BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF010M17

Length=766
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010683872.1|  PREDICTED: GATA transcription factor 8             155   2e-41   Beta vulgaris subsp. vulgaris [field beet]
gb|ACL52876.1|  unknown                                                 150   3e-41   Zea mays [maize]
ref|XP_007009854.1|  Plant-specific GATA-type zinc finger transcr...    155   4e-41   
ref|XP_010092608.1|  GATA transcription factor 9                        155   5e-41   Morus notabilis
ref|XP_008233316.1|  PREDICTED: GATA transcription factor 8             155   6e-41   Prunus mume [ume]
ref|XP_007218229.1|  hypothetical protein PRUPE_ppa007936mg             154   8e-41   Prunus persica
ref|XP_009344766.1|  PREDICTED: GATA transcription factor 8-like        154   8e-41   Pyrus x bretschneideri [bai li]
ref|XP_008347480.1|  PREDICTED: GATA transcription factor 8-like        154   9e-41   
ref|XP_008367332.1|  PREDICTED: GATA transcription factor 8-like        154   9e-41   Malus domestica [apple tree]
gb|KHG25368.1|  GATA transcription factor 8 -like protein               153   2e-40   Gossypium arboreum [tree cotton]
ref|XP_009770305.1|  PREDICTED: GATA transcription factor 8-like        151   2e-40   Nicotiana sylvestris
gb|KJB60582.1|  hypothetical protein B456_009G313700                    153   2e-40   Gossypium raimondii
ref|XP_004496271.1|  PREDICTED: GATA transcription factor 8-like ...    153   2e-40   Cicer arietinum [garbanzo]
ref|XP_009345388.1|  PREDICTED: GATA transcription factor 8-like        153   2e-40   Pyrus x bretschneideri [bai li]
ref|XP_007009853.1|  Plant-specific GATA-type zinc finger transcr...    154   3e-40   
ref|XP_006378769.1|  hypothetical protein POPTR_0010s23010g             153   3e-40   
ref|XP_009760862.1|  PREDICTED: GATA transcription factor 8-like        152   3e-40   Nicotiana sylvestris
dbj|BAP90356.1|  GATA type zinc finger domain                           153   3e-40   Populus nigra [black poplar]
gb|KDP44375.1|  hypothetical protein JCGZ_20055                         153   3e-40   Jatropha curcas
ref|XP_011076972.1|  PREDICTED: GATA transcription factor 8-like        152   4e-40   Sesamum indicum [beniseed]
ref|XP_011041012.1|  PREDICTED: GATA transcription factor 8-like        152   4e-40   Populus euphratica
ref|XP_009628969.1|  PREDICTED: LOW QUALITY PROTEIN: GATA transcr...    152   4e-40   
ref|XP_006436435.1|  hypothetical protein CICLE_v10032018mg             152   5e-40   
ref|XP_009598426.1|  PREDICTED: GATA transcription factor 8-like        152   5e-40   Nicotiana tomentosiformis
dbj|BAC98491.1|  AG-motif binding protein-1                             152   5e-40   Nicotiana tabacum [American tobacco]
ref|XP_004307386.1|  PREDICTED: GATA transcription factor 8             152   7e-40   Fragaria vesca subsp. vesca
ref|XP_010032187.1|  PREDICTED: GATA transcription factor 8-like ...    151   7e-40   Eucalyptus grandis [rose gum]
gb|KJB73559.1|  hypothetical protein B456_011G238800                    151   7e-40   Gossypium raimondii
ref|XP_011031733.1|  PREDICTED: GATA transcription factor 8-like        152   8e-40   Populus euphratica
gb|ACN36994.1|  unknown                                                 150   9e-40   Zea mays [maize]
ref|XP_004954283.1|  PREDICTED: GATA transcription factor 8-like ...    153   1e-39   Setaria italica
gb|AFW64083.1|  putative GATA transcription factor family protein       150   1e-39   
ref|XP_004142426.1|  PREDICTED: GATA transcription factor 9-like        151   1e-39   Cucumis sativus [cucumbers]
dbj|BAC98495.1|  AG-motif binding protein-5                             151   2e-39   Nicotiana tabacum [American tobacco]
ref|XP_008446884.1|  PREDICTED: GATA transcription factor 8             151   2e-39   Cucumis melo [Oriental melon]
ref|XP_004239665.1|  PREDICTED: GATA transcription factor 8-like ...    150   2e-39   Solanum lycopersicum
ref|XP_010032183.1|  PREDICTED: GATA transcription factor 8-like ...    151   2e-39   Eucalyptus grandis [rose gum]
ref|XP_004239666.1|  PREDICTED: GATA transcription factor 8-like ...    150   2e-39   Solanum lycopersicum
ref|XP_002311088.1|  zinc finger family protein                         150   2e-39   Populus trichocarpa [western balsam poplar]
gb|KDO44680.1|  hypothetical protein CISIN_1g016706mg                   151   2e-39   Citrus sinensis [apfelsine]
gb|AFW73937.1|  putative GATA transcription factor family protein...    152   2e-39   
ref|XP_010253699.1|  PREDICTED: GATA transcription factor 8-like        150   2e-39   Nelumbo nucifera [Indian lotus]
ref|XP_002273502.1|  PREDICTED: GATA transcription factor 8-like        150   3e-39   Vitis vinifera
ref|XP_002453007.1|  hypothetical protein SORBIDRAFT_04g036520          152   3e-39   Sorghum bicolor [broomcorn]
ref|XP_006345791.1|  PREDICTED: GATA transcription factor 8-like ...    150   3e-39   Solanum tuberosum [potatoes]
ref|XP_002534043.1|  GATA transcription factor, putative                150   3e-39   Ricinus communis
ref|NP_001146600.1|  putative GATA transcription factor family pr...    151   3e-39   Zea mays [maize]
gb|ACL54362.1|  unknown                                                 151   3e-39   Zea mays [maize]
emb|CDO99748.1|  unnamed protein product                                149   6e-39   Coffea canephora [robusta coffee]
ref|XP_004239667.2|  PREDICTED: GATA transcription factor 8-like ...    150   6e-39   Solanum lycopersicum
ref|XP_011084325.1|  PREDICTED: GATA transcription factor 8             149   7e-39   Sesamum indicum [beniseed]
gb|KHG18876.1|  GATA transcription factor 8 -like protein               148   1e-38   Gossypium arboreum [tree cotton]
ref|XP_010264666.1|  PREDICTED: GATA transcription factor 8-like        148   1e-38   Nelumbo nucifera [Indian lotus]
gb|EYU39843.1|  hypothetical protein MIMGU_mgv1a010405mg                148   1e-38   Erythranthe guttata [common monkey flower]
gb|KHN00843.1|  GATA transcription factor 8                             146   1e-38   Glycine soja [wild soybean]
ref|XP_010067308.1|  PREDICTED: GATA transcription factor 8-like        148   2e-38   Eucalyptus grandis [rose gum]
gb|KHN00692.1|  GATA transcription factor 8                             143   2e-38   Glycine soja [wild soybean]
gb|ACJ02090.1|  AG-motif binding protein                                147   3e-38   Garcinia mangostana [mangosteen]
ref|XP_010906504.1|  PREDICTED: GATA transcription factor 8             148   4e-38   Elaeis guineensis
gb|EMS65328.1|  GATA transcription factor 11                            142   5e-38   Triticum urartu
gb|KHN17141.1|  GATA transcription factor 9                             147   5e-38   Glycine soja [wild soybean]
ref|XP_003556234.1|  PREDICTED: GATA transcription factor 8-like ...    147   5e-38   Glycine max [soybeans]
ref|XP_003536350.1|  PREDICTED: GATA transcription factor 8-like ...    147   5e-38   
ref|XP_009382468.1|  PREDICTED: GATA transcription factor 4-like        147   6e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006606248.1|  PREDICTED: GATA transcription factor 8-like ...    147   6e-38   Glycine max [soybeans]
ref|XP_004236632.1|  PREDICTED: GATA transcription factor 8             146   8e-38   Solanum lycopersicum
ref|XP_011089920.1|  PREDICTED: GATA transcription factor 11-like...    146   1e-37   Sesamum indicum [beniseed]
ref|XP_009605437.1|  PREDICTED: GATA transcription factor 8-like        145   1e-37   Nicotiana tomentosiformis
ref|XP_011089919.1|  PREDICTED: GATA transcription factor 11-like...    146   1e-37   Sesamum indicum [beniseed]
ref|XP_007151876.1|  hypothetical protein PHAVU_004G083100g             145   1e-37   Phaseolus vulgaris [French bean]
ref|XP_006350222.1|  PREDICTED: GATA transcription factor 8-like ...    145   2e-37   Solanum tuberosum [potatoes]
ref|XP_003548072.1|  PREDICTED: GATA transcription factor 8-like ...    145   2e-37   Glycine max [soybeans]
ref|XP_010555821.1|  PREDICTED: GATA transcription factor 8             145   3e-37   Tarenaya hassleriana [spider flower]
ref|XP_010935873.1|  PREDICTED: LOW QUALITY PROTEIN: GATA transcr...    145   3e-37   Elaeis guineensis
gb|AES62142.2|  GATA type zinc finger transcription factor family...    142   3e-37   Medicago truncatula
ref|XP_009418334.1|  PREDICTED: GATA transcription factor 8-like ...    145   3e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418333.1|  PREDICTED: GATA transcription factor 8-like ...    145   3e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010554544.1|  PREDICTED: GATA transcription factor 8-like        144   4e-37   Tarenaya hassleriana [spider flower]
ref|XP_003591891.1|  GATA transcription factor                          144   4e-37   
ref|XP_003591890.1|  GATA transcription factor                          144   4e-37   Medicago truncatula
ref|XP_006574762.1|  PREDICTED: GATA transcription factor 8-like ...    144   7e-37   Glycine max [soybeans]
ref|XP_008807395.1|  PREDICTED: GATA transcription factor 8             145   7e-37   Phoenix dactylifera
ref|XP_010235943.1|  PREDICTED: PHD finger protein rhinoceros-like      145   9e-37   Brachypodium distachyon [annual false brome]
ref|XP_006291493.1|  hypothetical protein CARUB_v10017647mg             143   1e-36   Capsella rubella
ref|XP_007016761.1|  GATA zinc finger protein regulating nitrogen...    143   1e-36   
emb|CDX67609.1|  BnaA07g16490D                                          142   1e-36   
ref|XP_009802378.1|  PREDICTED: GATA transcription factor 8-like        143   1e-36   Nicotiana sylvestris
ref|XP_004149904.1|  PREDICTED: GATA transcription factor 4-like        143   1e-36   Cucumis sativus [cucumbers]
ref|XP_009103933.1|  PREDICTED: GATA transcription factor 8-like        142   1e-36   Brassica rapa
ref|XP_010504307.1|  PREDICTED: GATA transcription factor 8             143   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010427202.1|  PREDICTED: GATA transcription factor 8-like ...    143   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010427201.1|  PREDICTED: GATA transcription factor 8-like ...    142   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010516023.1|  PREDICTED: GATA transcription factor 8-like        142   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_008805201.1|  PREDICTED: GATA transcription factor 4-like        144   1e-36   Phoenix dactylifera
emb|CDP07101.1|  unnamed protein product                                142   2e-36   Coffea canephora [robusta coffee]
gb|EMT09679.1|  GATA transcription factor 11                            142   2e-36   
ref|XP_007143712.1|  hypothetical protein PHAVU_007G095300g             143   2e-36   Phaseolus vulgaris [French bean]
ref|XP_009392221.1|  PREDICTED: GATA transcription factor 8-like        142   2e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006403533.1|  hypothetical protein EUTSA_v10010544mg             142   2e-36   Eutrema salsugineum [saltwater cress]
emb|CDX78264.1|  BnaA09g34590D                                          142   3e-36   
emb|CDY67017.1|  BnaCnng53150D                                          142   3e-36   Brassica napus [oilseed rape]
ref|XP_008456488.1|  PREDICTED: LOW QUALITY PROTEIN: GATA transcr...    142   3e-36   
ref|XP_003543479.1|  PREDICTED: GATA transcription factor 11-like       142   3e-36   Glycine max [soybeans]
emb|CDX73447.1|  BnaC08g25560D                                          142   3e-36   
gb|KHN21512.1|  GATA transcription factor 11                            142   3e-36   Glycine soja [wild soybean]
gb|ACU24388.1|  unknown                                                 141   3e-36   Glycine max [soybeans]
ref|XP_009116158.1|  PREDICTED: GATA transcription factor 8             141   4e-36   Brassica rapa
ref|XP_011089286.1|  PREDICTED: GATA transcription factor 11-like       142   4e-36   
ref|XP_003519961.2|  PREDICTED: GATA transcription factor 8-like ...    143   4e-36   Glycine max [soybeans]
ref|XP_002876270.1|  BME3/BME3-ZF                                       141   5e-36   
dbj|BAH20385.1|  AT3G54810                                              141   5e-36   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191041.1|  GATA transcription factor 8                           141   5e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003540186.1|  PREDICTED: GATA transcription factor 11-like       141   6e-36   Glycine max [soybeans]
dbj|BAJ84868.1|  predicted protein                                      142   6e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN11215.1|  GATA transcription factor 10                            140   6e-36   Glycine soja [wild soybean]
gb|KDP44040.1|  hypothetical protein JCGZ_05507                         140   7e-36   Jatropha curcas
gb|KJB26178.1|  hypothetical protein B456_004G230100                    141   8e-36   Gossypium raimondii
gb|AAK98698.1|AC069158_10  Putative GATA-1 zinc finger protein          142   9e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010031983.1|  PREDICTED: GATA transcription factor 10-like...    140   1e-35   Eucalyptus grandis [rose gum]
ref|XP_010031984.1|  PREDICTED: GATA transcription factor 10-like...    140   1e-35   
ref|XP_007132266.1|  hypothetical protein PHAVU_011G080200g             139   1e-35   Phaseolus vulgaris [French bean]
gb|KHN05677.1|  GATA transcription factor 11                            137   1e-35   Glycine soja [wild soybean]
gb|KJB20301.1|  hypothetical protein B456_003G142600                    138   1e-35   Gossypium raimondii
ref|XP_004242094.2|  PREDICTED: GATA transcription factor 11-like       138   2e-35   Solanum lycopersicum
ref|XP_002529940.1|  GATA transcription factor, putative                139   2e-35   Ricinus communis
ref|XP_007150193.1|  hypothetical protein PHAVU_005G134400g             139   2e-35   Phaseolus vulgaris [French bean]
gb|KHG09661.1|  GATA transcription factor 11 -like protein              139   3e-35   Gossypium arboreum [tree cotton]
ref|XP_009621794.1|  PREDICTED: GATA transcription factor 11-like...    138   4e-35   Nicotiana tomentosiformis
ref|XP_009621793.1|  PREDICTED: GATA transcription factor 11-like...    138   4e-35   Nicotiana tomentosiformis
gb|KJB20300.1|  hypothetical protein B456_003G142600                    139   4e-35   Gossypium raimondii
gb|KHG27547.1|  GATA transcription factor 10 -like protein              139   4e-35   Gossypium arboreum [tree cotton]
emb|CDY07522.1|  BnaC06g15420D                                          138   4e-35   Brassica napus [oilseed rape]
ref|XP_009795845.1|  PREDICTED: GATA transcription factor 11-like...    138   5e-35   Nicotiana sylvestris
ref|XP_009795846.1|  PREDICTED: GATA transcription factor 11-like...    138   5e-35   Nicotiana sylvestris
gb|EPS57111.1|  hypothetical protein M569_17712                         131   5e-35   Genlisea aurea
emb|CAC28528.1|  GATA-1 zinc finger protein                             138   5e-35   Nicotiana tabacum [American tobacco]
ref|XP_006365758.1|  PREDICTED: GATA transcription factor 10-like       136   7e-35   
ref|XP_010089971.1|  Protein-tyrosine sulfotransferase                  143   8e-35   
gb|KHG08445.1|  GATA transcription factor 11 -like protein              139   8e-35   Gossypium arboreum [tree cotton]
emb|CDY02894.1|  BnaC04g25920D                                          137   1e-34   
ref|XP_004251141.1|  PREDICTED: GATA transcription factor 11-like       137   1e-34   Solanum lycopersicum
gb|KJB56141.1|  hypothetical protein B456_009G107900                    135   1e-34   Gossypium raimondii
gb|KHG05024.1|  GATA transcription factor 11 -like protein              137   1e-34   Gossypium arboreum [tree cotton]
ref|XP_006340186.1|  PREDICTED: GATA transcription factor 11-like       137   1e-34   Solanum tuberosum [potatoes]
gb|KJB56138.1|  hypothetical protein B456_009G107900                    136   1e-34   Gossypium raimondii
ref|XP_003539767.1|  PREDICTED: GATA transcription factor 11-like       137   2e-34   Glycine max [soybeans]
ref|XP_009118398.1|  PREDICTED: GATA transcription factor 11-like       135   2e-34   Brassica rapa
ref|XP_010521758.1|  PREDICTED: GATA transcription factor 11-like       136   2e-34   Tarenaya hassleriana [spider flower]
gb|KJB56139.1|  hypothetical protein B456_009G107900                    137   3e-34   Gossypium raimondii
ref|XP_006488078.1|  PREDICTED: GATA transcription factor 11-like       135   3e-34   Citrus sinensis [apfelsine]
ref|XP_009598797.1|  PREDICTED: GATA transcription factor 11-like...    134   3e-34   Nicotiana tomentosiformis
gb|AFK40558.1|  unknown                                                 129   3e-34   Medicago truncatula
gb|KHN38758.1|  GATA transcription factor 11                            135   3e-34   Glycine soja [wild soybean]
ref|XP_009774660.1|  PREDICTED: GATA transcription factor 11-like       135   3e-34   Nicotiana sylvestris
ref|XP_003538192.1|  PREDICTED: GATA transcription factor 11-like       135   3e-34   Glycine max [soybeans]
ref|XP_009598796.1|  PREDICTED: GATA transcription factor 11-like...    134   4e-34   Nicotiana tomentosiformis
emb|CDY22706.1|  BnaC08g43400D                                          134   5e-34   Brassica napus [oilseed rape]
gb|ACU23703.1|  unknown                                                 135   7e-34   Glycine max [soybeans]
ref|XP_006304051.1|  hypothetical protein CARUB_v10009871mg             134   8e-34   Capsella rubella
ref|XP_006424556.1|  hypothetical protein CICLE_v10029015mg             134   9e-34   Citrus clementina [clementine]
ref|XP_007205805.1|  hypothetical protein PRUPE_ppa010692mg             133   9e-34   
ref|XP_010542590.1|  PREDICTED: GATA transcription factor 11-like       134   1e-33   Tarenaya hassleriana [spider flower]
emb|CDX95103.1|  BnaC05g05680D                                          134   1e-33   
ref|XP_010510639.1|  PREDICTED: putative GATA transcription facto...    132   1e-33   Camelina sativa [gold-of-pleasure]
ref|NP_172279.1|  GATA transcription factor 11                          134   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006384910.1|  hypothetical protein POPTR_0004s22140g             132   2e-33   
gb|EYU18824.1|  hypothetical protein MIMGU_mgv1a008576mg                134   2e-33   Erythranthe guttata [common monkey flower]
ref|XP_008245237.1|  PREDICTED: GATA transcription factor 11-like...    134   2e-33   Prunus mume [ume]
ref|XP_010526169.1|  PREDICTED: GATA transcription factor 9             134   2e-33   Tarenaya hassleriana [spider flower]
ref|XP_010458021.1|  PREDICTED: GATA transcription factor 11-like       134   2e-33   Camelina sativa [gold-of-pleasure]
emb|CDY06293.1|  BnaA09g49100D                                          132   2e-33   
ref|XP_008245238.1|  PREDICTED: GATA transcription factor 11-like...    133   2e-33   Prunus mume [ume]
ref|XP_006846789.1|  hypothetical protein AMTR_s00148p00049970          133   2e-33   
ref|XP_010475585.1|  PREDICTED: GATA transcription factor 11-like       134   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010488262.1|  PREDICTED: GATA transcription factor 11-like       134   2e-33   
ref|XP_009148049.1|  PREDICTED: GATA transcription factor 11-like       132   3e-33   Brassica rapa
gb|EYU18823.1|  hypothetical protein MIMGU_mgv1a008576mg                134   4e-33   Erythranthe guttata [common monkey flower]
emb|CDX71356.1|  BnaC04g15910D                                          132   4e-33   
ref|XP_010414542.1|  PREDICTED: putative GATA transcription facto...    130   5e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010414543.1|  PREDICTED: putative GATA transcription facto...    130   6e-33   Camelina sativa [gold-of-pleasure]
ref|XP_004506013.1|  PREDICTED: GATA transcription factor 11-like       132   6e-33   
ref|XP_002892428.1|  zinc finger family protein                         132   1e-32   
ref|XP_004487098.1|  PREDICTED: GATA transcription factor 11-like       132   1e-32   Cicer arietinum [garbanzo]
ref|XP_011040891.1|  PREDICTED: GATA transcription factor 11-like...    132   1e-32   Populus euphratica
ref|XP_008359306.1|  PREDICTED: GATA transcription factor 11-like       131   1e-32   
ref|XP_011040892.1|  PREDICTED: GATA transcription factor 11-like...    132   1e-32   Populus euphratica
ref|XP_006417739.1|  hypothetical protein EUTSA_v10008338mg             131   1e-32   Eutrema salsugineum [saltwater cress]
gb|EYU36178.1|  hypothetical protein MIMGU_mgv1a0095201mg               132   1e-32   Erythranthe guttata [common monkey flower]
ref|XP_009103677.1|  PREDICTED: GATA transcription factor 11 isof...    131   1e-32   Brassica rapa
emb|CDY04556.1|  BnaA07g13820D                                          131   1e-32   
ref|XP_006409859.1|  hypothetical protein EUTSA_v10017012mg             131   1e-32   Eutrema salsugineum [saltwater cress]
ref|XP_009103676.1|  PREDICTED: GATA transcription factor 11 isof...    132   1e-32   Brassica rapa
gb|ABK26808.1|  unknown                                                 127   1e-32   Picea sitchensis
ref|XP_008385404.1|  PREDICTED: GATA transcription factor 11            131   1e-32   
ref|XP_008359134.1|  PREDICTED: GATA transcription factor 11-like...    131   1e-32   
ref|XP_009367061.1|  PREDICTED: GATA transcription factor 11            131   2e-32   Pyrus x bretschneideri [bai li]
ref|XP_003592781.1|  GATA transcription factor                          130   2e-32   Medicago truncatula
ref|XP_004291710.1|  PREDICTED: GATA transcription factor 11-like       131   2e-32   Fragaria vesca subsp. vesca
ref|XP_008359133.1|  PREDICTED: GATA transcription factor 11-like...    131   2e-32   
ref|XP_010047283.1|  PREDICTED: GATA transcription factor 12-like       132   3e-32   Eucalyptus grandis [rose gum]
ref|XP_011073746.1|  PREDICTED: GATA transcription factor 1-like ...    129   4e-32   
ref|XP_011073745.1|  PREDICTED: GATA transcription factor 1-like ...    130   4e-32   Sesamum indicum [beniseed]
ref|XP_010470098.1|  PREDICTED: putative GATA transcription facto...    129   6e-32   Camelina sativa [gold-of-pleasure]
gb|AAF79843.1|AC026875_23  T6D22.9                                      134   8e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006854315.1|  hypothetical protein AMTR_s00039p00112210          128   8e-32   Amborella trichopoda
ref|XP_011046757.1|  PREDICTED: GATA transcription factor 9-like        129   9e-32   Populus euphratica
ref|XP_010557328.1|  PREDICTED: GATA transcription factor 11-like       129   1e-31   Tarenaya hassleriana [spider flower]
ref|XP_010470099.1|  PREDICTED: putative GATA transcription facto...    127   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_006465677.1|  PREDICTED: GATA transcription factor 12-like       129   1e-31   Citrus sinensis [apfelsine]
ref|XP_010470100.1|  PREDICTED: putative GATA transcription facto...    128   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010510636.1|  PREDICTED: putative GATA transcription facto...    128   1e-31   
ref|XP_010510638.1|  PREDICTED: putative GATA transcription facto...    127   2e-31   
ref|XP_006294768.1|  hypothetical protein CARUB_v10023820mg             128   2e-31   Capsella rubella
ref|XP_010414541.1|  PREDICTED: putative GATA transcription facto...    128   2e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010414546.1|  PREDICTED: putative GATA transcription facto...    128   2e-31   Camelina sativa [gold-of-pleasure]
ref|XP_011081778.1|  PREDICTED: GATA transcription factor 12-like       129   2e-31   Sesamum indicum [beniseed]
ref|XP_006649146.1|  PREDICTED: GATA transcription factor 8-like        128   2e-31   
ref|XP_010414544.1|  PREDICTED: putative GATA transcription facto...    128   2e-31   
ref|XP_010510637.1|  PREDICTED: putative GATA transcription facto...    127   3e-31   Camelina sativa [gold-of-pleasure]
ref|XP_008462442.1|  PREDICTED: GATA transcription factor 9-like        129   3e-31   Cucumis melo [Oriental melon]
ref|XP_010940106.1|  PREDICTED: GATA transcription factor 2-like        126   3e-31   Elaeis guineensis
ref|XP_002880933.1|  hypothetical protein ARALYDRAFT_901675             128   3e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_009802570.1|  PREDICTED: GATA transcription factor 5-like        128   3e-31   Nicotiana sylvestris
dbj|BAC98494.1|  AG-motif binding protein-4                             128   3e-31   Nicotiana tabacum [American tobacco]
gb|EPS67172.1|  hypothetical protein M569_07604                         125   4e-31   Genlisea aurea
ref|XP_009631302.1|  PREDICTED: GATA transcription factor 5-like        128   5e-31   Nicotiana tomentosiformis
ref|XP_003619010.1|  GATA transcription factor                          125   5e-31   
