BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF010L11

Length=738
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP12421.1|  unnamed protein product                                238   5e-75   Coffea canephora [robusta coffee]
emb|CBI15019.3|  unnamed protein product                                249   1e-72   Vitis vinifera
ref|XP_002279079.1|  PREDICTED: pantothenate kinase 2                   242   4e-70   Vitis vinifera
gb|EYU42581.1|  hypothetical protein MIMGU_mgv1a001050mg                241   5e-70   Erythranthe guttata [common monkey flower]
gb|KDO69623.1|  hypothetical protein CISIN_1g042742mg                   236   2e-68   Citrus sinensis [apfelsine]
ref|XP_006477543.1|  PREDICTED: pantothenate kinase 2-like              236   3e-68   
gb|KHG02710.1|  hypothetical protein F383_25888                         235   4e-68   Gossypium arboreum [tree cotton]
ref|XP_006439830.1|  hypothetical protein CICLE_v10018751mg             236   4e-68   Citrus clementina [clementine]
gb|KJB53157.1|  hypothetical protein B456_008G295400                    234   1e-67   Gossypium raimondii
ref|XP_004298946.1|  PREDICTED: pantothenate kinase 2                   235   1e-67   Fragaria vesca subsp. vesca
gb|KHG28314.1|  hypothetical protein F383_13494                         234   2e-67   Gossypium arboreum [tree cotton]
gb|KJB39190.1|  hypothetical protein B456_007G001600                    234   2e-67   Gossypium raimondii
gb|KJB53156.1|  hypothetical protein B456_008G295400                    234   2e-67   Gossypium raimondii
gb|KCW49278.1|  hypothetical protein EUGRSUZ_K02840                     234   3e-67   Eucalyptus grandis [rose gum]
ref|XP_010037560.1|  PREDICTED: pantothenate kinase 2                   234   3e-67   Eucalyptus grandis [rose gum]
gb|KCW49280.1|  hypothetical protein EUGRSUZ_K02840                     234   3e-67   Eucalyptus grandis [rose gum]
ref|XP_010534230.1|  PREDICTED: pantothenate kinase 2                   233   7e-67   Tarenaya hassleriana [spider flower]
ref|XP_008356598.1|  PREDICTED: pantothenate kinase 2-like              232   1e-66   
ref|XP_009363012.1|  PREDICTED: pantothenate kinase 2                   230   7e-66   Pyrus x bretschneideri [bai li]
ref|XP_009600890.1|  PREDICTED: pantothenate kinase 2                   230   7e-66   
ref|XP_009793998.1|  PREDICTED: pantothenate kinase 2 isoform X2        230   7e-66   Nicotiana sylvestris
ref|XP_009793996.1|  PREDICTED: pantothenate kinase 2 isoform X1        230   9e-66   Nicotiana sylvestris
ref|XP_004236210.1|  PREDICTED: pantothenate kinase 2                   229   1e-65   
ref|XP_006344398.1|  PREDICTED: pantothenate kinase 2-like isofor...    229   1e-65   Solanum tuberosum [potatoes]
ref|XP_008239770.1|  PREDICTED: pantothenate kinase 2                   228   3e-65   Prunus mume [ume]
ref|XP_007210380.1|  hypothetical protein PRUPE_ppa001094mg             228   3e-65   Prunus persica
ref|XP_011001529.1|  PREDICTED: pantothenate kinase 2-like              227   7e-65   Populus euphratica
ref|XP_008393029.1|  PREDICTED: pantothenate kinase 2                   227   7e-65   
ref|XP_007036234.1|  Pantothenate kinase 2 isoform 1                    227   9e-65   
ref|XP_006374524.1|  hypothetical protein POPTR_0015s08830g             224   2e-64   
gb|KHN19303.1|  Pantothenate kinase 2                                   218   4e-64   Glycine soja [wild soybean]
ref|XP_008795922.1|  PREDICTED: pantothenate kinase 2-like isofor...    224   5e-64   
ref|XP_008795923.1|  PREDICTED: pantothenate kinase 2-like isofor...    224   6e-64   Phoenix dactylifera
emb|CDX68824.1|  BnaC01g06290D                                          224   8e-64   
ref|XP_002318651.1|  hypothetical protein POPTR_0012s08310g             224   1e-63   
ref|XP_011028555.1|  PREDICTED: pantothenate kinase 2-like              224   1e-63   Populus euphratica
ref|XP_010101220.1|  Pantothenate kinase 2                              221   1e-62   Morus notabilis
ref|XP_004152477.1|  PREDICTED: pantothenate kinase 2-like              220   2e-62   Cucumis sativus [cucumbers]
ref|XP_008438456.1|  PREDICTED: pantothenate kinase 2                   220   2e-62   Cucumis melo [Oriental melon]
gb|KDP31092.1|  hypothetical protein JCGZ_11468                         220   3e-62   Jatropha curcas
ref|XP_011071870.1|  PREDICTED: pantothenate kinase 2                   219   5e-62   Sesamum indicum [beniseed]
ref|XP_007155432.1|  hypothetical protein PHAVU_003G200700g             219   6e-62   Phaseolus vulgaris [French bean]
ref|XP_002511391.1|  Pantothenate kinase, putative                      218   1e-61   
gb|AAM20690.1|  putative protein                                        217   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003528148.1|  PREDICTED: pantothenate kinase 2-like              217   3e-61   Glycine max [soybeans]
ref|XP_010437940.1|  PREDICTED: pantothenate kinase 2-like              217   3e-61   Camelina sativa [gold-of-pleasure]
ref|XP_006282554.1|  hypothetical protein CARUB_v10004099mg             217   3e-61   Capsella rubella
ref|XP_010243065.1|  PREDICTED: pantothenate kinase 2 isoform X2        216   3e-61   Nelumbo nucifera [Indian lotus]
ref|XP_006600640.1|  PREDICTED: pantothenate kinase 2-like isofor...    216   5e-61   Glycine max [soybeans]
ref|XP_006600639.1|  PREDICTED: pantothenate kinase 2-like isofor...    216   6e-61   Glycine max [soybeans]
ref|XP_010243061.1|  PREDICTED: pantothenate kinase 2 isoform X1        216   6e-61   Nelumbo nucifera [Indian lotus]
gb|EMT07573.1|  Pantothenate kinase 2                                   215   1e-60   
gb|KFK29830.1|  hypothetical protein AALP_AA7G184400                    215   2e-60   Arabis alpina [alpine rockcress]
ref|XP_009403915.1|  PREDICTED: pantothenate kinase 2                   215   2e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009126332.1|  PREDICTED: pantothenate kinase 2                   214   2e-60   Brassica rapa
ref|XP_009108890.1|  PREDICTED: pantothenate kinase 2                   214   2e-60   Brassica rapa
ref|XP_010678776.1|  PREDICTED: pantothenate kinase 2                   214   2e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006412505.1|  hypothetical protein EUTSA_v10024357mg             213   5e-60   Eutrema salsugineum [saltwater cress]
ref|XP_010447428.1|  PREDICTED: pantothenate kinase 2 isoform X2        212   7e-60   Camelina sativa [gold-of-pleasure]
ref|XP_003576771.1|  PREDICTED: pantothenate kinase 2                   213   1e-59   Brachypodium distachyon [annual false brome]
ref|XP_006840740.1|  hypothetical protein AMTR_s00096p00130150          212   1e-59   
ref|XP_010432761.1|  PREDICTED: pantothenate kinase 2-like              212   1e-59   Camelina sativa [gold-of-pleasure]
ref|NP_194945.3|  pantothenate kinase 2                                 212   2e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010447427.1|  PREDICTED: pantothenate kinase 2 isoform X1        212   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_002867254.1|  ATPANK2                                            212   2e-59   
dbj|BAD33319.1|  putative pantothenate kinase 4                         210   2e-59   Oryza sativa Japonica Group [Japonica rice]
gb|ACN39905.1|  unknown                                                 211   2e-59   Picea sitchensis
ref|NP_001063766.1|  Os09g0533100                                       210   3e-59   
ref|XP_007138072.1|  hypothetical protein PHAVU_009G178200g             210   6e-59   Phaseolus vulgaris [French bean]
gb|EEE70109.1|  hypothetical protein OsJ_30119                          210   6e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003601259.1|  Pantothenate kinase                                210   7e-59   Medicago truncatula
gb|EEC84941.1|  hypothetical protein OsI_32156                          210   7e-59   Oryza sativa Indica Group [Indian rice]
ref|XP_004501924.1|  PREDICTED: pantothenate kinase 2-like isofor...    210   8e-59   Cicer arietinum [garbanzo]
sp|Q0J035.2|PANK2_ORYSJ  RecName: Full=Pantothenate kinase 2; Alt...    210   8e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004957459.1|  PREDICTED: pantothenate kinase 2-like              209   1e-58   Setaria italica
emb|CDX75226.1|  BnaA01g04760D                                          210   1e-58   
gb|EMS60500.1|  Pantothenate kinase 2                                   209   2e-58   Triticum urartu
ref|XP_008652990.1|  PREDICTED: pantothenate kinase 2                   209   2e-58   
ref|XP_010940070.1|  PREDICTED: pantothenate kinase 2-like isofor...    209   2e-58   Elaeis guineensis
ref|XP_010940068.1|  PREDICTED: pantothenate kinase 2-like isofor...    209   2e-58   Elaeis guineensis
ref|XP_002460569.1|  hypothetical protein SORBIDRAFT_02g030920          209   3e-58   Sorghum bicolor [broomcorn]
ref|XP_006660887.1|  PREDICTED: pantothenate kinase 2-like              206   1e-57   
ref|XP_008782481.1|  PREDICTED: pantothenate kinase 2-like              206   3e-57   
ref|XP_003542534.2|  PREDICTED: pantothenate kinase 2-like isofor...    205   5e-57   
ref|XP_006594169.1|  PREDICTED: pantothenate kinase 2-like isofor...    205   6e-57   
ref|XP_010936708.1|  PREDICTED: pantothenate kinase 2-like              204   8e-57   Elaeis guineensis
gb|KHN48232.1|  Pantothenate kinase 2                                   203   2e-56   Glycine soja [wild soybean]
ref|XP_007036235.1|  Pantothenate kinase 2 isoform 2                    201   1e-55   
ref|XP_001757682.1|  predicted protein                                  196   5e-54   
ref|XP_001768632.1|  predicted protein                                  193   2e-53   
ref|XP_002991207.1|  hypothetical protein SELMODRAFT_161467             177   2e-47   
ref|XP_002991270.1|  hypothetical protein SELMODRAFT_269774             176   5e-47   
ref|XP_002320020.2|  hypothetical protein POPTR_0014s01415g             154   4e-43   
pir||T05410  hypothetical protein F10M6.180 - Arabidopsis thaliana      162   1e-41
ref|XP_003056202.1|  pantothenate kinase                                142   1e-34   Micromonas pusilla CCMP1545
ref|XP_005849803.1|  hypothetical protein CHLNCDRAFT_34679              139   1e-33   Chlorella variabilis
ref|XP_002507494.1|  pantothenate kinase                                129   5e-30   Micromonas commoda
pir||T04627  hypothetical protein F10N7.10 - Arabidopsis thaliana...    120   4e-29
ref|XP_007512793.1|  predicted protein                                  125   8e-29   Bathycoccus prasinos
ref|XP_001692949.1|  predicted protein                                  122   4e-28   Chlamydomonas reinhardtii
ref|XP_005649526.1|  fumble-domain-containing protein                   118   2e-26   Coccomyxa subellipsoidea C-169
ref|XP_002951581.1|  hypothetical protein VOLCADRAFT_61514              117   3e-26   Volvox carteri f. nagariensis
gb|KDD72143.1|  hypothetical protein H632_c3796p0                       107   1e-25   Helicosporidium sp. ATCC 50920
ref|XP_011395801.1|  Pantothenate kinase 2                              116   1e-25   Auxenochlorella protothecoides
ref|XP_003078604.1|  eukaryotic pantothenate kinase family protei...    116   1e-25   Ostreococcus tauri
ref|XP_001417152.1|  predicted protein                                  111   7e-24   Ostreococcus lucimarinus CCE9901
ref|XP_001749703.1|  hypothetical protein                               111   7e-24   Monosiga brevicollis MX1
gb|EYU38044.1|  hypothetical protein MIMGU_mgv1a0084892mg               102   2e-23   Erythranthe guttata [common monkey flower]
ref|XP_001619295.1|  hypothetical protein NEMVEDRAFT_v1g151759          105   2e-23   Nematostella vectensis
gb|EFN73794.1|  Pantothenate kinase 4                                   107   9e-23   Camponotus floridanus
ref|XP_011264108.1|  PREDICTED: LOW QUALITY PROTEIN: pantothenate...    107   1e-22   
ref|XP_002078206.1|  GD23321                                            104   2e-22   
ref|XP_002037921.1|  GM18528                                            104   2e-22   Drosophila sechellia
ref|XP_011187412.1|  PREDICTED: pantothenate kinase 4                   103   3e-22   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_008472729.1|  PREDICTED: pantothenate kinase 4                   105   5e-22   
ref|XP_011200749.1|  PREDICTED: pantothenate kinase 4                   102   5e-22   Bactrocera dorsalis [papaya fruit fly]
ref|NP_608907.1|  CG5828, isoform A                                     102   7e-22   Drosophila melanogaster
ref|XP_001968771.1|  GG25052                                            102   7e-22   
gb|AAM52026.1|  RE73673p                                                102   7e-22   Drosophila melanogaster
ref|XP_005184448.1|  PREDICTED: pantothenate kinase 4                   102   8e-22   Musca domestica
ref|XP_011052880.1|  PREDICTED: pantothenate kinase 4 isoform X2        104   1e-21   Acromyrmex echinatior
ref|XP_002001690.1|  GI16988                                            101   2e-21   Drosophila mojavensis
ref|XP_001989026.1|  GH11492                                            101   2e-21   Drosophila grimshawi
ref|XP_011052879.1|  PREDICTED: pantothenate kinase 4 isoform X1        103   2e-21   Acromyrmex echinatior
ref|XP_004531491.1|  PREDICTED: pantothenate kinase 4-like              100   2e-21   Ceratitis capitata [medfly]
ref|XP_005645866.1|  hypothetical protein COCSUDRAFT_53962              100   4e-21   Coccomyxa subellipsoidea C-169
ref|XP_008357337.1|  PREDICTED: uncharacterized protein At2g17340...  96.7    5e-21   
ref|XP_008349020.1|  PREDICTED: uncharacterized protein At2g17340...  97.8    5e-21   
gb|ADE76712.1|  unknown                                               99.8    5e-21   Picea sitchensis
ref|XP_010025652.1|  PREDICTED: uncharacterized protein At2g17340...  99.4    7e-21   
ref|XP_010090711.1|  hypothetical protein L484_013733                 99.0    8e-21   
ref|XP_001962564.1|  GF14376                                          99.4    8e-21   
ref|XP_011088725.1|  PREDICTED: uncharacterized protein At2g17340     99.0    1e-20   Sesamum indicum [beniseed]
ref|XP_004290081.1|  PREDICTED: uncharacterized protein At2g17340...  99.0    1e-20   Fragaria vesca subsp. vesca
gb|ACU19479.1|  unknown                                               99.0    1e-20   Glycine max [soybeans]
ref|XP_003556399.1|  PREDICTED: uncharacterized protein At2g17340...  99.0    1e-20   Glycine max [soybeans]
gb|KJE93934.1|  pantothenate kinase 4, variant                          101   1e-20   Capsaspora owczarzaki ATCC 30864
ref|XP_002051981.1|  GJ24127                                          98.6    1e-20   Drosophila virilis
gb|KHN05036.1|  Hypothetical protein glysoja_013943                   98.6    1e-20   Glycine soja [wild soybean]
ref|XP_004347393.1|  pantothenate kinase 4                              101   1e-20   Capsaspora owczarzaki ATCC 30864
ref|XP_009011203.1|  hypothetical protein HELRODRAFT_109215             100   3e-20   Helobdella robusta
ref|XP_002088669.1|  GE11338                                          97.8    3e-20   
ref|XP_006283971.1|  hypothetical protein CARUB_v10005094mg           97.8    3e-20   Capsella rubella
ref|XP_004996233.1|  pantothenate kinase 4                              100   3e-20   Salpingoeca rosetta
ref|XP_010270546.1|  PREDICTED: uncharacterized protein At2g17340     97.8    3e-20   Nelumbo nucifera [Indian lotus]
gb|EPS59987.1|  hypothetical protein M569_14816                       97.8    3e-20   Genlisea aurea
ref|XP_004495429.1|  PREDICTED: uncharacterized protein At2g17340...  97.4    3e-20   
ref|XP_001652140.1|  AAEL006648-PA                                    97.4    3e-20   Aedes aegypti
gb|ENN72915.1|  hypothetical protein YQE_10483                        97.4    3e-20   Dendroctonus ponderosae
ref|XP_007143901.1|  hypothetical protein PHAVU_007G111800g           97.8    3e-20   Phaseolus vulgaris [French bean]
ref|XP_007043093.1|  Uncharacterized protein TCM_007589               97.4    4e-20   
ref|XP_002014710.1|  GL18804                                          97.4    4e-20   
ref|XP_001356515.2|  GA19161                                          97.4    4e-20   
gb|AAM63225.1|  unknown                                               97.4    4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006384863.1|  pantothenate kinase-related family protein       97.1    5e-20   Populus trichocarpa [western balsam poplar]
