BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF010M19

Length=704
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008360906.1|  PREDICTED: uncharacterized protein LOC103424589    239   8e-75   
gb|KDO58106.1|  hypothetical protein CISIN_1g0053622mg                  234   2e-74   Citrus sinensis [apfelsine]
ref|XP_009783888.1|  PREDICTED: protein transport protein SEC24         249   1e-73   Nicotiana sylvestris
gb|KDO58105.1|  hypothetical protein CISIN_1g0053622mg                  233   6e-73   Citrus sinensis [apfelsine]
ref|XP_009605315.1|  PREDICTED: protein transport protein Sec24B        247   7e-73   Nicotiana tomentosiformis
ref|XP_006362886.1|  PREDICTED: protein transport protein sec24-like    246   8e-73   Solanum tuberosum [potatoes]
gb|KGN64934.1|  hypothetical protein Csa_1G164680                       232   3e-71   Cucumis sativus [cucumbers]
ref|XP_004251061.1|  PREDICTED: protein transport protein SEC24         242   4e-71   Solanum lycopersicum
emb|CDP06905.1|  unnamed protein product                                241   9e-71   Coffea canephora [robusta coffee]
gb|KDP24980.1|  hypothetical protein JCGZ_24318                         239   2e-70   Jatropha curcas
ref|XP_009346558.1|  PREDICTED: protein transport protein sec24-like    240   2e-70   Pyrus x bretschneideri [bai li]
ref|XP_009339600.1|  PREDICTED: protein transport protein sec24-like    240   2e-70   Pyrus x bretschneideri [bai li]
ref|XP_007015799.1|  Sec23/sec24 transport family protein isoform 1     239   6e-70   
gb|KJB21716.1|  hypothetical protein B456_004G010100                    238   1e-69   Gossypium raimondii
gb|KHG08020.1|  transport protein sec24-1                               238   1e-69   Gossypium arboreum [tree cotton]
ref|XP_010685999.1|  PREDICTED: protein transport protein sec24         238   1e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010927800.1|  PREDICTED: protein transport protein sec24-like    237   2e-69   Elaeis guineensis
gb|KHN21153.1|  Protein transport protein SEC24-1                       237   4e-69   Glycine soja [wild soybean]
ref|XP_003539835.1|  PREDICTED: protein transport protein Sec24-l...    237   4e-69   Glycine max [soybeans]
gb|KHN38627.1|  Protein transport protein Sec24-like                    237   4e-69   Glycine soja [wild soybean]
ref|XP_002275292.1|  PREDICTED: protein transport protein Sec24-l...    236   6e-69   Vitis vinifera
ref|XP_007208430.1|  hypothetical protein PRUPE_ppa001892mg             236   7e-69   Prunus persica
ref|XP_008228686.1|  PREDICTED: protein transport protein SEC24 i...    236   7e-69   Prunus mume [ume]
ref|XP_002313596.1|  hypothetical protein POPTR_0009s16480g             236   9e-69   Populus trichocarpa [western balsam poplar]
ref|XP_004291596.2|  PREDICTED: protein transport protein Sec24-l...    235   2e-68   Fragaria vesca subsp. vesca
ref|XP_003538113.1|  PREDICTED: protein transport protein Sec24-l...    234   3e-68   Glycine max [soybeans]
ref|XP_006591072.1|  PREDICTED: protein transport protein Sec24-l...    234   3e-68   
ref|XP_006487894.1|  PREDICTED: protein transport protein Sec24-l...    233   7e-68   Citrus sinensis [apfelsine]
ref|XP_006424228.1|  hypothetical protein CICLE_v10027862mg             233   7e-68   Citrus clementina [clementine]
ref|XP_006487893.1|  PREDICTED: protein transport protein Sec24-l...    233   9e-68   Citrus sinensis [apfelsine]
ref|XP_004517292.1|  PREDICTED: protein transport protein SEC24-l...    233   1e-67   Cicer arietinum [garbanzo]
ref|XP_006424227.1|  hypothetical protein CICLE_v10027862mg             233   1e-67   Citrus clementina [clementine]
ref|XP_007132444.1|  hypothetical protein PHAVU_011G094800g             233   1e-67   Phaseolus vulgaris [French bean]
ref|XP_004517293.1|  PREDICTED: protein transport protein SEC24-l...    233   1e-67   
ref|XP_004517291.1|  PREDICTED: protein transport protein SEC24-l...    233   1e-67   Cicer arietinum [garbanzo]
ref|XP_002523817.1|  expressed protein, putative                        233   1e-67   
gb|KFK36699.1|  hypothetical protein AALP_AA4G157700                    232   2e-67   Arabis alpina [alpine rockcress]
ref|XP_006409731.1|  hypothetical protein EUTSA_v10016271mg             233   3e-67   
ref|XP_008788954.1|  PREDICTED: protein transport protein Sec24-l...    232   3e-67   Phoenix dactylifera
ref|XP_004139490.1|  PREDICTED: protein transport protein SEC24-1...    231   7e-67   Cucumis sativus [cucumbers]
ref|XP_008461390.1|  PREDICTED: protein transport protein SEC24         231   7e-67   Cucumis melo [Oriental melon]
ref|XP_011015487.1|  PREDICTED: protein transport protein SEC24-like    229   1e-66   Populus euphratica
ref|XP_010089815.1|  Protein transport protein SEC24-1                  229   2e-66   Morus notabilis
gb|KEH29852.1|  Sec23/Sec24 transport family protein                    229   2e-66   Medicago truncatula
ref|XP_010245214.1|  PREDICTED: protein transport protein Sec24-l...    229   3e-66   Nelumbo nucifera [Indian lotus]
ref|XP_011043111.1|  PREDICTED: protein transport protein SEC24         229   4e-66   Populus euphratica
ref|XP_006384797.1|  sec23/sec24 transport family protein               229   4e-66   Populus trichocarpa [western balsam poplar]
ref|XP_010045202.1|  PREDICTED: protein transport protein Sec24-l...    226   4e-65   Eucalyptus grandis [rose gum]
gb|EYU36066.1|  hypothetical protein MIMGU_mgv1a001880mg                225   9e-65   Erythranthe guttata [common monkey flower]
ref|XP_009103601.1|  PREDICTED: protein transport protein SEC24 i...    224   1e-64   Brassica rapa
ref|XP_009103600.1|  PREDICTED: protein transport protein SEC24 i...    224   1e-64   Brassica rapa
ref|XP_011090338.1|  PREDICTED: protein transport protein SEC24         224   2e-64   Sesamum indicum [beniseed]
ref|XP_010417884.1|  PREDICTED: protein transport protein sec24-like    223   4e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010497331.1|  PREDICTED: uncharacterized protein LOC104774419    206   9e-64   Camelina sativa [gold-of-pleasure]
emb|CDX71451.1|  BnaC04g16860D                                          222   1e-63   
ref|XP_010473124.1|  PREDICTED: protein transport protein sec24-like    222   1e-63   Camelina sativa [gold-of-pleasure]
ref|NP_565651.1|  sec23/sec24 transport family protein                  221   2e-63   Arabidopsis thaliana [mouse-ear cress]
emb|CDY04496.1|  BnaA07g13220D                                          221   3e-63   
gb|ADE77470.1|  unknown                                                 213   4e-63   Picea sitchensis
ref|XP_002879090.1|  sec23/sec24 transport family protein               219   1e-62   
ref|XP_006293742.1|  hypothetical protein CARUB_v10022704mg             218   2e-62   Capsella rubella
ref|XP_010542559.1|  PREDICTED: protein transport protein SEC24-l...    218   3e-62   Tarenaya hassleriana [spider flower]
ref|XP_010542560.1|  PREDICTED: protein transport protein SEC24-l...    218   3e-62   Tarenaya hassleriana [spider flower]
emb|CDX77118.1|  BnaC04g39130D                                          218   3e-62   
emb|CDY30546.1|  BnaA04g15870D                                          217   6e-62   Brassica napus [oilseed rape]
ref|XP_009140802.1|  PREDICTED: protein transport protein SEC24-like    217   6e-62   Brassica rapa
ref|XP_006855085.1|  hypothetical protein AMTR_s00031p00165880          217   7e-62   Amborella trichopoda
ref|XP_010510770.1|  PREDICTED: protein transport protein sec24         216   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_009404358.1|  PREDICTED: protein transport protein sec24-like    212   5e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009411948.1|  PREDICTED: protein transport protein SEC23-like    209   4e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008787674.1|  PREDICTED: protein transport protein sec24-like    206   5e-58   Phoenix dactylifera
ref|XP_010931128.1|  PREDICTED: protein transport protein SEC24-l...    206   7e-58   Elaeis guineensis
ref|XP_010931127.1|  PREDICTED: protein transport protein SEC24-l...    206   8e-58   Elaeis guineensis
gb|EMS61482.1|  Protein transport protein Sec24C                        199   1e-55   Triticum urartu
dbj|BAJ97505.1|  predicted protein                                      198   1e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB55613.1|  hypothetical protein B456_009G085000                    199   1e-55   Gossypium raimondii
gb|EMT05114.1|  Protein transport protein SEC24                         200   2e-55   
dbj|BAJ95494.1|  predicted protein                                      198   5e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004961931.1|  PREDICTED: uncharacterized protein C4.03c-like     196   2e-54   Setaria italica
emb|CAN62128.1|  hypothetical protein VITISV_037581                     195   5e-54   Vitis vinifera
ref|XP_008647340.1|  PREDICTED: uncharacterized protein LOC100192...    193   3e-53   
ref|XP_002441179.1|  hypothetical protein SORBIDRAFT_09g021790          192   9e-53   Sorghum bicolor [broomcorn]
ref|XP_006655364.1|  PREDICTED: protein transport protein SEC24-like    191   1e-52   
gb|AAT69610.1|  unknown protein                                         187   5e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001757713.1|  predicted protein                                  189   9e-52   
gb|EAY98220.1|  hypothetical protein OsI_20132                          188   2e-51   Oryza sativa Indica Group [Indian rice]
gb|EEE63885.1|  hypothetical protein OsJ_18710                          187   3e-51   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001055673.1|  Os05g0443300                                       187   3e-51   
gb|AFW81781.1|  hypothetical protein ZEAMMB73_245204                    186   6e-51   
ref|NP_001170139.1|  uncharacterized protein LOC100384066               186   6e-51   Zea mays [maize]
ref|XP_003568355.1|  PREDICTED: protein transport protein sec24         186   1e-50   Brachypodium distachyon [annual false brome]
ref|XP_002968253.1|  hypothetical protein SELMODRAFT_440407             183   1e-49   Selaginella moellendorffii
ref|XP_002976124.1|  hypothetical protein SELMODRAFT_104389             183   1e-49   
ref|XP_010557420.1|  PREDICTED: protein transport protein SEC23         181   4e-49   Tarenaya hassleriana [spider flower]
ref|XP_001777420.1|  predicted protein                                  179   2e-48   
gb|EPS57992.1|  hypothetical protein M569_16825                         166   5e-48   Genlisea aurea
ref|XP_001777387.1|  predicted protein                                  160   2e-43   
ref|NP_001131363.1|  uncharacterized protein LOC100192686               144   9e-40   
ref|XP_002489113.1|  hypothetical protein SORBIDRAFT_0067s002270        142   1e-37   
gb|EEC77245.1|  hypothetical protein OsI_15817                          145   5e-36   Oryza sativa Indica Group [Indian rice]
gb|EEE60965.1|  hypothetical protein OsJ_14735                          145   5e-36   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001052744.1|  Os04g0412900                                       145   5e-36   
emb|CAH67359.1|  OSIGBa0134P10.5                                        145   5e-36   Oryza sativa [red rice]
dbj|BAK03991.1|  predicted protein                                      142   5e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004975570.1|  PREDICTED: protein transport protein Sec24C-...    141   1e-34   Setaria italica
ref|XP_008663179.1|  PREDICTED: protein transport protein SEC24-like    139   6e-34   Zea mays [maize]
gb|EMT28162.1|  Protein transport protein Sec24B                        139   7e-34   
ref|XP_003579703.1|  PREDICTED: protein transport protein SEC24-like    135   1e-32   Brachypodium distachyon [annual false brome]
gb|EMS67454.1|  Protein transport protein Sec24A                        134   6e-32   Triticum urartu
ref|XP_005650920.1|  vWA-like protein                                   122   9e-28   Coccomyxa subellipsoidea C-169
gb|KDO58107.1|  hypothetical protein CISIN_1g0053622mg                  115   1e-27   Citrus sinensis [apfelsine]
gb|KJB21718.1|  hypothetical protein B456_004G010100                    121   1e-27   Gossypium raimondii
ref|XP_002501401.1|  predicted protein                                  103   2e-21   Micromonas commoda
dbj|GAM18106.1|  hypothetical protein SAMD00019534_012810             90.1    7e-17   Acytostelium subglobosum LB1
ref|XP_002947745.1|  hypothetical protein VOLCADRAFT_87927            86.3    1e-15   Volvox carteri f. nagariensis
gb|AFW58189.1|  hypothetical protein ZEAMMB73_262773                  85.5    2e-15   
ref|XP_003058885.1|  predicted protein                                83.2    1e-14   Micromonas pusilla CCMP1545
ref|XP_646591.1|  hypothetical protein DDB_G0271044                   77.4    1e-12   Dictyostelium discoideum AX4
ref|XP_004350752.1|  hypothetical protein DFA_11807                   76.3    2e-12   Cavenderia fasciculata
ref|XP_003284541.1|  hypothetical protein DICPUDRAFT_96735            75.9    3e-12   Dictyostelium purpureum
ref|XP_005844187.1|  hypothetical protein CHLNCDRAFT_139348           74.3    1e-11   Chlorella variabilis
ref|XP_005713593.1|  unnamed protein product                          67.4    1e-09   Chondrus crispus [carageen]
gb|KFK32560.1|  hypothetical protein AALP_AA6G258900                  61.6    2e-09   Arabis alpina [alpine rockcress]
ref|XP_001694580.1|  COP-II coat subunit                              64.3    2e-08   Chlamydomonas reinhardtii
ref|XP_005839653.1|  secretory protein Sec24B                         64.3    2e-08   Guillardia theta CCMP2712
emb|CBN75666.1|  conserved unknown protein                            52.4    2e-04   Ectocarpus siliculosus



>ref|XP_008360906.1| PREDICTED: uncharacterized protein LOC103424589 [Malus domestica]
Length=257

 Score =   239 bits (609),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H A+YP+LTSY++PDKQAYPRHS SRAALITSGSPIFFLDAFT+LIVFYSST  PSLPFP
Sbjct  121  HRAVYPVLTSYSTPDKQAYPRHSXSRAALITSGSPIFFLDAFTSLIVFYSSTADPSLPFP  180

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PP DCLLRT IN LK+ERCI+PKL+FIR GQDDATPFEN+LIEEQDV+G+G TS+MGFVS
Sbjct  181  PPHDCLLRTVINNLKKERCITPKLIFIRGGQDDATPFENYLIEEQDVDGSGITSVMGFVS  240

Query  343  FLEEIHQSVLEYMK  302
            FLE++ QSVLEYMK
Sbjct  241  FLEDVTQSVLEYMK  254



>gb|KDO58106.1| hypothetical protein CISIN_1g0053622mg, partial [Citrus sinensis]
Length=141

 Score =   234 bits (597),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            A+YP+LTSY++PDKQA+PRHSLSRAALITSGSPIF LDAFT +IVFYSST  P+LPFPPP
Sbjct  10   AVYPLLTSYSTPDKQAFPRHSLSRAALITSGSPIFLLDAFTTIIVFYSSTADPTLPFPPP  69

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            QDCLLRTTINK+KQER I+PKL+FIR GQDDAT FEN+LIEEQDV+G+G TS+MGFVSFL
Sbjct  70   QDCLLRTTINKMKQERSITPKLIFIRGGQDDATIFENYLIEEQDVDGSGLTSVMGFVSFL  129