dbj|BAJ92617.1|  predicted protein                                      128   6e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006426898.1|  hypothetical protein CICLE_v10027138mg             128   6e-31   
ref|XP_009110913.1|  PREDICTED: GATA transcription factor 11-like       126   6e-31   Brassica rapa
ref|NP_001159272.1|  uncharacterized protein LOC100304362               126   6e-31   
gb|KEH30032.1|  GATA type zinc finger transcription factor family...    129   6e-31   Medicago truncatula
emb|CDY58825.1|  BnaAnng15440D                                          126   6e-31   Brassica napus [oilseed rape]
ref|XP_003597258.1|  GATA transcription factor                          127   6e-31   Medicago truncatula
ref|XP_004230938.1|  PREDICTED: GATA transcription factor 5             127   6e-31   Solanum lycopersicum
ref|XP_010651174.1|  PREDICTED: GATA transcription factor 8-like        129   7e-31   Vitis vinifera
ref|XP_006294728.1|  hypothetical protein CARUB_v10023774mg             126   7e-31   Capsella rubella
ref|XP_011033283.1|  PREDICTED: GATA transcription factor 2-like        125   7e-31   Populus euphratica
emb|CDX80542.1|  BnaC07g29020D                                          127   9e-31   
emb|CBI16323.3|  unnamed protein product                                128   9e-31   Vitis vinifera
gb|EYU42584.1|  hypothetical protein MIMGU_mgv1a010838mg                126   9e-31   Erythranthe guttata [common monkey flower]
gb|KDO51760.1|  hypothetical protein CISIN_1g019919mg                   127   1e-30   Citrus sinensis [apfelsine]
ref|XP_011092007.1|  PREDICTED: GATA transcription factor 12            127   1e-30   Sesamum indicum [beniseed]
gb|AES75228.2|  GATA type zinc finger transcription factor family...    125   1e-30   Medicago truncatula
ref|XP_002301258.2|  hypothetical protein POPTR_0002s14380g             125   1e-30   Populus trichocarpa [western balsam poplar]
ref|XP_003540668.1|  PREDICTED: GATA transcription factor 7-like        126   1e-30   
ref|XP_010679831.1|  PREDICTED: GATA transcription factor 7             125   1e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009111680.1|  PREDICTED: GATA transcription factor 12-like       126   1e-30   Brassica rapa
ref|XP_011091388.1|  PREDICTED: GATA transcription factor 1             125   1e-30   Sesamum indicum [beniseed]
ref|XP_009151105.1|  PREDICTED: GATA transcription factor 12            126   1e-30   Brassica rapa
ref|XP_010519882.1|  PREDICTED: GATA transcription factor 12            126   1e-30   Tarenaya hassleriana [spider flower]
ref|XP_002308598.1|  zinc finger family protein                         127   1e-30   
ref|XP_006375265.1|  hypothetical protein POPTR_0014s05760g             125   1e-30   Populus trichocarpa [western balsam poplar]
ref|XP_004162986.1|  PREDICTED: GATA transcription factor 12-like       126   2e-30   
emb|CDX87075.1|  BnaC09g03900D                                          126   2e-30   
ref|XP_011017443.1|  PREDICTED: GATA transcription factor 4-like        124   2e-30   Populus euphratica
ref|XP_004148425.1|  PREDICTED: GATA transcription factor 12-like       126   2e-30   
ref|NP_172278.1|  GATA transcription factor 10                          125   2e-30   Arabidopsis thaliana [mouse-ear cress]
emb|CDY19792.1|  BnaA09g04450D                                          126   2e-30   Brassica napus [oilseed rape]
ref|XP_009395984.1|  PREDICTED: GATA transcription factor 9-like        126   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX93600.1|  BnaA06g04480D                                          125   2e-30   
emb|CDO99396.1|  unnamed protein product                                125   2e-30   Coffea canephora [robusta coffee]
ref|XP_004141657.1|  PREDICTED: GATA transcription factor 9-like        126   2e-30   Cucumis sativus [cucumbers]
ref|XP_009758423.1|  PREDICTED: GATA transcription factor 1             124   2e-30   Nicotiana sylvestris
ref|XP_003624611.1|  GATA transcription factor                          125   2e-30   Medicago truncatula
gb|KGN60319.1|  hypothetical protein Csa_3G895650                       126   2e-30   Cucumis sativus [cucumbers]
ref|XP_009394172.1|  PREDICTED: GATA transcription factor 9-like ...    126   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI36080.3|  unnamed protein product                                125   2e-30   Vitis vinifera
ref|XP_009394171.1|  PREDICTED: GATA transcription factor 9-like ...    126   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008466068.1|  PREDICTED: GATA transcription factor 9-like        126   2e-30   Cucumis melo [Oriental melon]
ref|XP_011019597.1|  PREDICTED: GATA transcription factor 12            127   2e-30   Populus euphratica
ref|XP_004501147.1|  PREDICTED: GATA transcription factor 12-like       125   2e-30   Cicer arietinum [garbanzo]
ref|NP_001056071.1|  Os05g0520300                                       127   2e-30   
ref|XP_009606887.1|  PREDICTED: GATA transcription factor 1-like ...    124   2e-30   Nicotiana tomentosiformis
gb|EYU29287.1|  hypothetical protein MIMGU_mgv1a024688mg                127   2e-30   Erythranthe guttata [common monkey flower]
ref|XP_008445001.1|  PREDICTED: GATA transcription factor 12-like       126   2e-30   Cucumis melo [Oriental melon]
ref|XP_009606886.1|  PREDICTED: GATA transcription factor 1-like ...    124   2e-30   Nicotiana tomentosiformis
ref|XP_006362004.1|  PREDICTED: GATA transcription factor 5-like        125   2e-30   Solanum tuberosum [potatoes]
gb|EYU32614.1|  hypothetical protein MIMGU_mgv1a023497mg                124   3e-30   Erythranthe guttata [common monkey flower]
gb|KGN62802.1|  hypothetical protein Csa_2G373450                       126   3e-30   
ref|XP_010054482.1|  PREDICTED: GATA transcription factor 2-like        125   3e-30   
ref|XP_010267189.1|  PREDICTED: GATA transcription factor 12-like       125   3e-30   
ref|XP_010521511.1|  PREDICTED: GATA transcription factor 9-like        124   3e-30   
ref|XP_008655150.1|  PREDICTED: uncharacterized protein LOC100304...    126   3e-30   
ref|XP_009138148.1|  PREDICTED: GATA transcription factor 9-like        125   3e-30   
ref|XP_002284028.1|  PREDICTED: GATA transcription factor 9             125   3e-30   
ref|XP_007024273.1|  GATA transcription factor 9, putative              125   3e-30   
gb|AFK35594.1|  unknown                                                 125   4e-30   
ref|XP_003603996.1|  GATA transcription factor                          125   4e-30   
ref|XP_010668515.1|  PREDICTED: GATA transcription factor 12-like       126   4e-30   
ref|XP_006853640.1|  hypothetical protein AMTR_s00056p00080350          125   4e-30   
ref|XP_006394835.1|  hypothetical protein EUTSA_v10004553mg             125   4e-30   
ref|XP_008656467.1|  PREDICTED: GATA transcription factor 12-like       126   4e-30   
ref|XP_006359592.1|  PREDICTED: GATA transcription factor 2-like        124   4e-30   
ref|XP_003527843.1|  PREDICTED: GATA transcription factor 12-like       125   4e-30   
gb|EYU43811.1|  hypothetical protein MIMGU_mgv1a011652mg                124   4e-30   
ref|XP_001778541.1|  predicted protein                                  123   4e-30   
gb|AES74247.2|  GATA type zinc finger transcription factor family...    125   4e-30   
ref|XP_007030701.1|  GATA transcription factor 9, putative              124   5e-30   
gb|KJB70417.1|  hypothetical protein B456_011G072500                    125   5e-30   
gb|EPS59023.1|  hypothetical protein M569_15789                         124   5e-30   
gb|KHG06288.1|  GATA transcription factor 9 -like protein               125   5e-30   
ref|XP_007217275.1|  hypothetical protein PRUPE_ppa017460mg             125   5e-30   
ref|XP_007161927.1|  hypothetical protein PHAVU_001G109500g             124   5e-30   
ref|XP_002458475.1|  hypothetical protein SORBIDRAFT_03g034360          126   5e-30   
ref|NP_195015.1|  GATA transcription factor 9                           124   6e-30   
ref|XP_006847160.1|  hypothetical protein AMTR_s00017p00242860          122   6e-30   
emb|CDO96997.1|  unnamed protein product                                125   6e-30   
ref|XP_010454925.1|  PREDICTED: GATA transcription factor 12-like       125   6e-30   
ref|XP_009394834.1|  PREDICTED: GATA transcription factor 9-like ...    125   6e-30   
ref|XP_004239871.1|  PREDICTED: GATA transcription factor 1-like        123   6e-30   
ref|XP_009394835.1|  PREDICTED: GATA transcription factor 9-like ...    125   6e-30   
gb|KJB83843.1|  hypothetical protein B456_013G267200                    122   6e-30   
ref|XP_004969927.1|  PREDICTED: GATA transcription factor 12-like       125   6e-30   
ref|XP_010924658.1|  PREDICTED: GATA transcription factor 12-like       125   7e-30   
ref|XP_004290341.1|  PREDICTED: GATA transcription factor 5-like        125   7e-30   
ref|XP_010249552.1|  PREDICTED: GATA transcription factor 12            124   7e-30   
gb|EPS63160.1|  hypothetical protein M569_11630                         124   7e-30   
ref|XP_007137230.1|  hypothetical protein PHAVU_009G110400g             124   7e-30   
dbj|BAE99493.1|  GATA transcription factor 1                            119   7e-30   
ref|XP_011014869.1|  PREDICTED: GATA transcription factor 12-like       125   8e-30   
ref|XP_002511642.1|  GATA transcription factor, putative                122   8e-30   
ref|XP_002869237.1|  zinc finger family protein                         124   8e-30   
emb|CDP08170.1|  unnamed protein product                                125   8e-30   
ref|XP_003567108.1|  PREDICTED: GATA transcription factor 12            125   8e-30   
gb|KHG09448.1|  GATA transcription factor 9 -like protein               124   8e-30   
gb|KDP28810.1|  hypothetical protein JCGZ_14581                         123   8e-30   
ref|XP_008378072.1|  PREDICTED: GATA transcription factor 12-like       125   8e-30   
ref|NP_197955.1|  GATA transcription factor 12                          124   8e-30   
ref|XP_003603626.1|  GATA transcription factor                          124   8e-30   
ref|XP_010447323.1|  PREDICTED: GATA transcription factor 9-like        124   9e-30   
emb|CDX68902.1|  BnaC01g05510D                                          123   9e-30   
ref|XP_006846028.1|  hypothetical protein AMTR_s00155p00085360          126   9e-30   
ref|XP_010421443.1|  PREDICTED: GATA transcription factor 12            124   9e-30   
ref|XP_009410894.1|  PREDICTED: GATA transcription factor 9-like ...    125   9e-30   
ref|XP_010437836.1|  PREDICTED: GATA transcription factor 9-like        124   9e-30   
emb|CDY32815.1|  BnaC08g02370D                                          123   9e-30   
ref|XP_008804627.1|  PREDICTED: GATA transcription factor 9-like        125   9e-30   
ref|XP_006450704.1|  hypothetical protein CICLE_v10008690mg             125   9e-30   
ref|XP_009410893.1|  PREDICTED: GATA transcription factor 12-like...    125   1e-29   
gb|KJB45063.1|  hypothetical protein B456_007G287800                    123   1e-29   
gb|ADL36690.1|  GATA domain class transcription factor                  125   1e-29   
ref|XP_006412416.1|  hypothetical protein EUTSA_v10025757mg             124   1e-29   
ref|XP_010493840.1|  PREDICTED: GATA transcription factor 12-like       124   1e-29   
gb|KJB18591.1|  hypothetical protein B456_003G062900                    124   1e-29   
gb|KHG12527.1|  GATA transcription factor 9 -like protein               123   1e-29   
ref|XP_010426650.1|  PREDICTED: GATA transcription factor 6-like        124   1e-29   
ref|XP_002960543.1|  hypothetical protein SELMODRAFT_69566              117   1e-29   
gb|KDP40876.1|  hypothetical protein JCGZ_24875                         124   1e-29   
ref|XP_006476028.1|  PREDICTED: GATA transcription factor 12-like       125   1e-29   
emb|CDX68908.1|  BnaC01g05450D                                          123   1e-29   
ref|XP_004507504.1|  PREDICTED: GATA transcription factor 5-like ...    123   1e-29   
gb|AFK46483.1|  unknown                                                 123   1e-29   
ref|XP_006443395.1|  hypothetical protein CICLE_v10021190mg             124   1e-29   
ref|XP_006445338.1|  hypothetical protein CICLE_v10021733mg             122   1e-29   
emb|CBI20840.3|  unnamed protein product                                121   1e-29   
ref|XP_006372032.1|  hypothetical protein POPTR_0018s08090g             122   1e-29   
ref|XP_003607047.1|  GATA transcription factor                          123   1e-29   
gb|KDO55073.1|  hypothetical protein CISIN_1g020996mg                   124   1e-29   
ref|XP_010432642.1|  PREDICTED: GATA transcription factor 9-like        124   1e-29   
ref|XP_002440094.1|  hypothetical protein SORBIDRAFT_09g025950          125   1e-29   
emb|CDX94847.1|  BnaC03g43410D                                          121   1e-29   
gb|AFK34183.1|  unknown                                                 117   1e-29   
ref|XP_006644696.1|  PREDICTED: GATA transcription factor 12-like       125   1e-29   
gb|EPS57889.1|  hypothetical protein M569_16927                         123   1e-29   
ref|XP_009402051.1|  PREDICTED: GATA transcription factor 2-like        124   1e-29   
gb|EAY75795.1|  hypothetical protein OsI_03711                          125   1e-29   
ref|XP_003523746.1|  PREDICTED: GATA transcription factor 12-like       123   1e-29   
ref|XP_006288129.1|  hypothetical protein CARUB_v10001360mg             124   1e-29   
ref|XP_007052192.1|  GATA transcription factor 2, putative              122   1e-29   
ref|NP_001044227.1|  Os01g0745700                                       124   1e-29   
gb|KJB54801.1|  hypothetical protein B456_009G049300                    124   1e-29   
ref|XP_008228438.1|  PREDICTED: GATA transcription factor 9-like        124   1e-29   
ref|XP_002876563.1|  zinc finger family protein                         122   1e-29   
ref|XP_009767386.1|  PREDICTED: GATA transcription factor 1-like        123   1e-29   
dbj|BAK07945.1|  predicted protein                                      124   1e-29   
dbj|BAC98492.1|  AG-motif binding protein-2                             123   1e-29   
ref|XP_009631501.1|  PREDICTED: GATA transcription factor 9-like        124   1e-29   
ref|XP_011010123.1|  PREDICTED: GATA transcription factor 12-like       123   1e-29   
emb|CDY13505.1|  BnaA03g52230D                                          122   1e-29   
ref|XP_009628152.1|  PREDICTED: GATA transcription factor 12-like       124   1e-29   
gb|EPS68410.1|  hypothetical protein M569_06360                         119   2e-29   
gb|KFK35258.1|  hypothetical protein AALP_AA5G261900                    121   2e-29   
ref|XP_006423461.1|  hypothetical protein CICLE_v10028860mg             123   2e-29   
ref|XP_002283745.1|  PREDICTED: GATA transcription factor 9             124   2e-29   
ref|XP_008812058.1|  PREDICTED: GATA transcription factor 2-like        121   2e-29   
gb|EAZ13513.1|  hypothetical protein OsJ_03429                          124   2e-29   
ref|XP_006487363.1|  PREDICTED: GATA transcription factor 5-like        123   2e-29   
ref|XP_009776828.1|  PREDICTED: GATA transcription factor 12            124   2e-29   
ref|XP_009618081.1|  PREDICTED: GATA transcription factor 1-like ...    123   2e-29   
gb|AFW72550.1|  putative GATA transcription factor family protein       124   2e-29   
ref|XP_010690771.1|  PREDICTED: GATA transcription factor 7-like        123   2e-29   
gb|AFK36201.1|  unknown                                                 119   2e-29   
gb|KDO40065.1|  hypothetical protein CISIN_1g021193mg                   123   2e-29   
ref|XP_008393856.1|  PREDICTED: GATA transcription factor 12-like       124   2e-29   
ref|NP_001150502.1|  GATA zinc finger family protein                    124   2e-29   
gb|ADD09603.1|  zinc finger (GATA type) family protein                  123   2e-29   
ref|XP_008392662.1|  PREDICTED: GATA transcription factor 9-like        123   2e-29   
ref|XP_009618082.1|  PREDICTED: GATA transcription factor 1-like ...    121   2e-29   
ref|XP_002324216.2|  hypothetical protein POPTR_0018s08090g             124   2e-29   
ref|XP_007012149.1|  GATA transcription factor 9, putative              124   2e-29   
emb|CDX75297.1|  BnaA01g04050D                                          123   2e-29   
gb|KJB79069.1|  hypothetical protein B456_013G032900                    123   2e-29   
gb|KJB65651.1|  hypothetical protein B456_010G106100                    123   2e-29   
ref|XP_009125288.1|  PREDICTED: GATA transcription factor 9             123   2e-29   
ref|XP_004493146.1|  PREDICTED: GATA transcription factor 9-like        122   2e-29   
ref|XP_010513267.1|  PREDICTED: GATA transcription factor 1-like ...    121   2e-29   
gb|KJB68180.1|  hypothetical protein B456_010G230500                    123   2e-29   
emb|CDX72377.1|  BnaC07g43990D                                          123   2e-29   
gb|KDP39718.1|  hypothetical protein JCGZ_02738                         122   2e-29   
ref|XP_010513260.1|  PREDICTED: GATA transcription factor 1-like ...    122   2e-29   
dbj|BAJ97044.1|  predicted protein                                      123   2e-29   
ref|XP_009770170.1|  PREDICTED: GATA transcription factor 12-like       122   3e-29   
ref|XP_010466791.1|  PREDICTED: GATA transcription factor 1-like ...    122   3e-29   
gb|KHN08159.1|  GATA transcription factor 9                             122   3e-29   
ref|NP_201433.1|  GATA transcription factor 5                           123   3e-29   
ref|XP_006355741.1|  PREDICTED: GATA transcription factor 1-like        121   3e-29   
ref|XP_003554005.1|  PREDICTED: GATA transcription factor 5-like        122   3e-29   
ref|XP_003548758.1|  PREDICTED: GATA transcription factor 9-like        122   3e-29   
emb|CBI29927.3|  unnamed protein product                                122   3e-29   
ref|XP_007034503.1|  GATA transcription factor 1, putative              121   3e-29   
gb|EYU31938.1|  hypothetical protein MIMGU_mgv1a012669mg                121   3e-29   
gb|KJB27277.1|  hypothetical protein B456_004G288400                    123   3e-29   
gb|KHG10199.1|  GATA transcription factor 12 -like protein              123   3e-29   
ref|XP_010488503.1|  PREDICTED: GATA transcription factor 1-like ...    120   3e-29   
ref|XP_004961467.1|  PREDICTED: GATA transcription factor 12-like       124   3e-29   
ref|XP_002313763.2|  hypothetical protein POPTR_0009s12620g             123   3e-29   
ref|XP_009135870.1|  PREDICTED: GATA transcription factor 1             122   3e-29   
gb|KJB79070.1|  hypothetical protein B456_013G032900                    120   3e-29   
ref|XP_010089251.1|  GATA transcription factor 2                        124   3e-29   
ref|XP_002319169.2|  hypothetical protein POPTR_0013s05610g             122   3e-29   
ref|XP_006284030.1|  hypothetical protein CARUB_v10005152mg             123   3e-29   
ref|XP_004500773.1|  PREDICTED: GATA transcription factor 5-like        122   3e-29   
ref|XP_010098128.1|  GATA transcription factor 9                        122   3e-29   
ref|XP_009802675.1|  PREDICTED: GATA transcription factor 12            123   4e-29   
ref|XP_004291171.2|  PREDICTED: GATA transcription factor 12            124   4e-29   
gb|KHN00670.1|  GATA transcription factor 9                             122   4e-29   
ref|XP_011047468.1|  PREDICTED: GATA transcription factor 5-like        122   4e-29   
ref|XP_008643774.1|  PREDICTED: GATA zinc finger family protein i...    124   4e-29   
ref|XP_003539005.1|  PREDICTED: GATA transcription factor 5-like        122   4e-29   
ref|XP_009406167.1|  PREDICTED: GATA transcription factor 9-like        122   4e-29   
ref|XP_003566028.1|  PREDICTED: GATA transcription factor 12-like       123   4e-29   
ref|XP_011034353.1|  PREDICTED: GATA transcription factor 5-like        122   4e-29   
ref|XP_004172012.1|  PREDICTED: GATA transcription factor 9-like        122   4e-29   
ref|XP_010466792.1|  PREDICTED: GATA transcription factor 1-like ...    120   4e-29   
gb|ADL36693.1|  GATA domain class transcription factor                  122   4e-29   
ref|XP_010264324.1|  PREDICTED: GATA transcription factor 4-like        121   4e-29   
gb|KFK29899.1|  hypothetical protein AALP_AA7G192900                    122   4e-29   
ref|XP_008220089.1|  PREDICTED: GATA transcription factor 12            123   4e-29   
gb|KJB34234.1|  hypothetical protein B456_006G054800                    120   4e-29   
ref|XP_010488502.1|  PREDICTED: GATA transcription factor 1-like ...    121   4e-29   
gb|KFK27827.1|  hypothetical protein AALP_AA8G434900                    122   4e-29   
ref|XP_010915683.1|  PREDICTED: GATA transcription factor 12            123   4e-29   
ref|XP_010691426.1|  PREDICTED: GATA transcription factor 12-like       122   4e-29   
ref|XP_004302868.2|  PREDICTED: GATA transcription factor 9-like        123   4e-29   
gb|KHG24532.1|  GATA transcription factor 1 -like protein               120   4e-29   
gb|KJB34235.1|  hypothetical protein B456_006G054800                    120   4e-29   
ref|XP_008447537.1|  PREDICTED: GATA transcription factor 4-like        122   5e-29   
ref|XP_002463763.1|  hypothetical protein SORBIDRAFT_01g005690          123   5e-29   
ref|XP_009400683.1|  PREDICTED: GATA transcription factor 4-like        122   5e-29   
ref|XP_010547450.1|  PREDICTED: GATA transcription factor 5-like ...    122   5e-29   
ref|XP_009400880.1|  PREDICTED: GATA transcription factor 6-like        123   5e-29   
ref|XP_002303808.2|  hypothetical protein POPTR_0003s17340g             121   5e-29   
ref|XP_003530174.2|  PREDICTED: GATA transcription factor 2-like ...    121   5e-29   
gb|EYU37853.1|  hypothetical protein MIMGU_mgv1a009692mg                122   5e-29   
ref|XP_003521089.1|  PREDICTED: GATA transcription factor 2-like        120   5e-29   
ref|XP_007151835.1|  hypothetical protein PHAVU_004G079200g             120   5e-29   
ref|XP_004150603.1|  PREDICTED: GATA transcription factor 9-like        122   5e-29   
ref|NP_001146093.1|  uncharacterized protein LOC100279625               123   5e-29   
ref|XP_007140987.1|  hypothetical protein PHAVU_008G157600g             122   5e-29   
ref|XP_008460722.1|  PREDICTED: GATA transcription factor 1 isofo...    121   6e-29   
ref|XP_011037193.1|  PREDICTED: GATA transcription factor 5-like        122   6e-29   
ref|XP_007131760.1|  hypothetical protein PHAVU_011G039600g             122   6e-29   
ref|XP_002518163.1|  GATA transcription factor, putative                119   6e-29   
gb|KGN58045.1|  hypothetical protein Csa_3G457670                       122   6e-29   
gb|EPS69651.1|  hypothetical protein M569_05114                         121   6e-29   
ref|XP_010258899.1|  PREDICTED: GATA transcription factor 4-like        121   7e-29   
tpg|DAA36653.1|  TPA: putative GATA transcription factor family p...    117   7e-29   
ref|XP_010109771.1|  hypothetical protein L484_008447                   121   7e-29   
gb|KHG08475.1|  GATA transcription factor 12 -like protein              121   7e-29   
ref|XP_008460721.1|  PREDICTED: GATA transcription factor 1 isofo...    121   7e-29   
gb|KHN39835.1|  GATA transcription factor 7                             122   7e-29   
gb|AFW59007.1|  putative GATA transcription factor family protein       122   7e-29   
ref|XP_008805375.1|  PREDICTED: GATA transcription factor 2-like        120   7e-29   
ref|XP_004248553.1|  PREDICTED: GATA transcription factor 4-like        120   7e-29   
ref|XP_003550120.1|  PREDICTED: GATA transcription factor 12-like       122   7e-29   
gb|KDO46288.1|  hypothetical protein CISIN_1g024771mg                   120   7e-29   
ref|XP_002282225.1|  PREDICTED: GATA transcription factor 2-like        121   7e-29   
ref|XP_010245657.1|  PREDICTED: GATA transcription factor 1-like        120   7e-29   
ref|XP_004141141.1|  PREDICTED: GATA transcription factor 9-like        121   7e-29   
ref|XP_007156103.1|  hypothetical protein PHAVU_003G258900g             122   7e-29   
ref|XP_010033458.1|  PREDICTED: GATA transcription factor 5-like        116   7e-29   
ref|XP_010919380.1|  PREDICTED: GATA transcription factor 5-like        123   7e-29   
ref|NP_001053437.2|  Os04g0539500                                       119   8e-29   
ref|XP_009800952.1|  PREDICTED: GATA transcription factor 5-like        120   8e-29   
ref|XP_009367498.1|  PREDICTED: GATA transcription factor 9             121   8e-29   
emb|CBI16598.3|  unnamed protein product                                120   8e-29   
ref|XP_008810653.1|  PREDICTED: GATA transcription factor 12-like       122   8e-29   
ref|XP_003559045.1|  PREDICTED: GATA transcription factor 2-like        122   8e-29   
ref|XP_006492137.1|  PREDICTED: GATA transcription factor 1-like        120   8e-29   