ref|XP_008382502.1|  PREDICTED: uncharacterized protein At2g17340...  97.1    5e-20   Malus domestica [apple tree]
gb|AFK47314.1|  unknown                                               97.1    5e-20   Lotus japonicus
ref|XP_009341504.1|  PREDICTED: uncharacterized protein At2g17340...  97.1    5e-20   Pyrus x bretschneideri [bai li]
gb|KHG04221.1|  hypothetical protein F383_29469                       96.7    5e-20   Gossypium arboreum [tree cotton]
gb|KJB79742.1|  hypothetical protein B456_013G064800                  96.7    5e-20   Gossypium raimondii
ref|NP_567984.1|  uncharacterized protein                             97.1    5e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867075.1|  hypothetical protein ARALYDRAFT_491111           97.1    5e-20   Arabidopsis lyrata subsp. lyrata
gb|KFK30177.1|  hypothetical protein AALP_AA7G227700                  97.1    5e-20   Arabis alpina [alpine rockcress]
ref|XP_010530975.1|  PREDICTED: uncharacterized protein At2g17340     97.1    5e-20   Tarenaya hassleriana [spider flower]
ref|XP_010432289.1|  PREDICTED: uncharacterized protein At2g17340...  97.1    6e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010446932.1|  PREDICTED: uncharacterized protein At2g17340...  97.1    6e-20   Camelina sativa [gold-of-pleasure]
gb|KJB79743.1|  hypothetical protein B456_013G064800                  96.7    6e-20   Gossypium raimondii
gb|KJB79741.1|  hypothetical protein B456_013G064800                  96.7    6e-20   Gossypium raimondii
ref|XP_006412112.1|  hypothetical protein EUTSA_v10025517mg           96.7    7e-20   Eutrema salsugineum [saltwater cress]
ref|XP_002283109.1|  PREDICTED: uncharacterized protein At2g17340     96.7    7e-20   Vitis vinifera
ref|XP_008357317.1|  PREDICTED: uncharacterized protein At2g17340...  96.7    7e-20   Malus domestica [apple tree]
ref|XP_003622334.1|  hypothetical protein MTR_7g034640                94.4    8e-20   
ref|XP_006365309.1|  PREDICTED: uncharacterized protein At2g17340...  96.3    9e-20   Solanum tuberosum [potatoes]
ref|XP_002886110.1|  hypothetical protein ARALYDRAFT_480618           96.3    1e-19   
emb|CDP14484.1|  unnamed protein product                              96.3    1e-19   Coffea canephora [robusta coffee]
ref|XP_002155967.2|  PREDICTED: uncharacterized protein LOC100203531  98.6    1e-19   
ref|XP_009340789.1|  PREDICTED: uncharacterized protein At2g17340...  95.9    1e-19   Pyrus x bretschneideri [bai li]
ref|XP_004514973.1|  PREDICTED: uncharacterized protein At2g17340...  95.9    1e-19   Cicer arietinum [garbanzo]
ref|XP_010690567.1|  PREDICTED: uncharacterized protein At2g17340     95.9    1e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009333785.1|  PREDICTED: uncharacterized protein At2g17340...  95.9    1e-19   Pyrus x bretschneideri [bai li]
ref|XP_006299544.1|  hypothetical protein CARUB_v10015717mg           95.9    1e-19   Capsella rubella
ref|XP_004338527.1|  pantothenate kinase, putative                    95.9    1e-19   Acanthamoeba castellanii str. Neff
ref|XP_002886109.1|  hypothetical protein ARALYDRAFT_900074           95.9    1e-19   Arabidopsis lyrata subsp. lyrata
gb|EAW56099.1|  pantothenate kinase 4, isoform CRA_c                  93.2    1e-19   Homo sapiens [man]
gb|KHN27854.1|  Hypothetical protein glysoja_033002                   95.5    1e-19   Glycine soja [wild soybean]
ref|XP_009102804.1|  PREDICTED: uncharacterized protein At2g17340     95.9    1e-19   Brassica rapa
ref|XP_007201314.1|  hypothetical protein PRUPE_ppa007505mg           95.5    2e-19   Prunus persica
ref|XP_969975.2|  PREDICTED: pantothenate kinase 4                    95.5    2e-19   Tribolium castaneum [rust-red flour beetle]
ref|XP_002514412.1|  pantothenate kinase, putative                    95.5    2e-19   Ricinus communis
ref|XP_006299401.1|  hypothetical protein CARUB_v10015561mg           95.5    2e-19   Capsella rubella
gb|KFK40120.1|  hypothetical protein AALP_AA3G333000                  95.5    2e-19   Arabis alpina [alpine rockcress]
ref|XP_001752572.1|  predicted protein                                95.5    2e-19   
ref|XP_004495428.1|  PREDICTED: uncharacterized protein At2g17340...  96.3    2e-19   Cicer arietinum [garbanzo]
ref|XP_010467504.1|  PREDICTED: uncharacterized protein At2g17340     95.5    2e-19   Camelina sativa [gold-of-pleasure]
gb|AES75860.2|  pantothenate kinase                                   95.1    2e-19   Medicago truncatula
ref|XP_008235825.1|  PREDICTED: uncharacterized protein At2g17340...  95.1    2e-19   Prunus mume [ume]
ref|XP_003690310.1|  PREDICTED: LOW QUALITY PROTEIN: pantothenate...  97.8    2e-19   
gb|KDP47020.1|  hypothetical protein JCGZ_10747                       95.1    2e-19   Jatropha curcas
emb|CDX69133.1|  BnaC01g03200D                                        94.7    3e-19   
ref|XP_006299387.1|  hypothetical protein CARUB_v10015546mg           94.7    3e-19   Capsella rubella
ref|XP_004249007.1|  PREDICTED: uncharacterized protein At2g17340     94.7    3e-19   Solanum lycopersicum
ref|XP_002424875.1|  Pantothenate kinase, putative                    97.4    3e-19   Pediculus humanus corporis [human body lice]
ref|XP_010928426.1|  PREDICTED: uncharacterized protein At2g17340...  94.7    3e-19   
ref|XP_002500562.1|  predicted protein                                94.7    3e-19   Micromonas commoda
ref|XP_010467503.1|  PREDICTED: uncharacterized protein At2g17340...  94.7    3e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010928425.1|  PREDICTED: uncharacterized protein At2g17340...  94.7    3e-19   Elaeis guineensis
ref|XP_009053272.1|  hypothetical protein LOTGIDRAFT_116077           97.1    4e-19   Lottia gigantea
gb|KIH53051.1|  hypothetical protein ANCDUO_16832                     91.3    4e-19   Ancylostoma duodenale
ref|XP_006610071.1|  PREDICTED: pantothenate kinase 4-like isofor...  97.1    4e-19   Apis dorsata [rock honeybee]
ref|XP_011040827.1|  PREDICTED: uncharacterized protein At2g17340...  94.4    4e-19   Populus euphratica
ref|XP_011340652.1|  PREDICTED: pantothenate kinase 4                 97.1    4e-19   
gb|EHJ77585.1|  hypothetical protein KGM_11112                        94.4    4e-19   
ref|XP_006610072.1|  PREDICTED: pantothenate kinase 4-like isofor...  97.1    4e-19   Apis dorsata [rock honeybee]
gb|AAS76704.1|  At2g17320                                             94.0    5e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179324.2|  uncharacterized protein                             94.0    5e-19   Arabidopsis thaliana [mouse-ear cress]
gb|ELT88727.1|  hypothetical protein CAPTEDRAFT_118737                96.7    5e-19   Capitella teleta
ref|XP_009150843.1|  PREDICTED: uncharacterized protein At2g17340...  94.0    5e-19   Brassica rapa
pdb|1XFI|A  Chain A, X-Ray Structure Of Gene Product From Arabido...  94.0    6e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006364340.1|  PREDICTED: uncharacterized protein At2g17340...  94.0    6e-19   Solanum tuberosum [potatoes]
ref|XP_008799277.1|  PREDICTED: uncharacterized protein At2g17340...  93.2    6e-19   
gb|AAM63619.1|  unknown                                               94.0    6e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565412.1|  uncharacterized protein                             94.0    6e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006680154.1|  hypothetical protein BATDEDRAFT_89522            96.3    6e-19   Batrachochytrium dendrobatidis JAM81
gb|KGB34411.1|  Pantothenate kinase 4                                 96.7    6e-19   Schistosoma haematobium
ref|XP_008451197.1|  PREDICTED: uncharacterized protein At2g17340...  94.0    6e-19   Cucumis melo [Oriental melon]
ref|NP_001242288.1|  uncharacterized protein LOC100804454             94.0    7e-19   Glycine max [soybeans]
ref|XP_003622335.1|  hypothetical protein MTR_7g034660                93.6    7e-19   
ref|XP_006561827.1|  PREDICTED: pantothenate kinase 4 isoform X5      96.3    7e-19   
ref|XP_003622333.1|  hypothetical protein MTR_7g034640                93.6    7e-19   
gb|KDR11647.1|  hypothetical protein L798_13976                       95.9    8e-19   Zootermopsis nevadensis
ref|XP_006561823.1|  PREDICTED: pantothenate kinase 4 isoform X1      96.3    8e-19   
gb|ERL90334.1|  hypothetical protein D910_07683                       96.3    8e-19   Dendroctonus ponderosae
ref|XP_008799268.1|  PREDICTED: uncharacterized protein At2g17340...  93.2    1e-18   Phoenix dactylifera
ref|XP_003555531.2|  PREDICTED: uncharacterized protein At2g17340...  94.0    1e-18   Glycine max [soybeans]
ref|XP_001952497.2|  PREDICTED: pantothenate kinase 4                 95.5    1e-18   Acyrthosiphon pisum
ref|XP_011000862.1|  PREDICTED: uncharacterized protein At2g17340...  93.2    1e-18   Populus euphratica
gb|KDO68379.1|  hypothetical protein CISIN_1g017689mg                 92.4    1e-18   Citrus sinensis [apfelsine]
gb|KDO68380.1|  hypothetical protein CISIN_1g017689mg                 92.4    1e-18   Citrus sinensis [apfelsine]
ref|XP_006606399.1|  PREDICTED: uncharacterized protein At2g17340...  92.8    1e-18   Glycine max [soybeans]
ref|XP_002064615.1|  GK23730                                          92.8    1e-18   Drosophila willistoni
gb|ESA02283.1|  hypothetical protein GLOINDRAFT_337485                95.5    1e-18   
gb|EXX62049.1|  pantothenate kinase                                   95.5    1e-18   Rhizophagus irregularis DAOM 197198w
ref|XP_009771830.1|  PREDICTED: uncharacterized protein At2g17340...  92.8    1e-18   Nicotiana sylvestris
gb|KHN30541.1|  Hypothetical protein glysoja_029978                   91.7    2e-18   Glycine soja [wild soybean]
ref|XP_005850909.1|  hypothetical protein CHLNCDRAFT_19893            92.4    2e-18   Chlorella variabilis
emb|CDY07861.1|  BnaC03g47610D                                        92.4    2e-18   Brassica napus [oilseed rape]
ref|XP_007152408.1|  hypothetical protein PHAVU_004G127600g           92.4    2e-18   Phaseolus vulgaris [French bean]
ref|XP_006422408.1|  hypothetical protein CICLE_v10028695mg           92.4    2e-18   Citrus clementina [clementine]
ref|XP_009304208.1|  PREDICTED: pantothenate kinase 4 isoform X8      92.8    2e-18   
gb|EXX73217.1|  pantothenate kinase                                   94.7    2e-18   Rhizophagus irregularis DAOM 197198w
ref|XP_004144900.1|  PREDICTED: uncharacterized protein At2g17340...  92.4    2e-18   Cucumis sativus [cucumbers]
gb|KEH42822.1|  pantothenate kinase                                   94.0    2e-18   Medicago truncatula
ref|XP_010515176.1|  PREDICTED: uncharacterized protein At2g17340...  92.0    2e-18   Camelina sativa [gold-of-pleasure]
emb|CCD82465.1|  putative pantothenate kinase                         94.7    3e-18   Schistosoma mansoni
ref|XP_011166367.1|  PREDICTED: pantothenate kinase 4                 94.7    3e-18   Solenopsis invicta [imported red fire ant]
ref|XP_009417292.1|  PREDICTED: uncharacterized protein At2g17340...  92.0    3e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006409325.1|  hypothetical protein EUTSA_v10022748mg           91.7    3e-18   Eutrema salsugineum [saltwater cress]
ref|XP_001693488.1|  protein of pantothenate kinase family            92.8    3e-18   Chlamydomonas reinhardtii
gb|KFM61167.1|  Pantothenate kinase 4                                 89.7    3e-18   Stegodyphus mimosarum
ref|XP_006849981.1|  hypothetical protein AMTR_s00022p00158890        91.7    3e-18   Amborella trichopoda
ref|XP_002436967.1|  hypothetical protein SORBIDRAFT_10g012720        91.7    4e-18   Sorghum bicolor [broomcorn]
ref|XP_008204438.1|  PREDICTED: pantothenate kinase 4 isoform X1      93.6    5e-18   Nasonia vitripennis
ref|XP_008204439.1|  PREDICTED: pantothenate kinase 4 isoform X2      93.6    5e-18   Nasonia vitripennis
ref|NP_508866.1|  Protein PNK-4                                       93.2    6e-18   Caenorhabditis elegans [roundworm]
ref|XP_011501587.1|  PREDICTED: pantothenate kinase 4                 93.6    6e-18   Ceratosolen solmsi marchali
gb|EAZ00743.1|  hypothetical protein OsI_22771                        90.9    7e-18   Oryza sativa Indica Group [Indian rice]
gb|ETN63140.1|  pantothenate kinase                                   90.9    8e-18   Anopheles darlingi [American malaria mosquito]
gb|ERG84809.1|  pantothenate kinase 4                                 93.2    8e-18   
gb|ETN87160.1|  hypothetical protein NECAME_00019                     90.1    8e-18   Necator americanus
ref|XP_003397673.1|  PREDICTED: pantothenate kinase 4-like            93.2    9e-18   
ref|XP_004933776.1|  PREDICTED: pantothenate kinase 4-like            90.5    9e-18   Bombyx mori [silk moth]
ref|XP_003117647.1|  CRE-PNK-4 protein                                92.8    1e-17   Caenorhabditis remanei
ref|XP_003488881.1|  PREDICTED: pantothenate kinase 4-like            92.8    1e-17   
ref|NP_001057524.1|  Os06g0325500                                     90.1    1e-17   
ref|XP_010003582.1|  PREDICTED: pantothenate kinase 4                 92.4    1e-17   Chaetura pelagica
gb|KHJ79124.1|  hypothetical protein OESDEN_21238                     88.2    1e-17   Oesophagostomum dentatum [nodule worm]
ref|XP_009304206.1|  PREDICTED: pantothenate kinase 4 isoform X6      92.4    1e-17   Danio rerio [leopard danio]
ref|XP_009304205.1|  PREDICTED: pantothenate kinase 4 isoform X5      92.4    1e-17   Danio rerio [leopard danio]
gb|KFU95410.1|  Pantothenate kinase 4                                 92.4    1e-17   Chaetura pelagica
ref|XP_005155853.1|  PREDICTED: pantothenate kinase 4 isoform X4      92.4    1e-17   
ref|XP_009304204.1|  PREDICTED: pantothenate kinase 4 isoform X3      92.4    1e-17   
ref|XP_005155852.1|  PREDICTED: pantothenate kinase 4 isoform X2      92.4    1e-17   
ref|XP_009304203.1|  PREDICTED: pantothenate kinase 4 isoform X1      92.4    1e-17   
ref|XP_004965348.1|  PREDICTED: uncharacterized protein At2g17340...  89.7    2e-17   
ref|XP_006642013.1|  PREDICTED: pantothenate kinase 4-like            92.0    2e-17   
gb|EYC19297.1|  hypothetical protein Y032_0024g1002                   92.0    2e-17   
gb|EYC19296.1|  hypothetical protein Y032_0024g1002                   92.0    2e-17   
gb|EYC19294.1|  hypothetical protein Y032_0024g1002                   92.0    2e-17   
ref|XP_006422407.1|  hypothetical protein CICLE_v10028695mg           89.4    2e-17   
ref|XP_007900305.1|  PREDICTED: pantothenate kinase 4 isoform X2      92.0    2e-17   
gb|EYC19298.1|  hypothetical protein Y032_0024g1002                   92.0    2e-17   
ref|XP_007900304.1|  PREDICTED: pantothenate kinase 4 isoform X1      92.0    2e-17   
gb|EYC19295.1|  hypothetical protein Y032_0024g1002                   92.0    2e-17   
ref|XP_007449007.1|  PREDICTED: pantothenate kinase 4                 91.7    2e-17   
ref|XP_009601035.1|  PREDICTED: uncharacterized protein At2g17340...  84.3    2e-17   
ref|XP_006850069.1|  hypothetical protein AMTR_s00022p00210390        91.3    2e-17   
gb|EPZ33494.1|  Type II pantothenate kinase domain-containing pro...  92.0    3e-17   
ref|XP_005102785.1|  PREDICTED: pantothenate kinase 4-like            91.7    3e-17   
ref|XP_008998534.1|  PREDICTED: pantothenate kinase 4                 91.7    3e-17   
gb|EGT30162.1|  CBN-PNK-4 protein                                     91.3    3e-17   
ref|XP_003563893.1|  PREDICTED: uncharacterized protein At2g17340...  89.0    3e-17   
gb|EMS50340.1|  hypothetical protein TRIUR3_18240                     89.0    3e-17   
ref|XP_011298123.1|  PREDICTED: pantothenate kinase 4                 91.3    3e-17   
ref|NP_001149554.1|  pantothenate kinase 4                            89.0    3e-17   
ref|XP_003939688.1|  PREDICTED: pantothenate kinase 4                 91.3    4e-17   
ref|XP_010022564.1|  PREDICTED: pantothenate kinase 4                 90.9    4e-17   
emb|CAC09438.1|  hypothetical protein                                 90.9    4e-17   
gb|KFQ45402.1|  Pantothenate kinase 4                                 90.9    4e-17   
ref|XP_007979100.1|  PREDICTED: pantothenate kinase 4 isoform X2      90.9    4e-17   
ref|NP_060686.2|  pantothenate kinase 4                               90.9    4e-17   
dbj|BAG58281.1|  unnamed protein product                              90.9    4e-17   