Query  337  EEIHQSVLEYMK  302
            EEI QSV+EYMK
Sbjct  130  EEISQSVVEYMK  141



>ref|XP_009783888.1| PREDICTED: protein transport protein SEC24 [Nicotiana sylvestris]
Length=742

 Score =   249 bits (635),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AIYP+LTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFY+ST  PSLPFPPP
Sbjct  611  AIYPLLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYASTADPSLPFPPP  670

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            QDCLLRTTINKLKQ+RCI+PKL FI+ GQDDAT FEN+LIEEQDVEG+GFTSIMGFVSFL
Sbjct  671  QDCLLRTTINKLKQDRCITPKLTFIKGGQDDATSFENYLIEEQDVEGSGFTSIMGFVSFL  730

Query  337  EEIHQSVLEYMK  302
            EEI+QS LEYMK
Sbjct  731  EEINQSTLEYMK  742



>gb|KDO58105.1| hypothetical protein CISIN_1g0053622mg, partial [Citrus sinensis]
Length=234

 Score =   233 bits (595),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            A+YP+LTSY++PDKQA+PRHSLSRAALITSGSPIF LDAFT +IVFYSST  P+LPFPPP
Sbjct  103  AVYPLLTSYSTPDKQAFPRHSLSRAALITSGSPIFLLDAFTTIIVFYSSTADPTLPFPPP  162

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            QDCLLRTTINK+KQER I+PKL+FIR GQDDAT FEN+LIEEQDV+G+G TS+MGFVSFL
Sbjct  163  QDCLLRTTINKMKQERSITPKLIFIRGGQDDATIFENYLIEEQDVDGSGLTSVMGFVSFL  222

Query  337  EEIHQSVLEYMK  302
            EEI QSV+EYMK
Sbjct  223  EEISQSVVEYMK  234



>ref|XP_009605315.1| PREDICTED: protein transport protein Sec24B [Nicotiana tomentosiformis]
Length=742

 Score =   247 bits (630),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AIYP+LTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFY+ST  PSLP+PPP
Sbjct  611  AIYPLLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYASTADPSLPYPPP  670

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            QDCLLRTTINKLKQERCI+PKL FI+ GQDD T FEN+LIEEQDVEG+GFTS+MGFVSFL
Sbjct  671  QDCLLRTTINKLKQERCITPKLTFIKGGQDDTTSFENYLIEEQDVEGSGFTSVMGFVSFL  730

Query  337  EEIHQSVLEYMK  302
            EEI+QS LEYMK
Sbjct  731  EEINQSTLEYMK  742



>ref|XP_006362886.1| PREDICTED: protein transport protein sec24-like [Solanum tuberosum]
Length=742

 Score =   246 bits (629),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            A+YP+LTSYASPD QAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSST  PSLPFPPP
Sbjct  611  AVYPLLTSYASPDTQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTADPSLPFPPP  670

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            QDCLLRTTINKLKQERCI+PKL FI+ GQDDAT FEN+LIEEQDVEG+GFTS+MGFVSFL
Sbjct  671  QDCLLRTTINKLKQERCITPKLSFIKGGQDDATAFENYLIEEQDVEGSGFTSVMGFVSFL  730

Query  337  EEIHQSVLEYMK  302
            EEI+QS LEY+K
Sbjct  731  EEINQSTLEYLK  742



>gb|KGN64934.1| hypothetical protein Csa_1G164680 [Cucumis sativus]
Length=311

 Score =   232 bits (591),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H A+YP+LTSY++PD QAYPRHSLSRAALITSGSPIFFLDAFT LIVFYSST   +LPFP
Sbjct  178  HCAVYPVLTSYSTPDIQAYPRHSLSRAALITSGSPIFFLDAFTTLIVFYSSTADATLPFP  237

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PPQDCLLR+TIN+LK++RCI+P+L+FIR GQDDAT FEN+LIEEQDV+G+G TS+MGFVS
Sbjct  238  PPQDCLLRSTINELKKDRCITPRLIFIRGGQDDATAFENYLIEEQDVDGSGLTSVMGFVS  297

Query  343  FLEEIHQSVLEYMK  302
            FLE++ QSVLEY+K
Sbjct  298  FLEDVKQSVLEYLK  311



>ref|XP_004251061.1| PREDICTED: protein transport protein SEC24 [Solanum lycopersicum]
Length=742

 Score =   242 bits (618),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            A+YP+LTSYASPDKQAYPRHSLSRAALITSGS IFFLDAFTNLIVFY+ST  PSLPFPPP
Sbjct  611  AVYPLLTSYASPDKQAYPRHSLSRAALITSGSSIFFLDAFTNLIVFYASTAEPSLPFPPP  670

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            QDCLLRTTINKLKQERCI+P+L FI+ GQDDAT FEN+LIEEQDVEG+GFTS+MGFVSFL
Sbjct  671  QDCLLRTTINKLKQERCITPRLSFIKGGQDDATAFENYLIEEQDVEGSGFTSVMGFVSFL  730

Query  337  EEIHQSVLEYMK  302
            +EI+QS LEY+K
Sbjct  731  DEINQSTLEYLK  742



>emb|CDP06905.1| unnamed protein product [Coffea canephora]
Length=742

 Score =   241 bits (615),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H AIYP+LTS+A+PDKQA+PRHSLSRAALITSGSPIFFLDAFT LIVFYSST  P+LPFP
Sbjct  609  HRAIYPILTSFATPDKQAFPRHSLSRAALITSGSPIFFLDAFTTLIVFYSSTADPALPFP  668

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PPQDCLLRTTINKLKQERCI+P LMFIR GQDD+T FEN+LIEEQDVEG+GFTS+MGFVS
Sbjct  669  PPQDCLLRTTINKLKQERCITPTLMFIRGGQDDSTIFENYLIEEQDVEGSGFTSVMGFVS  728

Query  343  FLEEIHQSVLEYMK  302
            FLEEI+  VLEY+K
Sbjct  729  FLEEINHGVLEYLK  742



>gb|KDP24980.1| hypothetical protein JCGZ_24318 [Jatropha curcas]
Length=677

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H AIYP+L SY++PDKQAYPRHSLSRAALITSGSPIFFLDAFT LIVFYSST  PSLPFP
Sbjct  544  HHAIYPVLMSYSTPDKQAYPRHSLSRAALITSGSPIFFLDAFTTLIVFYSSTADPSLPFP  603

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PP DCLLR+TINKLKQ+RCI+PKL+FIR GQDDA+ FEN+LIEEQDV+G GFTS+MGFVS
Sbjct  604  PPHDCLLRSTINKLKQDRCITPKLIFIRGGQDDASVFENYLIEEQDVDGQGFTSVMGFVS  663

Query  343  FLEEIHQSVLEYMK  302
            FLE+I QSVLEYMK
Sbjct  664  FLEDITQSVLEYMK  677



>ref|XP_009346558.1| PREDICTED: protein transport protein sec24-like [Pyrus x bretschneideri]
Length=746

 Score =   240 bits (613),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H A+YP+LTSY++PDKQAYPRHSLSRAALITSGSPIFFLDAFT LIVFYSST  PSLPFP
Sbjct  610  HRAVYPVLTSYSTPDKQAYPRHSLSRAALITSGSPIFFLDAFTALIVFYSSTADPSLPFP  669

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PP DCLLRT IN LK+ERCI+PKL+FIR GQDDATPFEN+LIEEQDV+G+G TS+MGFVS
Sbjct  670  PPHDCLLRTVINNLKKERCITPKLLFIRGGQDDATPFENYLIEEQDVDGSGITSVMGFVS  729

Query  343  FLEEIHQSVLEYMK  302
            FLE++ QSVLEYMK
Sbjct  730  FLEDVTQSVLEYMK  743



>ref|XP_009339600.1| PREDICTED: protein transport protein sec24-like [Pyrus x bretschneideri]
Length=746

 Score =   240 bits (613),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H A+YP+LTSY++PDKQAYPRHSLSRAALITSGSPIFFLDAFT LIVFYSST  PSLPFP
Sbjct  610  HRAVYPVLTSYSTPDKQAYPRHSLSRAALITSGSPIFFLDAFTALIVFYSSTADPSLPFP  669

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PP DCLLRT IN LK+ERCI+PKL+FIR GQDDATPFEN+LIEEQDV+G+G TS+MGFVS
Sbjct  670  PPHDCLLRTVINNLKKERCITPKLLFIRGGQDDATPFENYLIEEQDVDGSGITSVMGFVS  729

Query  343  FLEEIHQSVLEYMK  302
            FLE++ QSVLEYMK
Sbjct  730  FLEDVTQSVLEYMK  743



>ref|XP_007015799.1| Sec23/sec24 transport family protein isoform 1 [Theobroma cacao]
 gb|EOY33418.1| Sec23/sec24 transport family protein isoform 1 [Theobroma cacao]
Length=745

 Score =   239 bits (609),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H AIYP+LTSY++PDKQAYPRHSLSRAALITSGSPIFFLDAFT LIVFYSST  PSLPFP
Sbjct  612  HHAIYPVLTSYSTPDKQAYPRHSLSRAALITSGSPIFFLDAFTTLIVFYSSTADPSLPFP  671

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PPQDCLLR TINKLKQ+RCI+PKL+FI+ GQDDAT FEN+LIEEQDV+G+G TS+MGFVS
Sbjct  672  PPQDCLLRATINKLKQDRCITPKLLFIQGGQDDATAFENYLIEEQDVDGSGLTSVMGFVS  731

Query  343  FLEEIHQSVLEYMK  302
            FLE+I QSVLEY+K
Sbjct  732  FLEDITQSVLEYIK  745



>gb|KJB21716.1| hypothetical protein B456_004G010100 [Gossypium raimondii]
Length=746

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H AIYP+LTSY++PDKQAYPRHSLSRAALITSGSPIFFLDA+T LIVFYSST  PSLPFP
Sbjct  613  HRAIYPVLTSYSTPDKQAYPRHSLSRAALITSGSPIFFLDAYTTLIVFYSSTADPSLPFP  672

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PP DCLLR+TINKLKQERCI+PKL+FIR GQDDA+ FEN+LIEEQDV G G TS+MGFVS
Sbjct  673  PPHDCLLRSTINKLKQERCITPKLIFIRGGQDDASVFENYLIEEQDVNGTGLTSVMGFVS  732

Query  343  FLEEIHQSVLEYMK  302
            FLE+I QSVLEYMK
Sbjct  733  FLEDITQSVLEYMK  746



>gb|KHG08020.1| transport protein sec24-1 [Gossypium arboreum]
Length=746

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H AIYP+LTSY++PDKQAYPRHSLSRAALITSGSPIFFLDA+T LIVFYSST  PSLPFP
Sbjct  613  HRAIYPVLTSYSTPDKQAYPRHSLSRAALITSGSPIFFLDAYTTLIVFYSSTADPSLPFP  672

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PP DCLLR+TINKLKQERCI+PKL+FIR GQDDA+ FEN+LIEEQDV G G TS+MGFVS
Sbjct  673  PPHDCLLRSTINKLKQERCITPKLIFIRGGQDDASVFENYLIEEQDVNGTGLTSVMGFVS  732

Query  343  FLEEIHQSVLEYMK  302
            FLE+I QSVLEYMK
Sbjct  733  FLEDITQSVLEYMK  746



>ref|XP_010685999.1| PREDICTED: protein transport protein sec24 [Beta vulgaris subsp. 
vulgaris]
Length=745

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H A+YP+LTSY +PDKQAYPRHSLSRAALITSGSPIF LDAFT LIVFYSST  P+LPFP
Sbjct  612  HRAVYPVLTSYTTPDKQAYPRHSLSRAALITSGSPIFLLDAFTTLIVFYSSTADPALPFP  671

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PP DC LRTTINKLKQER I+PKL+FIR GQDDAT FENFLIEEQDVEG+GFTS+MGFVS
Sbjct  672  PPHDCSLRTTINKLKQERSITPKLLFIRGGQDDATAFENFLIEEQDVEGSGFTSVMGFVS  731

Query  343  FLEEIHQSVLEYMK  302
            FLE+I++SVLEYMK
Sbjct  732  FLEDINRSVLEYMK  745



>ref|XP_010927800.1| PREDICTED: protein transport protein sec24-like [Elaeis guineensis]
 ref|XP_010927801.1| PREDICTED: protein transport protein sec24-like [Elaeis guineensis]
Length=737

 Score =   237 bits (605),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H AIYP+LTSYA+PDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIV+YSST  PSLPFP
Sbjct  604  HRAIYPVLTSYATPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVYYSSTADPSLPFP  663

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PP DCLLRTTINKLKQERCI+PKL FIR GQDDAT FEN+LIEEQDV+G G +S+ GFVS
Sbjct  664  PPHDCLLRTTINKLKQERCITPKLTFIRGGQDDATVFENYLIEEQDVDGTGISSVTGFVS  723

Query  343  FLEEIHQSVLEYMK  302
            FLEEI Q V EY+K
Sbjct  724  FLEEITQDVAEYLK  737



>gb|KHN21153.1| Protein transport protein SEC24-1 [Glycine soja]
Length=747

 Score =   237 bits (604),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H A+YP+LTSYA+PDKQAYPRHSLSRAALITSGSPIFFLDAFT LIVFYSST  P+LPFP
Sbjct  614  HRAVYPVLTSYATPDKQAYPRHSLSRAALITSGSPIFFLDAFTILIVFYSSTADPTLPFP  673

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PP DCLLRTTINKLKQERCI+PKL+FIR G DDA+ FENFLIEEQDV+G+G TS+MGFVS
Sbjct  674  PPHDCLLRTTINKLKQERCITPKLIFIRGGHDDASIFENFLIEEQDVDGSGLTSVMGFVS  733

Query  343  FLEEIHQSVLEYMK  302
            FLE+I Q VLE+MK
Sbjct  734  FLEDITQKVLEFMK  747



>ref|XP_003539835.1| PREDICTED: protein transport protein Sec24-like At3g07100-like 
[Glycine max]
Length=747

 Score =   237 bits (604),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H A+YP+LTSYA+PDKQAYPRHSLSRAALITSGSPIFFLDAFT LIVFYSST  P+LPFP
Sbjct  614  HRAVYPVLTSYATPDKQAYPRHSLSRAALITSGSPIFFLDAFTILIVFYSSTADPTLPFP  673

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PP DCLLRTTINKLKQERCI+PKL+FIR G DDA+ FENFLIEEQDV+G+G TS+MGFVS
Sbjct  674  PPHDCLLRTTINKLKQERCITPKLIFIRGGHDDASIFENFLIEEQDVDGSGLTSVMGFVS  733

Query  343  FLEEIHQSVLEYMK  302
            FLE+I Q VLE+MK
Sbjct  734  FLEDITQKVLEFMK  747



>gb|KHN38627.1| Protein transport protein Sec24-like [Glycine soja]
Length=747

 Score =   237 bits (604),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H A+YPMLTSYA+PDKQAYPRHSLSRAALITSGSPIFFLDAFT LIVFYSST  P+LPFP
Sbjct  614  HRAVYPMLTSYATPDKQAYPRHSLSRAALITSGSPIFFLDAFTILIVFYSSTADPTLPFP  673

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PP DCLLRTTINKLKQERCI+PKL+FIR G DDA+ FENFLIEEQDV+G+G TS+MGFVS
Sbjct  674  PPHDCLLRTTINKLKQERCITPKLIFIRGGHDDASIFENFLIEEQDVDGSGLTSVMGFVS  733

Query  343  FLEEIHQSVLEYMK  302
            FLE+  Q VLE+MK
Sbjct  734  FLEDTTQKVLEFMK  747



>ref|XP_002275292.1| PREDICTED: protein transport protein Sec24-like At3g07100 [Vitis 
vinifera]
 emb|CBI28313.3| unnamed protein product [Vitis vinifera]
Length=744

