032.1| hypothetical protein TTHERM_00760790 [Tetrahymena thermophila 
SB210]
Length=570

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 105/175 (60%), Gaps = 7/175 (4%)
 Frame = -1

Query  738  VDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTI  559
            +D + V SV+++  +  P    ++  EA+NKRLGTE L+L ++     +R LT  ++  I
Sbjct  401  LDINFVYSVLTLIEKFIPAVPKSLVGEAMNKRLGTENLNLVQLYEVMFQRNLTVAEVFAI  460

Query  558  PEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRL  379
            PEQD W+YSDG S  C +F+ A++K  G+F  L   I  TEFT RD Y    ++    + 
Sbjct  461  PEQDSWIYSDGPSMVCSSFVAAIWKAGGLFDGL--EINATEFTPRDVYQTNFFDKKYKK-  517

Query  378  PSWCNSGNDKLPFCQIVGEYRMELP--GYNTLEPYANMNENCPSLPPSYGRPIHC  220
            P  C    D LP+CQI+G++ M++   GY+++ PY+NM E+CPS PP + R   C
Sbjct  518  PEKCLK--DGLPYCQIMGKFVMDVATDGYSSINPYSNMFEHCPSQPPLFLRTKGC  570



>ref|XP_004346245.1| hypothetical protein CAOG_05572 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE95080.1| hypothetical protein CAOG_005572 [Capsaspora owczarzaki ATCC 
30864]
Length=582

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 107/182 (59%), Gaps = 14/182 (8%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTR-MQPT----YAANMWNEALNKRLGTEGLDLYEILAETERRGLTF  577
            PVD H ++ ++S+    ++P     +  ++WN A N+RLGT      EI A      ++F
Sbjct  394  PVDQHYLVVMLSLLDPILEPLLVELHTPSLWNVAFNRRLGTAYTRCVEIFAHAAAHNVSF  453

Query  576  DQLLTIPEQDEWVYS-------DGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDA  418
             QL+++PEQD W+Y+       DG +  C  F+   YK  G+FG+L +SI   EFT  D 
Sbjct  454  GQLISMPEQDWWIYAGHEPWYPDGIAMVCDVFVCYTYKAGGLFGNLTDSINCAEFTPLDV  513

Query  417  YMLKIYENNQTRLPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSY  238
            Y L  ++     +P+ C + +    +CQI+G+YR++LP +NT++P+A+M ENCPS+PP  
Sbjct  514  YELAWFDT--APIPAKCQAADPGNKWCQILGKYRIQLPEFNTVQPFAHMRENCPSMPPYA  571

Query  237  GR  232
             R
Sbjct  572  DR  573



>emb|CDW76296.1| UNKNOWN [Stylonychia lemnae]
Length=589

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 95/174 (55%), Gaps = 7/174 (4%)
 Frame = -1

Query  726  LVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQD  547
            ++ +  S+   + P       N+ALNKRLGT+GL L +I  E  +R LT D ++ +PE D
Sbjct  418  MLANTFSLVETISPEVVDIFMNQALNKRLGTKGLTLSQISVEAAKRNLTLDDVIAMPELD  477

Query  546  EWVY-----SDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTR  382
             W Y      DG+S  C  ++ A+ K +GVFG +       E T RD Y L I+E   T 
Sbjct  478  GWEYEGLEPKDGRSYVCSTYVTAVMKAAGVFGDMI--FNPGEQTPRDMYQLTIFETTSTW  535

Query  381  LPSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
                C       P+CQI+G Y+M  PG++T++PY +MNE CPS+ P Y R   C
Sbjct  536  RSKKCQETEPNTPWCQILGAYKMSFPGFSTVKPYPHMNERCPSIAPKYERTEGC  589



>ref|XP_010064383.1| PREDICTED: uncharacterized protein LOC104451423 [Eucalyptus grandis]
Length=207