ref|XP_524846.3|  PREDICTED: pantothenate kinase 4 isoform X1         90.9    4e-17   
sp|Q9NVE7.1|PANK4_HUMAN  RecName: Full=Pantothenate kinase 4; Sho...  90.9    4e-17   
ref|XP_007979099.1|  PREDICTED: pantothenate kinase 4 isoform X1      90.9    4e-17   
dbj|BAD97266.1|  pantothenate kinase 4 variant                        90.9    4e-17   
ref|XP_004272348.1|  PREDICTED: pantothenate kinase 4                 90.9    4e-17   
ref|NP_001127619.1|  pantothenate kinase 4                            90.9    4e-17   
ref|XP_003973095.1|  PREDICTED: pantothenate kinase 4-like            90.9    4e-17   
ref|XP_319230.4|  AGAP010073-PA                                       88.6    4e-17   
ref|XP_006659877.1|  PREDICTED: uncharacterized protein At2g17340...  88.6    5e-17   
ref|XP_002407616.1|  pantothenate kinase, putative                    90.9    5e-17   
gb|EMT20744.1|  hypothetical protein F775_10157                       89.0    5e-17   
ref|XP_001416328.1|  predicted protein                                87.4    5e-17   
ref|XP_004024565.1|  PREDICTED: pantothenate kinase 4                 90.1    5e-17   
dbj|BAG64233.1|  unnamed protein product                              90.5    6e-17   
ref|XP_003793255.1|  PREDICTED: pantothenate kinase 4 isoform 1       90.5    6e-17   
ref|XP_003413554.1|  PREDICTED: pantothenate kinase 4                 90.5    6e-17   
ref|XP_008957661.1|  PREDICTED: pantothenate kinase 4                 90.1    7e-17   
ref|XP_005339283.1|  PREDICTED: pantothenate kinase 4                 90.1    7e-17   
gb|ACN28516.1|  unknown                                               87.8    7e-17   
ref|XP_002989798.1|  hypothetical protein SELMODRAFT_269576           87.8    8e-17   
ref|XP_002990125.1|  hypothetical protein SELMODRAFT_447908           87.8    8e-17   
gb|EGW03589.1|  Pantothenate kinase 4                                 83.6    8e-17   
ref|XP_008067465.1|  PREDICTED: pantothenate kinase 4                 90.1    8e-17   
gb|KHN74784.1|  Pantothenate kinase 4                                 90.1    8e-17   
ref|XP_006992456.1|  PREDICTED: pantothenate kinase 4                 90.1    8e-17   
ref|XP_004319339.1|  PREDICTED: pantothenate kinase 4                 89.7    9e-17   
ref|XP_007228568.1|  PREDICTED: pantothenate kinase 4-like isofor...  89.4    1e-16   
ref|XP_007427172.1|  PREDICTED: pantothenate kinase 4 isoform X1      89.7    1e-16   
gb|KFP72021.1|  Pantothenate kinase 4                                 89.4    1e-16   
ref|XP_010955938.1|  PREDICTED: LOW QUALITY PROTEIN: pantothenate...  89.7    1e-16   
ref|XP_005143769.1|  PREDICTED: pantothenate kinase 4                 89.4    1e-16   
ref|XP_009071830.1|  PREDICTED: pantothenate kinase 4                 89.4    1e-16   
ref|XP_006196654.1|  PREDICTED: pantothenate kinase 4 isoform X2      89.4    1e-16   
ref|XP_003279784.1|  PREDICTED: pantothenate kinase 4                 89.7    1e-16   
ref|XP_002949177.1|  hypothetical protein VOLCADRAFT_80583            87.0    1e-16   
ref|XP_009909569.1|  PREDICTED: pantothenate kinase 4 isoform X1      89.4    1e-16   
gb|KFV63523.1|  Pantothenate kinase 4                                 89.4    1e-16   
ref|XP_006016264.1|  PREDICTED: pantothenate kinase 4                 89.4    1e-16   
ref|XP_003075229.1|  unnamed protein product                          87.0    1e-16   
ref|XP_006871793.1|  PREDICTED: pantothenate kinase 4                 89.4    2e-16   
ref|XP_011431671.1|  PREDICTED: pantothenate kinase 4-like            89.0    2e-16   
ref|XP_008946743.1|  PREDICTED: pantothenate kinase 4                 89.0    2e-16   
ref|XP_006885880.1|  PREDICTED: pantothenate kinase 4 isoform X1      89.0    2e-16   
emb|CEG01152.1|  Domain of unknown function DUF89                     87.0    2e-16   
gb|KFQ23078.1|  Pantothenate kinase 4                                 89.0    2e-16   
ref|XP_003793256.1|  PREDICTED: pantothenate kinase 4 isoform 2       89.0    2e-16   
gb|EHH49476.1|  hypothetical protein EGM_00139                        89.0    2e-16   
ref|XP_010081712.1|  PREDICTED: pantothenate kinase 4                 88.6    2e-16   
sp|Q4R4U1.2|PANK4_MACFA  RecName: Full=Pantothenate kinase 4; Alt...  89.0    2e-16   
gb|EHH14245.1|  hypothetical protein EGK_00136                        89.0    2e-16   
ref|XP_003891046.1|  PREDICTED: pantothenate kinase 4 isoform X2      89.0    2e-16   
ref|XP_001086116.2|  PREDICTED: pantothenate kinase 4 isoform 2       89.0    2e-16   
gb|KFV15236.1|  Pantothenate kinase 4                                 88.6    2e-16   
ref|XP_007228567.1|  PREDICTED: pantothenate kinase 4-like isofor...  88.6    2e-16   
ref|XP_007228566.1|  PREDICTED: pantothenate kinase 4-like isofor...  88.6    2e-16   
ref|NP_001270249.1|  pantothenate kinase 4                            88.6    2e-16   
ref|XP_007228565.1|  PREDICTED: pantothenate kinase 4-like isofor...  88.6    2e-16   
ref|XP_002644636.1|  C. briggsae CBR-UVT-3 protein                    88.6    2e-16   
ref|XP_010880004.1|  PREDICTED: pantothenate kinase 4 isoform X5      88.6    2e-16   
ref|XP_010374471.1|  PREDICTED: LOW QUALITY PROTEIN: pantothenate...  88.6    2e-16   
ref|XP_010721167.1|  PREDICTED: pantothenate kinase 4                 88.6    2e-16   
ref|XP_010880003.1|  PREDICTED: pantothenate kinase 4 isoform X4      88.6    2e-16   
ref|XP_010880002.1|  PREDICTED: pantothenate kinase 4 isoform X3      88.6    2e-16   
ref|XP_005368706.1|  PREDICTED: pantothenate kinase 4                 88.6    2e-16   
ref|XP_010880001.1|  PREDICTED: pantothenate kinase 4 isoform X2      88.6    2e-16   
ref|XP_010880000.1|  PREDICTED: pantothenate kinase 4 isoform X1      88.6    2e-16   
gb|KGL84572.1|  Pantothenate kinase 4                                 88.6    2e-16   
ref|XP_010223585.1|  PREDICTED: pantothenate kinase 4                 88.6    2e-16   
ref|XP_005011144.1|  PREDICTED: pantothenate kinase 4                 88.6    2e-16   
gb|EOB07531.1|  Pantothenate kinase 4                                 88.6    3e-16   
ref|XP_006196653.1|  PREDICTED: pantothenate kinase 4 isoform X1      88.2    3e-16   
gb|EMC79375.1|  Pantothenate kinase 4                                 88.2    3e-16   
ref|XP_005079304.1|  PREDICTED: pantothenate kinase 4                 88.2    3e-16   
ref|XP_004384378.1|  PREDICTED: pantothenate kinase 4                 88.2    3e-16   
ref|XP_006885881.1|  PREDICTED: pantothenate kinase 4 isoform X2      88.2    3e-16   
ref|XP_006746516.1|  PREDICTED: pantothenate kinase 4                 88.2    3e-16   
ref|XP_004407420.1|  PREDICTED: pantothenate kinase 4                 88.2    3e-16   
ref|XP_003356172.1|  PREDICTED: pantothenate kinase 4                 88.2    3e-16   
ref|XP_005514434.1|  PREDICTED: pantothenate kinase 4                 88.2    3e-16   
ref|XP_010141607.1|  PREDICTED: pantothenate kinase 4                 87.8    4e-16   
ref|XP_007943625.1|  PREDICTED: pantothenate kinase 4                 87.8    4e-16   
ref|XP_009968346.1|  PREDICTED: pantothenate kinase 4                 87.8    4e-16   
gb|KFO94211.1|  Pantothenate kinase 4                                 87.8    4e-16   
ref|XP_006823846.1|  PREDICTED: pantothenate kinase 4-like            87.8    4e-16   
gb|KFV55377.1|  Pantothenate kinase 4                                 87.8    4e-16   
gb|AAI61366.1|  LOC100145609 protein                                  87.8    4e-16   
gb|KFO76652.1|  Pantothenate kinase 4                                 87.8    4e-16   
ref|NP_001120490.2|  pantothenate kinase 4                            87.8    4e-16   
gb|KFP08332.1|  Pantothenate kinase 4                                 87.8    5e-16   
ref|XP_008501814.1|  PREDICTED: pantothenate kinase 4                 87.8    5e-16   
ref|XP_004705533.1|  PREDICTED: pantothenate kinase 4                 87.8    5e-16   
ref|XP_003056890.1|  predicted protein                                85.9    5e-16   
gb|KDO68376.1|  hypothetical protein CISIN_1g017689mg                 85.1    5e-16   
ref|XP_008544605.1|  PREDICTED: pantothenate kinase 4                 87.8    5e-16   
ref|XP_003461550.1|  PREDICTED: pantothenate kinase 4                 87.8    5e-16   
ref|XP_011154324.1|  PREDICTED: pantothenate kinase 4                 87.8    5e-16   
ref|XP_009559871.1|  PREDICTED: pantothenate kinase 4                 87.8    5e-16   
ref|NP_001231841.1|  pantothenate kinase 4                            87.8    5e-16   
ref|XP_002312796.2|  pantothenate kinase-related family protein       85.5    5e-16   
ref|XP_010575777.1|  PREDICTED: pantothenate kinase 4 isoform X6      87.0    6e-16   
ref|XP_005404223.1|  PREDICTED: pantothenate kinase 4 isoform X2      87.4    6e-16   
ref|XP_010188273.1|  PREDICTED: pantothenate kinase 4                 87.4    6e-16   
gb|KFV79555.1|  Pantothenate kinase 4                                 87.4    6e-16   
gb|KFP53306.1|  Pantothenate kinase 4                                 87.4    6e-16   
gb|KFW85890.1|  Pantothenate kinase 4                                 87.4    6e-16   
dbj|BAE72988.1|  hypothetical protein                                 87.0    6e-16   
ref|XP_010163632.1|  PREDICTED: pantothenate kinase 4                 87.4    6e-16   
ref|XP_009513199.1|  PREDICTED: pantothenate kinase 4                 87.4    6e-16   
gb|KFQ39396.1|  Pantothenate kinase 4                                 87.4    6e-16   
gb|KFP10534.1|  Pantothenate kinase 4                                 87.4    6e-16   
gb|KFP38681.1|  Pantothenate kinase 4                                 87.4    6e-16   
ref|XP_009491245.1|  PREDICTED: pantothenate kinase 4                 87.4    7e-16   
gb|KFZ55737.1|  Pantothenate kinase 4                                 87.4    7e-16   
ref|XP_002801781.1|  PREDICTED: pantothenate kinase 4                 87.4    7e-16   
ref|XP_010305525.1|  PREDICTED: pantothenate kinase 4                 87.0    7e-16   
gb|KFR10569.1|  Pantothenate kinase 4                                 87.0    7e-16   
gb|KFQ48702.1|  Pantothenate kinase 4                                 87.0    7e-16   
ref|XP_009947817.1|  PREDICTED: pantothenate kinase 4                 87.0    7e-16   
gb|KGL96989.1|  Pantothenate kinase 4                                 87.0    7e-16   
gb|KFZ57411.1|  Pantothenate kinase 4                                 87.0    7e-16   
gb|KFM04076.1|  Pantothenate kinase 4                                 87.0    7e-16   
ref|XP_009669970.1|  PREDICTED: pantothenate kinase 4                 87.0    7e-16   
gb|KFQ10871.1|  Pantothenate kinase 4                                 87.0    7e-16   
ref|XP_009873641.1|  PREDICTED: pantothenate kinase 4                 87.0    7e-16   
ref|XP_009704664.1|  PREDICTED: pantothenate kinase 4                 87.0    7e-16   
gb|KFP81805.1|  Pantothenate kinase 4                                 87.0    7e-16   
gb|KFP60469.1|  Pantothenate kinase 4                                 87.0    7e-16   
ref|XP_009816817.1|  PREDICTED: pantothenate kinase 4                 87.0    7e-16   
ref|XP_009887980.1|  PREDICTED: pantothenate kinase 4                 87.0    7e-16   
ref|XP_010127500.1|  PREDICTED: pantothenate kinase 4                 87.0    7e-16   
ref|XP_009318835.1|  PREDICTED: pantothenate kinase 4                 87.0    7e-16   
ref|XP_009272502.1|  PREDICTED: pantothenate kinase 4                 87.0    7e-16   
ref|NP_766578.2|  pantothenate kinase 4                               87.0    7e-16   
gb|EDL14988.1|  pantothenate kinase 4, isoform CRA_b                  87.0    7e-16   
dbj|BAC34450.1|  unnamed protein product                              87.0    7e-16   
ref|XP_009646432.1|  PREDICTED: pantothenate kinase 4                 87.0    7e-16   
ref|XP_005437801.1|  PREDICTED: pantothenate kinase 4                 87.0    7e-16   
ref|XP_005238064.1|  PREDICTED: pantothenate kinase 4                 87.0    7e-16   
ref|XP_009925769.1|  PREDICTED: pantothenate kinase 4                 87.0    7e-16   
ref|XP_009573293.1|  PREDICTED: pantothenate kinase 4                 87.0    7e-16   
ref|XP_009981936.1|  PREDICTED: pantothenate kinase 4                 87.0    7e-16   
ref|XP_010285963.1|  PREDICTED: pantothenate kinase 4                 87.0    7e-16   
ref|XP_536718.2|  PREDICTED: pantothenate kinase 4                    87.0    7e-16   
ref|XP_010575775.1|  PREDICTED: pantothenate kinase 4 isoform X4      87.0    8e-16   
ref|XP_005404222.1|  PREDICTED: pantothenate kinase 4 isoform X1      87.0    8e-16   
ref|XP_010575773.1|  PREDICTED: pantothenate kinase 4 isoform X3      87.0    8e-16   
ref|XP_010575772.1|  PREDICTED: pantothenate kinase 4 isoform X2      87.0    8e-16   
ref|XP_010575771.1|  PREDICTED: pantothenate kinase 4 isoform X1      87.0    8e-16   
ref|XP_008508488.1|  PREDICTED: pantothenate kinase 4                 87.0    8e-16   
ref|XP_008575565.1|  PREDICTED: pantothenate kinase 4                 87.0    8e-16   
ref|XP_010848515.1|  PREDICTED: pantothenate kinase 4                 87.0    8e-16   
emb|CDS26957.1|  pantothenate kinase 4                                83.6    8e-16   
ref|XP_009932758.1|  PREDICTED: pantothenate kinase 4                 87.0    8e-16   
gb|KFQ75559.1|  Pantothenate kinase 4                                 87.0    8e-16   
ref|XP_004607250.1|  PREDICTED: pantothenate kinase 4                 87.0    8e-16   
ref|XP_005969935.1|  PREDICTED: pantothenate kinase 4                 87.0    8e-16   
ref|XP_005888905.1|  PREDICTED: pantothenate kinase 4                 87.0    8e-16   
tpg|DAA21103.1|  TPA: pantothenate kinase 4                           87.0    8e-16   
ref|NP_001076898.1|  pantothenate kinase 4                            87.0    8e-16   
gb|ELR61337.1|  Pantothenate kinase 4                                 87.0    8e-16   
ref|XP_004013820.1|  PREDICTED: pantothenate kinase 4                 87.0    8e-16   
ref|NP_598215.1|  pantothenate kinase 4                               87.0    9e-16   
gb|EDL81281.1|  pantothenate kinase 4                                 87.0    9e-16   
ref|XP_006124733.1|  PREDICTED: pantothenate kinase 4 isoform X2      86.7    1e-15   
ref|XP_006124732.1|  PREDICTED: pantothenate kinase 4 isoform X1      86.7    1e-15   
ref|XP_005690904.1|  PREDICTED: pantothenate kinase 4                 86.7    1e-15   
gb|EFB20669.1|  hypothetical protein PANDA_013754                     86.7    1e-15   
ref|XP_011229536.1|  PREDICTED: pantothenate kinase 4                 86.7    1e-15   
ref|XP_010997710.1|  PREDICTED: pantothenate kinase 4                 86.7    1e-15   
emb|CDJ00421.1|  pantothenate kinase 4                                86.7    1e-15   
ref|XP_008319266.1|  PREDICTED: pantothenate kinase 4 isoform X3      86.7    1e-15   
ref|XP_008319265.1|  PREDICTED: pantothenate kinase 4 isoform X2      86.7    1e-15   
ref|XP_008319264.1|  PREDICTED: pantothenate kinase 4 isoform X1      86.7    1e-15   
ref|XP_010626078.1|  PREDICTED: pantothenate kinase 4 isoform X1      86.3    1e-15   
ref|XP_010626080.1|  PREDICTED: pantothenate kinase 4 isoform X3      86.3    1e-15   
ref|XP_010626079.1|  PREDICTED: pantothenate kinase 4 isoform X2      86.3    1e-15   
ref|XP_006161261.1|  PREDICTED: pantothenate kinase 4                 86.3    1e-15   
emb|CDS19647.1|  pantothenate kinase 4                                86.3    1e-15   
ref|XP_011282738.1|  PREDICTED: pantothenate kinase 4                 86.3    1e-15   
ref|XP_004657776.1|  PREDICTED: pantothenate kinase 4 isoform X1      86.3    1e-15   
gb|ELV14242.1|  Pantothenate kinase 4                                 86.3    2e-15   
ref|XP_004639656.1|  PREDICTED: pantothenate kinase 4                 86.3    2e-15   
ref|XP_004768800.1|  PREDICTED: pantothenate kinase 4                 85.9    2e-15   
ref|XP_001366436.1|  PREDICTED: pantothenate kinase 4                 85.9    2e-15   
ref|XP_007070231.1|  PREDICTED: pantothenate kinase 4-like            85.9    2e-15   
gb|ERE82712.1|  pantothenate kinase 4-like protein                    85.9    2e-15   
ref|XP_003513896.1|  PREDICTED: pantothenate kinase 4                 85.9    2e-15   
ref|XP_007606831.1|  PREDICTED: LOW QUALITY PROTEIN: pantothenate...  85.9    2e-15   
emb|CDQ63015.1|  unnamed protein product                              85.5    2e-15   