 Score =   236 bits (602),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H A+YP+LTSY++PDKQAYPRHSLSRAALITSGSPIFFLDAFT LIVFYSST  P LP+P
Sbjct  611  HRAVYPVLTSYSAPDKQAYPRHSLSRAALITSGSPIFFLDAFTTLIVFYSSTADPILPYP  670

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PP DCLLRTTINKLKQER I+PKL+FIR GQDDAT FEN+LIEEQDVEG+G TS+MGFVS
Sbjct  671  PPHDCLLRTTINKLKQERSITPKLLFIRGGQDDATAFENYLIEEQDVEGSGLTSVMGFVS  730

Query  343  FLEEIHQSVLEYMK  302
            FLE+I +SVLEYMK
Sbjct  731  FLEDITRSVLEYMK  744



>ref|XP_007208430.1| hypothetical protein PRUPE_ppa001892mg [Prunus persica]
 gb|EMJ09629.1| hypothetical protein PRUPE_ppa001892mg [Prunus persica]
Length=746

 Score =   236 bits (602),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H A+YP+LTSY++PDKQAYPRHSLSRAALITSGSPIFFLDAFT LIVFYSST  P+LPFP
Sbjct  610  HRAVYPVLTSYSTPDKQAYPRHSLSRAALITSGSPIFFLDAFTTLIVFYSSTADPTLPFP  669

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PP DCLLRT INKLKQERC++PKL+FIR G+DDAT FEN+LIEEQDV G+G TS+MGFVS
Sbjct  670  PPHDCLLRTVINKLKQERCVTPKLIFIRGGKDDATAFENYLIEEQDVNGSGLTSVMGFVS  729

Query  343  FLEEIHQSVLEYMK  302
            FLE++ Q VLEYMK
Sbjct  730  FLEDVTQGVLEYMK  743



>ref|XP_008228686.1| PREDICTED: protein transport protein SEC24 isoform X1 [Prunus 
mume]
 ref|XP_008228693.1| PREDICTED: protein transport protein SEC24 isoform X2 [Prunus 
mume]
Length=746

 Score =   236 bits (602),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H A+YP+LTSY++PDKQAYPRHSLSRAALITSGSPIFFLDAFT LIVFYSST  P+LPFP
Sbjct  610  HRAVYPVLTSYSTPDKQAYPRHSLSRAALITSGSPIFFLDAFTTLIVFYSSTADPALPFP  669

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PP DCLLRT INKLKQERC++PKL+FIR G+DDAT FEN+LIEEQDV+G+G TS+MGFVS
Sbjct  670  PPHDCLLRTVINKLKQERCVTPKLIFIRGGKDDATAFENYLIEEQDVDGSGLTSVMGFVS  729

Query  343  FLEEIHQSVLEYMK  302
            FLE + Q VLEYMK
Sbjct  730  FLENVTQGVLEYMK  743



>ref|XP_002313596.1| hypothetical protein POPTR_0009s16480g [Populus trichocarpa]
 gb|EEE87551.1| hypothetical protein POPTR_0009s16480g [Populus trichocarpa]
Length=744

 Score =   236 bits (601),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H  IYP+L SY++PDKQAYPRHSLSRAALITSGSPIFFLDAFT LIVFYSST  P+LPFP
Sbjct  611  HRVIYPVLMSYSTPDKQAYPRHSLSRAALITSGSPIFFLDAFTTLIVFYSSTADPTLPFP  670

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PPQDCLLR+TINKLKQER I+PKL+FIR GQDDA+ FEN+LIEEQDV+G+GFTS+MGFVS
Sbjct  671  PPQDCLLRSTINKLKQERSITPKLIFIRGGQDDASAFENYLIEEQDVDGSGFTSVMGFVS  730

Query  343  FLEEIHQSVLEYMK  302
            FLE++ QSV+EYMK
Sbjct  731  FLEDVTQSVMEYMK  744



>ref|XP_004291596.2| PREDICTED: protein transport protein Sec24-like At3g07100 [Fragaria 
vesca subsp. vesca]
Length=772

 Score =   235 bits (599),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H A+YP+LTSY++PDK AYPRHSLSRAALITSGSPIFFLDAFT LIVFYSST  P+LPFP
Sbjct  639  HRAVYPVLTSYSTPDKLAYPRHSLSRAALITSGSPIFFLDAFTALIVFYSSTADPTLPFP  698

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PP DCLLRT INKLKQERCI+PKL+FIR GQDDAT FEN+LIEEQDV+G+G TS+MGFVS
Sbjct  699  PPHDCLLRTVINKLKQERCITPKLIFIRGGQDDATAFENYLIEEQDVDGSGITSVMGFVS  758

Query  343  FLEEIHQSVLEYMK  302
            FLE+I QSVLEY+K
Sbjct  759  FLEDITQSVLEYIK  772



>ref|XP_003538113.1| PREDICTED: protein transport protein Sec24-like At3g07100-like 
isoform X1 [Glycine max]
Length=747

 Score =   234 bits (598),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H A+YP+LTSYA+PDKQAYPRHSLSRAALITSGSPIFFLDAFT LIVFYSST  P+LPFP
Sbjct  614  HRAVYPVLTSYATPDKQAYPRHSLSRAALITSGSPIFFLDAFTILIVFYSSTADPTLPFP  673

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PP DCLLRTTINKLKQERCI+PKL+FIR G DDA+ FENFLIEEQDV+G+G TS+MGFVS
Sbjct  674  PPHDCLLRTTINKLKQERCITPKLIFIRGGHDDASIFENFLIEEQDVDGSGLTSVMGFVS  733

Query  343  FLEEIHQSVLEYMK  302
            FLE+  Q VLE+MK
Sbjct  734  FLEDTTQKVLEFMK  747



>ref|XP_006591072.1| PREDICTED: protein transport protein Sec24-like At3g07100-like 
isoform X2 [Glycine max]
Length=746

 Score =   234 bits (598),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H A+YP+LTSYA+PDKQAYPRHSLSRAALITSGSPIFFLDAFT LIVFYSST  P+LPFP
Sbjct  613  HRAVYPVLTSYATPDKQAYPRHSLSRAALITSGSPIFFLDAFTILIVFYSSTADPTLPFP  672

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PP DCLLRTTINKLKQERCI+PKL+FIR G DDA+ FENFLIEEQDV+G+G TS+MGFVS
Sbjct  673  PPHDCLLRTTINKLKQERCITPKLIFIRGGHDDASIFENFLIEEQDVDGSGLTSVMGFVS  732

Query  343  FLEEIHQSVLEYMK  302
            FLE+  Q VLE+MK
Sbjct  733  FLEDTTQKVLEFMK  746



>ref|XP_006487894.1| PREDICTED: protein transport protein Sec24-like At3g07100-like 
isoform X2 [Citrus sinensis]
Length=744

 Score =   233 bits (595),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            A+YP+LTSY++PDKQA+PRHSLSRAALITSGSPIF LDAFT +IVFYSST  P+LPFPPP
Sbjct  613  AVYPLLTSYSTPDKQAFPRHSLSRAALITSGSPIFLLDAFTTIIVFYSSTADPTLPFPPP  672

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            QDCLLRTTINK+KQER I+PKL+FIR GQDDAT FEN+LIEEQDV+G+G TS+MGFVSFL
Sbjct  673  QDCLLRTTINKMKQERSITPKLIFIRGGQDDATIFENYLIEEQDVDGSGLTSVMGFVSFL  732

Query  337  EEIHQSVLEYMK  302
            EEI QSV+EYMK
Sbjct  733  EEISQSVVEYMK  744



>ref|XP_006424228.1| hypothetical protein CICLE_v10027862mg [Citrus clementina]
 gb|ESR37468.1| hypothetical protein CICLE_v10027862mg [Citrus clementina]
Length=744

 Score =   233 bits (595),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            A+YP+LTSY++PDKQA+PRHSLSRAALITSGSPIF LDAFT +IVFYSST  P+LPFPPP
Sbjct  613  AVYPLLTSYSTPDKQAFPRHSLSRAALITSGSPIFLLDAFTTIIVFYSSTADPTLPFPPP  672

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            QDCLLRTTINK+KQER I+PKL+FIR GQDDAT FEN+LIEEQDV+G+G TS+MGFVSFL
Sbjct  673  QDCLLRTTINKMKQERSITPKLIFIRGGQDDATIFENYLIEEQDVDGSGLTSVMGFVSFL  732

Query  337  EEIHQSVLEYMK  302
            EEI QSV+EYMK
Sbjct  733  EEISQSVVEYMK  744



>ref|XP_006487893.1| PREDICTED: protein transport protein Sec24-like At3g07100-like 
isoform X1 [Citrus sinensis]
Length=778

 Score =   233 bits (595),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            A+YP+LTSY++PDKQA+PRHSLSRAALITSGSPIF LDAFT +IVFYSST  P+LPFPPP
Sbjct  647  AVYPLLTSYSTPDKQAFPRHSLSRAALITSGSPIFLLDAFTTIIVFYSSTADPTLPFPPP  706

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            QDCLLRTTINK+KQER I+PKL+FIR GQDDAT FEN+LIEEQDV+G+G TS+MGFVSFL
Sbjct  707  QDCLLRTTINKMKQERSITPKLIFIRGGQDDATIFENYLIEEQDVDGSGLTSVMGFVSFL  766

Query  337  EEIHQSVLEYMK  302
            EEI QSV+EYMK
Sbjct  767  EEISQSVVEYMK  778



>ref|XP_004517292.1| PREDICTED: protein transport protein SEC24-like isoform X2 [Cicer 
arietinum]
Length=745

 Score =   233 bits (594),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H A+YP+LTSYA+PDKQAYPRHSLSRAAL+TSGSPIFFLDAFT LIVFYSST   +LPFP
Sbjct  612  HRAVYPVLTSYATPDKQAYPRHSLSRAALLTSGSPIFFLDAFTILIVFYSSTADQTLPFP  671

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PP DCLLRTTINKLK+ERCI+PKL+FIR GQDDA+ FENFLIEEQDV+G+G TS+MGFVS
Sbjct  672  PPHDCLLRTTINKLKKERCITPKLIFIRGGQDDASIFENFLIEEQDVDGSGLTSVMGFVS  731

Query  343  FLEEIHQSVLEYMK  302
            FLE+I Q VLE+MK
Sbjct  732  FLEDITQKVLEFMK  745



>ref|XP_006424227.1| hypothetical protein CICLE_v10027862mg [Citrus clementina]
 gb|ESR37467.1| hypothetical protein CICLE_v10027862mg [Citrus clementina]
Length=778

 Score =   233 bits (595),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            A+YP+LTSY++PDKQA+PRHSLSRAALITSGSPIF LDAFT +IVFYSST  P+LPFPPP
Sbjct  647  AVYPLLTSYSTPDKQAFPRHSLSRAALITSGSPIFLLDAFTTIIVFYSSTADPTLPFPPP  706

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            QDCLLRTTINK+KQER I+PKL+FIR GQDDAT FEN+LIEEQDV+G+G TS+MGFVSFL
Sbjct  707  QDCLLRTTINKMKQERSITPKLIFIRGGQDDATIFENYLIEEQDVDGSGLTSVMGFVSFL  766

Query  337  EEIHQSVLEYMK  302
            EEI QSV+EYMK
Sbjct  767  EEISQSVVEYMK  778



>ref|XP_007132444.1| hypothetical protein PHAVU_011G094800g [Phaseolus vulgaris]
 gb|ESW04438.1| hypothetical protein PHAVU_011G094800g [Phaseolus vulgaris]
Length=745

 Score =   233 bits (594),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H A+YP+LTSYA+PDKQAYPRHSLSRAALITSGSPIFFLDAFT L+VFYSST  P++PFP
Sbjct  612  HRAVYPVLTSYATPDKQAYPRHSLSRAALITSGSPIFFLDAFTILVVFYSSTADPTIPFP  671

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PP DCLLRTTINKLKQ+RCI+PKL+FIR GQDDA+ FENFLIEEQDV+G+G TS+MGFVS
Sbjct  672  PPHDCLLRTTINKLKQDRCITPKLIFIRGGQDDASIFENFLIEEQDVDGSGLTSVMGFVS  731

Query  343  FLEEIHQSVLEYMK  302
            FLE+I Q VL+++K
Sbjct  732  FLEDITQKVLDFVK  745



>ref|XP_004517293.1| PREDICTED: protein transport protein SEC24-like isoform X3 [Cicer 
arietinum]
Length=745

 Score =   233 bits (594),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H A+YP+LTSYA+PDKQAYPRHSLSRAAL+TSGSPIFFLDAFT LIVFYSST   +LPFP
Sbjct  612  HRAVYPVLTSYATPDKQAYPRHSLSRAALLTSGSPIFFLDAFTILIVFYSSTADQTLPFP  671

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PP DCLLRTTINKLK+ERCI+PKL+FIR GQDDA+ FENFLIEEQDV+G+G TS+MGFVS
Sbjct  672  PPHDCLLRTTINKLKKERCITPKLIFIRGGQDDASIFENFLIEEQDVDGSGLTSVMGFVS  731

Query  343  FLEEIHQSVLEYMK  302
            FLE+I Q VLE+MK
Sbjct  732  FLEDITQKVLEFMK  745



>ref|XP_004517291.1| PREDICTED: protein transport protein SEC24-like isoform X1 [Cicer 
arietinum]
Length=746

 Score =   233 bits (594),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H A+YP+LTSYA+PDKQAYPRHSLSRAAL+TSGSPIFFLDAFT LIVFYSST   +LPFP
Sbjct  613  HRAVYPVLTSYATPDKQAYPRHSLSRAALLTSGSPIFFLDAFTILIVFYSSTADQTLPFP  672

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PP DCLLRTTINKLK+ERCI+PKL+FIR GQDDA+ FENFLIEEQDV+G+G TS+MGFVS
Sbjct  673  PPHDCLLRTTINKLKKERCITPKLIFIRGGQDDASIFENFLIEEQDVDGSGLTSVMGFVS  732

Query  343  FLEEIHQSVLEYMK  302
            FLE+I Q VLE+MK
Sbjct  733  FLEDITQKVLEFMK  746



>ref|XP_002523817.1| expressed protein, putative [Ricinus communis]
 gb|EEF38543.1| expressed protein, putative [Ricinus communis]
Length=740

 Score =   233 bits (593),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            A+YP+L SY++PDKQAYPRHSLSRAALITSGSPIFFLDAFT LIVFYSS   P++PFPPP
Sbjct  609  AVYPVLMSYSTPDKQAYPRHSLSRAALITSGSPIFFLDAFTTLIVFYSSIADPTIPFPPP  668

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            QDCLLR+TINKLKQ+R I+PKL+FIR GQDDA+ FEN+LIEEQDV+GNGFTS+MGFVSFL
Sbjct  669  QDCLLRSTINKLKQDRSITPKLIFIRGGQDDASAFENYLIEEQDVDGNGFTSVMGFVSFL  728

Query  337  EEIHQSVLEYMK  302
            E+I QSV+EYMK
Sbjct  729  EDITQSVMEYMK  740



>gb|KFK36699.1| hypothetical protein AALP_AA4G157700 [Arabis alpina]
Length=742

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H  IYP L SY++PDK+AYPRHSLSRAALITSGSPIFFLDA+T LIVFYSST  PS+PFP
Sbjct  609  HCGIYPALMSYSTPDKEAYPRHSLSRAALITSGSPIFFLDAYTTLIVFYSSTVDPSVPFP  668

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PPQDCLLR  INK+KQER I+PKLMFIRAGQDDAT FEN+LIEEQDV+GNGF S MGFVS
Sbjct  669  PPQDCLLRKKINKVKQERSITPKLMFIRAGQDDATAFENYLIEEQDVDGNGFASAMGFVS  728

Query  343  FLEEIHQSVLEYMK  302
            FLE+I QSV EYMK
Sbjct  729  FLEDISQSVAEYMK  742



>ref|XP_006409731.1| hypothetical protein EUTSA_v10016271mg [Eutrema salsugineum]
 gb|ESQ51184.1| hypothetical protein EUTSA_v10016271mg [Eutrema salsugineum]
Length=793