>ref|XP_010683872.1| PREDICTED: GATA transcription factor 8 [Beta vulgaris subsp. 
vulgaris]
Length=310

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 79/94 (84%), Gaps = 5/94 (5%)
 Frame = -3

Query  701  NPGAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP  522
            NP A    Q  A+RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP
Sbjct  220  NPNANTTSQ--ALRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP  277

Query  521  TFVPSLHSNSHKKVVEMRTKAVPSLEQSPVSSVA  420
            TFVPSLHSNSHKKVVEMRTK     E+ P+ + A
Sbjct  278  TFVPSLHSNSHKKVVEMRTKIT---EEKPLVTTA  308



>gb|ACL52876.1| unknown [Zea mays]
Length=152

 Score =   150 bits (379),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            QGGAVR+C HC+I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTFVPS+HS
Sbjct  62   QGGAVRRCTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSIHS  121

Query  497  NSHKKVVEMRTKAVPS  450
            NSHKKVVEMR KAV S
Sbjct  122  NSHKKVVEMRQKAVRS  137



>ref|XP_007009854.1| Plant-specific GATA-type zinc finger transcription factor family 
protein isoform 2 [Theobroma cacao]
 gb|EOY18664.1| Plant-specific GATA-type zinc finger transcription factor family 
protein isoform 2 [Theobroma cacao]
Length=341

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 73/80 (91%), Gaps = 1/80 (1%)
 Frame = -3

Query  698  PGAPNQDQGG-AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP  522
            P   NQ+  G AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP
Sbjct  235  PADNNQNSSGQAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP  294

Query  521  TFVPSLHSNSHKKVVEMRTK  462
            TFVPSLHSNSHKKV+EMR K
Sbjct  295  TFVPSLHSNSHKKVIEMRNK  314



>ref|XP_010092608.1| GATA transcription factor 9 [Morus notabilis]
 gb|EXB51749.1| GATA transcription factor 9 [Morus notabilis]
Length=351

 Score =   155 bits (391),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/80 (90%), Positives = 74/80 (93%), Gaps = 1/80 (1%)
 Frame = -3

Query  698  PGAPNQDQGG-AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP  522
            P   NQ+Q   AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP
Sbjct  234  PVETNQNQSSQAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP  293

Query  521  TFVPSLHSNSHKKVVEMRTK  462
            TFVPSLHSNSHKKV+EMRTK
Sbjct  294  TFVPSLHSNSHKKVLEMRTK  313



>ref|XP_008233316.1| PREDICTED: GATA transcription factor 8 [Prunus mume]
 ref|XP_008233317.1| PREDICTED: GATA transcription factor 8 [Prunus mume]
Length=351

 Score =   155 bits (391),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 88/101 (87%), Gaps = 5/101 (5%)
 Frame = -3

Query  755  AGEQkkkkkiKFSMPALXNPGAPNQDQG---GAVRKCMHCEITKTPQWRAGPMGPKTLCN  585
            +GEQKKKKK+K S+P    P   NQ+ G    AVRKC+HCEITKTPQWRAGPMGPKTLCN
Sbjct  220  SGEQKKKKKLKVSLPLA--PLEGNQNSGPTQAAVRKCLHCEITKTPQWRAGPMGPKTLCN  277

Query  584  ACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKKVVEMRTK  462
            ACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKKV+EMRTK
Sbjct  278  ACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKKVLEMRTK  318



>ref|XP_007218229.1| hypothetical protein PRUPE_ppa007936mg [Prunus persica]
 gb|EMJ19428.1| hypothetical protein PRUPE_ppa007936mg [Prunus persica]
Length=351

 Score =   154 bits (390),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 88/101 (87%), Gaps = 5/101 (5%)
 Frame = -3

Query  755  AGEQkkkkkiKFSMPALXNPGAPNQDQG---GAVRKCMHCEITKTPQWRAGPMGPKTLCN  585
            +GEQKKKKK+K S+P    P   NQ+ G    AVRKC+HCEITKTPQWRAGPMGPKTLCN
Sbjct  220  SGEQKKKKKLKVSLPLA--PFEGNQNSGPTQAAVRKCLHCEITKTPQWRAGPMGPKTLCN  277

Query  584  ACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKKVVEMRTK  462
            ACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKKV+EMRTK
Sbjct  278  ACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKKVLEMRTK  318



>ref|XP_009344766.1| PREDICTED: GATA transcription factor 8-like [Pyrus x bretschneideri]
Length=354

 Score =   154 bits (390),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 87/102 (85%), Gaps = 5/102 (5%)
 Frame = -3

Query  758  GAGEQkkkkkiKFSMPALXNPGAPNQDQG---GAVRKCMHCEITKTPQWRAGPMGPKTLC  588
             +GEQKKKKKIK ++P    P   NQ  G   GAVRKC+HCEITKTPQWRAGPMGPKTLC
Sbjct  222  ASGEQKKKKKIKLTLPQA--PAEGNQSSGTTQGAVRKCLHCEITKTPQWRAGPMGPKTLC  279

Query  587  NACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKKVVEMRTK  462
            NACGVRYKSGRLFPEYRPAASPTFVP+LHSNSHKKV+EMR K
Sbjct  280  NACGVRYKSGRLFPEYRPAASPTFVPALHSNSHKKVIEMRNK  321



>ref|XP_008347480.1| PREDICTED: GATA transcription factor 8-like [Malus domestica]
Length=351

 Score =   154 bits (389),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 87/102 (85%), Gaps = 5/102 (5%)
 Frame = -3

Query  758  GAGEQkkkkkiKFSMPALXNPGAPNQDQG---GAVRKCMHCEITKTPQWRAGPMGPKTLC  588
             +GEQKKKKKIK ++P    P   NQ  G   GAVRKC+HCEITKTPQWRAGPMGPKTLC
Sbjct  219  ASGEQKKKKKIKLTLPQA--PAEGNQSSGTTQGAVRKCLHCEITKTPQWRAGPMGPKTLC  276

Query  587  NACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKKVVEMRTK  462
            NACGVRYKSGRLFPEYRPAASPTFVP+LHSNSHKKV+EMR K
Sbjct  277  NACGVRYKSGRLFPEYRPAASPTFVPALHSNSHKKVIEMRNK  318



>ref|XP_008367332.1| PREDICTED: GATA transcription factor 8-like [Malus domestica]
Length=351

 Score =   154 bits (389),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 87/102 (85%), Gaps = 5/102 (5%)
 Frame = -3

Query  758  GAGEQkkkkkiKFSMPALXNPGAPNQDQG---GAVRKCMHCEITKTPQWRAGPMGPKTLC  588
             +GEQKKKKKIK ++P    P   NQ  G   GAVRKC+HCEITKTPQWRAGPMGPKTLC
Sbjct  219  ASGEQKKKKKIKLTLPQA--PAEGNQSSGTTQGAVRKCLHCEITKTPQWRAGPMGPKTLC  276

Query  587  NACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKKVVEMRTK  462
            NACGVRYKSGRLFPEYRPAASPTFVP+LHSNSHKKV+EMR K
Sbjct  277  NACGVRYKSGRLFPEYRPAASPTFVPALHSNSHKKVIEMRNK  318



>gb|KHG25368.1| GATA transcription factor 8 -like protein [Gossypium arboreum]
Length=339

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/72 (94%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = -3

Query  674  GGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSN  495
            G AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPS+HSN
Sbjct  239  GQAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSVHSN  298

Query  494  SHKKVVEMRTKA  459
            SHKKV+EMRTK+
Sbjct  299  SHKKVLEMRTKS  310



>ref|XP_009770305.1| PREDICTED: GATA transcription factor 8-like, partial [Nicotiana 
sylvestris]
Length=272

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 75/84 (89%), Gaps = 1/84 (1%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            +RKC HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPS+HSNSHK
Sbjct  169  IRKCQHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSIHSNSHK  228

Query  485  KVVEMRTKAVPSLEQSPVSSVAPP  414
            KV+EMRTK VP    + ++  APP
Sbjct  229  KVIEMRTKFVPD-NNANIARTAPP  251



>gb|KJB60582.1| hypothetical protein B456_009G313700 [Gossypium raimondii]
 gb|KJB60583.1| hypothetical protein B456_009G313700 [Gossypium raimondii]
Length=337

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/72 (94%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = -3

Query  674  GGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSN  495
            G AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPS+HSN
Sbjct  237  GQAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSVHSN  296

Query  494  SHKKVVEMRTKA  459
            SHKKV+EMRTK+
Sbjct  297  SHKKVLEMRTKS  308



>ref|XP_004496271.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Cicer 
arietinum]
 ref|XP_004496272.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Cicer 
arietinum]
Length=345

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -3

Query  698  PGAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT  519
            P   NQD    +RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT
Sbjct  237  PADSNQDASQPIRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT  296

Query  518  FVPSLHSNSHKKVVEMRTKAV  456
            F PSLHSNSHKKV+EMR K +
Sbjct  297  FCPSLHSNSHKKVLEMRCKDI  317



>ref|XP_009345388.1| PREDICTED: GATA transcription factor 8-like [Pyrus x bretschneideri]
Length=351

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 87/102 (85%), Gaps = 5/102 (5%)
 Frame = -3

Query  758  GAGEQkkkkkiKFSMPALXNPGAPNQDQG---GAVRKCMHCEITKTPQWRAGPMGPKTLC  588
             +GEQKKKKKIK ++P    P   NQ  G   GAVRKC+HCEITKTPQWRAGPMGPKTLC
Sbjct  219  ASGEQKKKKKIKLTIPQA--PAEGNQSSGTTQGAVRKCLHCEITKTPQWRAGPMGPKTLC  276

Query  587  NACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKKVVEMRTK  462
            NACGVRYKSGRLFPEYRPAASPTFVP+LHSNSHKKV+EMR K
Sbjct  277  NACGVRYKSGRLFPEYRPAASPTFVPALHSNSHKKVLEMRNK  318



>ref|XP_007009853.1| Plant-specific GATA-type zinc finger transcription factor family 
protein isoform 1 [Theobroma cacao]
 gb|EOY18663.1| Plant-specific GATA-type zinc finger transcription factor family 
protein isoform 1 [Theobroma cacao]
Length=414

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 73/80 (91%), Gaps = 1/80 (1%)
 Frame = -3

Query  698  PGAPNQDQGG-AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP  522
            P   NQ+  G AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP
Sbjct  308  PADNNQNSSGQAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP  367

Query  521  TFVPSLHSNSHKKVVEMRTK  462
            TFVPSLHSNSHKKV+EMR K
Sbjct  368  TFVPSLHSNSHKKVIEMRNK  387



>ref|XP_006378769.1| hypothetical protein POPTR_0010s23010g [Populus trichocarpa]
 ref|XP_002316371.2| zinc finger family protein [Populus trichocarpa]
 gb|ERP56566.1| hypothetical protein POPTR_0010s23010g [Populus trichocarpa]
 gb|EEF02542.2| zinc finger family protein [Populus trichocarpa]
Length=352

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
            AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH
Sbjct  252  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  311

Query  488  KKVVEMRTKA  459
            KKVVEMR KA
Sbjct  312  KKVVEMRAKA  321



>ref|XP_009760862.1| PREDICTED: GATA transcription factor 8-like [Nicotiana sylvestris]
 ref|XP_009760863.1| PREDICTED: GATA transcription factor 8-like [Nicotiana sylvestris]
Length=332

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 75/83 (90%), Gaps = 1/83 (1%)
 Frame = -3

Query  698  PGAPNQDQGG-AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP  522
            P   NQ+    AVR+CMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP
Sbjct  224  PIETNQNSTAHAVRRCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP  283

Query  521  TFVPSLHSNSHKKVVEMRTKAVP  453
            TFVPS+HSNSHKKV+EMRTK +P
Sbjct  284  TFVPSMHSNSHKKVLEMRTKDIP  306



>dbj|BAP90356.1| GATA type zinc finger domain [Populus nigra]
Length=352

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
            AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH
Sbjct  252  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  311

Query  488  KKVVEMRTKA  459
            KKVVEMR KA
Sbjct  312  KKVVEMRAKA  321



>gb|KDP44375.1| hypothetical protein JCGZ_20055 [Jatropha curcas]
Length=357

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
            AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH
Sbjct  257  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  316

Query  488  KKVVEMRTKAV  456
            KKV+EMRTK  
Sbjct  317  KKVLEMRTKTT  327



>ref|XP_011076972.1| PREDICTED: GATA transcription factor 8-like [Sesamum indicum]
 ref|XP_011076974.1| PREDICTED: GATA transcription factor 8-like [Sesamum indicum]
Length=328

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 86/101 (85%), Gaps = 4/101 (4%)
 Frame = -3

Query  749  EQkkkkkiKFSMPALXNPGAPNQD--QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACG  576
            EQKK KKIK ++PA  +P A   D     AVRKC+HCEITKTPQWRAGPMGPKTLCNACG
Sbjct  216  EQKKHKKIKITLPA--DPTATRNDPPAQAAVRKCLHCEITKTPQWRAGPMGPKTLCNACG  273

Query  575  VRYKSGRLFPEYRPAASPTFVPSLHSNSHKKVVEMRTKAVP  453
            VRYKSGRLFPEYRPAASPTFVPSLHSNSHKKV+EMR+K  P
Sbjct  274  VRYKSGRLFPEYRPAASPTFVPSLHSNSHKKVIEMRSKVGP  314



>ref|XP_011041012.1| PREDICTED: GATA transcription factor 8-like [Populus euphratica]
 ref|XP_011041013.1| PREDICTED: GATA transcription factor 8-like [Populus euphratica]
Length=355

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
            AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH
Sbjct  255  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  314

Query  488  KKVVEMRTKA  459
            KKVVEMR KA
Sbjct  315  KKVVEMRAKA  324



>ref|XP_009628969.1| PREDICTED: LOW QUALITY PROTEIN: GATA transcription factor 8-like 
[Nicotiana tomentosiformis]
Length=320

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
            AVR+CMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPS+HSNSH
Sbjct  224  AVRRCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSMHSNSH  283

Query  488  KKVVEMRTKAVP  453
            KKV+EMRTK +P
Sbjct  284  KKVLEMRTKDIP  295



>ref|XP_006436435.1| hypothetical protein CICLE_v10032018mg [Citrus clementina]
 ref|XP_006436436.1| hypothetical protein CICLE_v10032018mg [Citrus clementina]
 ref|XP_006436437.1| hypothetical protein CICLE_v10032018mg [Citrus clementina]
 ref|XP_006485699.1| PREDICTED: GATA transcription factor 8-like [Citrus sinensis]
 gb|ESR49675.1| hypothetical protein CICLE_v10032018mg [Citrus clementina]
 gb|ESR49676.1| hypothetical protein CICLE_v10032018mg [Citrus clementina]
 gb|ESR49677.1| hypothetical protein CICLE_v10032018mg [Citrus clementina]
Length=341

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/69 (99%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
            AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH
Sbjct  241  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  300

Query  488  KKVVEMRTK  462
            KKVVEMR K
Sbjct  301  KKVVEMRNK  309



>ref|XP_009598426.1| PREDICTED: GATA transcription factor 8-like [Nicotiana tomentosiformis]
 ref|XP_009598427.1| PREDICTED: GATA transcription factor 8-like [Nicotiana tomentosiformis]
Length=343

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 75/85 (88%), Gaps = 1/85 (1%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
             +RKC HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVP++HSNSH
Sbjct  239  TIRKCQHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPAIHSNSH  298

Query  488  KKVVEMRTKAVPSLEQSPVSSVAPP  414
            KKV+EMRTK VP    + ++  APP
Sbjct  299  KKVIEMRTKVVPD-NNATIARTAPP  322



>dbj|BAC98491.1| AG-motif binding protein-1 [Nicotiana tabacum]
Length=343

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 75/85 (88%), Gaps = 1/85 (1%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
             +RKC HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVP++HSNSH
Sbjct  239  TIRKCQHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPAIHSNSH  298

Query  488  KKVVEMRTKAVPSLEQSPVSSVAPP  414
            KKV+EMRTK VP    + ++  APP
Sbjct  299  KKVIEMRTKVVPD-NNATIARTAPP  322



>ref|XP_004307386.1| PREDICTED: GATA transcription factor 8 [Fragaria vesca subsp. 
vesca]
Length=344

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = -3

Query  671  GAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNS  492
            GA+RKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVP+LHSNS
Sbjct  247  GAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPALHSNS  306

Query  491  HKKVVEMRTK  462
            HKKV+EMRTK
Sbjct  307  HKKVLEMRTK  316



>ref|XP_010032187.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Eucalyptus 
grandis]
Length=310

 Score =   151 bits (381),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 93/118 (79%), Gaps = 8/118 (7%)
 Frame = -3

Query  761  AGAGEQkkkkkiKFSMP----ALXNPGAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKT  594
            +G  E KKKKKIKF+MP    A  + G P Q    AVRKC+HCEITKTPQWRAGP+GPKT
Sbjct  179  SGGAEPKKKKKIKFTMPPAPPAEADQGLPQQ----AVRKCLHCEITKTPQWRAGPLGPKT  234

Query  593  LCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKKVVEMRTKAVPSLEQSPVSSVA  420
            LCNACGVRYKSGRL+PEYRPAASPTF+PSLHSNSHKKV+EMR K   + + S  +S A
Sbjct  235  LCNACGVRYKSGRLYPEYRPAASPTFIPSLHSNSHKKVLEMRNKTTDNADDSGTASAA  292



>gb|KJB73559.1| hypothetical protein B456_011G238800 [Gossypium raimondii]
 gb|KJB73560.1| hypothetical protein B456_011G238800 [Gossypium raimondii]
 gb|KJB73561.1| hypothetical protein B456_011G238800 [Gossypium raimondii]
Length=337

 Score =   151 bits (382),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = -3

Query  698  PGAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT  519
            P   N  Q  +VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT
Sbjct  238  PTDNNTTQNPSVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT  297

Query  518  FVPSLHSNSHKKVVEMRTK  462
            F+PS+HSNSHKKV+EMRTK
Sbjct  298  FIPSVHSNSHKKVLEMRTK  316



>ref|XP_011031733.1| PREDICTED: GATA transcription factor 8-like [Populus euphratica]
Length=358

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
            AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH
Sbjct  254  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  313

Query  488  KKVVEMRTKA  459
            KKVVEMR KA
Sbjct  314  KKVVEMRAKA  323



>gb|ACN36994.1| unknown [Zea mays]
 gb|AFW64082.1| putative GATA transcription factor family protein [Zea mays]
Length=301

 Score =   150 bits (380),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            QGGAVR+C HC+I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTFVPS+HS
Sbjct  211  QGGAVRRCTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSIHS  270

Query  497  NSHKKVVEMRTKAVPS  450
            NSHKKVVEMR KAV S
Sbjct  271  NSHKKVVEMRQKAVRS  286



>ref|XP_004954283.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Setaria 
italica]
 ref|XP_004954284.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Setaria 
italica]
Length=422

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -3

Query  695  GAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF  516
            G  +Q QGGAVR+C HC+I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTF
Sbjct  326  GERSQPQGGAVRRCTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTF  385

Query  515  VPSLHSNSHKKVVEMRTKAV  456
            VPS+HSNSHKKVVEMR KAV
Sbjct  386  VPSIHSNSHKKVVEMRQKAV  405



>gb|AFW64083.1| putative GATA transcription factor family protein [Zea mays]
Length=311

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            QGGAVR+C HC+I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTFVPS+HS
Sbjct  221  QGGAVRRCTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSIHS  280

Query  497  NSHKKVVEMRTKAVPS  450
            NSHKKVVEMR KAV S
Sbjct  281  NSHKKVVEMRQKAVRS  296



>ref|XP_004142426.1| PREDICTED: GATA transcription factor 9-like [Cucumis sativus]
 ref|XP_004166767.1| PREDICTED: GATA transcription factor 9-like [Cucumis sativus]
 gb|KGN52268.1| hypothetical protein Csa_5G622830 [Cucumis sativus]
Length=355

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 84/106 (79%), Gaps = 5/106 (5%)
 Frame = -3

Query  761  AGAGEQkkkkki---KFSMPALXNPGAPNQD--QGGAVRKCMHCEITKTPQWRAGPMGPK  597
            AG+G QK K K     FS+      GA NQ+     +VRKCMHCEITKTPQWRAGPMGPK
Sbjct  222  AGSGTQKIKNKKIKLSFSLAPPLEGGAGNQNLPSSQSVRKCMHCEITKTPQWRAGPMGPK  281

Query  596  TLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKKVVEMRTKA  459
            TLCNACGVRYKSGRLFPEYRPAASPTF+PSLHSNSHKKV+EMR K 
Sbjct  282  TLCNACGVRYKSGRLFPEYRPAASPTFIPSLHSNSHKKVLEMRNKT  327



>dbj|BAC98495.1| AG-motif binding protein-5 [Nicotiana tabacum]
Length=342

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 75/85 (88%), Gaps = 1/85 (1%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
             +RKC HCE+TKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPS+HSNSH
Sbjct  238  TIRKCQHCEMTKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSIHSNSH  297

Query  488  KKVVEMRTKAVPSLEQSPVSSVAPP  414
            KKV+EMRTK VP    + ++  APP
Sbjct  298  KKVIEMRTKFVPD-NNANIARTAPP  321



>ref|XP_008446884.1| PREDICTED: GATA transcription factor 8 [Cucumis melo]
Length=353

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 76/90 (84%), Gaps = 2/90 (2%)
 Frame = -3

Query  722  FSMPALXNPGAPNQD--QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLF  549
            FS+      GA NQ+     +VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLF
Sbjct  236  FSLAPPLEAGAGNQNLPSSQSVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLF  295

Query  548  PEYRPAASPTFVPSLHSNSHKKVVEMRTKA  459
            PEYRPAASPTF+PSLHSNSHKKV+EMR K 
Sbjct  296  PEYRPAASPTFIPSLHSNSHKKVLEMRNKT  325



>ref|XP_004239665.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Solanum 
lycopersicum]
Length=341

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -3

Query  749  EQkkkkkiKFSMPALXNPGAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVR  570
            EQKKKKKIKFS+P        N     AVRKC HCEITKTPQWRAGPMGPKTLCNACGVR
Sbjct  212  EQKKKKKIKFSIPLAPVETNQNPVAQQAVRKCQHCEITKTPQWRAGPMGPKTLCNACGVR  271