>emb|CDP12421.1| unnamed protein product [Coffea canephora]
Length=189

 Score =   238 bits (606),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I R AAEAGGLLVDAM N QDG  D   SVPLMVVEN
Sbjct  52   PALNDVTAMELPDIVAEAAKHCDILRRAAEAGGLLVDAMINIQDGSIDSSSSVPLMVVEN  111

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  ++ADL+ILEGMGR LHTNFNAKF+CDALKLAMVKNQRLAE
Sbjct  112  GCGSPCIDLRQVSSELAAAAKEADLVILEGMGRSLHTNFNAKFRCDALKLAMVKNQRLAE  171

Query  362  KLIGGKIYDCVCRYEPA  312
            KLI G IYDCVCR+EPA
Sbjct  172  KLIKGSIYDCVCRFEPA  188



>emb|CBI15019.3| unnamed protein product [Vitis vinifera]
Length=988

 Score =   249 bits (636),  Expect = 1e-72, Method: Composition-based stats.
 Identities = 120/137 (88%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I R AAEAGGLLVDAM N QDG KD   SVPLMVVEN
Sbjct  851  PALNDVTAMELPDIVAEAAKHCDILRRAAEAGGLLVDAMVNIQDGSKDSLSSVPLMVVEN  910

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  ++ADLIILEGMGR LHTNFNA+FKCDALKLAMVKNQRLAE
Sbjct  911  GCGSPCIDLRQVSSELAAAAKEADLIILEGMGRALHTNFNARFKCDALKLAMVKNQRLAE  970

Query  362  KLIGGKIYDCVCRYEPA  312
            KLI G IYDCVCRYEPA
Sbjct  971  KLIKGNIYDCVCRYEPA  987



>ref|XP_002279079.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
 ref|XP_010663163.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
 ref|XP_010663164.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
 ref|XP_010663165.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
 ref|XP_010663166.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
 ref|XP_010663167.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
 ref|XP_010663168.1| PREDICTED: pantothenate kinase 2 [Vitis vinifera]
Length=906

 Score =   242 bits (617),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I R AAEAGGLLVDAM N QDG KD   SVPLMVVEN
Sbjct  769  PALNDVTAMELPDIVAEAAKHCDILRRAAEAGGLLVDAMVNIQDGSKDSLSSVPLMVVEN  828

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  ++ADLIILEGMGR LHTNFNA+FKCDALKLAMVKNQRLAE
Sbjct  829  GCGSPCIDLRQVSSELAAAAKEADLIILEGMGRALHTNFNARFKCDALKLAMVKNQRLAE  888

Query  362  KLIGGKIYDCVCRYEPA  312
            KLI G IYDCVCRYEPA
Sbjct  889  KLIKGNIYDCVCRYEPA  905



>gb|EYU42581.1| hypothetical protein MIMGU_mgv1a001050mg [Erythranthe guttata]
Length=904

 Score =   241 bits (616),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALND+TAMELPDIVAEAAKHC I RGAAEAGGLLVDAM N QD  +D   SVPLMVVEN
Sbjct  767  PALNDITAMELPDIVAEAAKHCDILRGAAEAGGLLVDAMINVQDSPRDSSFSVPLMVVEN  826

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADL+ILEGMGR LHTNFNAKFKCDALKLAMVKNQRLA 
Sbjct  827  GCGSPCIDLRQVSSELAAVAKDADLVILEGMGRSLHTNFNAKFKCDALKLAMVKNQRLAA  886

Query  362  KLIGGKIYDCVCRYEPA  312
            KLI G IYDCVCR+EPA
Sbjct  887  KLINGNIYDCVCRFEPA  903



>gb|KDO69623.1| hypothetical protein CISIN_1g042742mg [Citrus sinensis]
Length=834

 Score =   236 bits (603),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALND+TAMELPDIVAEAAKHC I R AAEAGGLLVDAM N  DG K+   SVPLMVVEN
Sbjct  697  PALNDITAMELPDIVAEAAKHCDILRRAAEAGGLLVDAMINTLDGSKENSPSVPLMVVEN  756

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  ++ADLIILEGMGR LHTNFNA+FKC+ALKLAMVKNQRLAE
Sbjct  757  GCGSPCIDLRQVSSELAAAAKNADLIILEGMGRALHTNFNARFKCEALKLAMVKNQRLAE  816

Query  362  KLIGGKIYDCVCRYEPA  312
            KLI G IYDCVCRYEPA
Sbjct  817  KLIKGNIYDCVCRYEPA  833



>ref|XP_006477543.1| PREDICTED: pantothenate kinase 2-like [Citrus sinensis]
Length=865

 Score =   236 bits (602),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALND+TAMELPDIVAEAAKHC I R AAEAGGLLVDAM N  DG K+   SVPLMVVEN
Sbjct  728  PALNDITAMELPDIVAEAAKHCDILRRAAEAGGLLVDAMINTLDGSKENSPSVPLMVVEN  787

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  ++ADLIILEGMGR LHTNFNA+FKC+ALKLAMVKNQRLAE
Sbjct  788  GCGSPCIDLRQVSSELAAAAKNADLIILEGMGRALHTNFNARFKCEALKLAMVKNQRLAE  847

Query  362  KLIGGKIYDCVCRYEPA  312
            KLI G IYDCVCRYEPA
Sbjct  848  KLIKGNIYDCVCRYEPA  864



>gb|KHG02710.1| hypothetical protein F383_25888 [Gossypium arboreum]
Length=810

 Score =   235 bits (600),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I R AAEAGGLLVDAM N  DG K+   SVPLMVVEN
Sbjct  673  PALNDVTAMELPDIVAEAAKHCDILRRAAEAGGLLVDAMTNTLDGSKENCSSVPLMVVEN  732

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELA+  + ADLIILEGMGR LHTNFNA+FKC+ALKLAMVKNQRLAE
Sbjct  733  GCGSPCIDLRQVSSELASAAKHADLIILEGMGRALHTNFNARFKCEALKLAMVKNQRLAE  792

Query  362  KLIGGKIYDCVCRYEPA  312
            KLI G+IYDCVCRYEPA
Sbjct  793  KLIKGEIYDCVCRYEPA  809



>ref|XP_006439830.1| hypothetical protein CICLE_v10018751mg [Citrus clementina]
 gb|ESR53070.1| hypothetical protein CICLE_v10018751mg [Citrus clementina]
Length=927

 Score =   236 bits (602),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALND+TAMELPDIVAEAAKHC I R AAEAGGLLVDAM N  DG K+   SVPLMVVEN
Sbjct  790  PALNDITAMELPDIVAEAAKHCDILRRAAEAGGLLVDAMINTLDGSKENSPSVPLMVVEN  849

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  ++ADLIILEGMGR LHTNFNA+FKC+ALKLAMVKNQRLAE
Sbjct  850  GCGSPCIDLRQVSSELAAAAKNADLIILEGMGRALHTNFNARFKCEALKLAMVKNQRLAE  909

Query  362  KLIGGKIYDCVCRYEPA  312
            KLI G IYDCVCRYEPA
Sbjct  910  KLIKGNIYDCVCRYEPA  926



>gb|KJB53157.1| hypothetical protein B456_008G295400 [Gossypium raimondii]
Length=867

 Score =   234 bits (598),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNN-AQDGFKDGPVSVPLMVVE  546
            PALNDVTAMELPDIVAEAAKHC + R AAEAGGLLVDAMNN + DG +    SVPLMVVE
Sbjct  729  PALNDVTAMELPDIVAEAAKHCDVLRRAAEAGGLLVDAMNNNSLDGSRGNSSSVPLMVVE  788

Query  545  NGCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLA  366
            NGCGSPCIDLRQVSSELAA  + ADL+ILEGMGR LHTNFNA+FKC+ALKLAMVKNQRLA
Sbjct  789  NGCGSPCIDLRQVSSELAAAAKHADLVILEGMGRALHTNFNARFKCEALKLAMVKNQRLA  848

Query  365  EKLIGGKIYDCVCRYEPA  312
            EKLI GKIYDCVCRYEPA
Sbjct  849  EKLIKGKIYDCVCRYEPA  866



>ref|XP_004298946.1| PREDICTED: pantothenate kinase 2 [Fragaria vesca subsp. vesca]
 ref|XP_011464015.1| PREDICTED: pantothenate kinase 2 [Fragaria vesca subsp. vesca]
Length=908

 Score =   235 bits (599),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 122/136 (90%), Gaps = 0/136 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELP+IVAEAAKHC I R AAEAGGLLVDAM +  DG K+   SVPLMVVEN
Sbjct  771  PALNDVTAMELPEIVAEAAKHCDILRRAAEAGGLLVDAMVSNLDGSKENSSSVPLMVVEN  830

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  ++ADLIILEGMGR LHTNFNA+FKCDALKLAMVKNQRLAE
Sbjct  831  GCGSPCIDLRQVSSELAAAAKEADLIILEGMGRALHTNFNARFKCDALKLAMVKNQRLAE  890

Query  362  KLIGGKIYDCVCRYEP  315
            KLI GKIYDCVCRYEP
Sbjct  891  KLIKGKIYDCVCRYEP  906



>gb|KHG28314.1| hypothetical protein F383_13494 [Gossypium arboreum]
Length=950

 Score =   234 bits (598),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQ-DGFKDGPVSVPLMVVE  546
            PALNDVTAMELPDIVAEAAKHC I R AAEAGGLLVDAMNN   DG +    SVPLMVVE
Sbjct  812  PALNDVTAMELPDIVAEAAKHCDILRRAAEAGGLLVDAMNNNTLDGSRGNSSSVPLMVVE  871

Query  545  NGCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLA  366
            NGCGSPCIDLRQVSSELAA  + ADL+ILEGMGR LHTNFNA+FKC+ALKLAMVKNQRLA
Sbjct  872  NGCGSPCIDLRQVSSELAAAAKHADLVILEGMGRALHTNFNARFKCEALKLAMVKNQRLA  931

Query  365  EKLIGGKIYDCVCRYEPA  312
            EKLI GKIYDCVCRYEPA
Sbjct  932  EKLIKGKIYDCVCRYEPA  949



>gb|KJB39190.1| hypothetical protein B456_007G001600 [Gossypium raimondii]
 gb|KJB39192.1| hypothetical protein B456_007G001600 [Gossypium raimondii]
Length=924

 Score =   234 bits (598),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I R AAEAGGLLVDAM N  DG K+   SVPLMVVEN
Sbjct  787  PALNDVTAMELPDIVAEAAKHCDILRRAAEAGGLLVDAMTNTLDGSKENCSSVPLMVVEN  846

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELA+  + ADLIILEGMGR LHTNFNA FKC+ALKLAMVKNQRLAE
Sbjct  847  GCGSPCIDLRQVSSELASAAKHADLIILEGMGRALHTNFNAWFKCEALKLAMVKNQRLAE  906

Query  362  KLIGGKIYDCVCRYEPA  312
            KLI G+IYDCVCRYEPA
Sbjct  907  KLIKGEIYDCVCRYEPA  923



>gb|KJB53156.1| hypothetical protein B456_008G295400 [Gossypium raimondii]
 gb|KJB53158.1| hypothetical protein B456_008G295400 [Gossypium raimondii]
Length=922

 Score =   234 bits (597),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNN-AQDGFKDGPVSVPLMVVE  546
            PALNDVTAMELPDIVAEAAKHC + R AAEAGGLLVDAMNN + DG +    SVPLMVVE
Sbjct  784  PALNDVTAMELPDIVAEAAKHCDVLRRAAEAGGLLVDAMNNNSLDGSRGNSSSVPLMVVE  843

Query  545  NGCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLA  366
            NGCGSPCIDLRQVSSELAA  + ADL+ILEGMGR LHTNFNA+FKC+ALKLAMVKNQRLA
Sbjct  844  NGCGSPCIDLRQVSSELAAAAKHADLVILEGMGRALHTNFNARFKCEALKLAMVKNQRLA  903

Query  365  EKLIGGKIYDCVCRYEPA  312
            EKLI GKIYDCVCRYEPA
Sbjct  904  EKLIKGKIYDCVCRYEPA  921



>gb|KCW49278.1| hypothetical protein EUGRSUZ_K02840 [Eucalyptus grandis]
Length=916

 Score =   234 bits (597),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALND+TAMELP+IVAEAAKHC I R AAEAGGLLVDAM N+ DG K+   SVPLMVVEN
Sbjct  779  PALNDITAMELPEIVAEAAKHCDILRRAAEAGGLLVDAMTNSIDGSKENSSSVPLMVVEN  838

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADL+ILEGMGR LHTN  A+FKCDALKLAMVKNQRLAE
Sbjct  839  GCGSPCIDLRQVSSELAALAKDADLVILEGMGRALHTNLYARFKCDALKLAMVKNQRLAE  898

Query  362  KLIGGKIYDCVCRYEPA  312
            KL+ GKIYDCVC+YEPA
Sbjct  899  KLVKGKIYDCVCKYEPA  915



>ref|XP_010037560.1| PREDICTED: pantothenate kinase 2 [Eucalyptus grandis]
 gb|KCW49279.1| hypothetical protein EUGRSUZ_K02840 [Eucalyptus grandis]
Length=915

 Score =   234 bits (596),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALND+TAMELP+IVAEAAKHC I R AAEAGGLLVDAM N+ DG K+   SVPLMVVEN
Sbjct  778  PALNDITAMELPEIVAEAAKHCDILRRAAEAGGLLVDAMTNSIDGSKENSSSVPLMVVEN  837

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADL+ILEGMGR LHTN  A+FKCDALKLAMVKNQRLAE
Sbjct  838  GCGSPCIDLRQVSSELAALAKDADLVILEGMGRALHTNLYARFKCDALKLAMVKNQRLAE  897

Query  362  KLIGGKIYDCVCRYEPA  312
            KL+ GKIYDCVC+YEPA
Sbjct  898  KLVKGKIYDCVCKYEPA  914



>gb|KCW49280.1| hypothetical protein EUGRSUZ_K02840 [Eucalyptus grandis]
Length=906

 Score =   234 bits (596),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALND+TAMELP+IVAEAAKHC I R AAEAGGLLVDAM N+ DG K+   SVPLMVVEN
Sbjct  769  PALNDITAMELPEIVAEAAKHCDILRRAAEAGGLLVDAMTNSIDGSKENSSSVPLMVVEN  828

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADL+ILEGMGR LHTN  A+FKCDALKLAMVKNQRLAE
Sbjct  829  GCGSPCIDLRQVSSELAALAKDADLVILEGMGRALHTNLYARFKCDALKLAMVKNQRLAE  888

Query  362  KLIGGKIYDCVCRYEPA  312
            KL+ GKIYDCVC+YEPA
Sbjct  889  KLVKGKIYDCVCKYEPA  905



>ref|XP_010534230.1| PREDICTED: pantothenate kinase 2 [Tarenaya hassleriana]
 ref|XP_010534231.1| PREDICTED: pantothenate kinase 2 [Tarenaya hassleriana]
 ref|XP_010534232.1| PREDICTED: pantothenate kinase 2 [Tarenaya hassleriana]
Length=923

 Score =   233 bits (594),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 118/136 (87%), Gaps = 0/136 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I R AAE GGLLVDAM N  DG K    S PLMVVEN
Sbjct  784  PALNDVTAMELPDIVAEAAKHCDILRRAAETGGLLVDAMINPSDGSKQNSASPPLMVVEN  843

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADLIILEGMGR LHTNFNA+FKC+ALKLAMVKNQRLAE
Sbjct  844  GCGSPCIDLRQVSSELAAMAKDADLIILEGMGRALHTNFNARFKCEALKLAMVKNQRLAE  903

Query  362  KLIGGKIYDCVCRYEP  315
            KLI G IYDCVCRYEP
Sbjct  904  KLIKGNIYDCVCRYEP  919



>ref|XP_008356598.1| PREDICTED: pantothenate kinase 2-like [Malus domestica]
Length=916

 Score =   232 bits (592),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELP+IVAEAAKHC I R AAEAGGLLVDAM +  DG K    SVPLMVVEN
Sbjct  779  PALNDVTAMELPEIVAEAAKHCDILRRAAEAGGLLVDAMVSTLDGSKGNSSSVPLMVVEN  838

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  ++ADL+ILEGMGR LHTNFNAKFKCDALKLAMVKNQRLA+
Sbjct  839  GCGSPCIDLRQVSSELAAAAKEADLVILEGMGRSLHTNFNAKFKCDALKLAMVKNQRLAQ  898

Query  362  KLIGGKIYDCVCRYEP  315
            KLI G IYDCVCRYEP
Sbjct  899  KLIKGNIYDCVCRYEP  914



>ref|XP_009363012.1| PREDICTED: pantothenate kinase 2 [Pyrus x bretschneideri]
 ref|XP_009363013.1| PREDICTED: pantothenate kinase 2 [Pyrus x bretschneideri]
 ref|XP_009363015.1| PREDICTED: pantothenate kinase 2 [Pyrus x bretschneideri]
Length=915