 Score =   233 bits (593),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H  IYP L SY++PDKQAYPRHSLSRAALITSGSPIFFLDA+T +IVFYSST  PSLPFP
Sbjct  660  HCGIYPALMSYSTPDKQAYPRHSLSRAALITSGSPIFFLDAYTTIIVFYSSTADPSLPFP  719

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PPQDCLLR TINK+KQER I+PKLMFIR GQDDAT FEN+LIEEQDV+GNGF S MGFVS
Sbjct  720  PPQDCLLRKTINKVKQERSITPKLMFIRGGQDDATAFENYLIEEQDVDGNGFASAMGFVS  779

Query  343  FLEEIHQSVLEYMK  302
            FL++I QSV EYMK
Sbjct  780  FLDDISQSVAEYMK  793



>ref|XP_008788954.1| PREDICTED: protein transport protein Sec24-like At3g07100 [Phoenix 
dactylifera]
 ref|XP_008788955.1| PREDICTED: protein transport protein Sec24-like At3g07100 [Phoenix 
dactylifera]
Length=737

 Score =   232 bits (591),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H AIYP+LTSYA+PDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIV+YSST  PSLPFP
Sbjct  604  HRAIYPVLTSYATPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVYYSSTADPSLPFP  663

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PP DCLLRTTINKLKQER I+PKL FIR GQDDAT FEN+LIEEQDV+G G +SI GFVS
Sbjct  664  PPHDCLLRTTINKLKQERSITPKLTFIRGGQDDATLFENYLIEEQDVDGTGISSITGFVS  723

Query  343  FLEEIHQSVLEYMK  302
            FLEEI + V EY+K
Sbjct  724  FLEEIARDVAEYLK  737



>ref|XP_004139490.1| PREDICTED: protein transport protein SEC24-1-like [Cucumis sativus]
Length=742

 Score =   231 bits (588),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H A+YP+LTSY++PD QAYPRHSLSRAALITSGSPIFFLDAFT LIVFYSST   +LPFP
Sbjct  609  HCAVYPVLTSYSTPDIQAYPRHSLSRAALITSGSPIFFLDAFTTLIVFYSSTADATLPFP  668

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PPQDCLLR+TIN+LK++RCI+P+L+FIR GQDDAT FEN+LIEEQDV+G+G TS+MGFVS
Sbjct  669  PPQDCLLRSTINELKKDRCITPRLIFIRGGQDDATAFENYLIEEQDVDGSGLTSVMGFVS  728

Query  343  FLEEIHQSVLEYMK  302
            FLE++ QSVLEY+K
Sbjct  729  FLEDVKQSVLEYLK  742



>ref|XP_008461390.1| PREDICTED: protein transport protein SEC24 [Cucumis melo]
Length=742

 Score =   231 bits (588),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H A+YP+LTSY++PD QAYPRHSLSRAALITSGSPIFFLDAFT LIVFYSST   +LPFP
Sbjct  609  HCAVYPVLTSYSTPDLQAYPRHSLSRAALITSGSPIFFLDAFTTLIVFYSSTADATLPFP  668

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PPQDCLLR+TIN+LK++RCI+P+L+FIR GQDDAT FEN+LIEEQDV+G+G TS+MGFVS
Sbjct  669  PPQDCLLRSTINELKKDRCITPRLIFIRGGQDDATAFENYLIEEQDVDGSGLTSVMGFVS  728

Query  343  FLEEIHQSVLEYMK  302
            FLE++ QSVLEY+K
Sbjct  729  FLEDVKQSVLEYLK  742



>ref|XP_011015487.1| PREDICTED: protein transport protein SEC24-like [Populus euphratica]
Length=699

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AIYP+LTSY++PDKQAYPRHSLSRAALITS SPIFFLDAFT LIVFYSST  P LPFPPP
Sbjct  568  AIYPLLTSYSTPDKQAYPRHSLSRAALITSDSPIFFLDAFTTLIVFYSSTADPELPFPPP  627

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            QDCLLR+TINKLKQER I+PKL+FIR GQDDA+ FEN+LIEEQ V+G+GF S+MGFVSFL
Sbjct  628  QDCLLRSTINKLKQERSITPKLIFIRGGQDDASAFENYLIEEQHVDGSGFASVMGFVSFL  687

Query  337  EEIHQSVLEYMK  302
            E++ QSVLEYMK
Sbjct  688  EDVTQSVLEYMK  699



>ref|XP_010089815.1| Protein transport protein SEC24-1 [Morus notabilis]
 gb|EXB38431.1| Protein transport protein SEC24-1 [Morus notabilis]
Length=744

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            A+YP+LTSY++PD+QAYP HSLSRAALITSGSPIFFLDAFT L+VFYSST  P+LP+PPP
Sbjct  613  AVYPVLTSYSTPDEQAYPSHSLSRAALITSGSPIFFLDAFTTLVVFYSSTADPTLPYPPP  672

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
             DCLLRTTINKLKQERCI+PKL+FIR GQ+DAT FEN+LIEEQDV+G+G TS+ GFVSFL
Sbjct  673  HDCLLRTTINKLKQERCITPKLIFIRGGQEDATIFENYLIEEQDVDGSGLTSVTGFVSFL  732

Query  337  EEIHQSVLEYMK  302
            EE+ QSVLEYMK
Sbjct  733  EEVTQSVLEYMK  744



>gb|KEH29852.1| Sec23/Sec24 transport family protein [Medicago truncatula]
Length=745

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H A+YP+LTSYA+PDKQAYPRHSLSRAAL+TSGSPIFFLDAFT LIVFYSST  P+LPFP
Sbjct  612  HRAVYPVLTSYATPDKQAYPRHSLSRAALLTSGSPIFFLDAFTILIVFYSSTADPTLPFP  671

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PP DCLLRTTINKLK+ERCI+PKL+FI+ GQDDA+ FENFLIEEQDV+G+G TS+MGFVS
Sbjct  672  PPHDCLLRTTINKLKKERCITPKLIFIQGGQDDASIFENFLIEEQDVDGSGLTSVMGFVS  731

Query  343  FLEEIHQSVLEYMK  302
            FLE+I   VLE++K
Sbjct  732  FLEDITVKVLEFIK  745



>ref|XP_010245214.1| PREDICTED: protein transport protein Sec24-like At3g07100 [Nelumbo 
nucifera]
Length=743

 Score =   229 bits (583),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H A+YP+LTSYA+PDK AYPRHSLSRAALITSGSPIFFLDAFT LIV+YSST   +LPFP
Sbjct  610  HRAVYPVLTSYATPDKHAYPRHSLSRAALITSGSPIFFLDAFTTLIVYYSSTADATLPFP  669

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PP DCLLR TINKLKQER I+PKL+FIR GQDDAT FEN+LIEEQDV+G+G T+ MGFVS
Sbjct  670  PPHDCLLRRTINKLKQERSITPKLIFIRGGQDDATAFENYLIEEQDVDGSGLTTAMGFVS  729

Query  343  FLEEIHQSVLEYMK  302
            FLEEI +SVLEYMK
Sbjct  730  FLEEITRSVLEYMK  743



>ref|XP_011043111.1| PREDICTED: protein transport protein SEC24 [Populus euphratica]
Length=744

 Score =   229 bits (583),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H  IYP+L SY++PDKQA+PRHSLS AALITSGSPIFFLDAFT LIVFYSST  P+LPFP
Sbjct  611  HRVIYPVLMSYSTPDKQAFPRHSLSHAALITSGSPIFFLDAFTTLIVFYSSTADPTLPFP  670

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PPQDCLLR+TINKLKQER I+PKL FIR GQDDA+ FEN+LIEEQDV+G+GFTS+MGFVS
Sbjct  671  PPQDCLLRSTINKLKQERSITPKLFFIRGGQDDASAFENYLIEEQDVDGSGFTSVMGFVS  730

Query  343  FLEEIHQSVLEYMK  302
            FLE++ Q V+EYMK
Sbjct  731  FLEDVTQRVMEYMK  744



>ref|XP_006384797.1| sec23/sec24 transport family protein [Populus trichocarpa]
 gb|ERP62594.1| sec23/sec24 transport family protein [Populus trichocarpa]
Length=744

 Score =   229 bits (583),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AIYP+LTSY++PDKQAYPRHSLSRAALITS SPIFFLDAFT LIVFYSST  P+LPFPPP
Sbjct  613  AIYPVLTSYSTPDKQAYPRHSLSRAALITSDSPIFFLDAFTTLIVFYSSTADPALPFPPP  672

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            QDCLLR+TINKLKQER I+PKL+FIR GQDDA+ FEN+LIEEQ V+G+GF S+MGFVSFL
Sbjct  673  QDCLLRSTINKLKQERSITPKLIFIRGGQDDASVFENYLIEEQHVDGSGFASVMGFVSFL  732

Query  337  EEIHQSVLEYMK  302
            E++ QSVLEYMK
Sbjct  733  EDVIQSVLEYMK  744



>ref|XP_010045202.1| PREDICTED: protein transport protein Sec24-like At3g07100 [Eucalyptus 
grandis]
 gb|KCW87363.1| hypothetical protein EUGRSUZ_B03845 [Eucalyptus grandis]
Length=743

 Score =   226 bits (575),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H A+YP LTSY++PDKQAYPRHSLSRAALITSGSPIFFLDAFT LIVFYSST  PSLPFP
Sbjct  610  HRAVYPRLTSYSTPDKQAYPRHSLSRAALITSGSPIFFLDAFTTLIVFYSSTADPSLPFP  669

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PP DCLLRTTINKLKQ+R I+PKL+FIR GQ+DA+ FE++LIEEQDV+G+G T+ MGFVS
Sbjct  670  PPHDCLLRTTINKLKQDRSITPKLLFIRGGQEDASAFESYLIEEQDVDGSGLTNNMGFVS  729

Query  343  FLEEIHQSVLEYMK  302
            FLE+I Q VLEY+K
Sbjct  730  FLEDITQGVLEYLK  743



>gb|EYU36066.1| hypothetical protein MIMGU_mgv1a001880mg [Erythranthe guttata]
Length=745

 Score =   225 bits (573),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            A+YP L+SY +PDKQAYPRHSLSRAALITSGSPIF LDAFT+LIVFYSST G ++PFPPP
Sbjct  609  AVYPSLSSYDTPDKQAYPRHSLSRAALITSGSPIFLLDAFTHLIVFYSSTAGATMPFPPP  668

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            QDCLLR+TINKLKQER I+PKL+FIR G DDAT FEN+LIEEQDVEG+GFTS+MGFVSFL
Sbjct  669  QDCLLRSTINKLKQERIITPKLIFIRGGIDDATAFENYLIEEQDVEGSGFTSVMGFVSFL  728

Query  337  EEIHQSVLEYM  305
            +EI+  V+EYM
Sbjct  729  DEINHDVVEYM  739



>ref|XP_009103601.1| PREDICTED: protein transport protein SEC24 isoform X2 [Brassica 
rapa]
Length=745

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H  IYP L SY++PDKQAYPRHSLSRAAL+TSGSPIFFLDA+T LIVFYSST  PSLPFP
Sbjct  612  HCGIYPSLMSYSTPDKQAYPRHSLSRAALMTSGSPIFFLDAYTTLIVFYSSTADPSLPFP  671

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PPQDCLLR TIN++KQ R I+PKLMFIR GQDDAT FEN+LIEEQDV+G+GF S MGFV+
Sbjct  672  PPQDCLLRKTINEVKQGRSITPKLMFIRGGQDDATAFENYLIEEQDVDGSGFASAMGFVA  731

Query  343  FLEEIHQSVLEYMK  302
            FL++I QSV EYMK
Sbjct  732  FLDDISQSVAEYMK  745



>ref|XP_009103600.1| PREDICTED: protein transport protein SEC24 isoform X1 [Brassica 
rapa]
Length=746

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H  IYP L SY++PDKQAYPRHSLSRAAL+TSGSPIFFLDA+T LIVFYSST  PSLPFP
Sbjct  613  HCGIYPSLMSYSTPDKQAYPRHSLSRAALMTSGSPIFFLDAYTTLIVFYSSTADPSLPFP  672

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PPQDCLLR TIN++KQ R I+PKLMFIR GQDDAT FEN+LIEEQDV+G+GF S MGFV+
Sbjct  673  PPQDCLLRKTINEVKQGRSITPKLMFIRGGQDDATAFENYLIEEQDVDGSGFASAMGFVA  732

Query  343  FLEEIHQSVLEYMK  302
            FL++I QSV EYMK
Sbjct  733  FLDDISQSVAEYMK  746



>ref|XP_011090338.1| PREDICTED: protein transport protein SEC24 [Sesamum indicum]
Length=750

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            A+YP+L SY +PDKQA+PRHSLSRAALITSGSPIFFLDAFT LIVFYSST   +LPFPPP
Sbjct  611  AVYPLLASYDTPDKQAFPRHSLSRAALITSGSPIFFLDAFTTLIVFYSSTADAALPFPPP  670

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            QDCLLRTTINKLKQER I+PKL+ IRAG+DDATPFEN+LIEEQDV G+GFTS+MGFVSFL
Sbjct  671  QDCLLRTTINKLKQERIITPKLILIRAGRDDATPFENYLIEEQDVGGSGFTSVMGFVSFL  730

Query  337  EEIHQSVLEYM  305
            +E++  V+EY+
Sbjct  731  DEVNHDVVEYL  741



>ref|XP_010417884.1| PREDICTED: protein transport protein sec24-like [Camelina sativa]
Length=745

 Score =   223 bits (569),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H  IYP L SY++PD  AYPRHSLSRAALITSGSPIFFLDA+T LIVFYSST  PS+PFP
Sbjct  612  HCGIYPALMSYSTPDTLAYPRHSLSRAALITSGSPIFFLDAYTTLIVFYSSTADPSIPFP  671

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PPQDCLLR TINK+KQER I+PKLMFIR GQDDAT FEN+LIEEQDV+G+GF S MGFVS
Sbjct  672  PPQDCLLRKTINKVKQERSITPKLMFIRGGQDDATAFENYLIEEQDVDGSGFASAMGFVS  731

Query  343  FLEEIHQSVLEYMK  302
            FL++I Q V EYMK
Sbjct  732  FLDDISQRVTEYMK  745



>ref|XP_010497331.1| PREDICTED: uncharacterized protein LOC104774419 [Camelina sativa]
Length=125

 Score =   206 bits (524),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = -2

Query  676  SYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPPQDCLLRT  497
            SY++PD  AYPRHSLSRAALITSGSPIFFLDA+T LIVFYSST  PS+PFPPPQDCLLR 
Sbjct  2    SYSTPDTLAYPRHSLSRAALITSGSPIFFLDAYTTLIVFYSSTADPSIPFPPPQDCLLRK  61

Query  496  TINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFLEEIHQSV  317
            TINK+KQER I+PKLMFIR GQDDAT FEN+LIEEQDV+GNGF S   FVSFL++I Q V
Sbjct  62   TINKVKQERSITPKLMFIRGGQDDATTFENYLIEEQDVDGNGFAS-ASFVSFLDDISQRV  120

Query  316  LEYMK  302
             EYMK
Sbjct  121  TEYMK  125



>emb|CDX71451.1| BnaC04g16860D [Brassica napus]
Length=745

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H  IYP L SY++PDKQAYPRHSLSRAAL+TSGSPIFFLDA+T LIVFYSST  PSLPFP
Sbjct  612  HCGIYPSLMSYSTPDKQAYPRHSLSRAALMTSGSPIFFLDAYTTLIVFYSSTADPSLPFP  671

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PPQDCLLR TIN++KQ R I+PKLMFIR GQDDAT FEN+LIEEQDV+G+GF S MGFV+
Sbjct  672  PPQDCLLRKTINEVKQGRSITPKLMFIRGGQDDATAFENYLIEEQDVDGSGFASAMGFVA  731