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -1

Query  741  PVDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLT  562
            P+DAH+V S+M++W +MQP YAANM NEALNKRLGTEGLDL +++ ET+ RG +F +LLT
Sbjct  109  PLDAHVVASIMTVWNQMQPAYAANMGNEALNKRLGTEGLDLPDVIVETKMRGSSFAELLT  168

Query  561  IPEQDEWVYSDGKSTTCVAFILAMYKE  481
            I EQD+WVYSDGKS +CVA  L   K+
Sbjct  169  ILEQDDWVYSDGKSASCVALFLKYTKQ  195



>ref|XP_001749148.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ85954.1| predicted protein [Monosiga brevicollis MX1]
Length=543

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 95/174 (55%), Gaps = 5/174 (3%)
 Frame = -1

Query  738  VDAHLVISVMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTI  559
            +D+HL   ++     +    +  +W+ ALNKRL T  +    +L     R ++F +L+ +
Sbjct  374  LDSHLHELLIGFANAISYELSGLLWDRALNKRLNTVNMTTVPLLNLAHSRNISFTELMEM  433

Query  558  PEQDEWVYSDGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRL  379
            PEQDEW Y DG +  C   +   +K  G+FG L    Q TEFT  D Y L I+  N T  
Sbjct  434  PEQDEWQYDDGYNMVCDVLVCEAWKAGGLFGDL--DFQCTEFTNWDDYTLAIF--NTTAP  489

Query  378  PSWCNSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCP-SLPPSYGRPIHC  220
            P++C   +  LPFCQI+G+YRM LP YN+    A+M E CP   PP + +P  C
Sbjct  490  PAYCQQIDPGLPFCQILGDYRMSLPTYNSRPMVAHMAERCPRGTPPDFDKPAGC  543



>gb|KDO49372.1| hypothetical protein CISIN_1g038412mg [Citrus sinensis]
Length=106

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -1

Query  513  CVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWCNSGND-KLPFC  337
            CV F+L MYKE+G+F  +A SI+ TEFT++DAY+++ +ENN +RLP WCN  +  KLP C
Sbjct  16   CVPFVLEMYKEAGLFDPIASSIRATEFTVKDAYLVRFFENNSSRLPKWCNDADTVKLPNC  75

Query  336  QIVGEYRMELPGYNTLEPYANMNE  265
            QI G+YR+ELP YN L+PY NMNE
Sbjct  76   QIRGKYRLELPVYNVLDPYPNMNE  99



>gb|EJY88389.1| hypothetical protein OXYTRI_16548 [Oxytricha trifallax]
Length=589

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/169 (40%), Positives = 103/169 (61%), Gaps = 7/169 (4%)
 Frame = -1

Query  714  VMSMWTRMQPTYAANMWNEALNKRLGTEGLDLYEILAETERRGLTFDQLLTIPEQDEWVY  535
            V S+     P+      N+ LNKRLGT GL+L +I AE   R LT + L++  E + W Y
Sbjct  424  VFSILEGFTPSTVDIFLNQGLNKRLGTSGLNLKQIAAEAATRNLTIEDLMSQVEVEGWEY  483

Query  534  S----DGKSTTCVAFILAMYKESGVFGSLAESIQVTEFTIRDAYMLKIYENNQTRLPSWC  367
            +    DGKS  C A++ A+Y+ +G+FG+   +I   EFT +D Y L  ++ +  + P+ C
Sbjct  484  TGLPNDGKSYVCSAYVAAVYRAAGMFGNF--TINGPEFTPKDVYTLAFFDLDYKK-PAVC  540

Query  366  NSGNDKLPFCQIVGEYRMELPGYNTLEPYANMNENCPSLPPSYGRPIHC  220
               +   PFCQ +G+YRME PGY+T+ PY +M+E+CP++ P + RP +C
Sbjct  541  AQADPDQPFCQFLGKYRMEFPGYSTIVPYDHMDEHCPTIAPEFDRPANC  589



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1347639082210