 Score =   230 bits (586),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELP+IVAE+AKHC I R AAEAGGLLVDAM +  DG K    SVPLMVVEN
Sbjct  778  PALNDVTAMELPEIVAESAKHCDILRRAAEAGGLLVDAMVSTLDGSKGNSSSVPLMVVEN  837

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCID RQVSSELAA  ++ADL+ILEGMGR LHTNFNAKFKCDALKLAMVKNQRLA+
Sbjct  838  GCGSPCIDFRQVSSELAAAAKEADLVILEGMGRSLHTNFNAKFKCDALKLAMVKNQRLAQ  897

Query  362  KLIGGKIYDCVCRYEP  315
            KLI G IYDCVCRYEP
Sbjct  898  KLIQGNIYDCVCRYEP  913



>ref|XP_009600890.1| PREDICTED: pantothenate kinase 2 [Nicotiana tomentosiformis]
 ref|XP_009600891.1| PREDICTED: pantothenate kinase 2 [Nicotiana tomentosiformis]
Length=908

 Score =   230 bits (586),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I RGAAEAGGLLVDAM+N QDG+K+   SVPLMVVEN
Sbjct  771  PALNDVTAMELPDIVAEAAKHCDILRGAAEAGGLLVDAMSNIQDGYKEDTPSVPLMVVEN  830

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADL+ILEGMGR LHTN+NAKFKCDALKLAMVKNQRLA+
Sbjct  831  GCGSPCIDLRQVSSELAAAAKDADLVILEGMGRSLHTNYNAKFKCDALKLAMVKNQRLAQ  890

Query  362  KLIGGKIYDCVCRYEPA  312
            KL+ G IYDCVCRYEPA
Sbjct  891  KLVKGNIYDCVCRYEPA  907



>ref|XP_009793998.1| PREDICTED: pantothenate kinase 2 isoform X2 [Nicotiana sylvestris]
Length=908

 Score =   230 bits (586),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I RGAAEAGGLLVDAM+N QDG+K+   SVPLMVVEN
Sbjct  771  PALNDVTAMELPDIVAEAAKHCDILRGAAEAGGLLVDAMSNIQDGYKEDTPSVPLMVVEN  830

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADL+ILEGMGR LHTN+NAKFKCDALKLAMVKNQRLA+
Sbjct  831  GCGSPCIDLRQVSSELAAAAKDADLVILEGMGRSLHTNYNAKFKCDALKLAMVKNQRLAQ  890

Query  362  KLIGGKIYDCVCRYEPA  312
            KL+ G IYDCVCRYEPA
Sbjct  891  KLVKGNIYDCVCRYEPA  907



>ref|XP_009793996.1| PREDICTED: pantothenate kinase 2 isoform X1 [Nicotiana sylvestris]
Length=932

 Score =   230 bits (586),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I RGAAEAGGLLVDAM+N QDG+K+   SVPLMVVEN
Sbjct  795  PALNDVTAMELPDIVAEAAKHCDILRGAAEAGGLLVDAMSNIQDGYKEDTPSVPLMVVEN  854

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADL+ILEGMGR LHTN+NAKFKCDALKLAMVKNQRLA+
Sbjct  855  GCGSPCIDLRQVSSELAAAAKDADLVILEGMGRSLHTNYNAKFKCDALKLAMVKNQRLAQ  914

Query  362  KLIGGKIYDCVCRYEPA  312
            KL+ G IYDCVCRYEPA
Sbjct  915  KLVKGNIYDCVCRYEPA  931



>ref|XP_004236210.1| PREDICTED: pantothenate kinase 2 [Solanum lycopersicum]
 ref|XP_010318982.1| PREDICTED: pantothenate kinase 2 [Solanum lycopersicum]
Length=901

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I RGAAEAGGLLVDAM+N QDG+K+   SVPLMVVEN
Sbjct  764  PALNDVTAMELPDIVAEAAKHCDILRGAAEAGGLLVDAMSNIQDGYKENTPSVPLMVVEN  823

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADL+ILEGMGR LHTN+NAKFKCDALKLAMVKNQRLA 
Sbjct  824  GCGSPCIDLRQVSSELAAAAKDADLVILEGMGRSLHTNYNAKFKCDALKLAMVKNQRLAA  883

Query  362  KLIGGKIYDCVCRYEPA  312
            KL+ G IYDCVCRYEPA
Sbjct  884  KLVKGNIYDCVCRYEPA  900



>ref|XP_006344398.1| PREDICTED: pantothenate kinase 2-like isoform X1 [Solanum tuberosum]
 ref|XP_006344399.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Solanum tuberosum]
 ref|XP_006344400.1| PREDICTED: pantothenate kinase 2-like isoform X3 [Solanum tuberosum]
Length=901

 Score =   229 bits (584),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I RGAAEAGGLLVDAM+N QDG+K+   SVPLMVVEN
Sbjct  764  PALNDVTAMELPDIVAEAAKHCDILRGAAEAGGLLVDAMSNIQDGYKENTPSVPLMVVEN  823

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADL+ILEGMGR LHTN+NAKFKCDALKLAMVKNQRLA 
Sbjct  824  GCGSPCIDLRQVSSELAAAAKDADLVILEGMGRSLHTNYNAKFKCDALKLAMVKNQRLAA  883

Query  362  KLIGGKIYDCVCRYEPA  312
            KL+ G IYDCVCRYEPA
Sbjct  884  KLVKGNIYDCVCRYEPA  900



>ref|XP_008239770.1| PREDICTED: pantothenate kinase 2 [Prunus mume]
Length=910

 Score =   228 bits (582),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELP+IVAEAAKHC I R AAEAGGLLVDAM +  D  K    SVPLMVVEN
Sbjct  773  PALNDVTAMELPEIVAEAAKHCDILRRAAEAGGLLVDAMVSTLDDSKGNSSSVPLMVVEN  832

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  ++ADLIILEGMGR LHTNFNA+FKCDALKLAMVKNQRLAE
Sbjct  833  GCGSPCIDLRQVSSELAAAAKEADLIILEGMGRALHTNFNARFKCDALKLAMVKNQRLAE  892

Query  362  KLIGGKIYDCVCRYEP  315
            KLI G IY+CVCRYEP
Sbjct  893  KLIKGNIYNCVCRYEP  908



>ref|XP_007210380.1| hypothetical protein PRUPE_ppa001094mg [Prunus persica]
 gb|EMJ11579.1| hypothetical protein PRUPE_ppa001094mg [Prunus persica]
Length=910

 Score =   228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELP+IVAEAAKHC I R AAEAGGLLVDAM +  D  K    SVPLMVVEN
Sbjct  773  PALNDVTAMELPEIVAEAAKHCDILRRAAEAGGLLVDAMVSTLDDSKGHSSSVPLMVVEN  832

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  ++ADLIILEGMGR LHTNFNA+FKCDALKLAMVKNQRLAE
Sbjct  833  GCGSPCIDLRQVSSELAAAAKEADLIILEGMGRALHTNFNARFKCDALKLAMVKNQRLAE  892

Query  362  KLIGGKIYDCVCRYEP  315
            KLI G IY+CVCRYEP
Sbjct  893  KLIKGNIYNCVCRYEP  908



>ref|XP_011001529.1| PREDICTED: pantothenate kinase 2-like [Populus euphratica]
 ref|XP_011001530.1| PREDICTED: pantothenate kinase 2-like [Populus euphratica]
Length=935

 Score =   227 bits (579),  Expect = 7e-65, Method: Composition-based stats.
 Identities = 117/137 (85%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I R AAEAGGLLVDAM N  DG K+   SVPLMVVEN
Sbjct  798  PALNDVTAMELPDIVAEAAKHCDILRRAAEAGGLLVDAMINTSDGSKENSSSVPLMVVEN  857

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADLI+LEGMGR LHTNFNA+FKCD LKLAMVKNQRLAE
Sbjct  858  GCGSPCIDLRQVSSELAAAAKDADLIVLEGMGRALHTNFNARFKCDTLKLAMVKNQRLAE  917

Query  362  KLIGGKIYDCVCRYEPA  312
            KLI G IYDCVCRYEPA
Sbjct  918  KLIKGNIYDCVCRYEPA  934



>ref|XP_008393029.1| PREDICTED: pantothenate kinase 2 [Malus domestica]
Length=907

 Score =   227 bits (579),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALND TAMELP+IVAEAAKHC I R AAEAGGLLVDAM ++ DG K    SVPLMVVEN
Sbjct  770  PALNDATAMELPEIVAEAAKHCDILRRAAEAGGLLVDAMVSSLDGSKGNSSSVPLMVVEN  829

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  ++ADL+ILEGMGR LHTN NAKFKCDALKLAMVKNQRLA+
Sbjct  830  GCGSPCIDLRQVSSELAAAAKEADLVILEGMGRALHTNXNAKFKCDALKLAMVKNQRLAQ  889

Query  362  KLIGGKIYDCVCRYEP  315
            KLI G IYDCVCRYEP
Sbjct  890  KLIQGNIYDCVCRYEP  905



>ref|XP_007036234.1| Pantothenate kinase 2 isoform 1 [Theobroma cacao]
 gb|EOY20735.1| Pantothenate kinase 2 isoform 1 [Theobroma cacao]
Length=973

 Score =   227 bits (579),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I R AAEAGGLLVDAMNN  DG K+   SVPLMVVEN
Sbjct  836  PALNDVTAMELPDIVAEAAKHCDILRRAAEAGGLLVDAMNNTLDGSKENASSVPLMVVEN  895

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADLIILEGMGR LHTNFNA+FKC+ALKLAMVKNQRLAE
Sbjct  896  GCGSPCIDLRQVSSELAAAAKDADLIILEGMGRALHTNFNAQFKCEALKLAMVKNQRLAE  955

Query  362  KLIGGKIYDCVCRYEPA  312
            KLI GKIYDCVCRYEPA
Sbjct  956  KLIKGKIYDCVCRYEPA  972



>ref|XP_006374524.1| hypothetical protein POPTR_0015s08830g [Populus trichocarpa]
 ref|XP_002322167.2| hypothetical protein POPTR_0015s08830g [Populus trichocarpa]
 gb|ERP52321.1| hypothetical protein POPTR_0015s08830g [Populus trichocarpa]
 gb|EEF06294.2| hypothetical protein POPTR_0015s08830g [Populus trichocarpa]
Length=715

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I R AAEAGGLLVDAM N  DG K+   SVPLMVVEN
Sbjct  578  PALNDVTAMELPDIVAEAAKHCDILRRAAEAGGLLVDAMINTSDGSKENSSSVPLMVVEN  637

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADLIILEGMGR LHTNFNA+FKC+ALKLAMVKNQRLAE
Sbjct  638  GCGSPCIDLRQVSSELAAAAKDADLIILEGMGRALHTNFNARFKCEALKLAMVKNQRLAE  697

Query  362  KLIGGKIYDCVCRYEPA  312
            KLI G IYDCVCRYEPA
Sbjct  698  KLIKGNIYDCVCRYEPA  714



>gb|KHN19303.1| Pantothenate kinase 2 [Glycine soja]
Length=440

 Score =   218 bits (554),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I R AAEAGGLLVDAM N  D  K+ P SVPLMVVEN
Sbjct  303  PALNDVTAMELPDIVAEAAKHCDILRRAAEAGGLLVDAMINTSDSSKENPSSVPLMVVEN  362

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADLIILEGMGR LHTN NA+FK DALKLAMVKNQRLAE
Sbjct  363  GCGSPCIDLRQVSSELAAAAKDADLIILEGMGRALHTNLNARFKRDALKLAMVKNQRLAE  422

Query  362  KLIGGKIYDCVCRYEPA  312
            KL+ G IYDC+C+YEPA
Sbjct  423  KLVKGNIYDCICKYEPA  439



>ref|XP_008795922.1| PREDICTED: pantothenate kinase 2-like isoform X1 [Phoenix dactylifera]
Length=913

 Score =   224 bits (572),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTA ELP+IVAEAAKHC I R AAEAGGLLVDAM + + G  D   SVPLMVVEN
Sbjct  764  PALNDVTANELPEIVAEAAKHCDILRKAAEAGGLLVDAMVSVEHGLVDNSASVPLMVVEN  823

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCID RQVSSELAA  R ADLIILEGMGR LHTNFNA+F+CDALKLAM+KNQRLAE
Sbjct  824  GCGSPCIDFRQVSSELAAAARGADLIILEGMGRALHTNFNARFRCDALKLAMMKNQRLAE  883

Query  362  KLIGGKIYDCVCRYEPA  312
            KL  G +YDCVCR+EPA
Sbjct  884  KLFNGNLYDCVCRFEPA  900



>ref|XP_008795923.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Phoenix dactylifera]
 ref|XP_008795924.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Phoenix dactylifera]
Length=909

 Score =   224 bits (572),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTA ELP+IVAEAAKHC I R AAEAGGLLVDAM + + G  D   SVPLMVVEN
Sbjct  764  PALNDVTANELPEIVAEAAKHCDILRKAAEAGGLLVDAMVSVEHGLVDNSASVPLMVVEN  823

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCID RQVSSELAA  R ADLIILEGMGR LHTNFNA+F+CDALKLAM+KNQRLAE
Sbjct  824  GCGSPCIDFRQVSSELAAAARGADLIILEGMGRALHTNFNARFRCDALKLAMMKNQRLAE  883

Query  362  KLIGGKIYDCVCRYEPA  312
            KL  G +YDCVCR+EPA
Sbjct  884  KLFNGNLYDCVCRFEPA  900



>emb|CDX68824.1| BnaC01g06290D [Brassica napus]
Length=906

 Score =   224 bits (571),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVA AAKHC I R AAE GGLLVDAM N  DG K    S PLMVVEN
Sbjct  765  PALNDVTAMELPDIVAGAAKHCDILRRAAEMGGLLVDAMVNPGDGSKKDSTSAPLMVVEN  824

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  ++ADL+ILEGMGR LHTNFNA+FKC++LKLAMVKNQRLA+
Sbjct  825  GCGSPCIDLRQVSSELAAAAKEADLVILEGMGRALHTNFNAQFKCESLKLAMVKNQRLAD  884

Query  362  KLIGGKIYDCVCRYEP  315
            KLI G IYDCVCRYEP
Sbjct  885  KLIKGNIYDCVCRYEP  900



>ref|XP_002318651.1| hypothetical protein POPTR_0012s08310g [Populus trichocarpa]
 gb|EEE96871.1| hypothetical protein POPTR_0012s08310g [Populus trichocarpa]
Length=939

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I R AAEAGGLLVDAM N  DG KD   SVPLMVVEN
Sbjct  802  PALNDVTAMELPDIVAEAAKHCDILRRAAEAGGLLVDAMINTSDGSKDNSSSVPLMVVEN  861

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADLI+LEGMGR LHTNFNA+FKC+ALKLAMVKNQRLAE
Sbjct  862  GCGSPCIDLRQVSSELAAAAKDADLIVLEGMGRALHTNFNARFKCEALKLAMVKNQRLAE  921

Query  362  KLIGGKIYDCVCRYEPA  312
            KLI G +YDCVCRYEPA
Sbjct  922  KLIEGNLYDCVCRYEPA  938



>ref|XP_011028555.1| PREDICTED: pantothenate kinase 2-like [Populus euphratica]
 ref|XP_011028556.1| PREDICTED: pantothenate kinase 2-like [Populus euphratica]
Length=936

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I R AAEAGGLLVDAM N  DG K+   SVPLMVVEN
Sbjct  799  PALNDVTAMELPDIVAEAAKHCDILRRAAEAGGLLVDAMINTSDGSKENSSSVPLMVVEN  858

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADLIILEGMGR LHTNFNA+FKC+ALKLAMVKNQRLAE
Sbjct  859  GCGSPCIDLRQVSSELAAAAKDADLIILEGMGRALHTNFNARFKCEALKLAMVKNQRLAE  918

Query  362  KLIGGKIYDCVCRYEPA  312
            KLI G IYDCVCRYEPA
Sbjct  919  KLIKGNIYDCVCRYEPA  935



>ref|XP_010101220.1| Pantothenate kinase 2 [Morus notabilis]
 gb|EXB87894.1| Pantothenate kinase 2 [Morus notabilis]
Length=912

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC + R AAEAGGLLVDAM + QDG K+    VPLMVVEN
Sbjct  775  PALNDVTAMELPDIVAEAAKHCDVLRRAAEAGGLLVDAMVSGQDGSKESSSLVPLMVVEN  834

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADLIILEGMGR LHTNFNA+FKC+ALKLAMVKNQRLAE
Sbjct  835  GCGSPCIDLRQVSSELAAAAKDADLIILEGMGRALHTNFNARFKCNALKLAMVKNQRLAE  894

Query  362  KLIGGKIYDCVCRYEPA  312
            KLI G IYDCVCRYEPA
Sbjct  895  KLIKGNIYDCVCRYEPA  911



>ref|XP_004152477.1| PREDICTED: pantothenate kinase 2-like [Cucumis sativus]
 ref|XP_004167266.1| PREDICTED: pantothenate kinase 2-like [Cucumis sativus]
 gb|KGN64313.1| hypothetical protein Csa_1G046095 [Cucumis sativus]
Length=911

 Score =   220 bits (561),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I R AAEAGGL+VDAM ++ DG K+G   VPLMVVEN
Sbjct  774  PALNDVTAMELPDIVAEAAKHCDILRRAAEAGGLIVDAMIDSADGSKEGSSFVPLMVVEN  833

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADL+ILEGMGR LHTNFNA+FKCDALKLAMVKNQRLAE
Sbjct  834  GCGSPCIDLRQVSSELAAAAKDADLVILEGMGRALHTNFNAQFKCDALKLAMVKNQRLAE  893