Query  343  FLEEIHQSVLEYM  305
            FL++I QSV EYM
Sbjct  732  FLDDISQSVAEYM  744



>ref|XP_010473124.1| PREDICTED: protein transport protein sec24-like [Camelina sativa]
Length=745

 Score =   222 bits (565),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H  IYP L SY++PD  AYPRHSLSRAALITSGSPIFFLDA+T LIVFYSST  PS+PFP
Sbjct  612  HCGIYPALMSYSTPDTLAYPRHSLSRAALITSGSPIFFLDAYTTLIVFYSSTADPSIPFP  671

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PPQDC+LR TINK+KQER I+PKLMFIR GQDDAT FEN+LIEEQDV+G+GF S MGFVS
Sbjct  672  PPQDCVLRKTINKVKQERSITPKLMFIRGGQDDATAFENYLIEEQDVDGSGFASAMGFVS  731

Query  343  FLEEIHQSVLEYMK  302
            FL++I Q V EYMK
Sbjct  732  FLDDISQRVTEYMK  745



>ref|NP_565651.1| sec23/sec24 transport family protein [Arabidopsis thaliana]
 gb|AAD15598.1| expressed protein [Arabidopsis thaliana]
 gb|AAK96686.1| Unknown protein [Arabidopsis thaliana]
 gb|AAQ56782.1| At2g27460 [Arabidopsis thaliana]
 gb|AEC07999.1| sec23/sec24 transport family protein [Arabidopsis thaliana]
Length=745

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H  IYP L SY++PD  AYPRHSLSRAALITSGSPIFFLDA+T LIVFYSST  PS+PFP
Sbjct  612  HCGIYPALMSYSTPDTLAYPRHSLSRAALITSGSPIFFLDAYTTLIVFYSSTADPSIPFP  671

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PPQDCLLR TINK+KQER I+PKL+FIR G+DDAT FEN+LIEEQDV+GNGF S MGFVS
Sbjct  672  PPQDCLLRQTINKVKQERSITPKLVFIRGGRDDATVFENYLIEEQDVDGNGFASAMGFVS  731

Query  343  FLEEIHQSVLEYMK  302
            FL++I Q V EYMK
Sbjct  732  FLDDISQRVTEYMK  745



>emb|CDY04496.1| BnaA07g13220D [Brassica napus]
Length=745

 Score =   221 bits (562),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H  IYP L SY++PDKQAYPRHSLSRAAL+TSGSPIFFLDA+T LIVFYSST  PSLPFP
Sbjct  612  HCGIYPSLMSYSTPDKQAYPRHSLSRAALMTSGSPIFFLDAYTTLIVFYSSTADPSLPFP  671

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PPQDCLLR TIN++KQ R I+PKLMFIR G DDAT FEN+LIEEQDV+G+GF S MGFV+
Sbjct  672  PPQDCLLRKTINEVKQGRSITPKLMFIRGGHDDATAFENYLIEEQDVDGSGFASAMGFVA  731

Query  343  FLEEIHQSVLEYMK  302
            FL++I Q V EYMK
Sbjct  732  FLDDISQCVAEYMK  745



>gb|ADE77470.1| unknown [Picea sitchensis]
Length=369

 Score =   213 bits (541),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            A+YP+L+SY++PDKQAYPRHSLSRAALITSGSPIFFLDAFT LIV+YSST  P+LPFPPP
Sbjct  238  AVYPVLSSYSTPDKQAYPRHSLSRAALITSGSPIFFLDAFTTLIVYYSSTADPALPFPPP  297

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            Q+CLLR  INKLKQER I+PKL+ IR+G D+A PFE +LIEEQDV+G G ++ MGFVSFL
Sbjct  298  QNCLLRAIINKLKQERSITPKLLLIRSGHDNAEPFEQYLIEEQDVDGVGLSNGMGFVSFL  357

Query  337  EEIHQSVLEYMK  302
            E+I + +LEYMK
Sbjct  358  EQISRDILEYMK  369



>ref|XP_002879090.1| sec23/sec24 transport family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55349.1| sec23/sec24 transport family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=745

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H  IYP L SY++PD  AYPRHSLSRAALITSGSPIFFLDA+T LIVFYSST  PS+PFP
Sbjct  612  HCGIYPALMSYSTPDTLAYPRHSLSRAALITSGSPIFFLDAYTTLIVFYSSTADPSIPFP  671

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PPQDCLLR TINK+KQER I+PKLMFIR G+DDAT FEN+LIEEQDV+G GF S MGFVS
Sbjct  672  PPQDCLLRQTINKVKQERSITPKLMFIRGGRDDATVFENYLIEEQDVDGIGFASAMGFVS  731

Query  343  FLEEIHQSVLEYMK  302
            FL++I Q V EYMK
Sbjct  732  FLDDISQRVTEYMK  745



>ref|XP_006293742.1| hypothetical protein CARUB_v10022704mg [Capsella rubella]
 gb|EOA26640.1| hypothetical protein CARUB_v10022704mg [Capsella rubella]
Length=745

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H  IYP L SY++PD  AYPRHSLSRAALITSGSPIFFLDA+T LIVFYSST  PS+PFP
Sbjct  612  HCGIYPALMSYSTPDTLAYPRHSLSRAALITSGSPIFFLDAYTTLIVFYSSTADPSMPFP  671

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PPQDCLLR TINK+KQER I+PKLMFIR G+DDAT FEN+LIEEQDV+G+GF S MGFVS
Sbjct  672  PPQDCLLRKTINKVKQERNITPKLMFIRGGKDDATAFENYLIEEQDVDGSGFASAMGFVS  731

Query  343  FLEEIHQSVLEYMK  302
            FL++I   V EYMK
Sbjct  732  FLDDISLRVTEYMK  745



>ref|XP_010542559.1| PREDICTED: protein transport protein SEC24-like isoform X1 [Tarenaya 
hassleriana]
Length=746

 Score =   218 bits (556),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 117/134 (87%), Gaps = 1/134 (1%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H AIYP L SY +PDKQAYPRHSLSRAALITSGSPIFFLDA+T LIVFYSST  PSLPFP
Sbjct  608  HRAIYPALMSYTTPDKQAYPRHSLSRAALITSGSPIFFLDAYTTLIVFYSSTADPSLPFP  667

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEG-NGFTSIMGFV  347
            PPQDC+LR TINK+K+ER I+P+LMF+R G+DDAT FEN+LIEEQDV G +GF S MGFV
Sbjct  668  PPQDCMLRKTINKMKKERSITPRLMFMRGGEDDATAFENYLIEEQDVNGSSGFASAMGFV  727

Query  346  SFLEEIHQSVLEYM  305
            SFLE++ QSV +YM
Sbjct  728  SFLEDVTQSVSQYM  741



>ref|XP_010542560.1| PREDICTED: protein transport protein SEC24-like isoform X2 [Tarenaya 
hassleriana]
Length=745

 Score =   218 bits (555),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 117/134 (87%), Gaps = 1/134 (1%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H AIYP L SY +PDKQAYPRHSLSRAALITSGSPIFFLDA+T LIVFYSST  PSLPFP
Sbjct  607  HRAIYPALMSYTTPDKQAYPRHSLSRAALITSGSPIFFLDAYTTLIVFYSSTADPSLPFP  666

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEG-NGFTSIMGFV  347
            PPQDC+LR TINK+K+ER I+P+LMF+R G+DDAT FEN+LIEEQDV G +GF S MGFV
Sbjct  667  PPQDCMLRKTINKMKKERSITPRLMFMRGGEDDATAFENYLIEEQDVNGSSGFASAMGFV  726

Query  346  SFLEEIHQSVLEYM  305
            SFLE++ QSV +YM
Sbjct  727  SFLEDVTQSVSQYM  740



>emb|CDX77118.1| BnaC04g39130D [Brassica napus]
Length=746

 Score =   218 bits (555),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H  IYP L SY++PDKQAYPRHSLSRAALITSGSPIFFLDA+T LIVFY+ST  PSLPFP
Sbjct  613  HCGIYPSLVSYSTPDKQAYPRHSLSRAALITSGSPIFFLDAYTTLIVFYTSTADPSLPFP  672

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PPQDCLLR  IN +KQ R I+PKLMFIR G+DDAT FEN+LIEEQDV+G+GF S  GFVS
Sbjct  673  PPQDCLLRKNINMVKQGRSITPKLMFIREGKDDATAFENYLIEEQDVDGSGFASARGFVS  732

Query  343  FLEEIHQSVLEYMK  302
            FL+++ QSV EYMK
Sbjct  733  FLDDVSQSVAEYMK  746



>emb|CDY30546.1| BnaA04g15870D [Brassica napus]
Length=746

 Score =   217 bits (553),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H  IYP LTSY++PDKQAYPRHSLSRAAL+TS SPIFFLDA+T LIVFY+ST  PSLPFP
Sbjct  613  HCGIYPSLTSYSTPDKQAYPRHSLSRAALLTSDSPIFFLDAYTTLIVFYTSTADPSLPFP  672

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PPQDCLLR  IN +KQ R I+PKLMFIR G+DDAT FEN+LIEEQDV+G+GF S  GFVS
Sbjct  673  PPQDCLLRKNINMVKQGRSITPKLMFIRGGKDDATAFENYLIEEQDVDGSGFASAKGFVS  732

Query  343  FLEEIHQSVLEYMK  302
            FL++I QSV EYMK
Sbjct  733  FLDDISQSVAEYMK  746



>ref|XP_009140802.1| PREDICTED: protein transport protein SEC24-like [Brassica rapa]
Length=746

 Score =   217 bits (553),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H  IYP LTSY++PDKQAYPRHSLSRAAL+TS SPIFFLDA+T LIVFY+ST  PSLPFP
Sbjct  613  HCGIYPSLTSYSTPDKQAYPRHSLSRAALLTSDSPIFFLDAYTTLIVFYTSTADPSLPFP  672

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PPQDCLLR  IN +KQ R I+PKLMFIR G+DDAT FEN+LIEEQDV+G+GF S  GFVS
Sbjct  673  PPQDCLLRKNINMVKQGRSITPKLMFIRGGKDDATAFENYLIEEQDVDGSGFASAKGFVS  732

Query  343  FLEEIHQSVLEYMK  302
            FL++I QSV EYMK
Sbjct  733  FLDDISQSVAEYMK  746



>ref|XP_006855085.1| hypothetical protein AMTR_s00031p00165880 [Amborella trichopoda]
 gb|ERN16552.1| hypothetical protein AMTR_s00031p00165880 [Amborella trichopoda]
Length=743

 Score =   217 bits (553),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AIYP LTS+++PDKQAYPRHSLSRAAL+TSGSPIFFLDAFTNLIV+YSST  P+ PFPPP
Sbjct  611  AIYPALTSFSTPDKQAYPRHSLSRAALLTSGSPIFFLDAFTNLIVYYSSTADPTHPFPPP  670

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            QDCLLR TINKLKQER I+PKL+ IR GQDDA+PFE++LIEEQDV+G G T+ MGFVSFL
Sbjct  671  QDCLLRATINKLKQERSITPKLLLIRGGQDDASPFEHYLIEEQDVDGTGLTNGMGFVSFL  730

Query  337  EEIHQSVLEYMK  302
            E+I ++V+E +K
Sbjct  731  EDISRNVIECIK  742



>ref|XP_010510770.1| PREDICTED: protein transport protein sec24 [Camelina sativa]
Length=744

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 114/134 (85%), Gaps = 1/134 (1%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H  IYP L SY++PD  AYPRHSLSRAALITSGSPIFFLDA+T LIVFYSST  PS+PFP
Sbjct  612  HCGIYPALMSYSTPDTLAYPRHSLSRAALITSGSPIFFLDAYTTLIVFYSSTADPSIPFP  671

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PPQDCLLR TINK+KQER I+PKLMFIR GQDDAT FEN+LIEEQDV+GNGF S   FVS
Sbjct  672  PPQDCLLRKTINKVKQERSITPKLMFIRGGQDDATTFENYLIEEQDVDGNGFAS-ASFVS  730

Query  343  FLEEIHQSVLEYMK  302
            FL++I Q V EYMK
Sbjct  731  FLDDISQRVTEYMK  744



>ref|XP_009404358.1| PREDICTED: protein transport protein sec24-like [Musa acuminata 
subsp. malaccensis]
Length=740

 Score =   212 bits (539),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AIYP+LTSYA+PDKQAYPRHSLSR+AL+ SGSPIFFLDAFTNLIV+YSST   SLPFPPP
Sbjct  609  AIYPVLTSYATPDKQAYPRHSLSRSALVKSGSPIFFLDAFTNLIVYYSSTADSSLPFPPP  668

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
             DCLLRTTIN+LKQER I+PKLMFIR G DDAT FEN+L+E++DV+G G  S+ GFV+FL
Sbjct  669  HDCLLRTTINRLKQERSITPKLMFIRGGHDDATAFENYLMEDKDVDGTGIPSVTGFVTFL  728

Query  337  EEIHQSVLEYMK  302
            EEI   V E +K
Sbjct  729  EEIASDVSENIK  740



>ref|XP_009411948.1| PREDICTED: protein transport protein SEC23-like [Musa acuminata 
subsp. malaccensis]
Length=742

 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AIYP+L+SY +PD+QAYPRHSLS AAL+TSGSPIF LDAFTN+IV+YS T   S+PFPPP
Sbjct  611  AIYPLLSSYTTPDQQAYPRHSLSHAALVTSGSPIFLLDAFTNIIVYYSPTADSSIPFPPP  670

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
             DCLLR TINKLKQER I+PKL FIR GQDDAT FE +LIEEQ+++G+  +SIMGFVSFL
Sbjct  671  HDCLLRATINKLKQERNITPKLTFIRGGQDDATAFEKYLIEEQNIDGSDLSSIMGFVSFL  730

Query  337  EEIHQSVLEYMK  302
            EEI + VLEY+K
Sbjct  731  EEISRGVLEYLK  742



>ref|XP_008787674.1| PREDICTED: protein transport protein sec24-like [Phoenix dactylifera]
Length=743

 Score =   206 bits (525),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AIYP+L S+A+PDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIV+YS T   SLP+PPP
Sbjct  611  AIYPVLMSFATPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVYYSPTADASLPYPPP  670

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
             DCLLR TIN+LKQER I+PKL FI    DD T FE++LIEEQDV+G GF SI GFV+FL
Sbjct  671  HDCLLRNTINRLKQERSITPKLTFIHGQHDDTTAFESYLIEEQDVDGTGFPSITGFVAFL  730

Query  337  EEIHQSVLEYMK  302
            EE+ + V EY+K
Sbjct  731  EEVSRDVAEYLK  742



>ref|XP_010931128.1| PREDICTED: protein transport protein SEC24-like isoform X2 [Elaeis 
guineensis]
Length=709

 Score =   206 bits (523),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AIYP+L S+A+PDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIV+YS T   SLP+PPP
Sbjct  577  AIYPVLMSFATPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVYYSPTADASLPYPPP  636

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
             DCLLRTTIN+LKQ+R I+PKL FI     DAT FE++LIEEQDV+G GF SI GFV+FL
Sbjct  637  HDCLLRTTINRLKQDRSITPKLTFIHGQHGDATAFESYLIEEQDVDGTGFPSITGFVAFL  696

Query  337  EEIHQSVLEYMK  302
            EE+ + V EY+K
Sbjct  697  EEVSRDVAEYLK  708



>ref|XP_010931127.1| PREDICTED: protein transport protein SEC24-like isoform X1 [Elaeis 
guineensis]
Length=743

 Score =   206 bits (523),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AIYP+L S+A+PDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIV+YS T   SLP+PPP
Sbjct  611  AIYPVLMSFATPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVYYSPTADASLPYPPP  670

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
             DCLLRTTIN+LKQ+R I+PKL FI     DAT FE++LIEEQDV+G GF SI GFV+FL
Sbjct  671  HDCLLRTTINRLKQDRSITPKLTFIHGQHGDATAFESYLIEEQDVDGTGFPSITGFVAFL  730