Query  569  YKSGRLFPEYRPAASPTFVPSLHSNSHKKVVEMRTKAVPS  450
            YKSGRLFPEYRPAASPTFVP+LHSNSHKKV+EMRT  VP 
Sbjct  272  YKSGRLFPEYRPAASPTFVPALHSNSHKKVLEMRTTIVPD  311



>ref|XP_010032183.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010032184.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010032185.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010032186.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW51583.1| hypothetical protein EUGRSUZ_J01083 [Eucalyptus grandis]
 gb|KCW51584.1| hypothetical protein EUGRSUZ_J01083 [Eucalyptus grandis]
 gb|KCW51585.1| hypothetical protein EUGRSUZ_J01083 [Eucalyptus grandis]
Length=350

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 93/118 (79%), Gaps = 8/118 (7%)
 Frame = -3

Query  761  AGAGEQkkkkkiKFSMP----ALXNPGAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKT  594
            +G  E KKKKKIKF+MP    A  + G P Q    AVRKC+HCEITKTPQWRAGP+GPKT
Sbjct  219  SGGAEPKKKKKIKFTMPPAPPAEADQGLPQQ----AVRKCLHCEITKTPQWRAGPLGPKT  274

Query  593  LCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKKVVEMRTKAVPSLEQSPVSSVA  420
            LCNACGVRYKSGRL+PEYRPAASPTF+PSLHSNSHKKV+EMR K   + + S  +S A
Sbjct  275  LCNACGVRYKSGRLYPEYRPAASPTFIPSLHSNSHKKVLEMRNKTTDNADDSGTASAA  332



>ref|XP_004239666.1| PREDICTED: GATA transcription factor 8-like isoform X3 [Solanum 
lycopersicum]
 ref|XP_010321318.1| PREDICTED: GATA transcription factor 8-like isoform X3 [Solanum 
lycopersicum]
 ref|XP_010321319.1| PREDICTED: GATA transcription factor 8-like isoform X3 [Solanum 
lycopersicum]
Length=327

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -3

Query  749  EQkkkkkiKFSMPALXNPGAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVR  570
            EQKKKKKIKFS+P        N     AVRKC HCEITKTPQWRAGPMGPKTLCNACGVR
Sbjct  198  EQKKKKKIKFSIPLAPVETNQNPVAQQAVRKCQHCEITKTPQWRAGPMGPKTLCNACGVR  257

Query  569  YKSGRLFPEYRPAASPTFVPSLHSNSHKKVVEMRTKAVPS  450
            YKSGRLFPEYRPAASPTFVP+LHSNSHKKV+EMRT  VP 
Sbjct  258  YKSGRLFPEYRPAASPTFVPALHSNSHKKVLEMRTTIVPD  297



>ref|XP_002311088.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE88455.1| zinc finger family protein [Populus trichocarpa]
Length=354

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/70 (97%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
            AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH
Sbjct  254  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  313

Query  488  KKVVEMRTKA  459
            KKVVEMR K+
Sbjct  314  KKVVEMRAKS  323



>gb|KDO44680.1| hypothetical protein CISIN_1g016706mg [Citrus sinensis]
 gb|KDO44681.1| hypothetical protein CISIN_1g016706mg [Citrus sinensis]
Length=384

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/69 (99%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
            AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH
Sbjct  241  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  300

Query  488  KKVVEMRTK  462
            KKVVEMR K
Sbjct  301  KKVVEMRNK  309



>gb|AFW73937.1| putative GATA transcription factor family protein isoform 1 [Zea 
mays]
 gb|AFW73938.1| putative GATA transcription factor family protein isoform 2 [Zea 
mays]
 gb|AFW73939.1| putative GATA transcription factor family protein isoform 3 [Zea 
mays]
 gb|AFW73940.1| putative GATA transcription factor family protein isoform 4 [Zea 
mays]
 gb|AIB04338.1| C2C2-GATA transcription factor, partial [Zea mays]
Length=422

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = -3

Query  695  GAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF  516
            G   + QGGAVR+C HC+I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTF
Sbjct  326  GEQTEPQGGAVRRCTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTF  385

Query  515  VPSLHSNSHKKVVEMRTKAVPS  450
            VPS+HSNSHK+VVEMR KAV S
Sbjct  386  VPSIHSNSHKRVVEMRQKAVRS  407



>ref|XP_010253699.1| PREDICTED: GATA transcription factor 8-like [Nelumbo nucifera]
Length=334

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
            A+RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFV SLHSNSH
Sbjct  235  AIRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVSSLHSNSH  294

Query  488  KKVVEMRTKAVPSLEQS  438
            KKV+EMR+K   + E S
Sbjct  295  KKVLEMRSKVSHNAEMS  311



>ref|XP_002273502.1| PREDICTED: GATA transcription factor 8-like [Vitis vinifera]
Length=340

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/70 (96%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
            AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVP+LHSNSH
Sbjct  240  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPALHSNSH  299

Query  488  KKVVEMRTKA  459
            KKV+EMR KA
Sbjct  300  KKVIEMRNKA  309



>ref|XP_002453007.1| hypothetical protein SORBIDRAFT_04g036520 [Sorghum bicolor]
 gb|EES05983.1| hypothetical protein SORBIDRAFT_04g036520 [Sorghum bicolor]
Length=434

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            QGGAVR+C HC+I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTFVPS+HS
Sbjct  344  QGGAVRRCTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSIHS  403

Query  497  NSHKKVVEMRTKAVPS  450
            NSHKKVVEMR KAV S
Sbjct  404  NSHKKVVEMRQKAVRS  419



>ref|XP_006345791.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006345792.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006345793.1| PREDICTED: GATA transcription factor 8-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006345794.1| PREDICTED: GATA transcription factor 8-like isoform X4 [Solanum 
tuberosum]
Length=328

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = -3

Query  758  GAGEQkkkkkiKFSMPALXNPGAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNAC  579
             A EQKKKKKIKFS+P        N     AVRKC HCEITKTPQWRAGPMGPKTLCNAC
Sbjct  195  AAPEQKKKKKIKFSVPLAPVETNQNPVAQQAVRKCQHCEITKTPQWRAGPMGPKTLCNAC  254

Query  578  GVRYKSGRLFPEYRPAASPTFVPSLHSNSHKKVVEMRTKAVPS  450
            GVRYKSGRLFPEYRPAASPTFVP+LHSNSHKKV+EMRT  VP 
Sbjct  255  GVRYKSGRLFPEYRPAASPTFVPALHSNSHKKVLEMRTTIVPD  297



>ref|XP_002534043.1| GATA transcription factor, putative [Ricinus communis]
 gb|EEF28339.1| GATA transcription factor, putative [Ricinus communis]
Length=359

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/73 (93%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            Q  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS
Sbjct  256  QQQAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  315

Query  497  NSHKKVVEMRTKA  459
            NSHKKV+EMR K 
Sbjct  316  NSHKKVLEMRNKV  328



>ref|NP_001146600.1| putative GATA transcription factor family protein isoform 1 [Zea 
mays]
 ref|XP_008677139.1| PREDICTED: putative GATA transcription factor family protein 
isoform 1 isoform X1 [Zea mays]
 ref|XP_008677140.1| PREDICTED: putative GATA transcription factor family protein 
isoform 1 isoform X1 [Zea mays]
 gb|ACN33964.1| unknown [Zea mays]
 gb|AFW64084.1| putative GATA transcription factor family protein isoform 1 [Zea 
mays]
 gb|AFW64085.1| putative GATA transcription factor family protein isoform 2 [Zea 
mays]
 gb|AFW64086.1| putative GATA transcription factor family protein isoform 3 [Zea 
mays]
Length=405

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            QGGAVR+C HC+I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTFVPS+HS
Sbjct  315  QGGAVRRCTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSIHS  374

Query  497  NSHKKVVEMRTKAVPS  450
            NSHKKVVEMR KAV S
Sbjct  375  NSHKKVVEMRQKAVRS  390



>gb|ACL54362.1| unknown [Zea mays]
 gb|AIB05491.1| C2C2-GATA transcription factor, partial [Zea mays]
Length=405

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            QGGAVR+C HC+I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTFVPS+HS
Sbjct  315  QGGAVRRCTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSIHS  374

Query  497  NSHKKVVEMRTKAVPS  450
            NSHKKVVEMR KAV S
Sbjct  375  NSHKKVVEMRQKAVRS  390



>emb|CDO99748.1| unnamed protein product [Coffea canephora]
Length=341

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
            AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH
Sbjct  241  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  300

Query  488  KKVVEMRTKAV  456
            KKV+EMR K V
Sbjct  301  KKVLEMRGKVV  311



>ref|XP_004239667.2| PREDICTED: GATA transcription factor 8-like isoform X1 [Solanum 
lycopersicum]
Length=410

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -3

Query  749  EQkkkkkiKFSMPALXNPGAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVR  570
            EQKKKKKIKFS+P        N     AVRKC HCEITKTPQWRAGPMGPKTLCNACGVR
Sbjct  281  EQKKKKKIKFSIPLAPVETNQNPVAQQAVRKCQHCEITKTPQWRAGPMGPKTLCNACGVR  340

Query  569  YKSGRLFPEYRPAASPTFVPSLHSNSHKKVVEMRTKAVPS  450
            YKSGRLFPEYRPAASPTFVP+LHSNSHKKV+EMRT  VP 
Sbjct  341  YKSGRLFPEYRPAASPTFVPALHSNSHKKVLEMRTTIVPD  380



>ref|XP_011084325.1| PREDICTED: GATA transcription factor 8 [Sesamum indicum]
Length=333

 Score =   149 bits (376),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/70 (96%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
            AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH
Sbjct  244  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  303

Query  488  KKVVEMRTKA  459
            KKV+EMR K 
Sbjct  304  KKVLEMRGKV  313



>gb|KHG18876.1| GATA transcription factor 8 -like protein [Gossypium arboreum]
Length=337

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 69/69 (100%), Gaps = 0/69 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
            +VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF+PS+HSNSH
Sbjct  248  SVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFIPSVHSNSH  307

Query  488  KKVVEMRTK  462
            KKV+EMRTK
Sbjct  308  KKVLEMRTK  316



>ref|XP_010264666.1| PREDICTED: GATA transcription factor 8-like [Nelumbo nucifera]
Length=333

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 74/83 (89%), Gaps = 3/83 (4%)
 Frame = -3

Query  698  PGAPNQ---DQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAA  528
            PGA  Q    Q  AVRKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAA
Sbjct  222  PGAKEQYAPAQPVAVRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAA  281

Query  527  SPTFVPSLHSNSHKKVVEMRTKA  459
            SPTFV SLHSNSHKKV+EMRT+A
Sbjct  282  SPTFVASLHSNSHKKVLEMRTQA  304



>gb|EYU39843.1| hypothetical protein MIMGU_mgv1a010405mg [Erythranthe guttata]
Length=313

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 74/84 (88%), Gaps = 5/84 (6%)
 Frame = -3

Query  686  NQDQGGA-----VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP  522
            + ++GGA     VRKC HCEITKTPQWRAGP GPKTLCNACGVRYKSGRLFPEYRPAASP
Sbjct  222  DDNEGGAHGDPPVRKCKHCEITKTPQWRAGPTGPKTLCNACGVRYKSGRLFPEYRPAASP  281

Query  521  TFVPSLHSNSHKKVVEMRTKAVPS  450
            TFVP+LHSNSHKKVVEMRTK  P+
Sbjct  282  TFVPALHSNSHKKVVEMRTKVGPA  305



>gb|KHN00843.1| GATA transcription factor 8 [Glycine soja]
Length=242

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = -3

Query  686  NQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPS  507
            NQ+    VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF PS
Sbjct  138  NQNASQPVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFCPS  197

Query  506  LHSNSHKKVVEMRTKAV  456
            +HSNSHKKV+EMR + +
Sbjct  198  VHSNSHKKVLEMRCRGI  214



>ref|XP_010067308.1| PREDICTED: GATA transcription factor 8-like [Eucalyptus grandis]
 gb|KCW65417.1| hypothetical protein EUGRSUZ_G02840 [Eucalyptus grandis]
Length=333

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
            AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF+PSLHSNSH
Sbjct  241  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFIPSLHSNSH  300

Query  488  KKVVEMRTKA  459
            KKV+EMR+  
Sbjct  301  KKVLEMRSNV  310



>gb|KHN00692.1| GATA transcription factor 8 [Glycine soja]
Length=168

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
            AVRKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF  ++HSNSH
Sbjct  70   AVRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFCAAVHSNSH  129

Query  488  KKVVEMRTK  462
            KKV+EMR K
Sbjct  130  KKVIEMRNK  138



>gb|ACJ02090.1| AG-motif binding protein [Garcinia mangostana]
Length=335

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
            AVRKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPS+HSNSH
Sbjct  234  AVRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSVHSNSH  293

Query  488  KKVVEMRTK  462
            KKV+EMR K
Sbjct  294  KKVLEMRNK  302



>ref|XP_010906504.1| PREDICTED: GATA transcription factor 8 [Elaeis guineensis]
 ref|XP_010906505.1| PREDICTED: GATA transcription factor 8 [Elaeis guineensis]
Length=381

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/74 (91%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -3

Query  680  DQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLH  501
            D+   VRKCMHCEI KTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVP LH
Sbjct  290  DEAPPVRKCMHCEIQKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPDLH  349

Query  500  SNSHKKVVEMRTKA  459
            SNSHKKVVEMR KA
Sbjct  350  SNSHKKVVEMRIKA  363



>gb|EMS65328.1| GATA transcription factor 11 [Triticum urartu]
Length=183

 Score =   142 bits (359),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -3

Query  671  GAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNS  492
            G VR+C HC+I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTFVP++HSNS
Sbjct  98   GEVRRCTHCQIDKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPAIHSNS  157

Query  491  HKKVVEMRTKAVP  453
            HKKVVEMR K  P
Sbjct  158  HKKVVEMRQKVEP  170



>gb|KHN17141.1| GATA transcription factor 9 [Glycine soja]
Length=339

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -3

Query  698  PGAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT  519
            P   NQ+    VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT
Sbjct  231  PADNNQNASQPVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT  290

Query  518  FVPSLHSNSHKKVVEMRTKAV  456
            F PS+HSNSHKKV+EMR +  
Sbjct  291  FCPSVHSNSHKKVLEMRCRGF  311



>ref|XP_003556234.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Glycine 
max]
Length=348

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = -3

Query  686  NQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPS  507
            NQ+    VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF PS
Sbjct  244  NQNASQPVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFCPS  303

Query  506  LHSNSHKKVVEMRTKAV  456
            +HSNSHKKV+EMR + +
Sbjct  304  VHSNSHKKVLEMRCRGI  320



>ref|XP_003536350.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Glycine 
max]
 ref|XP_006589425.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Glycine 
max]
 ref|XP_006589426.1| PREDICTED: GATA transcription factor 8-like isoform X3 [Glycine 
max]
Length=347

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -3

Query  698  PGAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT  519
            P   NQ+    VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT
Sbjct  239  PADNNQNASQPVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT  298

Query  518  FVPSLHSNSHKKVVEMRTKAV  456
            F PS+HSNSHKKV+EMR +  
Sbjct  299  FCPSVHSNSHKKVLEMRCRGF  319



>ref|XP_009382468.1| PREDICTED: GATA transcription factor 4-like [Musa acuminata subsp. 
malaccensis]
Length=371

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 72/79 (91%), Gaps = 3/79 (4%)
 Frame = -3

Query  686  NQDQGGA---VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF  516
            + D+ G+   VRKCMHCEI KTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF
Sbjct  265  DGDESGSPPPVRKCMHCEIQKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF  324

Query  515  VPSLHSNSHKKVVEMRTKA  459
            +PS+HSNSHKKVVEMR KA
Sbjct  325  LPSIHSNSHKKVVEMRIKA  343



>ref|XP_006606248.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Glycine 
max]
Length=357

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = -3

Query  686  NQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPS  507
            NQ+    VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF PS
Sbjct  253  NQNASQPVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFCPS  312

Query  506  LHSNSHKKVVEMRTKAV  456
            +HSNSHKKV+EMR + +
Sbjct  313  VHSNSHKKVLEMRCRGI  329



>ref|XP_004236632.1| PREDICTED: GATA transcription factor 8 [Solanum lycopersicum]
 ref|XP_010319208.1| PREDICTED: GATA transcription factor 8 [Solanum lycopersicum]
Length=337

 Score =   146 bits (368),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 73/89 (82%), Gaps = 4/89 (4%)
 Frame = -3

Query  698  PGAPNQDQGG----AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPA  531
            P   NQD       AVRKC+HCEITKTPQWRAGPMGPKTLCNACGVRYK GRL+PEYRPA
Sbjct  218  PIETNQDNYQPAPQAVRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKKGRLYPEYRPA  277

Query  530  ASPTFVPSLHSNSHKKVVEMRTKAVPSLE  444
            ASPTFVPSLHSNSHKKV+EMR+   P  E
Sbjct  278  ASPTFVPSLHSNSHKKVLEMRSNVFPEEE  306



>ref|XP_011089920.1| PREDICTED: GATA transcription factor 11-like isoform X2 [Sesamum 
indicum]
Length=335

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 75/82 (91%), Gaps = 3/82 (4%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            V+KC HCE+TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTF+PSLHSNSHK
Sbjct  237  VKKCTHCEVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFIPSLHSNSHK  296

Query  485  KVVEMRTKA---VPSLEQSPVS  429
            KV+EMR+KA   V ++E+ PVS
Sbjct  297  KVIEMRSKAKQQVSNIEEHPVS  318



>ref|XP_009605437.1| PREDICTED: GATA transcription factor 8-like [Nicotiana tomentosiformis]
Length=339

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
             VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYK GRLFPEYRPAA+PTFVPSLHSNSH
Sbjct  229  TVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKKGRLFPEYRPAAAPTFVPSLHSNSH  288

Query  488  KKVVEMRTKAVP  453
            KKV+EMR+  +P
Sbjct  289  KKVLEMRSNLIP  300



>ref|XP_011089919.1| PREDICTED: GATA transcription factor 11-like isoform X1 [Sesamum 
indicum]
Length=353

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 75/82 (91%), Gaps = 3/82 (4%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            V+KC HCE+TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTF+PSLHSNSHK
Sbjct  255  VKKCTHCEVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFIPSLHSNSHK  314

Query  485  KVVEMRTKA---VPSLEQSPVS  429
            KV+EMR+KA   V ++E+ PVS
Sbjct  315  KVIEMRSKAKQQVSNIEEHPVS  336



>ref|XP_007151876.1| hypothetical protein PHAVU_004G083100g [Phaseolus vulgaris]
 gb|ESW23870.1| hypothetical protein PHAVU_004G083100g [Phaseolus vulgaris]
Length=336

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 71/79 (90%), Gaps = 4/79 (5%)
 Frame = -3

Query  683  QDQGG----AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF  516
            QDQ G    AVRKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF
Sbjct  229  QDQNGSPSQAVRKCVHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF  288

Query  515  VPSLHSNSHKKVVEMRTKA  459
              ++HSNSHKKV+EMR K+
Sbjct  289  CAAVHSNSHKKVLEMRNKS  307



>ref|XP_006350222.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006350223.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Solanum 
tuberosum]
Length=344

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
            AVRKC+HCEITKTPQWRAGPMGPKTLCNACGVRYK GRL+PEYRPAASPTFVPSLHSNSH
Sbjct  232  AVRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKKGRLYPEYRPAASPTFVPSLHSNSH  291

Query  488  KKVVEMRTKAVP  453
            KKV+EMR+   P
Sbjct  292  KKVLEMRSNVFP  303



>ref|XP_003548072.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Glycine 
max]
 ref|XP_006599443.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Glycine 
max]
Length=333

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 83/99 (84%), Gaps = 4/99 (4%)
 Frame = -3

Query  758  GAGEQkkkkkiKFSMPALXNPGAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNAC  579
             +GE KKKKKIK + P+     AP+Q    A+RKC+HCEITKTPQWRAGPMGPKTLCNAC
Sbjct  209  ASGEHKKKKKIKVTFPSGQERNAPSQ----AIRKCLHCEITKTPQWRAGPMGPKTLCNAC  264

Query  578  GVRYKSGRLFPEYRPAASPTFVPSLHSNSHKKVVEMRTK  462
            GVRYKSGRLFPEYRPAASPTF  ++HSNSHKKV+EMR K
Sbjct  265  GVRYKSGRLFPEYRPAASPTFCAAMHSNSHKKVLEMRNK  303



>ref|XP_010555821.1| PREDICTED: GATA transcription factor 8 [Tarenaya hassleriana]
Length=331

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            VRKCMHCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF P+LHSNSHK
Sbjct  228  VRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPALHSNSHK  287

Query  485  KVVEMRTK  462
            KV+EMR+K
Sbjct  288  KVIEMRSK  295



>ref|XP_010935873.1| PREDICTED: LOW QUALITY PROTEIN: GATA transcription factor 8-like 
[Elaeis guineensis]
Length=383

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            VRKCMHCEI KTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK
Sbjct  285  VRKCMHCEIQKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  344

Query  485  KVVEMRTKA  459
            KVVE+R K+
Sbjct  345  KVVELRIKS  353



>gb|AES62142.2| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=236

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF P++HSNSHK
Sbjct  146  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFCPAVHSNSHK  205

Query  485  KVVEMRTK  462
            KV+EMR K
Sbjct  206  KVLEMRCK  213



>ref|XP_009418334.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=366

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            VRKCMHCEI KTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPS+HSNSHK
Sbjct  270  VRKCMHCEIQKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSIHSNSHK  329

Query  485  KVVEMRTKA  459
            KVVEMR  A
Sbjct  330  KVVEMRINA  338



>ref|XP_009418333.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=374

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            VRKCMHCEI KTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPS+HSNSHK
Sbjct  278  VRKCMHCEIQKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSIHSNSHK  337

Query  485  KVVEMRTKA  459
            KVVEMR  A
Sbjct  338  KVVEMRINA  346



>ref|XP_010554544.1| PREDICTED: GATA transcription factor 8-like [Tarenaya hassleriana]
Length=317

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 71/79 (90%), Gaps = 5/79 (6%)
 Frame = -3

Query  686  NQDQGGA-----VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP  522
            +QD G +     VRKCMHCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASP
Sbjct  214  DQDHGPSSSDKPVRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASP  273

Query  521  TFVPSLHSNSHKKVVEMRT  465
            TF+PSLHSNSHKKVVEMR+
Sbjct  274  TFMPSLHSNSHKKVVEMRS  292



>ref|XP_003591891.1| GATA transcription factor [Medicago truncatula]
Length=327

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF P++HSNSHK
Sbjct  237  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFCPAVHSNSHK  296

Query  485  KVVEMRTK  462
            KV+EMR K
Sbjct  297  KVLEMRCK  304



>ref|XP_003591890.1| GATA transcription factor [Medicago truncatula]
 gb|AES62141.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=331

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF P++HSNSHK
Sbjct  241  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFCPAVHSNSHK  300

Query  485  KVVEMRTK  462
            KV+EMR K
Sbjct  301  KVLEMRCK  308



>ref|XP_006574762.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Glycine 
max]
 ref|XP_006574763.1| PREDICTED: GATA transcription factor 8-like isoform X3 [Glycine 
max]
Length=333

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 70/78 (90%), Gaps = 4/78 (5%)
 Frame = -3

Query  695  GAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF  516
             AP+Q    AVRKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF
Sbjct  230  NAPSQ----AVRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF  285

Query  515  VPSLHSNSHKKVVEMRTK  462
              ++HSNSHKKV+EMR K
Sbjct  286  CAAVHSNSHKKVIEMRNK  303



>ref|XP_008807395.1| PREDICTED: GATA transcription factor 8 [Phoenix dactylifera]
 ref|XP_008807403.1| PREDICTED: GATA transcription factor 8 [Phoenix dactylifera]
Length=407

 Score =   145 bits (365),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = -3

Query  680  DQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLH  501
            D+   VRKCMHCEI KTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLH
Sbjct  304  DEAPPVRKCMHCEIQKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLH  363

Query  500  SNSHKKVVEMRTKA  459
            SNSH+KVVEMR +A
Sbjct  364  SNSHRKVVEMRLEA  377



>ref|XP_010235943.1| PREDICTED: PHD finger protein rhinoceros-like [Brachypodium distachyon]
 ref|XP_010235944.1| PREDICTED: PHD finger protein rhinoceros-like [Brachypodium distachyon]
Length=416

 Score =   145 bits (365),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -3

Query  671  GAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNS  492
            GAVR+C HC+I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTFVP++HSNS
Sbjct  331  GAVRRCTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPAIHSNS  390