Query  362  KLIGGKIYDCVCRYEPAE  309
            KLI G IYDCVCRYEP+ 
Sbjct  894  KLIKGNIYDCVCRYEPSH  911



>ref|XP_008438456.1| PREDICTED: pantothenate kinase 2 [Cucumis melo]
Length=911

 Score =   220 bits (561),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I R AAEAGGL+VDAM ++ DG K+G   VPLMVVEN
Sbjct  774  PALNDVTAMELPDIVAEAAKHCDILRRAAEAGGLIVDAMIDSADGSKEGSSFVPLMVVEN  833

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADL+ILEGMGR LHTNFNA+FKCDALKLAMVKNQRLAE
Sbjct  834  GCGSPCIDLRQVSSELAAAAKDADLVILEGMGRALHTNFNAQFKCDALKLAMVKNQRLAE  893

Query  362  KLIGGKIYDCVCRYEPAE  309
            KLI G IYDCVCRYEP+ 
Sbjct  894  KLIKGNIYDCVCRYEPSH  911



>gb|KDP31092.1| hypothetical protein JCGZ_11468 [Jatropha curcas]
Length=911

 Score =   220 bits (560),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELP+IVAEAAKHC I R AAEAGGLLVDAM N  D  K+   SVPLMVVEN
Sbjct  774  PALNDVTAMELPEIVAEAAKHCDILRRAAEAGGLLVDAMINTLDSSKENSASVPLMVVEN  833

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCID RQVSSELAA  +DADLIILEGMGR LHTNFNA+FKCD LKLAMVKNQRLAE
Sbjct  834  GCGSPCIDFRQVSSELAAAAKDADLIILEGMGRALHTNFNAQFKCDVLKLAMVKNQRLAE  893

Query  362  KLIGGKIYDCVCRYEPA  312
            KLI GKIYDCVCRYEPA
Sbjct  894  KLIKGKIYDCVCRYEPA  910



>ref|XP_011071870.1| PREDICTED: pantothenate kinase 2 [Sesamum indicum]
 ref|XP_011071871.1| PREDICTED: pantothenate kinase 2 [Sesamum indicum]
Length=922

 Score =   219 bits (558),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDG-FKDGPVSVPLMVVE  546
            PALNDVTAMELPDIVAEAAKHC + RGAAEAGGLLVDAM N QD   ++  +SVPLMVVE
Sbjct  784  PALNDVTAMELPDIVAEAAKHCDVLRGAAEAGGLLVDAMINIQDSPTRERSISVPLMVVE  843

Query  545  NGCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLA  366
            NGCGSPCIDLRQVSSELAA  +DADLIILEGMGR LHTN+NAKFKCDALKLAMVKNQRLA
Sbjct  844  NGCGSPCIDLRQVSSELAAAAKDADLIILEGMGRALHTNYNAKFKCDALKLAMVKNQRLA  903

Query  365  EKLIGGKIYDCVCRYEPA  312
             KLI G IYDCVCR+EPA
Sbjct  904  AKLINGNIYDCVCRFEPA  921



>ref|XP_007155432.1| hypothetical protein PHAVU_003G200700g [Phaseolus vulgaris]
 gb|ESW27426.1| hypothetical protein PHAVU_003G200700g [Phaseolus vulgaris]
Length=867

 Score =   219 bits (557),  Expect = 6e-62, Method: Composition-based stats.
 Identities = 110/137 (80%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I R AAE+GGLLVDAM+   D  ++ P SVPLMVVEN
Sbjct  730  PALNDVTAMELPDIVAEAAKHCDILRRAAESGGLLVDAMSTTLDSPRENPSSVPLMVVEN  789

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCID RQVSSELAA  +DADLIILEGMGR LHTN NA+FKCDALKLAMVKNQR AE
Sbjct  790  GCGSPCIDFRQVSSELAAAAKDADLIILEGMGRALHTNLNAQFKCDALKLAMVKNQRFAE  849

Query  362  KLIGGKIYDCVCRYEPA  312
            KLI G +YDC+C+YEPA
Sbjct  850  KLIKGNLYDCICKYEPA  866



>ref|XP_002511391.1| Pantothenate kinase, putative [Ricinus communis]
 gb|EEF51993.1| Pantothenate kinase, putative [Ricinus communis]
Length=907

 Score =   218 bits (555),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDI+AEAAKHC I R AAEAGGL+VDAM N  DG K+   SVPLMVVEN
Sbjct  770  PALNDVTAMELPDIIAEAAKHCDILRKAAEAGGLIVDAMINTSDGSKENCSSVPLMVVEN  829

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADLIILEGMGR LHTNFNA F CDALKLAMVKNQRLAE
Sbjct  830  GCGSPCIDLRQVSSELAAAAKDADLIILEGMGRALHTNFNAGFTCDALKLAMVKNQRLAE  889

Query  362  KLIGGKIYDCVCRYEPA  312
            KL+ G IYDCVCRYEPA
Sbjct  890  KLVRGNIYDCVCRYEPA  906



>gb|AAM20690.1| putative protein [Arabidopsis thaliana]
Length=870

 Score =   217 bits (552),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 112/139 (81%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVA AAKHC I R AAE GGLLVDAM N  DG K    S PLMVVEN
Sbjct  732  PALNDVTAMELPDIVAGAAKHCDILRRAAEMGGLLVDAMVNPGDGSKKDSTSAPLMVVEN  791

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADL++LEGMGR LHTNFNA+F+C+ALKLAMVKNQRLAE
Sbjct  792  GCGSPCIDLRQVSSELAAAAKDADLVVLEGMGRALHTNFNAQFQCEALKLAMVKNQRLAE  851

Query  362  KLIGGKIYDCVCRYEPAEL  306
            KLI G IYDCVCRYEP  L
Sbjct  852  KLIKGNIYDCVCRYEPPSL  870



>ref|XP_003528148.1| PREDICTED: pantothenate kinase 2-like [Glycine max]
Length=912

 Score =   217 bits (553),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I R AAEAGGLLVDAM N  D  K+ P SVPLMVVEN
Sbjct  775  PALNDVTAMELPDIVAEAAKHCDILRRAAEAGGLLVDAMINTSDSSKENPSSVPLMVVEN  834

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADLIILEGMGR LHTN NA+FK DALKLAMVKNQRLAE
Sbjct  835  GCGSPCIDLRQVSSELAAAAKDADLIILEGMGRALHTNLNARFKRDALKLAMVKNQRLAE  894

Query  362  KLIGGKIYDCVCRYEPA  312
            KL+ G IYDC+C+YEPA
Sbjct  895  KLVKGNIYDCICKYEPA  911



>ref|XP_010437940.1| PREDICTED: pantothenate kinase 2-like [Camelina sativa]
Length=902

 Score =   217 bits (552),  Expect = 3e-61, Method: Composition-based stats.
 Identities = 113/139 (81%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVA AAKHC I R AAE GGLLVDAM N  DG K    S PLMVVEN
Sbjct  764  PALNDVTAMELPDIVAWAAKHCDILRRAAEMGGLLVDAMVNPGDGSKKDLTSAPLMVVEN  823

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADL++LEGMGR LHTNFNA+FKC+ALKLAMVKNQRLAE
Sbjct  824  GCGSPCIDLRQVSSELAAAAKDADLVVLEGMGRALHTNFNAQFKCEALKLAMVKNQRLAE  883

Query  362  KLIGGKIYDCVCRYEPAEL  306
            KLI G IYDCVCRYEP  L
Sbjct  884  KLIKGNIYDCVCRYEPPSL  902



>ref|XP_006282554.1| hypothetical protein CARUB_v10004099mg [Capsella rubella]
 gb|EOA15452.1| hypothetical protein CARUB_v10004099mg [Capsella rubella]
Length=905

 Score =   217 bits (552),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVA AAKHC I R AAE GGLLVDAM N  DG K   VSVPLMVVEN
Sbjct  767  PALNDVTAMELPDIVAGAAKHCDILRRAAEMGGLLVDAMVNPGDGSKKDSVSVPLMVVEN  826

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADL+ILEGMGR LHTNFNA+FKC+ALKLAMVKNQRLAE
Sbjct  827  GCGSPCIDLRQVSSELAAAAKDADLVILEGMGRALHTNFNAQFKCEALKLAMVKNQRLAE  886

Query  362  KLIGGKIYDCVCRYEPAEL  306
            KLI G IYDCVCRYEP  L
Sbjct  887  KLIKGNIYDCVCRYEPPSL  905



>ref|XP_010243065.1| PREDICTED: pantothenate kinase 2 isoform X2 [Nelumbo nucifera]
Length=805

 Score =   216 bits (550),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 118/136 (87%), Gaps = 0/136 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELP+IVAEAAKHC I R AAEAGGLLVDAM N QD  K    SVPLMVVEN
Sbjct  668  PALNDVTAMELPEIVAEAAKHCDILRKAAEAGGLLVDAMINVQDDSKGNSSSVPLMVVEN  727

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADL+ILEGMGR LHTNFNA FKCDALKLAMVKNQRLAE
Sbjct  728  GCGSPCIDLRQVSSELAAAAKDADLVILEGMGRALHTNFNAHFKCDALKLAMVKNQRLAE  787

Query  362  KLIGGKIYDCVCRYEP  315
            KLI G IY CVCRYEP
Sbjct  788  KLIKGNIYSCVCRYEP  803



>ref|XP_006600640.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Glycine max]
Length=901

 Score =   216 bits (550),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I R AAE+GGLLVDAM N  D  ++   SVPLMVVEN
Sbjct  764  PALNDVTAMELPDIVAEAAKHCDILRRAAESGGLLVDAMTNTLDSPRENSSSVPLMVVEN  823

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADLIILEGMGR LHTN NA+F+CDALKLAMVKNQRLAE
Sbjct  824  GCGSPCIDLRQVSSELAAAAKDADLIILEGMGRALHTNLNARFQCDALKLAMVKNQRLAE  883

Query  362  KLIGGKIYDCVCRYEPA  312
            KLI G IYDC+C+YEPA
Sbjct  884  KLIKGNIYDCICKYEPA  900



>ref|XP_006600639.1| PREDICTED: pantothenate kinase 2-like isoform X1 [Glycine max]
Length=902

 Score =   216 bits (550),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I R AAE+GGLLVDAM N  D  ++   SVPLMVVEN
Sbjct  765  PALNDVTAMELPDIVAEAAKHCDILRRAAESGGLLVDAMTNTLDSPRENSSSVPLMVVEN  824

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADLIILEGMGR LHTN NA+F+CDALKLAMVKNQRLAE
Sbjct  825  GCGSPCIDLRQVSSELAAAAKDADLIILEGMGRALHTNLNARFQCDALKLAMVKNQRLAE  884

Query  362  KLIGGKIYDCVCRYEPA  312
            KLI G IYDC+C+YEPA
Sbjct  885  KLIKGNIYDCICKYEPA  901



>ref|XP_010243061.1| PREDICTED: pantothenate kinase 2 isoform X1 [Nelumbo nucifera]
 ref|XP_010243063.1| PREDICTED: pantothenate kinase 2 isoform X1 [Nelumbo nucifera]
 ref|XP_010243064.1| PREDICTED: pantothenate kinase 2 isoform X1 [Nelumbo nucifera]
Length=908

 Score =   216 bits (550),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 118/136 (87%), Gaps = 0/136 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELP+IVAEAAKHC I R AAEAGGLLVDAM N QD  K    SVPLMVVEN
Sbjct  771  PALNDVTAMELPEIVAEAAKHCDILRKAAEAGGLLVDAMINVQDDSKGNSSSVPLMVVEN  830

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADL+ILEGMGR LHTNFNA FKCDALKLAMVKNQRLAE
Sbjct  831  GCGSPCIDLRQVSSELAAAAKDADLVILEGMGRALHTNFNAHFKCDALKLAMVKNQRLAE  890

Query  362  KLIGGKIYDCVCRYEP  315
            KLI G IY CVCRYEP
Sbjct  891  KLIKGNIYSCVCRYEP  906



>gb|EMT07573.1| Pantothenate kinase 2 [Aegilops tauschii]
Length=832

 Score =   215 bits (547),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 108/136 (79%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALND+TA ELP+IVAEAAKHCGI R AAEAGGL+VDAM   Q   KD P SVPLMVVEN
Sbjct  695  PALNDITANELPEIVAEAAKHCGILRKAAEAGGLIVDAMAGIQGDTKDEPASVPLMVVEN  754

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCID RQVSSELAA  +DADL+ILEGMGR LHTN NA+FKCDALKLAMVKNQRLAE
Sbjct  755  GCGSPCIDFRQVSSELAAAAKDADLLILEGMGRSLHTNLNARFKCDALKLAMVKNQRLAE  814

Query  362  KLIGGKIYDCVCRYEP  315
            KL  G IYDC+C++EP
Sbjct  815  KLFNGNIYDCICKFEP  830



>gb|KFK29830.1| hypothetical protein AALP_AA7G184400 [Arabis alpina]
Length=891

 Score =   215 bits (547),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 113/139 (81%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVA AAKHC I R AAE GGLLVDAM N  DG K    S PLMVVEN
Sbjct  749  PALNDVTAMELPDIVAGAAKHCDILRRAAEMGGLLVDAMVNPGDGSKKDSTSAPLMVVEN  808

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADL+ILEGMGR LHTNF A+FKC+ALKLAMVKNQRLAE
Sbjct  809  GCGSPCIDLRQVSSELAAAAKDADLVILEGMGRALHTNFIAQFKCEALKLAMVKNQRLAE  868

Query  362  KLIGGKIYDCVCRYEPAEL  306
            KLI G IYDCVCRYEP  L
Sbjct  869  KLIKGNIYDCVCRYEPPSL  887



>ref|XP_009403915.1| PREDICTED: pantothenate kinase 2 [Musa acuminata subsp. malaccensis]
 ref|XP_009403916.1| PREDICTED: pantothenate kinase 2 [Musa acuminata subsp. malaccensis]
Length=899

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQ-DGFKDGPVSVPLMVVE  546
            PALNDVTA+ELP+IVAEAAKHC I R AAEAGGLL+DAM + Q DG K+   SV LMV E
Sbjct  758  PALNDVTALELPEIVAEAAKHCDIIRKAAEAGGLLMDAMVSIQEDGLKNHSTSVSLMVAE  817

Query  545  NGCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLA  366
            NG G PCIDLRQVSSELAA  +DADLIILEGMGR +HTN NA FKCD+LKLAMVKNQRLA
Sbjct  818  NGSGGPCIDLRQVSSELAAVAKDADLIILEGMGRAIHTNLNAHFKCDSLKLAMVKNQRLA  877

Query  365  EKLIGGKIYDCVCRYEPAE  309
            EKL  G IYDC+CR+EP +
Sbjct  878  EKLFNGNIYDCICRFEPGK  896



>ref|XP_009126332.1| PREDICTED: pantothenate kinase 2 [Brassica rapa]
Length=910

 Score =   214 bits (546),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 111/136 (82%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVA AAKHC I R AAE GGLLVDAM N  DG K    S PLMVVEN
Sbjct  769  PALNDVTAMELPDIVAGAAKHCDILRRAAEMGGLLVDAMVNPGDGSKKDSTSAPLMVVEN  828

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADL+ILEGMGR LHTNFNA+FKC++LKLAMVKNQRLA+
Sbjct  829  GCGSPCIDLRQVSSELAAAAKDADLVILEGMGRALHTNFNAQFKCESLKLAMVKNQRLAD  888

Query  362  KLIGGKIYDCVCRYEP  315
            KLI G IYDCVCRYEP
Sbjct  889  KLIKGNIYDCVCRYEP  904



>ref|XP_009108890.1| PREDICTED: pantothenate kinase 2 [Brassica rapa]
 emb|CDY61390.1| BnaA08g30620D [Brassica napus]
Length=899

 Score =   214 bits (546),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 112/139 (81%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVA AAKHC I R AAE GGLLVDAM N  DG K+   S PLMVVEN
Sbjct  760  PALNDVTAMELPDIVAGAAKHCDILRRAAEMGGLLVDAMVNPGDGSKNDLTSAPLMVVEN  819

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADL++LEGMGR LHTNFNA+FKC+ALKLAMVKNQRLAE
Sbjct  820  GCGSPCIDLRQVSSELAAAAKDADLVVLEGMGRALHTNFNAQFKCEALKLAMVKNQRLAE  879

Query  362  KLIGGKIYDCVCRYEPAEL  306
            KLI G IYD VCRYEP  L
Sbjct  880  KLINGNIYDSVCRYEPPSL  898



>ref|XP_010678776.1| PREDICTED: pantothenate kinase 2 [Beta vulgaris subsp. vulgaris]
Length=899

 Score =   214 bits (545),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAK+C I R AAEAGGLLVDAM N QD  K+   SVPLMVVEN
Sbjct  762  PALNDVTAMELPDIVAEAAKNCDILRRAAEAGGLLVDAMINIQDNSKEDLPSVPLMVVEN  821

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADLIILEGMGR +HTNFNA+F+CDALKLAMVKNQRLAE
Sbjct  822  GCGSPCIDLRQVSSELAAAAKDADLIILEGMGRAIHTNFNARFRCDALKLAMVKNQRLAE  881

Query  362  KLIGGKIYDCVCRYEPA  312
            KL+ G IYDCVCR+EPA
Sbjct  882  KLLKGNIYDCVCRFEPA  898



>ref|XP_006412505.1| hypothetical protein EUTSA_v10024357mg [Eutrema salsugineum]
 gb|ESQ53958.1| hypothetical protein EUTSA_v10024357mg [Eutrema salsugineum]
Length=901

 Score =   213 bits (543),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVA AAKHC I R AAE GGLLVDAM N  DG K    S PLMVVEN
Sbjct  760  PALNDVTAMELPDIVAGAAKHCDILRRAAEMGGLLVDAMVNPGDGSKKDSTSAPLMVVEN  819