Query  337  EEIHQSVLEYMK  302
            EE+ + V EY+K
Sbjct  731  EEVSRDVAEYLK  742



>gb|EMS61482.1| Protein transport protein Sec24C [Triticum urartu]
Length=656

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AIYP+L SY+SP+KQA+PRH+LSRAAL  S SPIF LDAFTNL+V+YSST  PSLPFPPP
Sbjct  520  AIYPLLISYSSPNKQAFPRHTLSRAALTMSESPIFLLDAFTNLVVYYSSTADPSLPFPPP  579

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
             DCLLRTTIN LKQ+RCI+PKL  +R GQDD++ FEN+LIEEQDV+G+G+TS  GF+SF 
Sbjct  580  HDCLLRTTINALKQDRCITPKLAIVRGGQDDSSLFENYLIEEQDVDGSGYTSGNGFISFR  639

Query  337  EEIHQSVLEYMK  302
            E I   V E +K
Sbjct  640  EGIRNEVAEILK  651



>dbj|BAJ97505.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=575

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AIYP+L SY+SP+KQA+PRH+LSRAAL  S SPIF LDAFTNLIV+YSST  PSLPFPPP
Sbjct  439  AIYPLLISYSSPNKQAFPRHTLSRAALTMSESPIFLLDAFTNLIVYYSSTADPSLPFPPP  498

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
             DCLLRT IN LKQ+RCI+PKL F+R GQDD++ FEN+LIEEQDV+G+G+ S  GF+SF 
Sbjct  499  HDCLLRTKINALKQDRCITPKLTFVRGGQDDSSLFENYLIEEQDVDGSGYASGNGFISFR  558

Query  337  EEIHQSVLEYMK  302
            E I   V E +K
Sbjct  559  EGIRNEVAEILK  570



>gb|KJB55613.1| hypothetical protein B456_009G085000 [Gossypium raimondii]
 gb|KJB55614.1| hypothetical protein B456_009G085000 [Gossypium raimondii]
Length=670

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 109/134 (81%), Gaps = 12/134 (9%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H AIYPMLTSY++PDK AYPRHSLSRAALI+SGSPIFFLDAF  LIVFYSST  PSLPFP
Sbjct  549  HRAIYPMLTSYSTPDKPAYPRHSLSRAALISSGSPIFFLDAFATLIVFYSSTADPSLPFP  608

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PP D             RCI+PKL+FI  GQDDAT FEN+LIEEQDV+G+G TS+MGFVS
Sbjct  609  PPHD------------YRCITPKLVFIWGGQDDATVFENYLIEEQDVDGSGLTSVMGFVS  656

Query  343  FLEEIHQSVLEYMK  302
            FLE+I QSVLEYMK
Sbjct  657  FLEDIPQSVLEYMK  670



>gb|EMT05114.1| Protein transport protein SEC24 [Aegilops tauschii]
Length=970

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AIYP+L SY+SP+KQA+PRH+LSRAAL  S SPIF LDAFTNL+V+YSST  PSLPFPPP
Sbjct  834  AIYPLLISYSSPNKQAFPRHTLSRAALTMSESPIFLLDAFTNLVVYYSSTADPSLPFPPP  893

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
             DCLLRTTIN LKQ+RCI+PKLM +R GQDD++ FEN+LIEEQDV+G+G+ S  GF+SF 
Sbjct  894  HDCLLRTTINALKQDRCITPKLMIVRGGQDDSSLFENYLIEEQDVDGSGYASGNGFISFR  953

Query  337  EEIHQSVLEYMK  302
            E I   V E +K
Sbjct  954  EGIRNEVAEILK  965



>dbj|BAJ95494.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=747

 Score =   198 bits (503),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AIYP+L SY+SP+KQA+PRH+LSRAAL  S SPIF LDAFTNLIV+YSST  PSLPFPPP
Sbjct  611  AIYPLLISYSSPNKQAFPRHTLSRAALTMSESPIFLLDAFTNLIVYYSSTADPSLPFPPP  670

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
             DCLLRT IN LKQ+RCI+PKL F+R GQDD++ FEN+LIEEQDV+G+G+ S  GF+SF 
Sbjct  671  HDCLLRTKINALKQDRCITPKLTFVRGGQDDSSLFENYLIEEQDVDGSGYASGNGFISFR  730

Query  337  EEIHQSVLEYMK  302
            E I   V E +K
Sbjct  731  EGIRNEVAEILK  742



>ref|XP_004961931.1| PREDICTED: uncharacterized protein C4.03c-like [Setaria italica]
Length=747

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AIYP+L SY+SPDKQA+PRH+LSRAALI S SPIF LDAFTNLIV+YSST  PS+PFPPP
Sbjct  611  AIYPVLISYSSPDKQAFPRHTLSRAALIMSESPIFLLDAFTNLIVYYSSTADPSIPFPPP  670

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            +DCLLRTTINKLKQ+RCI+PKL FI   +DD+T FE++LIEEQDV+G+GFT+  GFV+F 
Sbjct  671  RDCLLRTTINKLKQDRCITPKLTFIHGAKDDSTLFESYLIEEQDVDGSGFTTGSGFVAFR  730

Query  337  EEIHQSVLEYMK  302
            E +     E ++
Sbjct  731  ESVRNVAAEIVQ  742



>emb|CAN62128.1| hypothetical protein VITISV_037581 [Vitis vinifera]
Length=746

 Score =   195 bits (496),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 109/134 (81%), Gaps = 11/134 (8%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H A+YP +          +  H LSRAALITSGSPIFFLDAFT LIVFYSST  P LP+P
Sbjct  624  HRAVYPHI----------HATH-LSRAALITSGSPIFFLDAFTTLIVFYSSTADPILPYP  672

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PP DCLLRTTINKLKQER I+PKL+FIR GQDDAT FEN+LIEEQDVEG+G TS+MGFVS
Sbjct  673  PPHDCLLRTTINKLKQERSITPKLLFIRGGQDDATAFENYLIEEQDVEGSGLTSVMGFVS  732

Query  343  FLEEIHQSVLEYMK  302
            FLE+I +SVLEYMK
Sbjct  733  FLEDITRSVLEYMK  746



>ref|XP_008647340.1| PREDICTED: uncharacterized protein LOC100192686 isoform X1 [Zea 
mays]
 gb|ACN28654.1| unknown [Zea mays]
 gb|AFW78123.1| hypothetical protein ZEAMMB73_612731 [Zea mays]
Length=747

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AIYP+L SY+SPDKQA+PRH+LSRAALI S SPIF LD FTNLIV+YSST  PS PFPPP
Sbjct  611  AIYPVLISYSSPDKQAFPRHTLSRAALIMSESPIFLLDTFTNLIVYYSSTADPSFPFPPP  670

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            +DCLLRTTINKLKQ+RCI+PKL FI  G+DD+T FE++LIEEQDV+G+G T+  GFV+F 
Sbjct  671  RDCLLRTTINKLKQDRCITPKLTFIHGGEDDSTLFESYLIEEQDVDGSGLTTGSGFVAFR  730

Query  337  EEIHQSVLEYMK  302
            E +     E ++
Sbjct  731  ESVRNVAGEIIQ  742



>ref|XP_002441179.1| hypothetical protein SORBIDRAFT_09g021790 [Sorghum bicolor]
 gb|EES19609.1| hypothetical protein SORBIDRAFT_09g021790 [Sorghum bicolor]
Length=747

 Score =   192 bits (487),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            A+YP+L SY+SPDKQA+PRH+LSRAALI S SPIF LD FTNLIV+Y ST  PS+PFPPP
Sbjct  611  AVYPVLVSYSSPDKQAFPRHTLSRAALIMSESPIFLLDTFTNLIVYYLSTADPSIPFPPP  670

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            +DCLLRTTIN+LKQ+RCI+PKL FI  G+DD+T FE++LIEEQDV+G+GFT+  GFV+F 
Sbjct  671  RDCLLRTTINRLKQDRCITPKLTFIHGGKDDSTLFESYLIEEQDVDGSGFTTGSGFVAFR  730

Query  337  EEIHQSVLEYMK  302
            E +     E ++
Sbjct  731  ESVRNVAGEIIQ  742



>ref|XP_006655364.1| PREDICTED: protein transport protein SEC24-like [Oryza brachyantha]
Length=681

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            A+YP+L SY+SPDKQA+PRH+LSRAALI S SPIF LDAFTNLIV+YSST  PS+PFPPP
Sbjct  545  AMYPVLISYSSPDKQAFPRHTLSRAALIMSESPIFLLDAFTNLIVYYSSTADPSVPFPPP  604

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            +DCLLR  I++LK+ RCI+PKL FI  G++D+T FE++LIEEQDV+G+GFT+  GFVSF 
Sbjct  605  RDCLLRNKIDELKKNRCITPKLTFIHGGREDSTLFESYLIEEQDVDGSGFTTDKGFVSFR  664

Query  337  EEIHQSVLEYMK  302
            E I Q+  E ++
Sbjct  665  ESIRQAAAEIIE  676



>gb|AAT69610.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAU90101.1| unknown protein [Oryza sativa Japonica Group]
Length=538

 Score =   187 bits (475),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AIYP+L SY+SPDKQA+PRH+LSRAALI S SPIF LDAFTNLIV+YS +  PSLPFPPP
Sbjct  402  AIYPVLVSYSSPDKQAFPRHTLSRAALIMSESPIFLLDAFTNLIVYYSPSADPSLPFPPP  461

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
             DCLLRT +N+LKQ RCI+PKL FI  G++D   FE +LIEEQDV+G GFTS  GFVSF 
Sbjct  462  HDCLLRTMVNELKQGRCITPKLTFIHGGREDPALFERYLIEEQDVDGTGFTSGKGFVSFR  521

Query  337  EEIHQSVLEYMK  302
            E I  +  + ++
Sbjct  522  ESIRHAATDIIE  533



>ref|XP_001757713.1| predicted protein [Physcomitrella patens]
 gb|EDQ77353.1| predicted protein [Physcomitrella patens]
Length=754

 Score =   189 bits (479),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            A+YP+L+S+ + DK A+PRH LSRAALITSGSPIFFLDAFT LIV+YS+T  P+LPFPPP
Sbjct  623  AVYPVLSSFETLDKPAFPRHLLSRAALITSGSPIFFLDAFTTLIVYYSATADPALPFPPP  682

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            Q+C LR+ IN+LKQER I+PKL+ IR G D+  PF+ +LIEEQDV+GNG  + +GFV+FL
Sbjct  683  QNCGLRSIINRLKQERNITPKLLIIRGGHDNTDPFDRYLIEEQDVDGNGIATGVGFVAFL  742

Query  337  EEIHQSVLEYMK  302
            ++I   V++YMK
Sbjct  743  DQIAHDVMKYMK  754



>gb|EAY98220.1| hypothetical protein OsI_20132 [Oryza sativa Indica Group]
Length=747

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AIYP+L SY+SPDKQA+PRH+LSRAALI S SPIF LDAFTNLIV+YS +  PSLPFPPP
Sbjct  611  AIYPVLVSYSSPDKQAFPRHTLSRAALIMSESPIFLLDAFTNLIVYYSPSADPSLPFPPP  670

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
             DCLLRT IN+LKQ RCI+PKL FI  G++D   FE +LIEEQDV+G GFTS  GFVSF 
Sbjct  671  HDCLLRTMINELKQGRCITPKLTFIHGGREDPALFERYLIEEQDVDGTGFTSGKGFVSFR  730

Query  337  EEIHQSVLEYMK  302
            E I  +  + ++
Sbjct  731  ESIRHAATDIIE  742



>gb|EEE63885.1| hypothetical protein OsJ_18710 [Oryza sativa Japonica Group]
Length=747

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AIYP+L SY+SPDKQA+PRH+LSRAALI S SPIF LDAFTNLIV+YS +  PSLPFPPP
Sbjct  611  AIYPVLVSYSSPDKQAFPRHTLSRAALIMSESPIFLLDAFTNLIVYYSPSADPSLPFPPP  670

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
             DCLLRT +N+LKQ RCI+PKL FI  G++D   FE +LIEEQDV+G GFTS  GFVSF 
Sbjct  671  HDCLLRTMVNELKQGRCITPKLTFIHGGREDPALFERYLIEEQDVDGTGFTSGKGFVSFR  730

Query  337  EEIHQSVLEYMK  302
            E I  +  + ++
Sbjct  731  ESIRHAATDIIE  742



>ref|NP_001055673.1| Os05g0443300 [Oryza sativa Japonica Group]
 dbj|BAF17587.1| Os05g0443300 [Oryza sativa Japonica Group]
Length=761

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AIYP+L SY+SPDKQA+PRH+LSRAALI S SPIF LDAFTNLIV+YS +  PSLPFPPP
Sbjct  625  AIYPVLVSYSSPDKQAFPRHTLSRAALIMSESPIFLLDAFTNLIVYYSPSADPSLPFPPP  684

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
             DCLLRT +N+LKQ RCI+PKL FI  G++D   FE +LIEEQDV+G GFTS  GFVSF 
Sbjct  685  HDCLLRTMVNELKQGRCITPKLTFIHGGREDPALFERYLIEEQDVDGTGFTSGKGFVSFR  744

Query  337  EEIHQSVLEYMK  302
            E I  +  + ++
Sbjct  745  ESIRHAATDIIE  756



>gb|AFW81781.1| hypothetical protein ZEAMMB73_245204 [Zea mays]
Length=746

 Score =   186 bits (473),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AIYP+L SY+SPDKQA+PRH+LS AALI S SPIF LD FTNLIV+YSST  PS+PFPPP
Sbjct  610  AIYPVLISYSSPDKQAFPRHTLSHAALIMSESPIFLLDTFTNLIVYYSSTADPSVPFPPP  669

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
             DCLLR TIN LKQ+RCI+PKL FI  G+DD+T FE++LIEEQDV+G+G T+  GFV+F 
Sbjct  670  HDCLLRKTINGLKQDRCITPKLTFIHGGKDDSTLFESYLIEEQDVDGSGLTTGSGFVAFR  729

Query  337  EEIHQSVLEYMK  302
            E +     E ++
Sbjct  730  ESVRNVAGEIIQ  741



>ref|NP_001170139.1| uncharacterized protein LOC100384066 [Zea mays]
 gb|ACN35960.1| unknown [Zea mays]
Length=746

 Score =   186 bits (473),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AIYP+L SY+SPDKQA+PRH+LS AALI S SPIF LD FTNLIV+YSST  PS+PFPPP
Sbjct  610  AIYPVLISYSSPDKQAFPRHTLSHAALIMSESPIFLLDTFTNLIVYYSSTADPSVPFPPP  669

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
             DCLLR TIN LKQ+RCI+PKL FI  G+DD+T FE++LIEEQDV+G+G T+  GFV+F 
Sbjct  670  HDCLLRKTINGLKQDRCITPKLTFIHGGKDDSTLFESYLIEEQDVDGSGLTTGSGFVAFR  729

Query  337  EEIHQSVLEYMK  302
            E +     E ++
Sbjct  730  ESVRNVAGEIIQ  741



>ref|XP_003568355.1| PREDICTED: protein transport protein sec24 [Brachypodium distachyon]
Length=746

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AIYP+L SY+SP+KQA+PRH+LSRAAL  S SPIF LDAFTNLIV+YSST  PSLPFPPP
Sbjct  610  AIYPVLISYSSPNKQAFPRHTLSRAALTMSESPIFLLDAFTNLIVYYSSTADPSLPFPPP  669

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
             DCLLRT IN LKQ+RCI+PKL F+R GQDD++ FEN+LIEEQDV+   FT+  GF+SF 
Sbjct  670  HDCLLRTKINVLKQDRCITPKLAFVRGGQDDSSLFENYLIEEQDVDDLRFTAGKGFISFR  729