Query  491  HKKVVEMRTKAVP  453
            HKKVVEMR K  P
Sbjct  391  HKKVVEMRQKVAP  403



>ref|XP_006291493.1| hypothetical protein CARUB_v10017647mg [Capsella rubella]
 gb|EOA24391.1| hypothetical protein CARUB_v10017647mg [Capsella rubella]
Length=323

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -3

Query  701  NPGAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP  522
            N  + + +Q   VRKCMHCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASP
Sbjct  217  NVDSYSSEQQHPVRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASP  276

Query  521  TFVPSLHSNSHKKVVEMRTK  462
            TF P+LHSNSHKKV EMR+K
Sbjct  277  TFTPALHSNSHKKVAEMRSK  296



>ref|XP_007016761.1| GATA zinc finger protein regulating nitrogen assimilation, putative 
[Theobroma cacao]
 gb|EOY34380.1| GATA zinc finger protein regulating nitrogen assimilation, putative 
[Theobroma cacao]
Length=342

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
             VRKCMHCE+TKTPQWR GPMGPKTLCNACGVRY+SGRL PEYRPAASPTFV SLHSNSH
Sbjct  253  VVRKCMHCEVTKTPQWREGPMGPKTLCNACGVRYRSGRLLPEYRPAASPTFVSSLHSNSH  312

Query  488  KKVVEMRTKA  459
            KKVVEMR KA
Sbjct  313  KKVVEMRKKA  322



>emb|CDX67609.1| BnaA07g16490D [Brassica napus]
Length=315

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            VRKCMHCEITKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF P+LHSNSHK
Sbjct  225  VRKCMHCEITKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPALHSNSHK  284

Query  485  KVVEMRTK  462
            KV EMR+K
Sbjct  285  KVAEMRSK  292



>ref|XP_009802378.1| PREDICTED: GATA transcription factor 8-like [Nicotiana sylvestris]
 ref|XP_009802379.1| PREDICTED: GATA transcription factor 8-like [Nicotiana sylvestris]
Length=338

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
             VRKC+HCEITKTPQWRAGPMGPKTLCNACGVRYK GRLFPEYRPAA+PTFVPSLHSNSH
Sbjct  228  TVRKCVHCEITKTPQWRAGPMGPKTLCNACGVRYKKGRLFPEYRPAAAPTFVPSLHSNSH  287

Query  488  KKVVEMRTKAVP  453
            KKV+EMR+   P
Sbjct  288  KKVLEMRSNVFP  299



>ref|XP_004149904.1| PREDICTED: GATA transcription factor 4-like [Cucumis sativus]
 ref|XP_004158598.1| PREDICTED: GATA transcription factor 4-like [Cucumis sativus]
 gb|KGN47830.1| hypothetical protein Csa_6G405920 [Cucumis sativus]
Length=327

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            VRKC+HCE+TKTPQWRAGP+GPKTLCNACGVRYKSGRL+PEYRPAASPTFVP LHSNSHK
Sbjct  215  VRKCLHCEVTKTPQWRAGPLGPKTLCNACGVRYKSGRLYPEYRPAASPTFVPCLHSNSHK  274

Query  485  KVVEMRTKAV  456
            KV+EMR K V
Sbjct  275  KVLEMRIKQV  284



>ref|XP_009103933.1| PREDICTED: GATA transcription factor 8-like [Brassica rapa]
Length=313

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            VRKCMHCEITKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF P+LHSNSHK
Sbjct  223  VRKCMHCEITKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPALHSNSHK  282

Query  485  KVVEMRTK  462
            KV EMR+K
Sbjct  283  KVAEMRSK  290



>ref|XP_010504307.1| PREDICTED: GATA transcription factor 8 [Camelina sativa]
 ref|XP_010504308.1| PREDICTED: GATA transcription factor 8 [Camelina sativa]
Length=326

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            VRKCMHCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF P+LHSNSHK
Sbjct  232  VRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPALHSNSHK  291

Query  485  KVVEMRTK  462
            KV EMR+K
Sbjct  292  KVAEMRSK  299



>ref|XP_010427202.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Camelina 
sativa]
Length=326

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            VRKCMHCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF P+LHSNSHK
Sbjct  232  VRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPALHSNSHK  291

Query  485  KVVEMRTK  462
            KV EMR+K
Sbjct  292  KVAEMRSK  299



>ref|XP_010427201.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Camelina 
sativa]
Length=326

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            VRKCMHCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF P+LHSNSHK
Sbjct  232  VRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPALHSNSHK  291

Query  485  KVVEMRTK  462
            KV EMR+K
Sbjct  292  KVAEMRSK  299



>ref|XP_010516023.1| PREDICTED: GATA transcription factor 8-like [Camelina sativa]
Length=324

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            VRKCMHCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF P+LHSNSHK
Sbjct  230  VRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPALHSNSHK  289

Query  485  KVVEMRTK  462
            KV EMR+K
Sbjct  290  KVAEMRSK  297



>ref|XP_008805201.1| PREDICTED: GATA transcription factor 4-like [Phoenix dactylifera]
 ref|XP_008805202.1| PREDICTED: GATA transcription factor 4-like [Phoenix dactylifera]
 ref|XP_008805203.1| PREDICTED: GATA transcription factor 4-like [Phoenix dactylifera]
Length=398

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/68 (94%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -3

Query  662  RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKK  483
            RKCMHCEI KTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPS+HSNSHKK
Sbjct  301  RKCMHCEIQKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSVHSNSHKK  360

Query  482  VVEMRTKA  459
            VVE+R KA
Sbjct  361  VVELRIKA  368



>emb|CDP07101.1| unnamed protein product [Coffea canephora]
Length=316

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
            A +KC HCE+TKTPQWR GPMGPKTLCNACGVRY+SGRLFPEYRPAASPTF+P+LHSNSH
Sbjct  215  AAKKCTHCEVTKTPQWREGPMGPKTLCNACGVRYRSGRLFPEYRPAASPTFIPTLHSNSH  274

Query  488  KKVVEMRTKAV  456
            +KVVEMR KAV
Sbjct  275  RKVVEMRKKAV  285



>gb|EMT09679.1| GATA transcription factor 11 [Aegilops tauschii]
Length=307

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -3

Query  671  GAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNS  492
            G VR+C HC+I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTFVP++HSNS
Sbjct  222  GEVRRCTHCQIDKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPAIHSNS  281

Query  491  HKKVVEMRTKAVP  453
            HKKVVEMR K  P
Sbjct  282  HKKVVEMRQKVEP  294



>ref|XP_007143712.1| hypothetical protein PHAVU_007G095300g [Phaseolus vulgaris]
 gb|ESW15706.1| hypothetical protein PHAVU_007G095300g [Phaseolus vulgaris]
Length=354

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = -3

Query  698  PGAPNQDQGGA-VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP  522
            PG  N   G   VRKCMHCEITKTPQWRAGPMGPKTLCNACGVR+KSGRL+PEYRPAASP
Sbjct  245  PGDSNNQNGLQPVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRFKSGRLYPEYRPAASP  304

Query  521  TFVPSLHSNSHKKVVEMRTKAV  456
            TF PS+HSNSHKKV+EMR + +
Sbjct  305  TFCPSVHSNSHKKVLEMRCRGI  326



>ref|XP_009392221.1| PREDICTED: GATA transcription factor 8-like [Musa acuminata subsp. 
malaccensis]
Length=340

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  662  RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKK  483
            RKC HCEI KTPQWRAGPMGPKTLCNACGVRY+SGRLFPEYRPA SPTFVPSLHSNSHKK
Sbjct  246  RKCTHCEIQKTPQWRAGPMGPKTLCNACGVRYRSGRLFPEYRPAGSPTFVPSLHSNSHKK  305

Query  482  VVEMRTKA  459
            VVEMR KA
Sbjct  306  VVEMRNKA  313



>ref|XP_006403533.1| hypothetical protein EUTSA_v10010544mg [Eutrema salsugineum]
 dbj|BAJ34547.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ44986.1| hypothetical protein EUTSA_v10010544mg [Eutrema salsugineum]
Length=325

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            +   VRKCMHCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF P+LHS
Sbjct  230  EQNLVRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPALHS  289

Query  497  NSHKKVVEMRTK  462
            NSHKKV EMR K
Sbjct  290  NSHKKVAEMRNK  301



>emb|CDX78264.1| BnaA09g34590D [Brassica napus]
Length=324

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            VRKCMHCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPA SPTF P+LHSNSHK
Sbjct  230  VRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPANSPTFTPALHSNSHK  289

Query  485  KVVEMRTK  462
            KV EMR+K
Sbjct  290  KVAEMRSK  297



>emb|CDY67017.1| BnaCnng53150D [Brassica napus]
Length=333

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            VRKCMHCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF P+LHSNSHK
Sbjct  229  VRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPALHSNSHK  288

Query  485  KVVEMRTK  462
            KV EMR K
Sbjct  289  KVAEMRNK  296



>ref|XP_008456488.1| PREDICTED: LOW QUALITY PROTEIN: GATA transcription factor 8-like 
[Cucumis melo]
Length=328

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 71/81 (88%), Gaps = 5/81 (6%)
 Frame = -3

Query  683  QDQGGAV-----RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT  519
            +DQ  A+     RKC+HCE+TKTPQWRAGP+GPKTLCNACGVRYKSGRL+PEYRPAASPT
Sbjct  205  RDQNDALNPQGMRKCLHCEVTKTPQWRAGPLGPKTLCNACGVRYKSGRLYPEYRPAASPT  264

Query  518  FVPSLHSNSHKKVVEMRTKAV  456
            FVP LHSNSHKKV+EMR K V
Sbjct  265  FVPCLHSNSHKKVLEMRIKQV  285



>ref|XP_003543479.1| PREDICTED: GATA transcription factor 11-like [Glycine max]
Length=327

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 72/82 (88%), Gaps = 4/82 (5%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            + G+ RKCMHCE+TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTFV SLHS
Sbjct  234  ESGSPRKCMHCEVTKTPQWREGPVGPKTLCNACGVRYRSGRLFPEYRPAASPTFVASLHS  293

Query  497  NSHKKVVEMRTKAVPSLEQSPV  432
            N HKKVVEMR++A+    Q PV
Sbjct  294  NCHKKVVEMRSRAI----QEPV  311



>emb|CDX73447.1| BnaC08g25560D [Brassica napus]
Length=323

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            VRKCMHCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPA SPTF P+LHSNSHK
Sbjct  229  VRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPANSPTFTPALHSNSHK  288

Query  485  KVVEMRTK  462
            KV EMR+K
Sbjct  289  KVAEMRSK  296



>gb|KHN21512.1| GATA transcription factor 11 [Glycine soja]
Length=327

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 72/82 (88%), Gaps = 4/82 (5%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            + G+ RKCMHCE+TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTFV SLHS
Sbjct  234  ESGSPRKCMHCEVTKTPQWREGPVGPKTLCNACGVRYRSGRLFPEYRPAASPTFVASLHS  293

Query  497  NSHKKVVEMRTKAVPSLEQSPV  432
            N HKKVVEMR++A+    Q PV
Sbjct  294  NCHKKVVEMRSRAI----QEPV  311



>gb|ACU24388.1| unknown [Glycine max]
Length=327

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 72/82 (88%), Gaps = 4/82 (5%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            + G+ RKCMHCE+TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTFV SLHS
Sbjct  234  ESGSPRKCMHCEVTKTPQWREGPVGPKTLCNACGVRYRSGRLFPEYRPAASPTFVASLHS  293

Query  497  NSHKKVVEMRTKAVPSLEQSPV  432
            N HKKVVEMR++A+    Q PV
Sbjct  294  NCHKKVVEMRSRAI----QEPV  311



>ref|XP_009116158.1| PREDICTED: GATA transcription factor 8 [Brassica rapa]
Length=324

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            VRKCMHCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPA SPTF P+LHSNSHK
Sbjct  230  VRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPANSPTFTPALHSNSHK  289

Query  485  KVVEMRTK  462
            KV EMR+K
Sbjct  290  KVAEMRSK  297



>ref|XP_011089286.1| PREDICTED: GATA transcription factor 11-like [Sesamum indicum]
Length=336

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 72/81 (89%), Gaps = 3/81 (4%)
 Frame = -3

Query  662  RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKK  483
            +KC HCE+TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTFVPSLHSNSHKK
Sbjct  239  KKCTHCEVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFVPSLHSNSHKK  298

Query  482  VVEMRTKA---VPSLEQSPVS  429
            V+EMR+KA      LE+ P+S
Sbjct  299  VIEMRSKAKQPATKLEEPPIS  319



>ref|XP_003519961.2| PREDICTED: GATA transcription factor 8-like isoform X1 [Glycine 
max]
Length=416

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 70/78 (90%), Gaps = 4/78 (5%)
 Frame = -3

Query  695  GAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF  516
             AP+Q    AVRKC+HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF
Sbjct  313  NAPSQ----AVRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF  368

Query  515  VPSLHSNSHKKVVEMRTK  462
              ++HSNSHKKV+EMR K
Sbjct  369  CAAVHSNSHKKVIEMRNK  386



>ref|XP_002876270.1| BME3/BME3-ZF [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52529.1| BME3/BME3-ZF [Arabidopsis lyrata subsp. lyrata]
Length=319

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = -3

Query  662  RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKK  483
            RKCMHCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF P+LHSNSHKK
Sbjct  226  RKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPALHSNSHKK  285

Query  482  VVEMRTK  462
            V EMR+K
Sbjct  286  VAEMRSK  292



>dbj|BAH20385.1| AT3G54810 [Arabidopsis thaliana]
Length=322

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            +RKCMHCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF P+LHSNSHK
Sbjct  228  LRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPALHSNSHK  287

Query  485  KVVEMRTK  462
            KV EMR K
Sbjct  288  KVAEMRNK  295



>ref|NP_191041.1| GATA transcription factor 8 [Arabidopsis thaliana]
 ref|NP_850704.1| GATA transcription factor 8 [Arabidopsis thaliana]
 sp|Q9SV30.1|GATA8_ARATH RecName: Full=GATA transcription factor 8 [Arabidopsis thaliana]
 gb|AAL06560.1|AF412107_1 AT3g54810/F28P10_210 [Arabidopsis thaliana]
 emb|CAB41103.1| putative protein [Arabidopsis thaliana]
 gb|AAL77730.1| AT3g54810/F28P10_210 [Arabidopsis thaliana]
 dbj|BAH20168.1| AT3G54810 [Arabidopsis thaliana]
 gb|AEE79293.1| GATA transcription factor 8 [Arabidopsis thaliana]
 gb|AEE79294.1| GATA transcription factor 8 [Arabidopsis thaliana]
Length=322

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            +RKCMHCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF P+LHSNSHK
Sbjct  228  LRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPALHSNSHK  287

Query  485  KVVEMRTK  462
            KV EMR K
Sbjct  288  KVAEMRNK  295



>ref|XP_003540186.1| PREDICTED: GATA transcription factor 11-like [Glycine max]
Length=326

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 70/82 (85%), Gaps = 4/82 (5%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            + G  RKCMHCE+TKTPQWR GPMGPKTLCNACGVRY+SGRLFPEYRPAASPTFV SLHS
Sbjct  233  ESGPPRKCMHCEVTKTPQWREGPMGPKTLCNACGVRYRSGRLFPEYRPAASPTFVASLHS  292

Query  497  NSHKKVVEMRTKAVPSLEQSPV  432
            N HKKVVEMR++ +    Q PV
Sbjct  293  NCHKKVVEMRSRVI----QEPV  310



>dbj|BAJ84868.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87901.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=405

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -3

Query  674  GGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSN  495
             G VR+C HC+I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTFVP++HSN
Sbjct  319  AGEVRRCTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPAIHSN  378

Query  494  SHKKVVEMRTKAVP  453
            SHKKVVEMR K  P
Sbjct  379  SHKKVVEMRQKVEP  392



>gb|KHN11215.1| GATA transcription factor 10 [Glycine soja]
Length=319

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 70/82 (85%), Gaps = 4/82 (5%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            + G  RKCMHCE+TKTPQWR GPMGPKTLCNACGVRY+SGRLFPEYRPAASPTFV SLHS
Sbjct  226  ESGPPRKCMHCEVTKTPQWREGPMGPKTLCNACGVRYRSGRLFPEYRPAASPTFVASLHS  285

Query  497  NSHKKVVEMRTKAVPSLEQSPV  432
            N HKKVVEMR++ +    Q PV
Sbjct  286  NCHKKVVEMRSRVI----QEPV  303



>gb|KDP44040.1| hypothetical protein JCGZ_05507 [Jatropha curcas]
Length=324

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            +RKC HCE+TKTPQWR GPMGPKTLCNACGVRY+SGRLFPEYRPAASPTFVPSLHSNSH+
Sbjct  234  IRKCTHCEVTKTPQWREGPMGPKTLCNACGVRYRSGRLFPEYRPAASPTFVPSLHSNSHR  293

Query  485  KVVEMRTKAV  456
            KVVEMR K  
Sbjct  294  KVVEMRKKTT  303



>gb|KJB26178.1| hypothetical protein B456_004G230100 [Gossypium raimondii]
Length=346

 Score =   141 bits (355),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -3

Query  680  DQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLH  501
            ++   VRKC HCE+TKTPQWR GP GPKTLCNACGVRY+SGRLFPEYRPAASPTFVPSLH
Sbjct  252  EEAAVVRKCTHCEVTKTPQWREGPKGPKTLCNACGVRYRSGRLFPEYRPAASPTFVPSLH  311

Query  500  SNSHKKVVEMR  468
            SNSHKKV+EMR
Sbjct  312  SNSHKKVIEMR  322



>gb|AAK98698.1|AC069158_10 Putative GATA-1 zinc finger protein [Oryza sativa Japonica Group]
 gb|EAY87927.1| hypothetical protein OsI_09352 [Oryza sativa Indica Group]
Length=418

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -3

Query  671  GAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNS  492
            G VR+C HC+I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTF+PS+HSNS
Sbjct  330  GTVRRCTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFMPSIHSNS  389

Query  491  HKKVVEMRTKAV  456
            HKKVVEMR KA 
Sbjct  390  HKKVVEMRQKAT  401



>ref|XP_010031983.1| PREDICTED: GATA transcription factor 10-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW51378.1| hypothetical protein EUGRSUZ_J00922 [Eucalyptus grandis]
Length=319

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
            A RKCMHCE+TKTPQWR GPMGPKTLCNACGVRY+SGRLFPEYRPAASPTF+ SLHSNSH
Sbjct  224  ATRKCMHCEVTKTPQWREGPMGPKTLCNACGVRYRSGRLFPEYRPAASPTFISSLHSNSH  283

Query  488  KKVVEMR  468
            +KV+EMR
Sbjct  284  RKVIEMR  290



>ref|XP_010031984.1| PREDICTED: GATA transcription factor 10-like isoform X2 [Eucalyptus 
grandis]
Length=318

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
            A RKCMHCE+TKTPQWR GPMGPKTLCNACGVRY+SGRLFPEYRPAASPTF+ SLHSNSH
Sbjct  223  ATRKCMHCEVTKTPQWREGPMGPKTLCNACGVRYRSGRLFPEYRPAASPTFISSLHSNSH  282

Query  488  KKVVEMR  468
            +KV+EMR
Sbjct  283  RKVIEMR  289



>ref|XP_007132266.1| hypothetical protein PHAVU_011G080200g [Phaseolus vulgaris]
 gb|ESW04260.1| hypothetical protein PHAVU_011G080200g [Phaseolus vulgaris]
Length=295

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -3

Query  680  DQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLH  501
            ++  AVRKC+HCE+TKTPQWR GPMGPKTLCNACGVRY+SGRLF EYRPAASPTFV SLH
Sbjct  220  EESVAVRKCLHCEVTKTPQWREGPMGPKTLCNACGVRYRSGRLFAEYRPAASPTFVGSLH  279

Query  500  SNSHKKVVEMRTKA  459
            SNSHKKV+E+R +A
Sbjct  280  SNSHKKVLEIRNRA  293



>gb|KHN05677.1| GATA transcription factor 11 [Glycine soja]
Length=221

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -3

Query  680  DQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLH  501
             +  A+RKC+HCE+TKTPQWR GPMGPKTLCNACGVRY+SGRLF EYRPAASPTFV SLH
Sbjct  142  QESVALRKCLHCEVTKTPQWREGPMGPKTLCNACGVRYRSGRLFAEYRPAASPTFVSSLH  201

Query  500  SNSHKKVVEMRTKA  459
            SNSHKKV+E+R +A
Sbjct  202  SNSHKKVLEIRNRA  215



>gb|KJB20301.1| hypothetical protein B456_003G142600 [Gossypium raimondii]
Length=248

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            VRKC+HCE+TKTPQWR GPMGPKTLCNACGVR++SGRL PEYRPAASPTFVP+LHSNSHK
Sbjct  160  VRKCLHCEVTKTPQWREGPMGPKTLCNACGVRFRSGRLLPEYRPAASPTFVPALHSNSHK  219

Query  485  KVVEMRTKA  459
            KVVEMR +A
Sbjct  220  KVVEMRKQA  228



>ref|XP_004242094.2| PREDICTED: GATA transcription factor 11-like [Solanum lycopersicum]
Length=258

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
             ++C HCE+TKTPQWR GP+GPKTLCNACGVRY+SGRL PEYRPAASPTF+PSLHSNSHK
Sbjct  166  FKRCTHCEVTKTPQWREGPLGPKTLCNACGVRYRSGRLLPEYRPAASPTFIPSLHSNSHK  225

Query  485  KVVEMRTKAVPS  450
            KVVEMR K V S
Sbjct  226  KVVEMRRKTVES  237



>ref|XP_002529940.1| GATA transcription factor, putative [Ricinus communis]
 gb|EEF32448.1| GATA transcription factor, putative [Ricinus communis]
Length=323

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -3

Query  689  PNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVP  510
            P+ +  G +RKC HCE+TKTPQWR GPMGPKTLCNACGVRY+SGRLFPEYRPAASPTFVP
Sbjct  226  PSSEVPGEIRKCTHCEVTKTPQWREGPMGPKTLCNACGVRYRSGRLFPEYRPAASPTFVP  285

Query  509  SLHSNSHKKVVEMR  468
            +LHSNSH+KV+EMR
Sbjct  286  ALHSNSHRKVIEMR  299



>ref|XP_007150193.1| hypothetical protein PHAVU_005G134400g [Phaseolus vulgaris]
 gb|AGV54633.1| GATA transcription factor [Phaseolus vulgaris]
 gb|ESW22187.1| hypothetical protein PHAVU_005G134400g [Phaseolus vulgaris]
Length=323

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  662  RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKK  483
            RKCMHCE+TKTPQWR GPMGPKTLCNACGVRY+SGRLFPEYRPAASPTFV SLHSN HKK
Sbjct  236  RKCMHCEVTKTPQWREGPMGPKTLCNACGVRYRSGRLFPEYRPAASPTFVSSLHSNCHKK  295

Query  482  VVEMRTKA  459
            VVEMR++ 
Sbjct  296  VVEMRSRV  303



>gb|KHG09661.1| GATA transcription factor 11 -like protein [Gossypium arboreum]
Length=314

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            Q   +RKC HCE+T+TPQWR GPMGPKTLCNACGVRY+SGRLFPEYRPA SPTF+ SLHS
Sbjct  218  QQLVIRKCGHCEVTETPQWRKGPMGPKTLCNACGVRYRSGRLFPEYRPAGSPTFIASLHS  277

Query  497  NSHKKVVEMRTKAVPSLEQSPVSSVAP  417
            NSHKKVVEMR K+  + + + +  V P
Sbjct  278  NSHKKVVEMRRKSQFTGDSNTIRVVNP  304



>ref|XP_009621794.1| PREDICTED: GATA transcription factor 11-like isoform X2 [Nicotiana 
tomentosiformis]
Length=305

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            Q  + +KC HC++TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTFVP+LHS
Sbjct  195  QQSSFKKCTHCQVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFVPTLHS  254

Query  497  NSHKKVVEMRTKAV  456
            NSH+KVVEMR KA+
Sbjct  255  NSHRKVVEMRKKAL  268



>ref|XP_009621793.1| PREDICTED: GATA transcription factor 11-like isoform X1 [Nicotiana 
tomentosiformis]
Length=306

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            Q  + +KC HC++TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTFVP+LHS
Sbjct  196  QQSSFKKCTHCQVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFVPTLHS  255

Query  497  NSHKKVVEMRTKAV  456
            NSH+KVVEMR KA+
Sbjct  256  NSHRKVVEMRKKAL  269



>gb|KJB20300.1| hypothetical protein B456_003G142600 [Gossypium raimondii]
Length=343

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            VRKC+HCE+TKTPQWR GPMGPKTLCNACGVR++SGRL PEYRPAASPTFVP+LHSNSHK
Sbjct  255  VRKCLHCEVTKTPQWREGPMGPKTLCNACGVRFRSGRLLPEYRPAASPTFVPALHSNSHK  314