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADL++LEGMGR LHTNFNA+FKC+ALKLAMVKNQRLAE
Sbjct  820  GCGSPCIDLRQVSSELAAAAKDADLVVLEGMGRALHTNFNAQFKCEALKLAMVKNQRLAE  879

Query  362  KLIGGKIYDCVCRYEPAEL  306
            KLI G IYDCVCRYEP  L
Sbjct  880  KLIKGNIYDCVCRYEPPSL  898



>ref|XP_010447428.1| PREDICTED: pantothenate kinase 2 isoform X2 [Camelina sativa]
Length=765

 Score =   212 bits (540),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVA AAKHC I R AAE GGLLVDAM N  DG K    S PLMVVEN
Sbjct  627  PALNDVTAMELPDIVAGAAKHCDILRRAAEMGGLLVDAMVNPGDGSKKDLTSAPLMVVEN  686

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADL++LEGMGR LHTNFNA+FKC+ALKLAMVKNQRLAE
Sbjct  687  GCGSPCIDLRQVSSELAAAAKDADLVVLEGMGRALHTNFNAQFKCEALKLAMVKNQRLAE  746

Query  362  KLIGGKIYDCVCRYEPAEL  306
            KLI G IYDCVCRYEP  L
Sbjct  747  KLIKGNIYDCVCRYEPPSL  765



>ref|XP_003576771.1| PREDICTED: pantothenate kinase 2 [Brachypodium distachyon]
Length=912

 Score =   213 bits (541),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALND+TA ELP IVAEAAKHCGI R AAEAGGL+VDAM   QD  KD PVSVPLMVVEN
Sbjct  760  PALNDITANELPGIVAEAAKHCGILRKAAEAGGLIVDAMAGIQDDAKDEPVSVPLMVVEN  819

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCID RQVSSELAA  +DADL+ILEGMGR LHTN NA+FKCDALKLAMVKNQRLAE
Sbjct  820  GCGSPCIDFRQVSSELAAAAKDADLLILEGMGRALHTNLNARFKCDALKLAMVKNQRLAE  879

Query  362  KLIGGKIYDCVCRYEPAE  309
            KL  G IYDC+C++EP +
Sbjct  880  KLFNGNIYDCICKFEPVD  897



>ref|XP_006840740.1| hypothetical protein AMTR_s00096p00130150 [Amborella trichopoda]
 gb|ERN02415.1| hypothetical protein AMTR_s00096p00130150 [Amborella trichopoda]
Length=919

 Score =   212 bits (540),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 114/138 (83%), Gaps = 1/138 (1%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVP-LMVVE  546
            PALNDVTA ELPDIVAEAAKHC I R AAEAGGLLVDAM + +D   D   S+P LMVVE
Sbjct  777  PALNDVTANELPDIVAEAAKHCDILRKAAEAGGLLVDAMVDCRDVSDDKFCSIPPLMVVE  836

Query  545  NGCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLA  366
            NGCGSPCID RQVSSELA   +DADLIILEGMGR LHTNFNA FK DALKLAMVKNQRLA
Sbjct  837  NGCGSPCIDFRQVSSELATAAKDADLIILEGMGRALHTNFNAHFKFDALKLAMVKNQRLA  896

Query  365  EKLIGGKIYDCVCRYEPA  312
            EKLI G IYD VCRYE A
Sbjct  897  EKLINGNIYDSVCRYEAA  914



>ref|XP_010432761.1| PREDICTED: pantothenate kinase 2-like [Camelina sativa]
Length=902

 Score =   212 bits (540),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVA AAKHC I R AAE GGLLVDAM N  DG K    S PLMVVEN
Sbjct  764  PALNDVTAMELPDIVAGAAKHCDILRRAAEMGGLLVDAMVNPGDGSKKDLTSAPLMVVEN  823

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADL++LEGMGR LHTNFNA+FKC+ALKLAMVKNQRLAE
Sbjct  824  GCGSPCIDLRQVSSELAAAAKDADLVVLEGMGRALHTNFNAQFKCEALKLAMVKNQRLAE  883

Query  362  KLIGGKIYDCVCRYEPAEL  306
            KLI G IYDCVCRYEP  L
Sbjct  884  KLIKGNIYDCVCRYEPPSL  902



>ref|NP_194945.3| pantothenate kinase 2 [Arabidopsis thaliana]
 sp|Q8L5Y9.2|PANK2_ARATH RecName: Full=Pantothenate kinase 2; Short=AtPANK2; AltName: 
Full=Pantothenic acid kinase 2 [Arabidopsis thaliana]
 gb|AEE86015.1| pantothenate kinase 2 [Arabidopsis thaliana]
Length=901

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVA AAKHC I R AAE GGLLVDAM N  DG K    S PLMVVEN
Sbjct  763  PALNDVTAMELPDIVAGAAKHCDILRRAAEMGGLLVDAMVNPGDGSKKDSTSAPLMVVEN  822

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADL++LEGMGR LHTNFNA+F+C+ALKLAMVKNQRLAE
Sbjct  823  GCGSPCIDLRQVSSELAAAAKDADLVVLEGMGRALHTNFNAQFQCEALKLAMVKNQRLAE  882

Query  362  KLIGGKIYDCVCRYEPAEL  306
            KLI G IYDCVCRYEP  L
Sbjct  883  KLIKGNIYDCVCRYEPPSL  901



>ref|XP_010447427.1| PREDICTED: pantothenate kinase 2 isoform X1 [Camelina sativa]
Length=905

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVA AAKHC I R AAE GGLLVDAM N  DG K    S PLMVVEN
Sbjct  767  PALNDVTAMELPDIVAGAAKHCDILRRAAEMGGLLVDAMVNPGDGSKKDLTSAPLMVVEN  826

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADL++LEGMGR LHTNFNA+FKC+ALKLAMVKNQRLAE
Sbjct  827  GCGSPCIDLRQVSSELAAAAKDADLVVLEGMGRALHTNFNAQFKCEALKLAMVKNQRLAE  886

Query  362  KLIGGKIYDCVCRYEPAEL  306
            KLI G IYDCVCRYEP  L
Sbjct  887  KLIKGNIYDCVCRYEPPSL  905



>ref|XP_002867254.1| ATPANK2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43513.1| ATPANK2 [Arabidopsis lyrata subsp. lyrata]
Length=902

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVA AAKHC I R AAE GGLLVDAM N  DG K    S PLMVVEN
Sbjct  764  PALNDVTAMELPDIVAGAAKHCDILRRAAEMGGLLVDAMVNPGDGSKKDSTSAPLMVVEN  823

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADL++LEGMGR LHTNFNA+F+C+ALKLAMVKNQRLAE
Sbjct  824  GCGSPCIDLRQVSSELAAAAKDADLVVLEGMGRALHTNFNAQFQCEALKLAMVKNQRLAE  883

Query  362  KLIGGKIYDCVCRYEPAEL  306
            KLI G IYDCVCRYEP  L
Sbjct  884  KLIKGNIYDCVCRYEPPSL  902



>dbj|BAD33319.1| putative pantothenate kinase 4 [Oryza sativa Japonica Group]
 dbj|BAD46028.1| putative pantothenate kinase 4 [Oryza sativa Japonica Group]
Length=697

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTA ELP IVAEAAKHCGI R AAEAGGL+ DAM   QD  KD PVSVPLMVVEN
Sbjct  560  PALNDVTANELPGIVAEAAKHCGILRKAAEAGGLIFDAMAGIQDDLKDEPVSVPLMVVEN  619

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCID RQVSSELAA  +DADL+ILEGMGR LHTN NA+FKCD LKLAMVKNQRLAE
Sbjct  620  GCGSPCIDFRQVSSELAAAAKDADLLILEGMGRSLHTNLNARFKCDTLKLAMVKNQRLAE  679

Query  362  KLIGGKIYDCVCRYEP  315
            KL  G IYDC+C++EP
Sbjct  680  KLFNGNIYDCICKFEP  695



>gb|ACN39905.1| unknown [Picea sitchensis]
Length=895

 Score =   211 bits (538),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 116/138 (84%), Gaps = 1/138 (1%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVP-LMVVE  546
            PALNDVTA ELP+IVAEAAKHC I R AAEAGGLLVDAM   ++       SVP LMVVE
Sbjct  757  PALNDVTASELPNIVAEAAKHCDILRKAAEAGGLLVDAMVTDREESVQNVSSVPRLMVVE  816

Query  545  NGCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLA  366
            NGCGSPCID RQVSS+LAA   +ADL+ILEGMGR LHTNFNA+FKC+ALKLAMVKNQRLA
Sbjct  817  NGCGSPCIDFRQVSSDLAAAANEADLVILEGMGRALHTNFNARFKCEALKLAMVKNQRLA  876

Query  365  EKLIGGKIYDCVCRYEPA  312
            EK++ G IYDC+CRYEPA
Sbjct  877  EKIVNGNIYDCICRYEPA  894



>ref|NP_001063766.1| Os09g0533100 [Oryza sativa Japonica Group]
 dbj|BAF25680.1| Os09g0533100, partial [Oryza sativa Japonica Group]
Length=755

 Score =   210 bits (535),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTA ELP IVAEAAKHCGI R AAEAGGL+ DAM   QD  KD PVSVPLMVVEN
Sbjct  618  PALNDVTANELPGIVAEAAKHCGILRKAAEAGGLIFDAMAGIQDDLKDEPVSVPLMVVEN  677

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCID RQVSSELAA  +DADL+ILEGMGR LHTN NA+FKCD LKLAMVKNQRLAE
Sbjct  678  GCGSPCIDFRQVSSELAAAAKDADLLILEGMGRSLHTNLNARFKCDTLKLAMVKNQRLAE  737

Query  362  KLIGGKIYDCVCRYEP  315
            KL  G IYDC+C++EP
Sbjct  738  KLFNGNIYDCICKFEP  753



>ref|XP_007138072.1| hypothetical protein PHAVU_009G178200g [Phaseolus vulgaris]
 ref|XP_007138073.1| hypothetical protein PHAVU_009G178200g [Phaseolus vulgaris]
 gb|ESW10066.1| hypothetical protein PHAVU_009G178200g [Phaseolus vulgaris]
 gb|ESW10067.1| hypothetical protein PHAVU_009G178200g [Phaseolus vulgaris]
Length=915

 Score =   210 bits (535),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 118/136 (87%), Gaps = 0/136 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDI+AEAAKHC I R AAE GGLLVDAM N  +  K+   SVPLMVVEN
Sbjct  778  PALNDVTAMELPDIIAEAAKHCDILRRAAEVGGLLVDAMINTSNSSKENSPSVPLMVVEN  837

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADL+ILEGMGR LHTN NA+FKCDALKLAMVKNQRLAE
Sbjct  838  GCGSPCIDLRQVSSELAAAAKDADLLILEGMGRALHTNLNARFKCDALKLAMVKNQRLAE  897

Query  362  KLIGGKIYDCVCRYEP  315
            KL+ G IYDC+C+YEP
Sbjct  898  KLVKGNIYDCICKYEP  913



>gb|EEE70109.1| hypothetical protein OsJ_30119 [Oryza sativa Japonica Group]
Length=872

 Score =   210 bits (535),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTA ELP IVAEAAKHCGI R AAEAGGL+ DAM   QD  KD PVSVPLMVVEN
Sbjct  735  PALNDVTANELPGIVAEAAKHCGILRKAAEAGGLIFDAMAGIQDDLKDEPVSVPLMVVEN  794

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCID RQVSSELAA  +DADL+ILEGMGR LHTN NA+FKCD LKLAMVKNQRLAE
Sbjct  795  GCGSPCIDFRQVSSELAAAAKDADLLILEGMGRSLHTNLNARFKCDTLKLAMVKNQRLAE  854

Query  362  KLIGGKIYDCVCRYEP  315
            KL  G IYDC+C++EP
Sbjct  855  KLFNGNIYDCICKFEP  870



>ref|XP_003601259.1| Pantothenate kinase [Medicago truncatula]
 gb|AES71510.1| pantothenate kinase [Medicago truncatula]
Length=893

 Score =   210 bits (535),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 119/137 (87%), Gaps = 1/137 (1%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I R AAEAGGLLVDAM N  D  K+   SVPLMVVEN
Sbjct  757  PALNDVTAMELPDIVAEAAKHCDILRRAAEAGGLLVDAMINT-DSSKENSSSVPLMVVEN  815

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADLIILEGMGR LHTN  A+FKCDALKLAMVKNQRLAE
Sbjct  816  GCGSPCIDLRQVSSELAAAAKDADLIILEGMGRSLHTNLYAQFKCDALKLAMVKNQRLAE  875

Query  362  KLIGGKIYDCVCRYEPA  312
            KLI G IYDC+C+Y+PA
Sbjct  876  KLIKGNIYDCICKYQPA  892



>gb|EEC84941.1| hypothetical protein OsI_32156 [Oryza sativa Indica Group]
Length=903

 Score =   210 bits (534),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTA ELP IVAEAAKHCGI R AAEAGGL+ DAM   QD  KD PVSVPLMVVEN
Sbjct  766  PALNDVTANELPGIVAEAAKHCGILRKAAEAGGLIFDAMAGIQDDLKDEPVSVPLMVVEN  825

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCID RQVSSELAA  +DADL+ILEGMGR LHTN NA+FKCD LKLAMVKNQRLAE
Sbjct  826  GCGSPCIDFRQVSSELAAAAKDADLLILEGMGRSLHTNLNARFKCDTLKLAMVKNQRLAE  885

Query  362  KLIGGKIYDCVCRYEP  315
            KL  G IYDC+C++EP
Sbjct  886  KLFNGNIYDCICKFEP  901



>ref|XP_004501924.1| PREDICTED: pantothenate kinase 2-like isoform X1 [Cicer arietinum]
 ref|XP_004501925.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Cicer arietinum]
 ref|XP_004501926.1| PREDICTED: pantothenate kinase 2-like isoform X3 [Cicer arietinum]
 ref|XP_004501927.1| PREDICTED: pantothenate kinase 2-like isoform X4 [Cicer arietinum]
Length=910

 Score =   210 bits (534),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 119/137 (87%), Gaps = 1/137 (1%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I R AAEAGGLLVDAM N  D  K+   SVPLMVVEN
Sbjct  774  PALNDVTAMELPDIVAEAAKHCDILRRAAEAGGLLVDAMINT-DSSKENSSSVPLMVVEN  832

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADLIILEGMGR LHTN  A+FKCDALKLAMVKNQRLAE
Sbjct  833  GCGSPCIDLRQVSSELAAAAKDADLIILEGMGRALHTNLYAQFKCDALKLAMVKNQRLAE  892

Query  362  KLIGGKIYDCVCRYEPA  312
            KLI G IYDC+C+Y+PA
Sbjct  893  KLIKGNIYDCICKYQPA  909



>sp|Q0J035.2|PANK2_ORYSJ RecName: Full=Pantothenate kinase 2; AltName: Full=Pantothenic 
acid kinase 2 [Oryza sativa Japonica Group]
Length=904

 Score =   210 bits (534),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTA ELP IVAEAAKHCGI R AAEAGGL+ DAM   QD  KD PVSVPLMVVEN
Sbjct  767  PALNDVTANELPGIVAEAAKHCGILRKAAEAGGLIFDAMAGIQDDLKDEPVSVPLMVVEN  826

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCID RQVSSELAA  +DADL+ILEGMGR LHTN NA+FKCD LKLAMVKNQRLAE
Sbjct  827  GCGSPCIDFRQVSSELAAAAKDADLLILEGMGRSLHTNLNARFKCDTLKLAMVKNQRLAE  886

Query  362  KLIGGKIYDCVCRYEP  315
            KL  G IYDC+C++EP
Sbjct  887  KLFNGNIYDCICKFEP  902



>ref|XP_004957459.1| PREDICTED: pantothenate kinase 2-like [Setaria italica]
Length=897

 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTA ELP+I+AEA+KHCGI R AAEAGGLLVDAM   QD  KD P SVPLMVVEN
Sbjct  760  PALNDVTANELPEIIAEASKHCGILRKAAEAGGLLVDAMAGIQDDLKDAPESVPLMVVEN  819

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCID RQVSSELAA  +DADL+ILEGMGR LHTN NA+FKCDALKLAMVKNQRLAE
Sbjct  820  GCGSPCIDFRQVSSELAAAAKDADLLILEGMGRALHTNLNARFKCDALKLAMVKNQRLAE  879

Query  362  KLIGGKIYDCVCRYEP  315
            KL  G IYD +C++EP
Sbjct  880  KLFNGNIYDSICKFEP  895



>emb|CDX75226.1| BnaA01g04760D [Brassica napus]
Length=910

 Score =   210 bits (534),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVA AAKHC I R AAE GGLLVDAM N  DG K    S PLMVVEN
Sbjct  769  PALNDVTAMELPDIVAGAAKHCDILRRAAEMGGLLVDAMVNPGDGSKKDSTSAPLMVVEN  828

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADL+ILEGMGR LHTNFNA+FKC++LKLAMVKNQRLA+
Sbjct  829  GCGSPCIDLRQVSSELAAAAKDADLVILEGMGRALHTNFNAQFKCESLKLAMVKNQRLAD  888

Query  362  KLIGGKIYDCVCRYEP  315
            KLI G IYDCVCRYEP
Sbjct  889  KLIKGNIYDCVCRYEP  904



>gb|EMS60500.1| Pantothenate kinase 2 [Triticum urartu]
Length=828

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALND+TA ELP+IVAEAAKHCGI R AAEAGGL+VDAM   Q   KD P SVPLMVVEN
Sbjct  691  PALNDITANELPEIVAEAAKHCGILRKAAEAGGLIVDAMAGIQGDTKDEPASVPLMVVEN  750

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCID RQVSSELAA  +DADL+ILEGMGR LHTN NA+FKCDALKLAMVKNQRLAE
Sbjct  751  GCGSPCIDFRQVSSELAAAAKDADLLILEGMGRSLHTNLNARFKCDALKLAMVKNQRLAE  810