Query  337  EEIH  326
            E I 
Sbjct  730  EGIR  733



>ref|XP_002968253.1| hypothetical protein SELMODRAFT_440407 [Selaginella moellendorffii]
 gb|EFJ30507.1| hypothetical protein SELMODRAFT_440407 [Selaginella moellendorffii]
Length=733

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 105/131 (80%), Gaps = 2/131 (2%)
 Frame = -2

Query  694  IYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPPQ  515
            +YP+L+SY SPDKQAYPRHSLSRAALITSGSPIFFLDA+T LIV+Y+ST  P+L FPPP 
Sbjct  605  VYPLLSSYTSPDKQAYPRHSLSRAALITSGSPIFFLDAYTLLIVYYASTADPALSFPPPH  664

Query  514  DCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFLE  335
               LR  INKLKQER ++PKL  IRAG D+  PFE  LIEEQDV  NG  +  GFVSFL+
Sbjct  665  KSALRELINKLKQERSVTPKLYMIRAGFDNVEPFERHLIEEQDV--NGAPTGTGFVSFLD  722

Query  334  EIHQSVLEYMK  302
            EI +SVLE+MK
Sbjct  723  EIARSVLEHMK  733



>ref|XP_002976124.1| hypothetical protein SELMODRAFT_104389 [Selaginella moellendorffii]
 gb|EFJ23029.1| hypothetical protein SELMODRAFT_104389 [Selaginella moellendorffii]
Length=740

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 105/131 (80%), Gaps = 2/131 (2%)
 Frame = -2

Query  694  IYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPPQ  515
            +YP+L+SY SPDKQAYPRHSLSRAALITSGSPIFFLDA+T LIV+Y+ST  P+L FPPP 
Sbjct  612  VYPLLSSYTSPDKQAYPRHSLSRAALITSGSPIFFLDAYTLLIVYYASTADPALSFPPPH  671

Query  514  DCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFLE  335
               LR  INKLKQER ++PKL  IRAG D+  PFE  LIEEQDV  NG  +  GFVSFL+
Sbjct  672  KSALRELINKLKQERSVTPKLYMIRAGFDNVEPFERHLIEEQDV--NGAPTGTGFVSFLD  729

Query  334  EIHQSVLEYMK  302
            EI +SVLE+MK
Sbjct  730  EIARSVLEHMK  740



>ref|XP_010557420.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
Length=734

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 110/134 (82%), Gaps = 6/134 (4%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H AIYP LTSY+SPDKQAYPRHSLSRAALITSGSPIFFLDA+T +IV YSST  PSLPFP
Sbjct  607  HRAIYPELTSYSSPDKQAYPRHSLSRAALITSGSPIFFLDAYTTVIVLYSSTADPSLPFP  666

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVS  344
            PPQDCLLR  I KLK+ER I+PKLMFIR GQDD T FEN+L+EEQD  G      +GFVS
Sbjct  667  PPQDCLLRKKIKKLKEERSITPKLMFIRGGQDDPTAFENYLLEEQDFNG------IGFVS  720

Query  343  FLEEIHQSVLEYMK  302
            FLE + QSV +Y+K
Sbjct  721  FLENVTQSVADYLK  734



>ref|XP_001777420.1| predicted protein [Physcomitrella patens]
 gb|EDQ57824.1| predicted protein [Physcomitrella patens]
Length=749

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            A+YP+L+S+ + D++AYPRHSLSRAAL+ +GSPI+ LDAFT LIV+YS T  P+LPFPPP
Sbjct  618  AVYPVLSSFETLDRRAYPRHSLSRAALMVNGSPIYVLDAFTTLIVYYSPTADPALPFPPP  677

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            Q+C LR+ INKLKQER I+PKL+ IR G+D+   F+ +LIEEQ+V+G+G  + +GFVSFL
Sbjct  678  QNCGLRSMINKLKQERNITPKLLMIRGGRDNTEAFDRYLIEEQEVDGSGIGTGVGFVSFL  737

Query  337  EEIHQSVLEYMK  302
            ++I   V++YMK
Sbjct  738  DDIAHDVMKYMK  749



>gb|EPS57992.1| hypothetical protein M569_16825 [Genlisea aurea]
Length=130

 Score =   166 bits (420),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 100/126 (79%), Gaps = 2/126 (2%)
 Frame = -2

Query  676  SYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSS-TTGPSLPFPPPQDCLLR  500
            S+ SPDK+AYPRHSLSRAALITSGSPIF LDAFT+L+VFYSS     SL FPPP DCLLR
Sbjct  2    SFESPDKEAYPRHSLSRAALITSGSPIFLLDAFTSLVVFYSSGADSSSLAFPPPHDCLLR  61

Query  499  TTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFLEEIHQS  320
            + INK KQ+R I+PK+++++ G+DDATPFEN+LIEE+  +G G  S +GFVSFL++I   
Sbjct  62   SRINKTKQDRIITPKVVYLQGGKDDATPFENYLIEEE-RDGGGSGSTVGFVSFLDDIGHD  120

Query  319  VLEYMK  302
            V    K
Sbjct  121  VRRRYK  126



>ref|XP_001777387.1| predicted protein [Physcomitrella patens]
 gb|EDQ57791.1| predicted protein [Physcomitrella patens]
Length=355

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 109/174 (63%), Gaps = 42/174 (24%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            A+YP+L+S+ + D++AYPRHSLSRAAL+ +GSPI+ LDAFT LIV+YS T  P+LPFPPP
Sbjct  182  AVYPVLSSFETLDRRAYPRHSLSRAALMVNGSPIYVLDAFTTLIVYYSPTADPALPFPPP  241

Query  517  QDCL------------------------------------------LRTTINKLKQERCI  464
            Q+C                                           LR+ INKLKQER I
Sbjct  242  QNCKTFWKSHPVDVEVIALCEHALTRTWHNGFERHLVVAVAVASGGLRSMINKLKQERNI  301

Query  463  SPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFLEEIHQSVLEYMK  302
            +PKL+ IR G+D+   F+ +LIEEQ+V+G+G  + +GFVSFL++I   V++YMK
Sbjct  302  TPKLLMIRGGRDNTEAFDRYLIEEQEVDGSGIGTGVGFVSFLDDIAHDVMKYMK  355



>ref|NP_001131363.1| uncharacterized protein LOC100192686 [Zea mays]
 gb|ACF79745.1| unknown [Zea mays]
Length=109

 Score =   144 bits (363),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = -2

Query  610  SGSPIFFLDAFTNLIVFYSSTTGPSLPFPPPQDCLLRTTINKLKQERCISPKLMFIRAGQ  431
            S SPIF LD FTNLIV+YSST  PS PFPPP+DCLLRTTINKLKQ+RCI+PKL FI  G+
Sbjct  2    SESPIFLLDTFTNLIVYYSSTADPSFPFPPPRDCLLRTTINKLKQDRCITPKLTFIHGGE  61

Query  430  DDATPFENFLIEEQDVEGNGFTSIMGFVSFLEEIHQSVLEYMK  302
            DD+T FE++LIEEQDV+G+G T+  GFV+F E +     E ++
Sbjct  62   DDSTLFESYLIEEQDVDGSGLTTGSGFVAFRESVRNVAGEIIQ  104



>ref|XP_002489113.1| hypothetical protein SORBIDRAFT_0067s002270 [Sorghum bicolor]
 gb|EES20534.1| hypothetical protein SORBIDRAFT_0067s002270 [Sorghum bicolor]
Length=206

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 93/130 (72%), Gaps = 1/130 (1%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AI+P L SY+SPD +A    SLSR  + TS  PIF LDA+ +L+V+YS T    +PFPPP
Sbjct  76   AIWPTLISYSSPDVEAEVHQSLSRT-VFTSERPIFLLDAYKDLLVYYSPTASSEIPFPPP  134

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            +DCLLR+T+++LKQER I+PKL+FI+   DD T FE +L+E+Q ++G+   S  GF SFL
Sbjct  135  RDCLLRSTVDRLKQERNITPKLVFIQGAHDDTTEFEKYLVEDQTLDGSLLPSSTGFSSFL  194

Query  337  EEIHQSVLEY  308
            +E+   V E+
Sbjct  195  DEVRSKVAEH  204



>gb|EEC77245.1| hypothetical protein OsI_15817 [Oryza sativa Indica Group]
Length=739

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AI P L SY+SPD +A    SLSR+ +  S SPIF LDA+T+L+V+YS T   ++PFPPP
Sbjct  609  AICPTLISYSSPDVEAEVHQSLSRS-VFNSESPIFLLDAYTDLLVYYSPTVSSTIPFPPP  667

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            +DCLLR+ I++LKQER I+PKL+FI    DD T FE +LIE+Q V+G+   S  GF SFL
Sbjct  668  RDCLLRSKIDRLKQERNITPKLVFIHGAHDDTTAFERYLIEDQSVDGSLVASATGFRSFL  727

Query  337  EEIHQSVLEYMK  302
            E I   + EY +
Sbjct  728  EGIRSRIAEYSR  739



>gb|EEE60965.1| hypothetical protein OsJ_14735 [Oryza sativa Japonica Group]
Length=739

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AI P L SY+SPD +A    SLSR+ +  S SPIF LDA+T+L+V+YS T   ++PFPPP
Sbjct  609  AICPTLISYSSPDVEAEVHQSLSRS-VFNSESPIFLLDAYTDLLVYYSPTVSSTIPFPPP  667

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            +DCLLR+ I++LKQER I+PKL+FI    DD T FE +LIE+Q V+G+   S  GF SFL
Sbjct  668  RDCLLRSKIDRLKQERNITPKLVFIHGAHDDTTAFERYLIEDQSVDGSLVASATGFRSFL  727

Query  337  EEIHQSVLEYMK  302
            E I   + EY +
Sbjct  728  EGIRSRIAEYSR  739



>ref|NP_001052744.1| Os04g0412900 [Oryza sativa Japonica Group]
 emb|CAD40593.2| OJ000126_13.4 [Oryza sativa Japonica Group]
 dbj|BAF14658.1| Os04g0412900 [Oryza sativa Japonica Group]
Length=739

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AI P L SY+SPD +A    SLSR+ +  S SPIF LDA+T+L+V+YS T   ++PFPPP
Sbjct  609  AICPTLISYSSPDVEAEVHQSLSRS-VFNSESPIFLLDAYTDLLVYYSPTVSSTIPFPPP  667

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            +DCLLR+ I++LKQER I+PKL+FI    DD T FE +LIE+Q V+G+   S  GF SFL
Sbjct  668  RDCLLRSKIDRLKQERNITPKLVFIHGAHDDTTAFERYLIEDQSVDGSLVASATGFRSFL  727

Query  337  EEIHQSVLEYMK  302
            E I   + EY +
Sbjct  728  EGIRSRIAEYSR  739



>emb|CAH67359.1| OSIGBa0134P10.5 [Oryza sativa Indica Group]
Length=739

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AI P L SY+SPD +A    SLSR+ +  S SPIF LDA+T+L+V+YS T   ++PFPPP
Sbjct  609  AICPTLISYSSPDVEAEVHQSLSRS-VFNSESPIFLLDAYTDLLVYYSPTVSSTIPFPPP  667

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            +DCLLR+ I++LKQER I+PKL+FI    DD T FE +LIE+Q V+G+   S  GF SFL
Sbjct  668  RDCLLRSKIDRLKQERNITPKLVFIHGAHDDTTAFERYLIEDQSVDGSLVASATGFRSFL  727

Query  337  EEIHQSVLEYMK  302
            E I   + EY +
Sbjct  728  EGIRSRIAEYSR  739



>dbj|BAK03991.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=740

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 92/130 (71%), Gaps = 1/130 (1%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AI P L+SY+SPD +A    SLSR  + TS  PIF LDA+T+L+V+Y  T  PS+PFPPP
Sbjct  610  AICPTLSSYSSPDIEAEVHQSLSRG-VFTSERPIFLLDAYTDLLVYYLPTASPSIPFPPP  668

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            +DCLLR+TI++LKQER ++P+L FI    DD T FE +LIE++ ++G    S  GF SFL
Sbjct  669  RDCLLRSTIDRLKQERTLTPRLAFIHGAHDDTTTFEKYLIEDRALDGTLLDSSTGFRSFL  728

Query  337  EEIHQSVLEY  308
            EE+   V E+
Sbjct  729  EEVRSRVTEF  738



>ref|XP_004975570.1| PREDICTED: protein transport protein Sec24C-like [Setaria italica]
Length=739

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 93/130 (72%), Gaps = 1/130 (1%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AI+P L SY SPD +A    SLSR  + TS SPIF LDA+ +L+V+YS T    +PFPPP
Sbjct  609  AIWPSLISYFSPDVEAEVHQSLSRT-VFTSESPIFLLDAYKDLLVYYSPTASSEIPFPPP  667

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            +DCLLR+TI++LKQER I+P+L+ I   +DD T FE +L+E+Q ++G+  +S  GF SFL
Sbjct  668  RDCLLRSTIDRLKQERNITPRLVLIHGARDDTTEFEKYLVEDQSLDGSWLSSSTGFSSFL  727

Query  337  EEIHQSVLEY  308
            +E+   V E+
Sbjct  728  DEVRSKVAEH  737



>ref|XP_008663179.1| PREDICTED: protein transport protein SEC24-like [Zea mays]
Length=740

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 93/130 (72%), Gaps = 1/130 (1%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AI+P L SY+SPD +A    SLSR  + TS  PI+ LDA+ +L+V+YS T    +PFPPP
Sbjct  610  AIWPTLISYSSPDVEAEVHQSLSRT-VFTSERPIYILDAYKDLLVYYSPTASSEIPFPPP  668

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            ++CLLR+T+++LKQER I+PKL+FI    DD T FE +L+E+Q ++G+  +S  GF SFL
Sbjct  669  RNCLLRSTVDRLKQERNITPKLVFIHGAHDDTTEFEKYLVEDQTLDGSPLSSSTGFSSFL  728

Query  337  EEIHQSVLEY  308
            +E+   V E+
Sbjct  729  DEVRSKVAEH  738



>gb|EMT28162.1| Protein transport protein Sec24B [Aegilops tauschii]
Length=726

 Score =   139 bits (349),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 92/130 (71%), Gaps = 1/130 (1%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AI P L+SY+S D +A    SLSR+ + TS  PIF LDA+T+L+V+Y  T  PS+PFPPP
Sbjct  596  AICPTLSSYSSLDTEAEVHQSLSRS-VFTSERPIFLLDAYTDLLVYYLPTASPSIPFPPP  654

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            +DCLLR+T+++LKQER ++P+L FI   +DD T FE +LIE++ ++G       GF SFL
Sbjct  655  RDCLLRSTVDRLKQERALTPRLAFIHGARDDTTTFEKYLIEDRGLDGTQLDGSTGFRSFL  714

Query  337  EEIHQSVLEY  308
            EE+   V E+
Sbjct  715  EEVRSRVAEF  724



>ref|XP_003579703.1| PREDICTED: protein transport protein SEC24-like [Brachypodium 
distachyon]
Length=739

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 90/130 (69%), Gaps = 1/130 (1%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AI P + SY SPD +A    SLSR+ + TS  PIF LDA+T+L+V+Y  T    +PFPPP
Sbjct  609  AICPTMISYISPDIEAEVHQSLSRS-VFTSERPIFLLDAYTDLLVYYLPTASTLIPFPPP  667

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            +DCLLR+TIN+LKQER ++P+L+FI    DD T FE +LIE++ ++G    S  GF SFL
Sbjct  668  RDCLLRSTINRLKQERNLTPRLVFIHGAHDDTTIFEKYLIEDETLDGTLVGSSAGFRSFL  727

Query  337  EEIHQSVLEY  308
            EE+   V E+
Sbjct  728  EEVRSRVAEF  737



>gb|EMS67454.1| Protein transport protein Sec24A [Triticum urartu]
Length=800

 Score =   134 bits (336),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 89/122 (73%), Gaps = 1/122 (1%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AI P L+SY+S D +A    SLSR+ + TS  PIF LDA+T+L+V+Y  T  PS+PFPPP
Sbjct  649  AICPTLSSYSSLDTEAEVHQSLSRS-VFTSERPIFLLDAYTDLLVYYLPTASPSIPFPPP  707