Query  485  KVVEMRTKA  459
            KVVEMR +A
Sbjct  315  KVVEMRKQA  323



>gb|KHG27547.1| GATA transcription factor 10 -like protein [Gossypium arboreum]
Length=343

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 73/82 (89%), Gaps = 1/82 (1%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            VRKC+HCE+TKTPQWR GPMGPKTLCNACGVR++SGRL PEYRPAASPTFVP+LHSNSHK
Sbjct  255  VRKCLHCEVTKTPQWREGPMGPKTLCNACGVRFRSGRLLPEYRPAASPTFVPALHSNSHK  314

Query  485  KVVEMRTKA-VPSLEQSPVSSV  423
            KVVEMR +A +P+    P+ S+
Sbjct  315  KVVEMRKQANLPTTGTPPMLSI  336



>emb|CDY07522.1| BnaC06g15420D [Brassica napus]
Length=324

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            VRKCMHCE+TKTPQWR GP GPKTLCNACGVRYKSGRLFPEYRPAASPTF P+LHSNSHK
Sbjct  224  VRKCMHCEVTKTPQWRLGPNGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPALHSNSHK  283

Query  485  KVVEMRTK  462
            KV EMR+K
Sbjct  284  KVAEMRSK  291



>ref|XP_009795845.1| PREDICTED: GATA transcription factor 11-like isoform X1 [Nicotiana 
sylvestris]
Length=306

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            Q  + +KC HC++TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTFVP+LHS
Sbjct  196  QQFSFKKCTHCQVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFVPTLHS  255

Query  497  NSHKKVVEMRTKAV  456
            NSH+KVVEMR KA+
Sbjct  256  NSHRKVVEMRKKAI  269



>ref|XP_009795846.1| PREDICTED: GATA transcription factor 11-like isoform X2 [Nicotiana 
sylvestris]
Length=305

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            Q  + +KC HC++TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTFVP+LHS
Sbjct  195  QQFSFKKCTHCQVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFVPTLHS  254

Query  497  NSHKKVVEMRTKAV  456
            NSH+KVVEMR KA+
Sbjct  255  NSHRKVVEMRKKAI  268



>gb|EPS57111.1| hypothetical protein M569_17712, partial [Genlisea aurea]
Length=64

 Score =   131 bits (329),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = -3

Query  659  KCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKKV  480
            KC+HCEITKTPQWR+GP GPKTLCNACGVR+KSGRLFPEYRPAASPTFVP+LHSNSHKKV
Sbjct  1    KCLHCEITKTPQWRSGPSGPKTLCNACGVRFKSGRLFPEYRPAASPTFVPALHSNSHKKV  60

Query  479  VEMR  468
            +EMR
Sbjct  61   IEMR  64



>emb|CAC28528.1| GATA-1 zinc finger protein [Nicotiana tabacum]
Length=305

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            Q  + +KC HC++TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTFVP+LHS
Sbjct  195  QQFSFKKCTHCQVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFVPTLHS  254

Query  497  NSHKKVVEMRTKAV  456
            NSH+KVVEMR KA+
Sbjct  255  NSHRKVVEMRKKAI  268



>ref|XP_006365758.1| PREDICTED: GATA transcription factor 10-like [Solanum tuberosum]
Length=258

 Score =   136 bits (343),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
             ++C HCE+TKTPQWR GP+GPKTLCNACGVRY+SGRL PEYRPAASPTF+PSLHSNSH+
Sbjct  170  FKRCTHCEVTKTPQWREGPLGPKTLCNACGVRYRSGRLLPEYRPAASPTFIPSLHSNSHR  229

Query  485  KVVEMRTKAVPSLEQSPV  432
            KVVEMR K V    Q+ V
Sbjct  230  KVVEMRRKTVECDSQNFV  247



>ref|XP_010089971.1| Protein-tyrosine sulfotransferase [Morus notabilis]
 gb|EXB38685.1| Protein-tyrosine sulfotransferase [Morus notabilis]
Length=820

 Score =   143 bits (360),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 60/76 (79%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  686  NQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPS  507
            +  Q G ++KC HC++T TPQWR GPMGPKTLCNACGVR++SGRLFPEYRPAASPTFVPS
Sbjct  717  SSQQSGEIKKCTHCQMTTTPQWREGPMGPKTLCNACGVRFRSGRLFPEYRPAASPTFVPS  776

Query  506  LHSNSHKKVVEMRTKA  459
            LHSNSHKKV+EMR KA
Sbjct  777  LHSNSHKKVIEMRNKA  792



>gb|KHG08445.1| GATA transcription factor 11 -like protein [Gossypium arboreum]
Length=390

 Score =   139 bits (350),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -3

Query  680  DQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLH  501
            ++   VRKC HCE+TKTPQWR GP GPKTLCNACGVRY+SGRLFPEYRPAASPTFV SLH
Sbjct  294  EEAAVVRKCTHCEVTKTPQWREGPKGPKTLCNACGVRYRSGRLFPEYRPAASPTFVASLH  353

Query  500  SNSHKKVVEMR  468
            SNSHKKV+EMR
Sbjct  354  SNSHKKVIEMR  364



>emb|CDY02894.1| BnaC04g25920D [Brassica napus]
Length=333

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            VRKCMHCE+TKTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTF P+LHSNSHK
Sbjct  229  VRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLCPEYRPAASPTFTPALHSNSHK  288

Query  485  KVVEMRTKAVPS  450
            KV EMR K   S
Sbjct  289  KVAEMRNKRCSS  300



>ref|XP_004251141.1| PREDICTED: GATA transcription factor 11-like [Solanum lycopersicum]
Length=336

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            Q    +KC HCE+TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTFVPS+HS
Sbjct  213  QSSFFKKCTHCEVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFVPSVHS  272

Query  497  NSHKKVVEMRTKAV  456
            NSH+KVVEMR K +
Sbjct  273  NSHRKVVEMRKKTL  286



>gb|KJB56141.1| hypothetical protein B456_009G107900 [Gossypium raimondii]
Length=234

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
             + KC HCE+T+TPQWR GPMGPKTLCNACGVRY+SGRLFPEYRPAASPTFV S+HSNSH
Sbjct  149  VIMKCTHCEVTETPQWREGPMGPKTLCNACGVRYRSGRLFPEYRPAASPTFVASMHSNSH  208

Query  488  KKVVEMRTKAVPSLEQSPV  432
            KKVVEMR KA   L  S +
Sbjct  209  KKVVEMRKKAKLPLSLSSI  227



>gb|KHG05024.1| GATA transcription factor 11 -like protein [Gossypium arboreum]
Length=347

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 71/84 (85%), Gaps = 5/84 (6%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
             + KC HCE+T+TPQWR GPMGPKTLCNACGVRY+SGRLFPEYRPAASPTFV S+HSNSH
Sbjct  264  VIMKCTHCEVTETPQWREGPMGPKTLCNACGVRYRSGRLFPEYRPAASPTFVASMHSNSH  323

Query  488  KKVVEMRTKAVPSLEQSPVSSVAP  417
            KKVVEMR KA     + P+SS+ P
Sbjct  324  KKVVEMRKKA-----KLPLSSIPP  342



>ref|XP_006340186.1| PREDICTED: GATA transcription factor 11-like [Solanum tuberosum]
Length=337

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            Q    +KC HCE+TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTFVPS+HS
Sbjct  215  QSSFFKKCTHCEVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFVPSVHS  274

Query  497  NSHKKVVEMRTKAV  456
            NSH+KVVEMR K +
Sbjct  275  NSHRKVVEMRKKTL  288



>gb|KJB56138.1| hypothetical protein B456_009G107900 [Gossypium raimondii]
Length=276

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
             + KC HCE+T+TPQWR GPMGPKTLCNACGVRY+SGRLFPEYRPAASPTFV S+HSNSH
Sbjct  191  VIMKCTHCEVTETPQWREGPMGPKTLCNACGVRYRSGRLFPEYRPAASPTFVASMHSNSH  250

Query  488  KKVVEMRTKA  459
            KKVVEMR KA
Sbjct  251  KKVVEMRKKA  260



>ref|XP_003539767.1| PREDICTED: GATA transcription factor 11-like [Glycine max]
Length=304

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
            A+RKC+HCE+TKTPQWR GPMGPKTLCNACGVRY+SGRLF EYRPAASPTFV SLHS+SH
Sbjct  229  ALRKCLHCEVTKTPQWREGPMGPKTLCNACGVRYRSGRLFAEYRPAASPTFVSSLHSDSH  288

Query  488  KKVVEMRTKA  459
            KKV+E+R +A
Sbjct  289  KKVLEIRNRA  298



>ref|XP_009118398.1| PREDICTED: GATA transcription factor 11-like [Brassica rapa]
Length=259

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
              G VR+C HCE TKTPQWR GP GPKTLCNACGVR++SGRL PEYRPA+SPTF+PSLHS
Sbjct  174  DDGIVRRCTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRLVPEYRPASSPTFIPSLHS  233

Query  497  NSHKKVVEMRTKAVPSLEQSPVSSVA  420
            NSH+K++EMR K     + S + S A
Sbjct  234  NSHRKIIEMRRKEGDEFDNSMIHSKA  259



>ref|XP_010521758.1| PREDICTED: GATA transcription factor 11-like [Tarenaya hassleriana]
 ref|XP_010521759.1| PREDICTED: GATA transcription factor 11-like [Tarenaya hassleriana]
Length=305

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -3

Query  701  NPGAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP  522
            +PG+ +  + G  RKC HCE TKTPQWR GP GPKTLCNACGVR++SGRL PEYRPAASP
Sbjct  208  HPGSSSHSESGTTRKCTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRLVPEYRPAASP  267

Query  521  TFVPSLHSNSHKKVVEMRTKA  459
            TF+PS+HSNSH+K+VEMR K 
Sbjct  268  TFIPSVHSNSHRKIVEMRRKG  288



>gb|KJB56139.1| hypothetical protein B456_009G107900 [Gossypium raimondii]
 gb|KJB56140.1| hypothetical protein B456_009G107900 [Gossypium raimondii]
Length=329

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
             + KC HCE+T+TPQWR GPMGPKTLCNACGVRY+SGRLFPEYRPAASPTFV S+HSNSH
Sbjct  244  VIMKCTHCEVTETPQWREGPMGPKTLCNACGVRYRSGRLFPEYRPAASPTFVASMHSNSH  303

Query  488  KKVVEMRTKAVPSLEQSPV  432
            KKVVEMR KA   L  S +
Sbjct  304  KKVVEMRKKAKLPLSLSSI  322



>ref|XP_006488078.1| PREDICTED: GATA transcription factor 11-like [Citrus sinensis]
Length=277

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            Q  A RKCMHCE+ +TPQWR GPMGPKTLCNACGVRY+SGRL PEYRPAASPTFVPSLHS
Sbjct  203  QTDAPRKCMHCEVAETPQWREGPMGPKTLCNACGVRYRSGRLVPEYRPAASPTFVPSLHS  262

Query  497  NSHKKVVEMRTK  462
            NSHK+++EMR K
Sbjct  263  NSHKRIMEMRNK  274



>ref|XP_009598797.1| PREDICTED: GATA transcription factor 11-like isoform X2 [Nicotiana 
tomentosiformis]
Length=250

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
             +KC HCE+TKTPQWR GP+GPKTLCNACGVRY+SGRL PEYRPAASPTFVPSLHSNSH 
Sbjct  166  FKKCTHCEVTKTPQWREGPLGPKTLCNACGVRYRSGRLLPEYRPAASPTFVPSLHSNSHM  225

Query  485  KVVEMRTKAV  456
            KV+EMR  AV
Sbjct  226  KVIEMRRNAV  235



>gb|AFK40558.1| unknown [Medicago truncatula]
Length=87

 Score =   129 bits (325),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = -3

Query  653  MHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKKVVE  474
            MHCEITKTPQWRAGPMGPKTLCNACGVR+KSGRLFPEYRPAASPTF P++HSNSHKKV+E
Sbjct  1    MHCEITKTPQWRAGPMGPKTLCNACGVRHKSGRLFPEYRPAASPTFCPAVHSNSHKKVLE  60

Query  473  MRTK  462
            MR K
Sbjct  61   MRCK  64



>gb|KHN38758.1| GATA transcription factor 11 [Glycine soja]
Length=305

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  662  RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKK  483
            RKC+HCE+TKTPQWR GPMGPKTLCNACGVRY+SGRLF EYRPA+SPTFV SLHSNSHKK
Sbjct  232  RKCLHCEVTKTPQWREGPMGPKTLCNACGVRYRSGRLFAEYRPASSPTFVASLHSNSHKK  291

Query  482  VVEMRTKA  459
            V+E+R +A
Sbjct  292  VLEIRNRA  299



>ref|XP_009774660.1| PREDICTED: GATA transcription factor 11-like [Nicotiana sylvestris]
Length=282

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
             +KC HCE+T+TPQWR GP+GPKTLCNACGVRY+SGRL PEYRPAASPTFVPSLHSNSH+
Sbjct  186  FKKCTHCEVTRTPQWREGPLGPKTLCNACGVRYRSGRLLPEYRPAASPTFVPSLHSNSHR  245

Query  485  KVVEMRTKAV  456
            KV+EMR  AV
Sbjct  246  KVIEMRRNAV  255



>ref|XP_003538192.1| PREDICTED: GATA transcription factor 11-like [Glycine max]
Length=305

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -3

Query  662  RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKK  483
            RKC+HCE+TKTPQWR GPMGPKTLCNACGVRY+SGRLF EYRPA+SPTFV SLHSNSHKK
Sbjct  232  RKCLHCEVTKTPQWREGPMGPKTLCNACGVRYRSGRLFAEYRPASSPTFVASLHSNSHKK  291

Query  482  VVEMRTKA  459
            V+E+R +A
Sbjct  292  VLEIRNRA  299



>ref|XP_009598796.1| PREDICTED: GATA transcription factor 11-like isoform X1 [Nicotiana 
tomentosiformis]
Length=264

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
             +KC HCE+TKTPQWR GP+GPKTLCNACGVRY+SGRL PEYRPAASPTFVPSLHSNSH 
Sbjct  180  FKKCTHCEVTKTPQWREGPLGPKTLCNACGVRYRSGRLLPEYRPAASPTFVPSLHSNSHM  239

Query  485  KVVEMRTKAV  456
            KV+EMR  AV
Sbjct  240  KVIEMRRNAV  249



>emb|CDY22706.1| BnaC08g43400D [Brassica napus]
Length=258

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
              G VR+C HCE TKTPQWR GP GPKTLCNACGVR++SGRL PEYRPA+SPTF+PSLHS
Sbjct  173  DDGIVRRCTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRLVPEYRPASSPTFIPSLHS  232

Query  497  NSHKKVVEMRTKAVPSLEQSPVSSVA  420
            NSH+K++EMR K     + S + S A
Sbjct  233  NSHRKIIEMRRKEGDEFDNSMIHSGA  258



>gb|ACU23703.1| unknown [Glycine max]
Length=305

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -3

Query  662  RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKK  483
            RKC+HCE+TKTPQWR GPMGPKTLCNACGVRY+SGRLF EYRPA+SPTFV SLHSNSHKK
Sbjct  232  RKCLHCEVTKTPQWREGPMGPKTLCNACGVRYRSGRLFAEYRPASSPTFVASLHSNSHKK  291

Query  482  VVEMRTKAV  456
            V+E+R +A 
Sbjct  292  VLEIRNRAT  300



>ref|XP_006304051.1| hypothetical protein CARUB_v10009871mg [Capsella rubella]
 ref|XP_006304052.1| hypothetical protein CARUB_v10009871mg [Capsella rubella]
 gb|EOA36949.1| hypothetical protein CARUB_v10009871mg [Capsella rubella]
 gb|EOA36950.1| hypothetical protein CARUB_v10009871mg [Capsella rubella]
Length=300

 Score =   134 bits (338),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 68/85 (80%), Gaps = 2/85 (2%)
 Frame = -3

Query  692  APNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFV  513
            A N D  G VRKC HCE TKTPQWR GP GPKTLCNACGVRY+SGRL PEYRPA+SPTF+
Sbjct  209  ASNSD--GIVRKCTHCETTKTPQWREGPSGPKTLCNACGVRYRSGRLVPEYRPASSPTFI  266

Query  512  PSLHSNSHKKVVEMRTKAVPSLEQS  438
            PSLHSNSH+K++EMR K     + S
Sbjct  267  PSLHSNSHRKIIEMRRKDDNQFDTS  291



>ref|XP_006424556.1| hypothetical protein CICLE_v10029015mg [Citrus clementina]
 gb|ESR37796.1| hypothetical protein CICLE_v10029015mg [Citrus clementina]
 gb|KDO73316.1| hypothetical protein CISIN_1g023588mg [Citrus sinensis]
Length=280

 Score =   134 bits (337),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            Q    RKCMHCE+ +TPQWR GPMGPKTLCNACGVRY+SGRL PEYRPAASPTFVPSLHS
Sbjct  206  QTDTPRKCMHCEVAETPQWREGPMGPKTLCNACGVRYRSGRLVPEYRPAASPTFVPSLHS  265

Query  497  NSHKKVVEMRTK  462
            NSHK+++EMR K
Sbjct  266  NSHKRIMEMRNK  277



>ref|XP_007205805.1| hypothetical protein PRUPE_ppa010692mg [Prunus persica]
 gb|EMJ07004.1| hypothetical protein PRUPE_ppa010692mg [Prunus persica]
Length=240

 Score =   133 bits (334),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
             ++CMHC +TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTFV S+HSNSHK
Sbjct  159  TKRCMHCAVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFVASVHSNSHK  218

Query  485  KVVEMRTK  462
            KV+E+R K
Sbjct  219  KVIELRNK  226



>ref|XP_010542590.1| PREDICTED: GATA transcription factor 11-like [Tarenaya hassleriana]
 ref|XP_010542591.1| PREDICTED: GATA transcription factor 11-like [Tarenaya hassleriana]
Length=288

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -3

Query  671  GAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNS  492
            G VRKC HCE TKTPQWR GP GPKTLCNACGVR++SGRL PEYRPAASPTFVPS+HSNS
Sbjct  202  GTVRKCTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRLVPEYRPAASPTFVPSVHSNS  261

Query  491  HKKVVEMRTKAVPSLEQSPVSSV  423
            H+K++EMR+K     +   + +V
Sbjct  262  HRKIIEMRSKDGQKFDSGMIHTV  284



>emb|CDX95103.1| BnaC05g05680D [Brassica napus]
Length=288

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -3

Query  680  DQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLH  501
            D  G VR+C HCE TKTPQWR GP GPKTLCNACGVR++SGRL PEYRPA+SPTFVPS+H
Sbjct  206  DSDGVVRRCTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRLVPEYRPASSPTFVPSVH  265

Query  500  SNSHKKVVEMRTK  462
            SNSH+K++EMR++
Sbjct  266  SNSHRKIIEMRSR  278



>ref|XP_010510639.1| PREDICTED: putative GATA transcription factor 13 [Camelina sativa]
Length=205

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 71/98 (72%), Gaps = 7/98 (7%)
 Frame = -3

Query  713  PALXNPGAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRP  534
            P L NP        G VRKC HCE T+TPQWR GP G KTLCNACGVR++SGRL PEYRP
Sbjct  114  PELFNPD-------GTVRKCTHCETTRTPQWREGPCGRKTLCNACGVRFRSGRLVPEYRP  166

Query  533  AASPTFVPSLHSNSHKKVVEMRTKAVPSLEQSPVSSVA  420
            A+SPTFVP++HSNSH+K++EMR K    LE   + +V 
Sbjct  167  ASSPTFVPTVHSNSHRKIIEMRRKDEGQLETRKIRTVT  204



>ref|NP_172279.1| GATA transcription factor 11 [Arabidopsis thaliana]
 ref|NP_001077485.1| GATA transcription factor 11 [Arabidopsis thaliana]
 sp|Q6DBP8.1|GAT11_ARATH RecName: Full=GATA transcription factor 11 [Arabidopsis thaliana]
 gb|AAT70425.1| At1g08010 [Arabidopsis thaliana]
 gb|AAU45211.1| At1g08010 [Arabidopsis thaliana]
 dbj|BAF01229.1| putative GATA transcription factor 3 [Arabidopsis thaliana]
 dbj|BAH30279.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28228.1| GATA transcription factor 11 [Arabidopsis thaliana]
 gb|AEE28229.1| GATA transcription factor 11 [Arabidopsis thaliana]
Length=303

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 71/90 (79%), Gaps = 2/90 (2%)
 Frame = -3

Query  692  APNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFV  513
            A N D  G VRKC HCE TKTPQWR GP GPKTLCNACGVR++SGRL PEYRPA+SPTF+
Sbjct  212  ASNSD--GIVRKCTHCETTKTPQWREGPSGPKTLCNACGVRFRSGRLVPEYRPASSPTFI  269

Query  512  PSLHSNSHKKVVEMRTKAVPSLEQSPVSSV  423
            P++HSNSH+K++EMR K     + S + +V
Sbjct  270  PAVHSNSHRKIIEMRRKDDEQFDSSMIRAV  299



>ref|XP_006384910.1| hypothetical protein POPTR_0004s22140g [Populus trichocarpa]
 gb|ERP62707.1| hypothetical protein POPTR_0004s22140g [Populus trichocarpa]
Length=232

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  692  APNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFV  513
            AP   Q    R+C HC++TKTPQWR GP+GPKTLCNACGVRY+SGRL PEYRPAASPTFV
Sbjct  155  APKMKQPVETRRCTHCQVTKTPQWREGPLGPKTLCNACGVRYRSGRLLPEYRPAASPTFV  214

Query  512  PSLHSNSHKKVVEMRTKA  459
            P LHSNSH+KV+EMR + 
Sbjct  215  PFLHSNSHRKVLEMRKQT  232



>gb|EYU18824.1| hypothetical protein MIMGU_mgv1a008576mg [Erythranthe guttata]
Length=304

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 70/81 (86%), Gaps = 3/81 (4%)
 Frame = -3

Query  662  RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKK  483
            +KC HCE+TKTPQWR GP+GPKTLCNACGVRY+SGRL+PEYRPAASPTF PSLHSNSHKK
Sbjct  204  KKCTHCEVTKTPQWREGPLGPKTLCNACGVRYRSGRLYPEYRPAASPTFAPSLHSNSHKK  263

Query  482  VVEMRTKA-VPS--LEQSPVS  429
            V+EMR K   P+   E+ P+S
Sbjct  264  VIEMRNKGKFPTNIFEEPPIS  284



>ref|XP_008245237.1| PREDICTED: GATA transcription factor 11-like isoform X1 [Prunus 
mume]
Length=309

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
             ++CMHC +TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTFV S+HSNSHK
Sbjct  228  TKRCMHCAVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFVASVHSNSHK  287

Query  485  KVVEMRTK  462
            KV+E+R K
Sbjct  288  KVIELRNK  295



>ref|XP_010526169.1| PREDICTED: GATA transcription factor 9 [Tarenaya hassleriana]
Length=314

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
             GG+VR+CMHCE  KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTFV + HS
Sbjct  196  DGGSVRRCMHCETEKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVMTKHS  255

Query  497  NSHKKVVEMRTK  462
            NSH+KV+E+R +
Sbjct  256  NSHRKVLELRQQ  267



>ref|XP_010458021.1| PREDICTED: GATA transcription factor 11-like [Camelina sativa]
Length=305

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 71/90 (79%), Gaps = 2/90 (2%)
 Frame = -3

Query  692  APNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFV  513
            A N D  G VRKC HCE TKTPQWR GP GPKTLCNACGVR++SGRL PEYRPA+SPTF+
Sbjct  214  ASNSD--GIVRKCTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRLVPEYRPASSPTFI  271

Query  512  PSLHSNSHKKVVEMRTKAVPSLEQSPVSSV  423
            PS+HSNSH+K++EMR K     + S + +V
Sbjct  272  PSVHSNSHRKIIEMRRKDDNQFDTSMMHAV  301



>emb|CDY06293.1| BnaA09g49100D [Brassica napus]
Length=256

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
              G VR+C HCE TKTPQWR GP GPKTLCNACGVR++SGRL PEYRPA+SPTF+PSLHS
Sbjct  174  DDGIVRRCTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRLVPEYRPASSPTFIPSLHS  233

Query  497  NSHKKVVEMRTK  462
            NSH+K++EMR K
Sbjct  234  NSHRKIIEMRRK  245



>ref|XP_008245238.1| PREDICTED: GATA transcription factor 11-like isoform X2 [Prunus 
mume]
Length=290

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
             ++CMHC +TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTFV S+HSNSHK
Sbjct  209  TKRCMHCAVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFVASVHSNSHK  268

Query  485  KVVEMRTK  462
            KV+E+R K
Sbjct  269  KVIELRNK  276



>ref|XP_006846789.1| hypothetical protein AMTR_s00148p00049970 [Amborella trichopoda]
 gb|ERN08370.1| hypothetical protein AMTR_s00148p00049970 [Amborella trichopoda]
Length=277

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -3

Query  662  RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKK  483
            RKC HCEI KTPQWR GP+GPKTLCNACGVRYKSGRLFPEYRPAASPTFV SLHSNSHKK
Sbjct  152  RKCTHCEIQKTPQWRTGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFVASLHSNSHKK  211

Query  482  VVEMRTK  462
            V+EMR +
Sbjct  212  VLEMRVR  218



>ref|XP_010475585.1| PREDICTED: GATA transcription factor 11-like [Camelina sativa]
 ref|XP_010475586.1| PREDICTED: GATA transcription factor 11-like [Camelina sativa]
Length=307

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -3

Query  680  DQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLH  501
            +  G VRKC HCE TKTPQWR GP GPKTLCNACGVR++SGRL PEYRPA+SPTF+PS+H
Sbjct  218  NSDGIVRKCTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRLVPEYRPASSPTFIPSVH  277

Query  500  SNSHKKVVEMRTKAVPSLEQSPVSSV  423
            SNSH+K++EMR K     + S + +V
Sbjct  278  SNSHRKIIEMRRKDDNQFDTSMMHAV  303



>ref|XP_010488262.1| PREDICTED: GATA transcription factor 11-like [Camelina sativa]
Length=312

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 71/90 (79%), Gaps = 2/90 (2%)
 Frame = -3

Query  692  APNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFV  513
            A N D  G VRKC HCE TKTPQWR GP GPKTLCNACGVR++SGRL PEYRPA+SPTF+
Sbjct  221  ASNSD--GIVRKCTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRLVPEYRPASSPTFI  278

Query  512  PSLHSNSHKKVVEMRTKAVPSLEQSPVSSV  423
            PS+HSNSH+K++EMR K     + S + +V
Sbjct  279  PSVHSNSHRKIIEMRRKDDNQFDTSMMHAV  308



>ref|XP_009148049.1| PREDICTED: GATA transcription factor 11-like [Brassica rapa]
 ref|XP_009148050.1| PREDICTED: GATA transcription factor 11-like [Brassica rapa]
Length=282

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -3

Query  680  DQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLH  501
            +  G VR+C HCE TKTPQWR GP GPKTLCNACGVR++SGRL PEYRPA+SPTF+PS+H
Sbjct  200  NSDGVVRRCTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRLVPEYRPASSPTFIPSVH  259

Query  500  SNSHKKVVEMRTKAVPSLEQSPV  432
            SNSH+K++EMR++     ++  V
Sbjct  260  SNSHRKIIEMRSREGDQFDKRAV  282



>gb|EYU18823.1| hypothetical protein MIMGU_mgv1a008576mg [Erythranthe guttata]
Length=369

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 70/81 (86%), Gaps = 3/81 (4%)
 Frame = -3

Query  662  RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKK  483
            +KC HCE+TKTPQWR GP+GPKTLCNACGVRY+SGRL+PEYRPAASPTF PSLHSNSHKK
Sbjct  269  KKCTHCEVTKTPQWREGPLGPKTLCNACGVRYRSGRLYPEYRPAASPTFAPSLHSNSHKK  328

Query  482  VVEMRTKA-VPS--LEQSPVS  429
            V+EMR K   P+   E+ P+S
Sbjct  329  VIEMRNKGKFPTNIFEEPPIS  349



>emb|CDX71356.1| BnaC04g15910D [Brassica napus]
Length=281

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            + G VRKC HCE TKTPQWR GP GPKTLCNACGVR++SGRL PEYRPA+SPTF+P++HS
Sbjct  192  ENGTVRKCTHCETTKTPQWREGPGGPKTLCNACGVRFRSGRLLPEYRPASSPTFIPTVHS  251

Query  497  NSHKKVVEMRTK  462
            NSH+K++EMR K
Sbjct  252  NSHRKIIEMRRK  263



>ref|XP_010414542.1| PREDICTED: putative GATA transcription factor 13 isoform X1 [Camelina 
sativa]
Length=232

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            Q    RKC HCE T+TPQWR GP GPKTLCNACGVR++SGRLFPEYRPA+SPTFVP++HS
Sbjct  154  QKSPARKCTHCETTRTPQWREGPRGPKTLCNACGVRFRSGRLFPEYRPASSPTFVPTVHS  213

Query  497  NSHKKVVEMRTKAVPSLE  444
            N H+K+VEMR K    L+
Sbjct  214  NMHRKIVEMRRKDEDQLD  231



>ref|XP_010414543.1| PREDICTED: putative GATA transcription factor 13 isoform X2 [Camelina 
sativa]
Length=230

 Score =   130 bits (328),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            Q    RKC HCE T+TPQWR GP GPKTLCNACGVR++SGRLFPEYRPA+SPTFVP++HS
Sbjct  152  QKSPARKCTHCETTRTPQWREGPRGPKTLCNACGVRFRSGRLFPEYRPASSPTFVPTVHS  211

Query  497  NSHKKVVEMRTKAVPSLE  444
            N H+K+VEMR K    L+
Sbjct  212  NMHRKIVEMRRKDEDQLD  229



>ref|XP_004506013.1| PREDICTED: GATA transcription factor 11-like [Cicer arietinum]
Length=317

 Score =   132 bits (333),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  662  RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKK  483
            RKCMHCE+T+TPQWR GP GPKTLCNACGVRY+SGRLFPEYRPAASPTF  S HSNSHKK
Sbjct  228  RKCMHCEVTETPQWREGPKGPKTLCNACGVRYRSGRLFPEYRPAASPTFEASSHSNSHKK  287

Query  482  VVEMRTKA  459
            V+EMR KA
Sbjct  288  VLEMRNKA  295



>ref|XP_002892428.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68687.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=303

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -3

Query  674  GGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSN  495
             G VRKC HCE TKTPQWR GP G KTLCNACGVR++SGRL PEYRPA+SPTF+PS+HSN
Sbjct  216  DGIVRKCTHCETTKTPQWREGPKGRKTLCNACGVRFRSGRLVPEYRPASSPTFIPSVHSN  275

Query  494  SHKKVVEMRTKAVPSLEQSPVSSV  423
            SH+K+VEMR K     + S + +V
Sbjct  276  SHRKIVEMRRKDDEQFDTSMIRAV  299



>ref|XP_004487098.1| PREDICTED: GATA transcription factor 11-like [Cicer arietinum]
Length=313

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
              RKC HCEITKTPQWR GP GPKTLCNACGVRY+SGRL+PEYRPAASPTFV S+HSN H
Sbjct  231  VTRKCSHCEITKTPQWREGPKGPKTLCNACGVRYRSGRLYPEYRPAASPTFVESIHSNCH  290

Query  488  KKVVEMRTKAVPSLEQSP  435
            KKV+EMR K +    ++P
Sbjct  291  KKVMEMRCKVIKECVRAP  308



>ref|XP_011040891.1| PREDICTED: GATA transcription factor 11-like isoform X1 [Populus 
euphratica]
Length=320

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  692  APNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFV  513
            AP + Q    R+C HC++TKTPQWR GP+GPKTLCNACGVRY+SGRL PEYRPAASPTFV
Sbjct  224  APKKKQPVETRRCTHCQVTKTPQWREGPLGPKTLCNACGVRYRSGRLLPEYRPAASPTFV  283

Query  512  PSLHSNSHKKVVEMRTKA  459
            P LHSNSH+KV+EMR + 
Sbjct  284  PFLHSNSHRKVLEMRKQT  301



>ref|XP_008359306.1| PREDICTED: GATA transcription factor 11-like [Malus domestica]
Length=296

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 67/77 (87%), Gaps = 3/77 (4%)
 Frame = -3

Query  680  DQGGAVR---KCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVP  510
            D+ G  R   +C HC++TKTPQWR GP+GPKTLCNACGVRY+SGRL PEYRPAASPTFV 
Sbjct  207  DEAGESRETKRCTHCQVTKTPQWREGPLGPKTLCNACGVRYRSGRLLPEYRPAASPTFVA  266

Query  509  SLHSNSHKKVVEMRTKA  459
            S+HSNSHKKV+E+R+K+
Sbjct  267  SVHSNSHKKVIELRSKS  283



>ref|XP_011040892.1| PREDICTED: GATA transcription factor 11-like isoform X2 [Populus 
euphratica]
Length=314

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -3

Query  692  APNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFV  513
            AP + Q    R+C HC++TKTPQWR GP+GPKTLCNACGVRY+SGRL PEYRPAASPTFV
Sbjct  218  APKKKQPVETRRCTHCQVTKTPQWREGPLGPKTLCNACGVRYRSGRLLPEYRPAASPTFV  277

Query  512  PSLHSNSHKKVVEMRTKA  459
            P LHSNSH+KV+EMR + 
Sbjct  278  PFLHSNSHRKVLEMRKQT  295



>ref|XP_006417739.1| hypothetical protein EUTSA_v10008338mg [Eutrema salsugineum]
 ref|XP_006417740.1| hypothetical protein EUTSA_v10008338mg [Eutrema salsugineum]
 ref|XP_006417741.1| hypothetical protein EUTSA_v10008338mg [Eutrema salsugineum]
 gb|ESQ36092.1| hypothetical protein EUTSA_v10008338mg [Eutrema salsugineum]
 gb|ESQ36093.1| hypothetical protein EUTSA_v10008338mg [Eutrema salsugineum]
 gb|ESQ36094.1| hypothetical protein EUTSA_v10008338mg [Eutrema salsugineum]
Length=295

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 65/75 (87%), Gaps = 2/75 (3%)
 Frame = -3

Query  692  APNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFV  513
            A N D  G VRKC HCE TKTPQWR GP GPKTLCNACGVR++SGRL PEYRPA+SPTF+
Sbjct  202  ASNSD--GMVRKCTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRLVPEYRPASSPTFI  259

Query  512  PSLHSNSHKKVVEMR  468
            PS+HSNSH+K++EMR
Sbjct  260  PSVHSNSHRKIIEMR  274



>gb|EYU36178.1| hypothetical protein MIMGU_mgv1a0095201mg [Erythranthe guttata]
 gb|EYU36179.1| hypothetical protein MIMGU_mgv1a0095201mg [Erythranthe guttata]
Length=339

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -3

Query  707  LXNPGAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAA  528
            L +  A  +      ++C HC++ KTPQWR GP GPKTLCNACGVRY+SGRLFPEYRPAA
Sbjct  194  LQSSAAQQRSPTATTKRCTHCQVMKTPQWREGPAGPKTLCNACGVRYRSGRLFPEYRPAA  253

Query  527  SPTFVPSLHSNSHKKVVEMRTK  462
            SPTFVP++HSNSH+KVVEMRTK
Sbjct  254  SPTFVPTVHSNSHRKVVEMRTK  275



>ref|XP_009103677.1| PREDICTED: GATA transcription factor 11 isoform X2 [Brassica 
rapa]
Length=306

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -3

Query  671  GAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNS  492
            G VRKC HCE TKTPQWR GP GPKTLCNACGVR++SGRL PEYRPA+SPTF+P++HSNS
Sbjct  219  GTVRKCTHCETTKTPQWREGPRGPKTLCNACGVRFRSGRLLPEYRPASSPTFIPTVHSNS  278

Query  491  HKKVVEMRTK  462
            H+K++EMR K
Sbjct  279  HRKIIEMRRK  288



>emb|CDY04556.1| BnaA07g13820D [Brassica napus]
Length=306

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -3

Query  671  GAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNS  492
            G VRKC HCE TKTPQWR GP GPKTLCNACGVR++SGRL PEYRPA+SPTF+P++HSNS
Sbjct  219  GTVRKCTHCETTKTPQWREGPRGPKTLCNACGVRFRSGRLLPEYRPASSPTFIPTVHSNS  278

Query  491  HKKVVEMRTK  462
            H+K++EMR K
Sbjct  279  HRKIIEMRRK  288



>ref|XP_006409859.1| hypothetical protein EUTSA_v10017012mg [Eutrema salsugineum]
 gb|ESQ51312.1| hypothetical protein EUTSA_v10017012mg [Eutrema salsugineum]
Length=295

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -3

Query  671  GAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNS  492
            G VRKC HCE TKTPQWR GP GPKTLCNACGVR++SGRL PEYRPA+SPTF+P++HSNS
Sbjct  209  GTVRKCTHCETTKTPQWREGPSGPKTLCNACGVRFRSGRLVPEYRPASSPTFIPTVHSNS  268

Query  491  HKKVVEMRTK  462
            H+K++EMR K
Sbjct  269  HRKIIEMRRK  278



>ref|XP_009103676.1| PREDICTED: GATA transcription factor 11 isoform X1 [Brassica 
rapa]
Length=315

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -3

Query  671  GAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNS  492
            G VRKC HCE TKTPQWR GP GPKTLCNACGVR++SGRL PEYRPA+SPTF+P++HSNS
Sbjct  228  GTVRKCTHCETTKTPQWREGPRGPKTLCNACGVRFRSGRLLPEYRPASSPTFIPTVHSNS  287

Query  491  HKKVVEMRTK  462
            H+K++EMR K
Sbjct  288  HRKIIEMRRK  297



>gb|ABK26808.1| unknown [Picea sitchensis]
Length=131

 Score =   127 bits (318),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 67/95 (71%), Gaps = 4/95 (4%)
 Frame = -3

Query  716  MPALXNPGAPNQDQGGAV----RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLF  549
            M  +   GA N  Q  A     R+C HC   +TPQWR GP+GPKTLCNACGVR+KSGRLF
Sbjct  1    MKTVTGTGAINNYQSSASQQQPRRCTHCLSQRTPQWRLGPLGPKTLCNACGVRFKSGRLF  60

Query  548  PEYRPAASPTFVPSLHSNSHKKVVEMRTKAVPSLE  444
            PEYRPA SPTF+  +HSNSHKKV+EMR +    LE
Sbjct  61   PEYRPAKSPTFIRYIHSNSHKKVLEMRNQEADDLE  95



>ref|XP_008385404.1| PREDICTED: GATA transcription factor 11 [Malus domestica]
Length=285

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = -3

Query  662  RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKK  483
            ++C HC++TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTFV ++HSNSHKK
Sbjct  205  KRCTHCQVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFVAAVHSNSHKK  264

Query  482  VVEMRTK  462
            V+E+R+K
Sbjct  265  VIELRSK  271



>ref|XP_008359134.1| PREDICTED: GATA transcription factor 11-like isoform X2 [Malus 
domestica]
Length=300

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = -3

Query  662  RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKK  483
            ++C HC++TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTFV ++HSNSHKK
Sbjct  220  KRCTHCQVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFVAAVHSNSHKK  279

Query  482  VVEMRTK  462
            V+E+R+K
Sbjct  280  VIELRSK  286



>ref|XP_009367061.1| PREDICTED: GATA transcription factor 11 [Pyrus x bretschneideri]
Length=301

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 67/77 (87%), Gaps = 3/77 (4%)
 Frame = -3

Query  680  DQGGAVR---KCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVP  510
            D+ G  R   +C HC++TKTPQWR GP+GPKTLCNACGVRY+SGRL PEYRPAASPTF+ 
Sbjct  212  DEAGESRETKRCAHCQVTKTPQWREGPLGPKTLCNACGVRYRSGRLLPEYRPAASPTFIA  271

Query  509  SLHSNSHKKVVEMRTKA  459
            S+HSNSHKKV+E+R+K+
Sbjct  272  SVHSNSHKKVIELRSKS  288



>ref|XP_003592781.1| GATA transcription factor [Medicago truncatula]
 gb|AES63032.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=246

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  695  GAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTF  516
             A + +  G VR+C HCE TKTPQWR GP GPKTLCNACGVRYKSGRL PEYRPAAS TF
Sbjct  153  AALDHNALGLVRQCTHCEATKTPQWRTGPEGPKTLCNACGVRYKSGRLCPEYRPAASSTF  212

Query  515  VPSLHSNSHKKVVEMR  468
             P LHSNSHKK++EMR
Sbjct  213  SPDLHSNSHKKILEMR  228



>ref|XP_004291710.1| PREDICTED: GATA transcription factor 11-like [Fragaria vesca 
subsp. vesca]
Length=309

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            +    ++C HC +TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTFVP++HS
Sbjct  233  ENRETKRCTHCAVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFVPAVHS  292

Query  497  NSHKKVVEMRTK  462
            NSHKKV+E+R K
Sbjct  293  NSHKKVIELRNK  304



>ref|XP_008359133.1| PREDICTED: GATA transcription factor 11-like isoform X1 [Malus 
domestica]
Length=316

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = -3

Query  662  RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKK  483
            ++C HC++TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTFV ++HSNSHKK
Sbjct  236  KRCTHCQVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFVAAVHSNSHKK  295

Query  482  VVEMRTK  462
            V+E+R+K
Sbjct  296  VIELRSK  302



>ref|XP_010047283.1| PREDICTED: GATA transcription factor 12-like [Eucalyptus grandis]
 gb|KCW79157.1| hypothetical protein EUGRSUZ_C00602 [Eucalyptus grandis]
Length=385

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 69/86 (80%), Gaps = 2/86 (2%)
 Frame = -3

Query  713  PALXNPGAPN--QDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEY  540
            P L  P  P+  +  GG VR+C+HC+  KTPQWR GPMGPKTLCNACGVRYKSGRL PEY
Sbjct  251  PGLDGPDGPDGPEAGGGEVRRCLHCQTDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEY  310

Query  539  RPAASPTFVPSLHSNSHKKVVEMRTK  462
            RPAASPTFV + HSNSH+KV+E+R +
Sbjct  311  RPAASPTFVLTRHSNSHRKVLELRRQ  336



>ref|XP_011073746.1| PREDICTED: GATA transcription factor 1-like isoform X2 [Sesamum 
indicum]
Length=283

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 68/85 (80%), Gaps = 6/85 (7%)
 Frame = -3

Query  716  MPALXNPGAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYR  537
            +P L N GA      G  R+C+HC+  KTPQWRAGPMGPKTLCNACGVRYKSGRL PEYR
Sbjct  185  LPMLANGGA------GLGRRCLHCQADKTPQWRAGPMGPKTLCNACGVRYKSGRLLPEYR  238

Query  536  PAASPTFVPSLHSNSHKKVVEMRTK  462
            PA+SPTF  +LHSNSH+KV+EMR +
Sbjct  239  PASSPTFSSTLHSNSHRKVIEMRKQ  263



>ref|XP_011073745.1| PREDICTED: GATA transcription factor 1-like isoform X1 [Sesamum 
indicum]
Length=284

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 68/85 (80%), Gaps = 6/85 (7%)
 Frame = -3

Query  716  MPALXNPGAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYR  537
            +P L N GA      G  R+C+HC+  KTPQWRAGPMGPKTLCNACGVRYKSGRL PEYR
Sbjct  186  LPMLANGGA------GLGRRCLHCQADKTPQWRAGPMGPKTLCNACGVRYKSGRLLPEYR  239

Query  536  PAASPTFVPSLHSNSHKKVVEMRTK  462
            PA+SPTF  +LHSNSH+KV+EMR +
Sbjct  240  PASSPTFSSTLHSNSHRKVIEMRKQ  264



>ref|XP_010470098.1| PREDICTED: putative GATA transcription factor 13 [Camelina sativa]
Length=286

 Score =   129 bits (325),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 69/85 (81%), Gaps = 2/85 (2%)
 Frame = -3

Query  713  PALXNPGAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRP  534
            P++ +P   N D  G VRKC HCE T+TPQWR GP G  TLCNACGVR++SGRL PEYRP
Sbjct  197  PSVSSPELFNSD--GTVRKCTHCETTRTPQWREGPCGRNTLCNACGVRFRSGRLVPEYRP  254

Query  533  AASPTFVPSLHSNSHKKVVEMRTKA  459
            A+SPTF+P++HSNSH+K++EM+TK 
Sbjct  255  ASSPTFIPTVHSNSHRKIIEMKTKT  279



>gb|AAF79843.1|AC026875_23 T6D22.9 [Arabidopsis thaliana]
Length=821

 Score =   134 bits (337),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 71/90 (79%), Gaps = 2/90 (2%)
 Frame = -3

Query  692  APNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFV  513
            A N D  G VRKC HCE TKTPQWR GP GPKTLCNACGVR++SGRL PEYRPA+SPTF+
Sbjct  287  ASNSD--GIVRKCTHCETTKTPQWREGPSGPKTLCNACGVRFRSGRLVPEYRPASSPTFI  344

Query  512  PSLHSNSHKKVVEMRTKAVPSLEQSPVSSV  423
            P++HSNSH+K++EMR K     + S + +V
Sbjct  345  PAVHSNSHRKIIEMRRKDDEQFDSSMIRAV  374


 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  674  GGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSN  495
             G VR C HCE   TPQWR GP GPKTLCNACGVR+KSGRL PEYRPA+SPTF+PS+HSN
Sbjct  727  DGIVRICTHCETITTPQWRQGPSGPKTLCNACGVRFKSGRLVPEYRPASSPTFIPSVHSN  786

Query  494  SHKKVVEMRTK  462
            SH+K++EMR K
Sbjct  787  SHRKIIEMRKK  797



>ref|XP_006854315.1| hypothetical protein AMTR_s00039p00112210 [Amborella trichopoda]
 gb|ERN15782.1| hypothetical protein AMTR_s00039p00112210 [Amborella trichopoda]
Length=258

 Score =   128 bits (322),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  671  GAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNS  492
            G VR+C+HC   +TPQWRAGP+GPKTLCNACGVRY SGRLFPEYRPA SPTF+  +HSNS
Sbjct  174  GEVRRCVHCLTQRTPQWRAGPLGPKTLCNACGVRYNSGRLFPEYRPADSPTFIREIHSNS  233

Query  491  HKKVVEMRTK  462
            H+K+VEMR K
Sbjct  234  HRKIVEMRKK  243



>ref|XP_011046757.1| PREDICTED: GATA transcription factor 9-like [Populus euphratica]
Length=308

 Score =   129 bits (324),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -3

Query  689  PNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVP  510
            PN D    VR+C+HC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTFV 
Sbjct  213  PNLDSNAIVRRCLHCGAEKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVS  272

Query  509  SLHSNSHKKVVEMR  468
            + HSNSH+KV+E+R
Sbjct  273  AKHSNSHRKVLELR  286



>ref|XP_010557328.1| PREDICTED: GATA transcription factor 11-like [Tarenaya hassleriana]
 ref|XP_010557329.1| PREDICTED: GATA transcription factor 11-like [Tarenaya hassleriana]
 ref|XP_010557330.1| PREDICTED: GATA transcription factor 11-like [Tarenaya hassleriana]
 ref|XP_010557331.1| PREDICTED: GATA transcription factor 11-like [Tarenaya hassleriana]
 ref|XP_010557332.1| PREDICTED: GATA transcription factor 11-like [Tarenaya hassleriana]
 ref|XP_010557333.1| PREDICTED: GATA transcription factor 11-like [Tarenaya hassleriana]
Length=296

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  671  GAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNS  492
            G +RKC HCE TKTPQWR GP GPKTLCNACGVR++SGRL PEYRPAASPTF+PS+HSNS
Sbjct  210  GTMRKCTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRLVPEYRPAASPTFIPSVHSNS  269

Query  491  HKKVVEMR  468
            H+K+VE+R
Sbjct  270  HRKIVEIR  277



>ref|XP_010470099.1| PREDICTED: putative GATA transcription factor 13 [Camelina sativa]
Length=233

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  659  KCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKKV  480
            KC HCE T+TPQWR GP GPKTLCNACGVR++SGRLFPEYRPA+SPTF+P++HSN H+K+
Sbjct  161  KCTHCETTRTPQWREGPRGPKTLCNACGVRFRSGRLFPEYRPASSPTFIPTVHSNMHRKI  220

Query  479  VEMRTKAVPSLE  444
            VEMR K    L+
Sbjct  221  VEMRRKGEGQLD  232



>ref|XP_006465677.1| PREDICTED: GATA transcription factor 12-like [Citrus sinensis]
Length=334

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -3

Query  686  NQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPS  507
            N + G +VRKC+HC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTFV +
Sbjct  219  NTESGDSVRKCLHCASEKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVSA  278

Query  506  LHSNSHKKVVEMR  468
             HSNSH+KV+E+R
Sbjct  279  KHSNSHRKVMELR  291



>ref|XP_010470100.1| PREDICTED: putative GATA transcription factor 13 [Camelina sativa]
Length=286

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 66/84 (79%), Gaps = 7/84 (8%)
 Frame = -3

Query  713  PALXNPGAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRP  534
            P L NP        G VRKC HCE T+TPQWR GP G KTLCNACGVR++SGRL PEYRP
Sbjct  195  PELFNPD-------GTVRKCTHCETTRTPQWREGPCGRKTLCNACGVRFRSGRLVPEYRP  247