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            +DCLLR+T+++LKQER ++P+L FI   +DD T FE +LIE++ ++G      +GF SFL
Sbjct  708  RDCLLRSTVDRLKQERTLTPRLAFIHGARDDTTTFEKYLIEDRALDGTLLVGSIGFRSFL  767

Query  337  EE  332
            EE
Sbjct  768  EE  769



>ref|XP_005650920.1| vWA-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE26376.1| vWA-like protein [Coccomyxa subellipsoidea C-169]
Length=828

 Score =   122 bits (305),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 66/132 (50%), Positives = 92/132 (70%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            A+YP+LTS+++PD  AYPRHSLSRAAL TSG PIF L+AFT +IV+Y ++T P LPFPPP
Sbjct  690  AVYPLLTSFSNPDTLAYPRHSLSRAALTTSGVPIFLLNAFTEVIVYYMASTPPDLPFPPP  749

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            Q  LLR  +N ++  R ++P+L  +R G D+  PF   LIEE ++  +G  +  G V FL
Sbjct  750  QTSLLRRKVNAVRAARRLTPQLRMLREGVDEVAPFMRHLIEEPEMGADGKVAFPGMVQFL  809

Query  337  EEIHQSVLEYMK  302
             ++   V EY++
Sbjct  810  YDVQTEVWEYLQ  821



>gb|KDO58107.1| hypothetical protein CISIN_1g0053622mg, partial [Citrus sinensis]
Length=175

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            A+YP+LTSY++PDKQA+PRHSLSRAALITSGSPIF LDAFT +IVFYSST  P+LPFPPP
Sbjct  103  AVYPLLTSYSTPDKQAFPRHSLSRAALITSGSPIFLLDAFTTIIVFYSSTADPTLPFPPP  162

Query  517  QDC  509
            QDC
Sbjct  163  QDC  165



>gb|KJB21718.1| hypothetical protein B456_004G010100 [Gossypium raimondii]
Length=698

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H AIYP+LTSY++PDKQAYPRHSLSRAALITSGSPIFFLDA+T LIVFYSST  PSLPFP
Sbjct  613  HRAIYPVLTSYSTPDKQAYPRHSLSRAALITSGSPIFFLDAYTTLIVFYSSTADPSLPFP  672

Query  523  PPQDCLLRTTINK  485
            PP DC L   ++K
Sbjct  673  PPHDCKLFYHLHK  685



>ref|XP_002501401.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62659.1| predicted protein [Micromonas sp. RCC299]
Length=806

 Score =   103 bits (257),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 58/136 (43%), Positives = 87/136 (64%), Gaps = 7/136 (5%)
 Frame = -2

Query  694  IYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYS----STTGPSLPF  527
            +YP L+SYA  D QA+PRHSL+R A+ TS   +F +DAF  ++VFY+     +   SLP+
Sbjct  671  LYPRLSSYADVDTQAFPRHSLTRTAVTTSNGAVFLVDAFDVVVVFYAPAQPGSERASLPY  730

Query  526  PPPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEG-NGFTSIMGF  350
            PPPQ   +R  +N L++ER ++P++++IR G +D + F + LIEE DV+G  G  S  GF
Sbjct  731  PPPQGSAVRAAVNALREEREVTPRVVYIRGGAEDPSAFHDLLIEELDVDGLEGGAS--GF  788

Query  349  VSFLEEIHQSVLEYMK  302
            V FL  +      +M+
Sbjct  789  VGFLHTVESQARRFMR  804



>dbj|GAM18106.1| hypothetical protein SAMD00019534_012810 [Acytostelium subglobosum 
LB1]
Length=742

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 66/118 (56%), Gaps = 2/118 (2%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            H AIYP L +Y +P+  AY    LS  ++  S S I+ +DA+  +IV+YS       PFP
Sbjct  612  HRAIYPTLNTYGAPNNLAYKYLPLSENSISVSVSHIYLMDAYDKMIVYYSPQVSSQHPFP  671

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRA--GQDDATPFENFLIEEQDVEGNGFTSIM  356
            PP D L+R TI   KQ+R + P++++ R     +    F ++LIEE + +G  F   +
Sbjct  672  PPADSLIRQTIANSKQDRLVVPEIIYTRGHLSSEGGRQFSDYLIEEDNWQGQSFNEFL  729



>ref|XP_002947745.1| hypothetical protein VOLCADRAFT_87927 [Volvox carteri f. nagariensis]
 gb|EFJ51278.1| hypothetical protein VOLCADRAFT_87927 [Volvox carteri f. nagariensis]
Length=815

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 71/105 (68%), Gaps = 1/105 (1%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALIT-SGSPIFFLDAFTNLIVFYSSTTGPSLPFPP  521
            A+YP++ SY +PD+ AYPRHSLSRAAL      PIF LDA+  ++V+Y+S   P +PFPP
Sbjct  649  AVYPVMQSYTTPDQLAYPRHSLSRAALAGPDAPPIFLLDAYILIMVYYTSRCPPEVPFPP  708

Query  520  PQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQD  386
            PQ   LR  +  ++ ER I+P++  +R G +D+  F+  L++E D
Sbjct  709  PQQSALRKAVAAIRSERRITPQVKILREGGEDSELFDQLLLDEPD  753



>gb|AFW58189.1| hypothetical protein ZEAMMB73_262773 [Zea mays]
Length=707

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 69/130 (53%), Gaps = 34/130 (26%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            AI+P L SY+SPD +A    SLSR                    VF S            
Sbjct  610  AIWPTLISYSSPDVEAEVHQSLSRT-------------------VFTS------------  638

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
               LLR+T+++LKQER I+PKL+FI    DD T FE +L+E+Q ++G+  +S  GF SFL
Sbjct  639  ---LLRSTVDRLKQERNITPKLVFIHGAHDDTTEFEKYLVEDQTLDGSPLSSSTGFSSFL  695

Query  337  EEIHQSVLEY  308
            +E+   V E+
Sbjct  696  DEVRSKVAEH  705



>ref|XP_003058885.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57340.1| predicted protein [Micromonas pusilla CCMP1545]
Length=818

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 47/150 (31%), Positives = 75/150 (50%), Gaps = 19/150 (13%)
 Frame = -2

Query  694  IYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLP----F  527
            +YP L+S+ S D+   P  SL+RAAL TS +P++ LDA   L+VF       S P    F
Sbjct  665  LYPSLSSWRSADEMECPSRSLTRAALATSDAPLWLLDAHAELVVFLKPRDDGSAPGDVIF  724

Query  526  PPPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQD-------------  386
            PP +D  LR  ++  ++ R ++PK+ F+    +DA+ F   L+EE+              
Sbjct  725  PPSRDSKLRAVVDAARETRRVTPKVRFVNGAVEDASAFYERLVEEESAELGGGGDGLAGE  784

Query  385  --VEGNGFTSIMGFVSFLEEIHQSVLEYMK  302
              +EG       GFV FL    ++   +++
Sbjct  785  GAIEGGSSHERDGFVGFLARTERTARTFLR  814



>ref|XP_646591.1| hypothetical protein DDB_G0271044 [Dictyostelium discoideum AX4]
 gb|EAL72872.1| hypothetical protein DDB_G0271044 [Dictyostelium discoideum AX4]
Length=782

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 74/131 (56%), Gaps = 8/131 (6%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYS-STTGPSLPF  527
            H +IYP+L SY +P+  A     LS+  ++TS S I+ +D+F  L+VFY+         F
Sbjct  654  HRSIYPVLYSYGAPNNLASKYLPLSQNTILTSTSHIYLVDSFDQLVVFYNLQEVSSHHQF  713

Query  526  PPPQDCLLRTTINKLKQERCISPKLMFIRAGQ-DDATPFENFLIEEQDVEGNGFTSIMGF  350
            PPP + L+R TI+  KQ+R I P++ +++    ++   F  FLI+E++  G        F
Sbjct  714  PPPPESLIRQTISNSKQDRLIVPEIQYLKGKLIENPIEFTKFLIDEENNAG------PSF  767

Query  349  VSFLEEIHQSV  317
             +FL +I  +V
Sbjct  768  YNFLRDISSNV  778



>ref|XP_004350752.1| hypothetical protein DFA_11807 [Dictyostelium fasciculatum]
 gb|EGG14044.1| hypothetical protein DFA_11807 [Dictyostelium fasciculatum]
Length=752

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 75/125 (60%), Gaps = 4/125 (3%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSL-PF  527
            H AIYP+L++Y +P+  A    +LS   + ++ S I+ LDA+  L+V+Y+     ++  F
Sbjct  620  HRAIYPVLSTYGAPNNLASKYLTLSTTTITSNISHIYLLDAYDTLMVYYAPQAVSNMYMF  679

Query  526  PPPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFV  347
            PPP D L+R TI+  KQ+R I P + + +   +    F  +L+E+++ +GN +   + F+
Sbjct  680  PPPPDSLIRQTISNSKQDRLIVPSVEYTKGPLEQVGQFRQYLVEDENTDGNSY---IQFI  736

Query  346  SFLEE  332
            + +EE
Sbjct  737  NSVEE  741



>ref|XP_003284541.1| hypothetical protein DICPUDRAFT_96735 [Dictyostelium purpureum]
 gb|EGC38976.1| hypothetical protein DICPUDRAFT_96735 [Dictyostelium purpureum]
Length=778

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 76/143 (53%), Gaps = 18/143 (13%)
 Frame = -2

Query  703  HLAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLP--  530
            H A+YP+L SY +P+  A     LS   ++TS S I+ +D+F +L+VFY+    P  P  
Sbjct  642  HRALYPVLYSYGAPNNLASKYLPLSINTILTSTSNIYLVDSFDSLVVFYN--LQPESPQQ  699

Query  529  --------FPPPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGN  374
                    FPPP + L+R TI+  KQ+R I P++ +++   ++   F  +LIEE+   G 
Sbjct  700  TQQQLQHQFPPPPESLIRQTISSSKQDRLIVPEIKYLKGKLNETPEFLKYLIEEETNAGE  759

Query  373  GFTSIMGFVSFLEEIHQSVLEYM  305
                   +  FL EI + + E +
Sbjct  760  ------PYYQFLNEIGKQIHENL  776



>ref|XP_005844187.1| hypothetical protein CHLNCDRAFT_139348 [Chlorella variabilis]
 gb|EFN52085.1| hypothetical protein CHLNCDRAFT_139348 [Chlorella variabilis]
Length=1236

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 49/109 (45%), Positives = 68/109 (62%), Gaps = 6/109 (6%)
 Frame = -2

Query  700   LAIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTT------GP  539
             +A+ P L+S+ASPD+ A  RHSLS AAL     PI+ LD F +LIV YS+T        P
Sbjct  1073  VAVCPQLSSWASPDEVAVWRHSLSAAALAVEQQPIWCLDTFQHLIVLYSATDFGLVGGPP  1132

Query  538   SLPFPPPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEE  392
                FPPP   LLR T+  ++Q R  +P+L+ +R G DD + F +FL+E+
Sbjct  1133  PPIFPPPAGSLLRRTLAGIRQVRRSTPELLLLRQGIDDISFFNSFLLED  1181



>ref|XP_005713593.1| unnamed protein product [Chondrus crispus]
 emb|CDF33774.1| unnamed protein product [Chondrus crispus]
Length=715

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 66/128 (52%), Gaps = 1/128 (1%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            A YP L S+ + D+++    +LS   +  SG PIF LDAF+ ++++Y+      L FPPP
Sbjct  584  AAYPRLFSFLNLDEKSIKALALSSLEVKQSGHPIFMLDAFSEVVIYYAQANRRDLTFPPP  643

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEEQDVEGNGFTSIMGFVSFL  338
            +  L+        ++R I+PK +  R G      F++ LIE+  V G    S   F+  +
Sbjct  644  ESSLIMRLRAASIRDRPITPKCIICREGTSKDRWFKSLLIEDP-VPGAAAQSFSAFIQGV  702

Query  337  EEIHQSVL  314
             +  Q +L
Sbjct  703  TDSAQELL  710



>gb|KFK32560.1| hypothetical protein AALP_AA6G258900 [Arabis alpina]
Length=47

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -2

Query  436  GQDDATPFENFLIEEQDVEGNGFTSIMGFVSFLEEIHQS  320
            GQD+AT FEN+LIEEQDV+G+ F S MGFVSFLE+I ++
Sbjct  8    GQDEATAFENYLIEEQDVDGSSFASAMGFVSFLEDISRN  46



>ref|XP_001694580.1| COP-II coat subunit [Chlamydomonas reinhardtii]
 gb|EDP02575.1| COP-II coat subunit [Chlamydomonas reinhardtii]
Length=825

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 61/102 (60%), Gaps = 17/102 (17%)
 Frame = -2

Query  697  AIYPMLTSYASPDKQAYPRHSLSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFPPP  518
            A+YP++ SY SPD+ AYPRHSLSRAAL                 V+Y++   P +PFPPP
Sbjct  597  AVYPVMQSYTSPDQLAYPRHSLSRAAL-----------------VYYTARCPPGIPFPPP  639

Query  517  QDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEE  392
            Q   LR  +  ++ ER I+P++  +R G +D+  F+  L++E
Sbjct  640  QQSALRKAVAAIRSERRITPQVKILREGGEDSELFDQLLLDE  681



>ref|XP_005839653.1| secretory protein Sec24B [Guillardia theta CCMP2712]
 gb|EKX52673.1| secretory protein Sec24B [Guillardia theta CCMP2712]
Length=725

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 70/141 (50%), Gaps = 11/141 (8%)
 Frame = -2

Query  694  IYPMLTSYASPDKQAYPRHS---LSRAALITSGSPIFFLDAFTNLIVFYSSTTGPSLPFP  524
            IYP L S+  P+  + P      L  + L  +   IF LD++T+L V+ ++    + P+P
Sbjct  586  IYPKLISFKDPNS-SQPSGGPLFLLNSTLDNATDGIFLLDSYTDLCVYCTAQGLETFPYP  644

Query  523  PPQDCLLRTTINKLKQERCISPKLMFIRAGQDDATPFENFLIEE--QDVEGNGFTSIMGF  350
            PP DC LRT I  +K+ R I P + + +A       F + LIEE       +G T  +G 
Sbjct  645  PPPDCGLRTYIQYIKENRAICPHVYYTKAKDGTEQDFISRLIEEPSHRTAESGATEWVGA  704

Query  349  VS-----FLEEIHQSVLEYMK  302
             +     FLE +   V E+++
Sbjct  705  AAKGYNVFLEVLGTEVKEFLE  725



>emb|CBN75666.1| conserved unknown protein [Ectocarpus siliculosus]
Length=753

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 43/147 (29%), Positives = 69/147 (47%), Gaps = 23/147 (16%)
 Frame = -2

Query  700  LAIYPMLTSYASPDKQAYPRHSLSRAALITSGSP---IFFLDAFTNLIVFYSSTTGP---  539
            +A+YP +  YA+PD +     SLSR A +T  SP   IF +D F  ++V Y+ +      
Sbjct  611  IALYPEMQGYATPDIRLANSLSLSRQA-VTEASPACRIFVVDTFWRVVVHYADSPASLAA  669

Query  538  -------SLPFPPPQDCLLRTTINKLKQERCISP----KLMFIRAGQDDATPFENFLIEE  392
                    LPFPP +D  +      L+  R + P    ++++ R G  +A  FE  L+E+
Sbjct  670  GEAAGEAPLPFPPSRDSAIG---QYLEMRRAVRPLAGQEVVYSRPGTPEAFFFEETLLED  726

Query  391  QDVEGNGFTSIMGFVSFLEEIHQSVLE  311
            + +          F  F  EI + VL+
Sbjct  727  RPLPRA--EKAETFKGFFAEIVRDVLQ  751



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1193157586335