Query  533  AASPTFVPSLHSNSHKKVVEMRTK  462
            A+SPTFVP++HSNSH+K++EMR K
Sbjct  248  ASSPTFVPTVHSNSHRKIIEMRRK  271



>ref|XP_010510636.1| PREDICTED: putative GATA transcription factor 13 [Camelina sativa]
Length=286

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 69/85 (81%), Gaps = 2/85 (2%)
 Frame = -3

Query  713  PALXNPGAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRP  534
            P++ +P   N D  G VRKC HCE T+TPQWR GP G  TLCNACGVR++SGRL PEYRP
Sbjct  197  PSVSSPELFNSD--GTVRKCTHCETTRTPQWREGPCGRNTLCNACGVRFRSGRLVPEYRP  254

Query  533  AASPTFVPSLHSNSHKKVVEMRTKA  459
            A+SPTF+P++HSNSH+K++EM+T+ 
Sbjct  255  ASSPTFIPTVHSNSHRKIIEMKTRT  279



>ref|XP_010510638.1| PREDICTED: putative GATA transcription factor 13 isoform X2 [Camelina 
sativa]
Length=248

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            Q    RKC HCE TKTPQWR GP GP+TLCNACGVR++SGRLFPEYRPA+SPTF+P++HS
Sbjct  170  QKSPARKCTHCETTKTPQWREGPRGPRTLCNACGVRFRSGRLFPEYRPASSPTFIPTVHS  229

Query  497  NSHKKVVEMRTKAVPSLE  444
            N H+ +VEMR K    L+
Sbjct  230  NMHRMIVEMRRKDEGQLD  247



>ref|XP_006294768.1| hypothetical protein CARUB_v10023820mg [Capsella rubella]
 gb|EOA27666.1| hypothetical protein CARUB_v10023820mg [Capsella rubella]
Length=277

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = -3

Query  713  PALXNPGAPNQ-DQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYR  537
            PAL    +P   +  G VRKC HCE T+TPQWR GP G KTLCNACGVR++SGRL PEYR
Sbjct  189  PALSISYSPELINSDGTVRKCTHCETTRTPQWREGPHGRKTLCNACGVRFRSGRLVPEYR  248

Query  536  PAASPTFVPSLHSNSHKKVVEMRTK  462
            PA+SPTF+P++HSNSH+K++EMR K
Sbjct  249  PASSPTFIPAVHSNSHRKIIEMRRK  273



>ref|XP_010414541.1| PREDICTED: putative GATA transcription factor 13 [Camelina sativa]
Length=286

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 69/85 (81%), Gaps = 2/85 (2%)
 Frame = -3

Query  713  PALXNPGAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRP  534
            P++ +P   N D  G VRKC HCE T+TPQWR GP G  TLCNACGVR++SGRL PEYRP
Sbjct  197  PSVSSPELFNSD--GTVRKCTHCETTRTPQWREGPCGRNTLCNACGVRFRSGRLVPEYRP  254

Query  533  AASPTFVPSLHSNSHKKVVEMRTKA  459
            A+SPTF+P++HSNSH+K++EM+T+ 
Sbjct  255  ASSPTFIPTVHSNSHRKIIEMKTRT  279



>ref|XP_010414546.1| PREDICTED: putative GATA transcription factor 13 isoform X3 [Camelina 
sativa]
 ref|XP_010414547.1| PREDICTED: putative GATA transcription factor 13 isoform X4 [Camelina 
sativa]
Length=287

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 66/84 (79%), Gaps = 7/84 (8%)
 Frame = -3

Query  713  PALXNPGAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRP  534
            P L NP        G VRKC HCE T+TPQWR GP G KTLCNACGVR++SGRL PEYRP
Sbjct  196  PELFNPD-------GTVRKCTHCETTRTPQWREGPCGRKTLCNACGVRFRSGRLVPEYRP  248

Query  533  AASPTFVPSLHSNSHKKVVEMRTK  462
            A+SPTFVP++HSNSH+K++EMR K
Sbjct  249  ASSPTFVPTVHSNSHRKIIEMRRK  272



>ref|XP_011081778.1| PREDICTED: GATA transcription factor 12-like [Sesamum indicum]
Length=359

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -3

Query  689  PNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVP  510
            P+   GG  RKC+HC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTFV 
Sbjct  234  PDSSTGGEGRKCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVL  293

Query  509  SLHSNSHKKVVEMR  468
            + HSNSH+KV+E+R
Sbjct  294  TKHSNSHRKVLELR  307



>ref|XP_006649146.1| PREDICTED: GATA transcription factor 8-like [Oryza brachyantha]
Length=292

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -3

Query  641  ITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKKVVEMRTK  462
            I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTFVPS+HSNSHKKVVEMR K
Sbjct  214  IEKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSIHSNSHKKVVEMRQK  273

Query  461  AVPSLEQS  438
            A  S + S
Sbjct  274  ATRSADAS  281



>ref|XP_010414544.1| PREDICTED: putative GATA transcription factor 13 isoform X1 [Camelina 
sativa]
 ref|XP_010414545.1| PREDICTED: putative GATA transcription factor 13 isoform X2 [Camelina 
sativa]
Length=304

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 66/84 (79%), Gaps = 7/84 (8%)
 Frame = -3

Query  713  PALXNPGAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRP  534
            P L NP        G VRKC HCE T+TPQWR GP G KTLCNACGVR++SGRL PEYRP
Sbjct  213  PELFNPD-------GTVRKCTHCETTRTPQWREGPCGRKTLCNACGVRFRSGRLVPEYRP  265

Query  533  AASPTFVPSLHSNSHKKVVEMRTK  462
            A+SPTFVP++HSNSH+K++EMR K
Sbjct  266  ASSPTFVPTVHSNSHRKIIEMRRK  289



>ref|XP_010510637.1| PREDICTED: putative GATA transcription factor 13 isoform X1 [Camelina 
sativa]
Length=269

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            Q    RKC HCE TKTPQWR GP GP+TLCNACGVR++SGRLFPEYRPA+SPTF+P++HS
Sbjct  191  QKSPARKCTHCETTKTPQWREGPRGPRTLCNACGVRFRSGRLFPEYRPASSPTFIPTVHS  250

Query  497  NSHKKVVEMRTKAVPSLE  444
            N H+ +VEMR K    L+
Sbjct  251  NMHRMIVEMRRKDEGQLD  268



>ref|XP_008462442.1| PREDICTED: GATA transcription factor 9-like [Cucumis melo]
Length=338

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 67/84 (80%), Gaps = 2/84 (2%)
 Frame = -3

Query  692  APNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFV  513
            APN D  G  RKC+HC+  KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTF+
Sbjct  218  APNGDSSG--RKCLHCQAEKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFI  275

Query  512  PSLHSNSHKKVVEMRTKAVPSLEQ  441
             + HSNSH+KV+E+R +    + Q
Sbjct  276  SAKHSNSHRKVLELRRQKELQIAQ  299



>ref|XP_010940106.1| PREDICTED: GATA transcription factor 2-like [Elaeis guineensis]
Length=235

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  683  QDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSL  504
            ++Q   +R+C HC   KTPQWRAGP+GPKTLCNACGVR+KSGRL PEYRPA SPTFV   
Sbjct  154  KEQQQQIRRCTHCLSHKTPQWRAGPLGPKTLCNACGVRFKSGRLLPEYRPAKSPTFVSYK  213

Query  503  HSNSHKKVVEMRTKAVPS  450
            HSNSHKKV+EMR  A+PS
Sbjct  214  HSNSHKKVMEMRMMAIPS  231



>ref|XP_002880933.1| hypothetical protein ARALYDRAFT_901675 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57192.1| hypothetical protein ARALYDRAFT_901675 [Arabidopsis lyrata subsp. 
lyrata]
Length=320

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = -3

Query  680  DQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLH  501
            + GG V+KC HCE T TPQWR GP GPKTLCNACGVR++SGRL PEYRPA+SPTF+P++H
Sbjct  206  NSGGRVQKCTHCETTNTPQWREGPSGPKTLCNACGVRFRSGRLVPEYRPASSPTFIPTVH  265

Query  500  SNSHKKVVEMRTKAVPSLEQSPVSSVA  420
            SN H+K+++MR+K     +   + +V 
Sbjct  266  SNMHRKIIQMRSKDEGQFDTRKIRAVT  292



>ref|XP_009802570.1| PREDICTED: GATA transcription factor 5-like [Nicotiana sylvestris]
Length=326

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            + G+ R+C HC++ KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPA SPTF   +HS
Sbjct  237  ETGSGRRCTHCQVQKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPACSPTFSQEVHS  296

Query  497  NSHKKVVEMRTK  462
            NSH+KV+EMR K
Sbjct  297  NSHRKVLEMRRK  308



>dbj|BAC98494.1| AG-motif binding protein-4 [Nicotiana tabacum]
Length=326

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            + G+ R+C HC++ KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPA SPTF   +HS
Sbjct  237  ETGSGRRCTHCQVQKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPACSPTFSQEVHS  296

Query  497  NSHKKVVEMRTK  462
            NSH+KV+EMR K
Sbjct  297  NSHRKVLEMRRK  308



>gb|EPS67172.1| hypothetical protein M569_07604, partial [Genlisea aurea]
Length=205

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 66/80 (83%), Gaps = 2/80 (3%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
            A RKC+HC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTFV S HSNSH
Sbjct  96   AGRKCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSH  155

Query  488  KKVVEMRTKA--VPSLEQSP  435
            +KV+E+R +   V + +QSP
Sbjct  156  RKVLELRRQKELVRAQQQSP  175



>ref|XP_009631302.1| PREDICTED: GATA transcription factor 5-like [Nicotiana tomentosiformis]
Length=338

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            + G+ R+C HC++ KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPA SPTF   +HS
Sbjct  237  ETGSGRRCTHCQVQKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPACSPTFSQEVHS  296

Query  497  NSHKKVVEMRTK  462
            NSH+KV+EMR K
Sbjct  297  NSHRKVLEMRRK  308



>ref|XP_003619010.1| GATA transcription factor [Medicago truncatula]
Length=217

 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  662  RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKK  483
            R+C HC   +TPQWRAGP+GPKTLCNACGVRYKSGRL PEYRPA SPTFV  LHSNSHKK
Sbjct  148  RRCTHCLSQRTPQWRAGPLGPKTLCNACGVRYKSGRLLPEYRPAKSPTFVSYLHSNSHKK  207

Query  482  VVEMRTKAV  456
            V+EMR +++
Sbjct  208  VLEMRMQSI  216



>dbj|BAJ92617.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07962.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = -3

Query  662  RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKK  483
            R+C+HCE  KTPQWR GP+GPKTLCNACGVRYKSGRL PEYRPAASPTFVPS HSNSH+K
Sbjct  248  RRCLHCETDKTPQWRTGPLGPKTLCNACGVRYKSGRLVPEYRPAASPTFVPSKHSNSHRK  307

Query  482  VVEMRTK  462
            VVE+R +
Sbjct  308  VVELRRQ  314



>ref|XP_006426898.1| hypothetical protein CICLE_v10027138mg, partial [Citrus clementina]
 gb|ESR40138.1| hypothetical protein CICLE_v10027138mg, partial [Citrus clementina]
Length=379

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  680  DQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLH  501
            + G +VRKC+HC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTFV + H
Sbjct  295  ESGDSVRKCLHCASEKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVSAKH  354

Query  500  SNSHKKVVEMR  468
            SNSH+KV+E+R
Sbjct  355  SNSHRKVMELR  365



>ref|XP_009110913.1| PREDICTED: GATA transcription factor 11-like [Brassica rapa]
Length=283

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -3

Query  662  RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKK  483
            RKC HCE T+TPQWR GP GPKTLCNACGVR++SGRL PEYRPA+SPTFVPS+HSNSH+K
Sbjct  200  RKCTHCETTETPQWREGPSGPKTLCNACGVRFRSGRLVPEYRPASSPTFVPSVHSNSHRK  259

Query  482  VVEMRTKAVPSLEQSPVSSV  423
            ++EMR K       S +  V
Sbjct  260  IIEMRRKEGGQFHTSMIHGV  279



>ref|NP_001159272.1| uncharacterized protein LOC100304362 [Zea mays]
 gb|ACN25647.1| unknown [Zea mays]
Length=260

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  662  RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKK  483
            R+C+HC+  KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTFV S HSNSH+K
Sbjct  129  RRCVHCDTDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVMSKHSNSHRK  188

Query  482  VVEMRTKAVPSLEQSP  435
            V+E+R +    ++Q P
Sbjct  189  VLELRRQKEVVVQQPP  204



>gb|KEH30032.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=402

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -3

Query  662  RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKK  483
            RKC HCE+T+TPQWR GP GPKTLCNACGVRY+SGRLFPEYRPAASPTF  S+HSNSHKK
Sbjct  314  RKCTHCEVTETPQWREGPKGPKTLCNACGVRYRSGRLFPEYRPAASPTFEASVHSNSHKK  373

Query  482  VVEMRTKA  459
            V+E+R K 
Sbjct  374  VLEIRKKV  381



>emb|CDY58825.1| BnaAnng15440D [Brassica napus]
Length=284

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -3

Query  662  RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKK  483
            RKC HCE T+TPQWR GP GPKTLCNACGVR++SGRL PEYRPA+SPTFVPS+HSNSH+K
Sbjct  201  RKCTHCETTETPQWREGPSGPKTLCNACGVRFRSGRLVPEYRPASSPTFVPSVHSNSHRK  260

Query  482  VVEMRTKAVPSLEQSPVSSV  423
            ++EMR K       S +  V
Sbjct  261  IIEMRRKEGGQFHTSMIHGV  280



>ref|XP_003597258.1| GATA transcription factor [Medicago truncatula]
 gb|AES67509.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=312

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = -3

Query  662  RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKK  483
            RKC HCE+T+TPQWR GP GPKTLCNACGVRY+SGRL+PEYRPA SPTFV S+HSNSHKK
Sbjct  216  RKCTHCEVTETPQWREGPNGPKTLCNACGVRYRSGRLYPEYRPANSPTFVASVHSNSHKK  275

Query  482  VVEMR  468
            V+EMR
Sbjct  276  VLEMR  280



>ref|XP_004230938.1| PREDICTED: GATA transcription factor 5 [Solanum lycopersicum]
Length=325

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -3

Query  677  QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHS  498
            + G+ R+C HC++ KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPA SPTF   +HS
Sbjct  236  ETGSGRRCTHCQVQKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPACSPTFSLEVHS  295

Query  497  NSHKKVVEMRTK  462
            NSH+KV+EMR K
Sbjct  296  NSHRKVLEMRRK  307



>ref|XP_010651174.1| PREDICTED: GATA transcription factor 8-like [Vitis vinifera]
 ref|XP_010651175.1| PREDICTED: GATA transcription factor 8-like [Vitis vinifera]
 ref|XP_010651176.1| PREDICTED: GATA transcription factor 8-like [Vitis vinifera]
Length=464

 Score =   129 bits (324),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            VRKCMHCE  +TP WR GP GPK+LCNACG+RYKSGRLFPEY PAASPTFV SLHSNSHK
Sbjct  374  VRKCMHCEAAQTPLWRQGPWGPKSLCNACGIRYKSGRLFPEYHPAASPTFVASLHSNSHK  433

Query  485  KVVEMRTKAV  456
            KV+EMR +A 
Sbjct  434  KVLEMRNQAT  443


 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -3

Query  665  VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHK  486
            + +CMHC +T+TPQWR GP GPKTLCNACGV YK G LFPEYRPA+SPTFVPSLH+NS +
Sbjct  173  IGRCMHCNVTRTPQWREGPNGPKTLCNACGVCYKRGSLFPEYRPASSPTFVPSLHTNSRR  232

Query  485  KVVEMRTKA  459
            KV EMR KA
Sbjct  233  KVTEMRHKA  241



>ref|XP_006294728.1| hypothetical protein CARUB_v10023774mg [Capsella rubella]
 gb|EOA27626.1| hypothetical protein CARUB_v10023774mg [Capsella rubella]
Length=288

 Score =   126 bits (317),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 67/84 (80%), Gaps = 2/84 (2%)
 Frame = -3

Query  713  PALXNPGAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRP  534
            P+  +P   N D  G VRKC HCE T+TPQWR GP G  TLCNACGVR++SGRL PEYRP
Sbjct  195  PSSYSPELFNSD--GTVRKCTHCETTRTPQWREGPHGRNTLCNACGVRFRSGRLVPEYRP  252

Query  533  AASPTFVPSLHSNSHKKVVEMRTK  462
            A+SPTF+P++HSNSH+K++EMR K
Sbjct  253  ASSPTFIPAVHSNSHRKIIEMRRK  276



>ref|XP_011033283.1| PREDICTED: GATA transcription factor 2-like [Populus euphratica]
Length=247

 Score =   125 bits (315),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 65/79 (82%), Gaps = 1/79 (1%)
 Frame = -3

Query  701  NPGAPNQD-QGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAAS  525
            N GAP+   + G VR+C HC   KTPQWR GP+GPKTLCNACGVRYKSGRL PEYRPAAS
Sbjct  148  NNGAPHSTAEEGTVRRCTHCASEKTPQWRTGPLGPKTLCNACGVRYKSGRLVPEYRPAAS  207

Query  524  PTFVPSLHSNSHKKVVEMR  468
            PTFV + HSNSH+KV+E+R
Sbjct  208  PTFVLTRHSNSHRKVLELR  226



>emb|CDX80542.1| BnaC07g29020D [Brassica napus]
Length=329

 Score =   127 bits (319),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  680  DQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLH  501
            D G   R+C+HC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTFV + H
Sbjct  211  DSGAEERRCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLAKH  270

Query  500  SNSHKKVVEMR  468
            SNSH+KV+E+R
Sbjct  271  SNSHRKVMELR  281



>emb|CBI16323.3| unnamed protein product [Vitis vinifera]
Length=386

 Score =   128 bits (321),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
             VRKCMHCE  +TP WR GP GPK+LCNACG+RYKSGRLFPEY PAASPTFV SLHSNSH
Sbjct  295  TVRKCMHCEAAQTPLWRQGPWGPKSLCNACGIRYKSGRLFPEYHPAASPTFVASLHSNSH  354

Query  488  KKVVEMRTKAV  456
            KKV+EMR +A 
Sbjct  355  KKVLEMRNQAT  365


 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  668  AVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSH  489
             + +CMHC +T+TPQWR GP GPKTLCNACGV YK G LFPEYRPA+SPTFVPSLH+NS 
Sbjct  172  TIGRCMHCNVTRTPQWREGPNGPKTLCNACGVCYKRGSLFPEYRPASSPTFVPSLHTNSR  231

Query  488  KKVVEMRTKAV  456
            +KV EMR KAV
Sbjct  232  RKVTEMRHKAV  242



>gb|EYU42584.1| hypothetical protein MIMGU_mgv1a010838mg [Erythranthe guttata]
Length=300

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 64/77 (83%), Gaps = 1/77 (1%)
 Frame = -3

Query  689  PNQDQG-GAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFV  513
            P  D G G+ R+C HC++ KTPQWR GP+GPKTLCNACGVR+KSGRLFPEYRPA SPTF 
Sbjct  217  PEADGGSGSGRRCTHCQVQKTPQWRTGPLGPKTLCNACGVRFKSGRLFPEYRPACSPTFS  276

Query  512  PSLHSNSHKKVVEMRTK  462
              +HSNSH+KVVEMR K
Sbjct  277  QEVHSNSHRKVVEMRLK  293



>gb|KDO51760.1| hypothetical protein CISIN_1g019919mg [Citrus sinensis]
Length=334

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  680  DQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLH  501
            + G +VRKC+HC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTFV + H
Sbjct  221  ESGDSVRKCLHCASEKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVSAKH  280

Query  500  SNSHKKVVEMR  468
            SNSH+KV+E+R
Sbjct  281  SNSHRKVMELR  291



>ref|XP_011092007.1| PREDICTED: GATA transcription factor 12 [Sesamum indicum]
Length=352

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -3

Query  674  GGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSN  495
            GG  RKC+HC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTFV + HSN
Sbjct  232  GGEGRKCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLTKHSN  291

Query  494  SHKKVVEMR  468
            SH+KV+E+R
Sbjct  292  SHRKVLELR  300



>gb|AES75228.2| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=261

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -3

Query  701  NPGAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP  522
            N    +++     R+C HC   +TPQWRAGP+GPKTLCNACGVRYKSGRL PEYRPA SP
Sbjct  179  NVNDDDEEHIPNARRCTHCLSQRTPQWRAGPLGPKTLCNACGVRYKSGRLLPEYRPAKSP  238

Query  521  TFVPSLHSNSHKKVVEMRTKAV  456
            TFV  LHSNSHKKV+EMR +++
Sbjct  239  TFVSYLHSNSHKKVLEMRMQSI  260



>ref|XP_002301258.2| hypothetical protein POPTR_0002s14380g [Populus trichocarpa]
 gb|EEE80531.2| hypothetical protein POPTR_0002s14380g [Populus trichocarpa]
Length=246

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 67/81 (83%), Gaps = 4/81 (5%)
 Frame = -3

Query  701  NPGAPN---QDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPA  531
            N GAP+   + +GGA R+C HC   KTPQWR GP+GPKTLCNACGVRYKSGRL PEYRPA
Sbjct  146  NNGAPHSSAETEGGA-RRCTHCASEKTPQWRTGPLGPKTLCNACGVRYKSGRLVPEYRPA  204

Query  530  ASPTFVPSLHSNSHKKVVEMR  468
            ASPTFV + HSNSH+KV+E+R
Sbjct  205  ASPTFVLTQHSNSHRKVLELR  225



>ref|XP_003540668.1| PREDICTED: GATA transcription factor 7-like [Glycine max]
 gb|KHN25424.1| GATA transcription factor 7 [Glycine soja]
Length=289

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 63/73 (86%), Gaps = 2/73 (3%)
 Frame = -3

Query  674  GGA--VRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLH  501
            GGA  +R+C HC++ KTPQWR GP+GPKTLCNACGVR+KSGRLFPEYRPA SPTF   +H
Sbjct  202  GGAQSLRRCSHCQVQKTPQWRTGPLGPKTLCNACGVRFKSGRLFPEYRPACSPTFSDDIH  261

Query  500  SNSHKKVVEMRTK  462
            SNSH+KV+EMR K
Sbjct  262  SNSHRKVLEMRRK  274



>ref|XP_010679831.1| PREDICTED: GATA transcription factor 7 [Beta vulgaris subsp. 
vulgaris]
Length=286

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 70/103 (68%), Gaps = 6/103 (6%)
 Frame = -3

Query  722  FSMPALXNPGAPNQDQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPE  543
            FS P L N        GG VR+C HC + KTPQWRAGPMG K+LCNACGVRYKSGRL PE
Sbjct  185  FSGPGLIN------GIGGPVRRCSHCGVQKTPQWRAGPMGAKSLCNACGVRYKSGRLLPE  238

Query  542  YRPAASPTFVPSLHSNSHKKVVEMRTKAVPSLEQSPVSSVAPP  414
            YRPA SPTF   LHSNSH+KV+EMR K   S  Q    S + P
Sbjct  239  YRPACSPTFSSELHSNSHRKVLEMRKKKETSTGQPESGSFSHP  281



>ref|XP_009111680.1| PREDICTED: GATA transcription factor 12-like [Brassica rapa]
Length=317

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -3

Query  680  DQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLH  501
            D G   R+C+HC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRP ASPTFV + H
Sbjct  214  DSGADERRCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPVASPTFVLTKH  273

Query  500  SNSHKKVVEMR  468
            SNSH+KV+E+R
Sbjct  274  SNSHRKVMELR  284



>ref|XP_011091388.1| PREDICTED: GATA transcription factor 1 [Sesamum indicum]
Length=284

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -3

Query  662  RKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLHSNSHKK  483
            R+C+HC+  KTPQWRAGPMGPKTLCNACGVRYKSGRL PEYRPA+SPTF   LHSNSH+K
Sbjct  198  RRCLHCQADKTPQWRAGPMGPKTLCNACGVRYKSGRLLPEYRPASSPTFSSILHSNSHRK  257

Query  482  VVEMRTK  462
            VVEMR +
Sbjct  258  VVEMRKQ  264



>ref|XP_009151105.1| PREDICTED: GATA transcription factor 12 [Brassica rapa]
 emb|CDX88201.1| BnaA06g27920D [Brassica napus]
Length=329

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  680  DQGGAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSLH  501
            D G   R+C+HC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAASPTFV + H
Sbjct  211  DSGAEERRCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLAKH  270

Query  500  SNSHKKVVEMR  468
            SNSH+KV+E+R
Sbjct  271  SNSHRKVMELR  281



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1454382771890