Query  362  KLIGGKIYDCVCRYEP  315
            KL  G IYDC+C++EP
Sbjct  811  KLFNGNIYDCICKFEP  826



>ref|XP_008652990.1| PREDICTED: pantothenate kinase 2 [Zea mays]
 ref|XP_008652991.1| PREDICTED: pantothenate kinase 2 [Zea mays]
 ref|XP_008652992.1| PREDICTED: pantothenate kinase 2 [Zea mays]
 ref|XP_008652993.1| PREDICTED: pantothenate kinase 2 [Zea mays]
Length=903

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 118/136 (87%), Gaps = 0/136 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTA ELP+++AEA+KHCGI R AAEAGGL+VDAM   QD  KD  VSVPLMVVEN
Sbjct  766  PALNDVTANELPEVIAEASKHCGILRKAAEAGGLIVDAMAGIQDDLKDETVSVPLMVVEN  825

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCID RQVSSELAA  +DADL+ILEGMGR LHTN NA+FKCDALKLAMVKNQRLAE
Sbjct  826  GCGSPCIDFRQVSSELAAAAKDADLLILEGMGRSLHTNLNARFKCDALKLAMVKNQRLAE  885

Query  362  KLIGGKIYDCVCRYEP  315
            KL  G +YDC+C++EP
Sbjct  886  KLFNGSLYDCICKFEP  901



>ref|XP_010940070.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Elaeis guineensis]
Length=908

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTA ELP+IVAEAAKHC I R AAEAGGLLVDAM + + G  D   SVPLMVVEN
Sbjct  763  PALNDVTANELPEIVAEAAKHCDILRKAAEAGGLLVDAMVSVEHGLVDNSASVPLMVVEN  822

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCG PCID RQVSSELAA  RDADLIILEGMGR LHTNFNA+F+CDALKLAMVKNQRLAE
Sbjct  823  GCGGPCIDFRQVSSELAAAARDADLIILEGMGRALHTNFNARFRCDALKLAMVKNQRLAE  882

Query  362  KLIGGKIYDCVCRYEPA  312
            KL  G IYDCVCR+EP 
Sbjct  883  KLFNGNIYDCVCRFEPT  899



>ref|XP_010940068.1| PREDICTED: pantothenate kinase 2-like isoform X1 [Elaeis guineensis]
 ref|XP_010940069.1| PREDICTED: pantothenate kinase 2-like isoform X1 [Elaeis guineensis]
Length=922

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTA ELP+IVAEAAKHC I R AAEAGGLLVDAM + + G  D   SVPLMVVEN
Sbjct  777  PALNDVTANELPEIVAEAAKHCDILRKAAEAGGLLVDAMVSVEHGLVDNSASVPLMVVEN  836

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCG PCID RQVSSELAA  RDADLIILEGMGR LHTNFNA+F+CDALKLAMVKNQRLAE
Sbjct  837  GCGGPCIDFRQVSSELAAAARDADLIILEGMGRALHTNFNARFRCDALKLAMVKNQRLAE  896

Query  362  KLIGGKIYDCVCRYEPA  312
            KL  G IYDCVCR+EP 
Sbjct  897  KLFNGNIYDCVCRFEPT  913



>ref|XP_002460569.1| hypothetical protein SORBIDRAFT_02g030920 [Sorghum bicolor]
 gb|EER97090.1| hypothetical protein SORBIDRAFT_02g030920 [Sorghum bicolor]
Length=902

 Score =   209 bits (531),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTA ELP+I+AEA+KHC I R AAEAGGL+VDAM   QD  KD PVSVPLMVVEN
Sbjct  765  PALNDVTANELPEIIAEASKHCSILRKAAEAGGLIVDAMAGIQDDLKDEPVSVPLMVVEN  824

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCID RQVSSELAA  +DADL+ILEGMGR LHTN NA FKCDALKLAMVKN+RLAE
Sbjct  825  GCGSPCIDFRQVSSELAAAAKDADLLILEGMGRSLHTNLNAHFKCDALKLAMVKNKRLAE  884

Query  362  KLIGGKIYDCVCRYEP  315
            KL  G IYDC+C++EP
Sbjct  885  KLFNGNIYDCICKFEP  900



>ref|XP_006660887.1| PREDICTED: pantothenate kinase 2-like [Oryza brachyantha]
Length=859

 Score =   206 bits (525),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTA ELP IVAEAAKHCGI R AAEAGGL+ DAM   QD  KD PV VPLMVVEN
Sbjct  722  PALNDVTANELPGIVAEAAKHCGILRKAAEAGGLIFDAMAGIQDDLKDEPVLVPLMVVEN  781

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCID RQVSSELAA  +DADL+ILEGMGR LHTN NA FKCD LKLAMVKNQRLAE
Sbjct  782  GCGSPCIDFRQVSSELAAAAKDADLLILEGMGRALHTNLNAHFKCDTLKLAMVKNQRLAE  841

Query  362  KLIGGKIYDCVCRYEP  315
            KL  G IYDC+C++EP
Sbjct  842  KLFNGNIYDCICKFEP  857



>ref|XP_008782481.1| PREDICTED: pantothenate kinase 2-like [Phoenix dactylifera]
 ref|XP_008782482.1| PREDICTED: pantothenate kinase 2-like [Phoenix dactylifera]
 ref|XP_008782483.1| PREDICTED: pantothenate kinase 2-like [Phoenix dactylifera]
Length=904

 Score =   206 bits (523),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTA ELP+IVAEAAKHC + R AAEAGGLLVDAM +  DG      S+PLMVVEN
Sbjct  764  PALNDVTANELPEIVAEAAKHCDVLRKAAEAGGLLVDAMVSIDDGLVGNSTSIPLMVVEN  823

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCID RQVSSELAA  +DADLIILEGMGR LHTNFNA FKCD LKLAMVKNQRLAE
Sbjct  824  GCGSPCIDFRQVSSELAAAAKDADLIILEGMGRALHTNFNAFFKCDVLKLAMVKNQRLAE  883

Query  362  KLIGGKIYDCVCRYEPA  312
            KL  G IYDCVCR+EP 
Sbjct  884  KLFNGNIYDCVCRFEPG  900



>ref|XP_003542534.2| PREDICTED: pantothenate kinase 2-like isoform X1 [Glycine max]
Length=910

 Score =   205 bits (521),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I R AAEAGGLLVDAM N  D  K    SVPLMVVEN
Sbjct  773  PALNDVTAMELPDIVAEAAKHCDILRRAAEAGGLLVDAMINTSDSSKKNSSSVPLMVVEN  832

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADLIILEGMGR LHTN NA+FK DALKLAMVKNQRLAE
Sbjct  833  GCGSPCIDLRQVSSELAAAAKDADLIILEGMGRALHTNLNARFKRDALKLAMVKNQRLAE  892

Query  362  KLIGGKIYDCVCRYEPA  312
            KL+ G IYDC+C+YEPA
Sbjct  893  KLVKGNIYDCICKYEPA  909



>ref|XP_006594169.1| PREDICTED: pantothenate kinase 2-like isoform X2 [Glycine max]
Length=920

 Score =   205 bits (521),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I R AAEAGGLLVDAM N  D  K    SVPLMVVEN
Sbjct  783  PALNDVTAMELPDIVAEAAKHCDILRRAAEAGGLLVDAMINTSDSSKKNSSSVPLMVVEN  842

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADLIILEGMGR LHTN NA+FK DALKLAMVKNQRLAE
Sbjct  843  GCGSPCIDLRQVSSELAAAAKDADLIILEGMGRALHTNLNARFKRDALKLAMVKNQRLAE  902

Query  362  KLIGGKIYDCVCRYEPA  312
            KL+ G IYDC+C+YEPA
Sbjct  903  KLVKGNIYDCICKYEPA  919



>ref|XP_010936708.1| PREDICTED: pantothenate kinase 2-like [Elaeis guineensis]
Length=903

 Score =   204 bits (520),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 117/136 (86%), Gaps = 1/136 (1%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTA ELP+IVAEAAKHC + R AAEAGGLLVDAM + ++G  D   S+PLMVVEN
Sbjct  764  PALNDVTANELPEIVAEAAKHCDVLRKAAEAGGLLVDAMVSVEEGLVDNS-SIPLMVVEN  822

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCID RQVSSELAA  +DADLIILEGMGR LHTNFNA FKCDALKLAMVKNQRLAE
Sbjct  823  GCGSPCIDFRQVSSELAAAAKDADLIILEGMGRALHTNFNACFKCDALKLAMVKNQRLAE  882

Query  362  KLIGGKIYDCVCRYEP  315
            KL  G IYDCVCR+EP
Sbjct  883  KLFNGNIYDCVCRFEP  898



>gb|KHN48232.1| Pantothenate kinase 2 [Glycine soja]
Length=868

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I R AAEAGGLLVDAM N  D  K+   SVPLMVVEN
Sbjct  731  PALNDVTAMELPDIVAEAAKHCDILRRAAEAGGLLVDAMINTSDSSKENSSSVPLMVVEN  790

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADLIILEGMGR LHTN NA FK DALKLAMVKNQRLAE
Sbjct  791  GCGSPCIDLRQVSSELAAAAKDADLIILEGMGRALHTNLNALFKQDALKLAMVKNQRLAE  850

Query  362  KLIGGKIYDCVCRYEPA  312
            KL+ G IYDC+C+YEPA
Sbjct  851  KLVKGNIYDCICKYEPA  867



>ref|XP_007036235.1| Pantothenate kinase 2 isoform 2, partial [Theobroma cacao]
 gb|EOY20736.1| Pantothenate kinase 2 isoform 2, partial [Theobroma cacao]
Length=919

 Score =   201 bits (512),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVAEAAKHC I R AAEAGGLLVDAMNN  DG K+   SVPLMVVEN
Sbjct  794  PALNDVTAMELPDIVAEAAKHCDILRRAAEAGGLLVDAMNNTLDGSKENASSVPLMVVEN  853

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCIDLRQVSSELAA  +DADLIILEGMGR LHTNFNA+FKC+ALKLAMVKNQRLAE
Sbjct  854  GCGSPCIDLRQVSSELAAAAKDADLIILEGMGRALHTNFNAQFKCEALKLAMVKNQRLAE  913

Query  362  KLIGGK  345
            KLI GK
Sbjct  914  KLIKGK  919



>ref|XP_001757682.1| predicted protein [Physcomitrella patens]
 gb|EDQ77322.1| predicted protein [Physcomitrella patens]
Length=884

 Score =   196 bits (499),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 106/138 (77%), Gaps = 0/138 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P +NDVTA+ELP I+A AAKHC I R AA AGGLLVD +       KD      L VVEN
Sbjct  745  PTINDVTAVELPSIIAAAAKHCEILRKAATAGGLLVDVIVTTDLTEKDQAEVPFLTVVEN  804

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            GCGSPCID RQVSSELA+   D DL++LEGMGR LHTNFNAKFKCD LKLAMVKNQRLAE
Sbjct  805  GCGSPCIDFRQVSSELASLADDTDLVVLEGMGRALHTNFNAKFKCDVLKLAMVKNQRLAE  864

Query  362  KLIGGKIYDCVCRYEPAE  309
            ++I G IYDCVCR+EP E
Sbjct  865  QIINGSIYDCVCRFEPKE  882



>ref|XP_001768632.1| predicted protein [Physcomitrella patens]
 gb|EDQ66570.1| predicted protein [Physcomitrella patens]
Length=700

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 109/139 (78%), Gaps = 9/139 (6%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVP-LMVVE  546
            PA+NDVTA+ELP IV  AAKHC I R AA AGGLL D +   QD      V++P L VVE
Sbjct  568  PAINDVTAVELPSIVVAAAKHCEILRRAATAGGLLFDDL--LQD------VNIPFLTVVE  619

Query  545  NGCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLA  366
            NGCGSPCID RQVSSELA+   D DL++LEGMGR LHTNFNAKFKCD LKLAMVKNQRLA
Sbjct  620  NGCGSPCIDFRQVSSELASLAEDTDLVVLEGMGRALHTNFNAKFKCDVLKLAMVKNQRLA  679

Query  365  EKLIGGKIYDCVCRYEPAE  309
            +++I G IYDCVCR+EP E
Sbjct  680  QQIISGSIYDCVCRFEPKE  698



>ref|XP_002991207.1| hypothetical protein SELMODRAFT_161467 [Selaginella moellendorffii]
 gb|EFJ07751.1| hypothetical protein SELMODRAFT_161467 [Selaginella moellendorffii]
Length=711

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 103/135 (76%), Gaps = 1/135 (1%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PA+NDVT MELP +VA AA HC I R AA AGG+L++A  +  D       +  LMVV++
Sbjct  573  PAINDVTYMELPTVVAAAATHCSILREAAIAGGVLLNA-TSLDDRSATTSTAPRLMVVQS  631

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G GSPC+D RQVSSELA    +ADLI+LEGMGR LHTN++A+F C+ALKLAMVKNQRLAE
Sbjct  632  GSGSPCLDFRQVSSELAILAEEADLIVLEGMGRSLHTNYDARFTCEALKLAMVKNQRLAE  691

Query  362  KLIGGKIYDCVCRYE  318
            KL  G IYDC+CRYE
Sbjct  692  KLFNGAIYDCICRYE  706



>ref|XP_002991270.1| hypothetical protein SELMODRAFT_269774 [Selaginella moellendorffii]
 gb|EFJ07698.1| hypothetical protein SELMODRAFT_269774 [Selaginella moellendorffii]
Length=696

 Score =   176 bits (445),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 103/135 (76%), Gaps = 1/135 (1%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PA+NDVT MELP +VA AA HC I R AA AGG+L+++  +  D       +  LMVV++
Sbjct  558  PAINDVTYMELPTVVAAAATHCSILREAAIAGGVLLNS-TSLDDRSATTSTAPRLMVVQS  616

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G GSPC+D RQVSSELA    +ADLI+LEGMGR LHTN++A+F C+ALKLAMVKNQRLAE
Sbjct  617  GSGSPCLDFRQVSSELAILAEEADLIVLEGMGRSLHTNYDARFTCEALKLAMVKNQRLAE  676

Query  362  KLIGGKIYDCVCRYE  318
            KL  G IYDC+CRYE
Sbjct  677  KLFNGAIYDCICRYE  691



>ref|XP_002320020.2| hypothetical protein POPTR_0014s01415g [Populus trichocarpa]
 gb|EEE98335.2| hypothetical protein POPTR_0014s01415g [Populus trichocarpa]
Length=134

 Score =   154 bits (388),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 97/134 (72%), Gaps = 4/134 (3%)
 Frame = -2

Query  698  MELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVENGCGSPCID  519
            MELP I AEAAK+C + R AAEAGGLLVDAM    DG K+    VPLMVVENGCGSPCID
Sbjct  1    MELPGIAAEAAKYCDVRRRAAEAGGLLVDAMTGTSDGSKENSSPVPLMVVENGCGSPCID  60

Query  518  LRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFK----CDALKLAMVKNQRLAEKLIG  351
            + Q SSELAA  +DADLIILEGMGR LH NFN + K       ++L MVK +RLA K I 
Sbjct  61   MMQGSSELAAAAKDADLIILEGMGRALHMNFNGRSKLCVQISFMQLVMVKKKRLAAKSIK  120

Query  350  GKIYDCVCRYEPAE  309
            G IYDCVCRYE A 
Sbjct  121  GNIYDCVCRYEAAS  134



>pir||T05410 hypothetical protein F10M6.180 - Arabidopsis thaliana
 emb|CAA16972.1| putative protein [Arabidopsis thaliana]
 emb|CAB79936.1| putative protein [Arabidopsis thaliana]
Length=838

 Score =   162 bits (409),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 86/110 (78%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVA AAKHC I R AAE GGLLVDAM N  DG K    S PLMVVEN
Sbjct  729  PALNDVTAMELPDIVAGAAKHCDILRRAAEMGGLLVDAMVNPGDGSKKDSTSAPLMVVEN  788

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKL  393
            GCGSPCIDLRQVSSELAA  +DADL++LEGMGR LHTNFNA+F+C+ALK+
Sbjct  789  GCGSPCIDLRQVSSELAAAAKDADLVVLEGMGRALHTNFNAQFQCEALKV  838



>ref|XP_003056202.1| pantothenate kinase [Micromonas pusilla CCMP1545]
 gb|EEH59578.1| pantothenate kinase [Micromonas pusilla CCMP1545]
Length=928

 Score =   142 bits (358),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 72/136 (53%), Positives = 90/136 (66%), Gaps = 7/136 (5%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PA+NDVTA EL ++V  AA++C     A  A       + ++ +     P  + L V  N
Sbjct  796  PAINDVTAQELREVVHLAAENCKTLTLALSA------HLRSSDNASLVKPSGI-LTVCAN  848

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G GSPC+D R+VS EL      ADLI+LEGMGR +HTNFNA F CD LKLAM+KN RLAE
Sbjct  849  GSGSPCLDFRRVSLELCKAAEGADLIVLEGMGRAIHTNFNAIFHCDTLKLAMIKNSRLAE  908

Query  362  KLIGGKIYDCVCRYEP  315
            KL GGK+YDCVC++EP
Sbjct  909  KLFGGKVYDCVCKFEP  924



>ref|XP_005849803.1| hypothetical protein CHLNCDRAFT_34679 [Chlorella variabilis]
 gb|EFN57701.1| hypothetical protein CHLNCDRAFT_34679 [Chlorella variabilis]
Length=815

 Score =   139 bits (350),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 93/135 (69%), Gaps = 5/135 (4%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PA+ND+TA EL  +VA+AA+ C I R A +A          A +G +  PV   L +V +
Sbjct  681  PAINDITAGELRSVVAKAAEACPIIRAARDAA-----VTAEAANGGRVPPVPGSLFIVAS  735

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G GSPC+DLR+VSSE+A      DL+++EGMGR +HTN+ A FKCDALKL+M+KNQ LAE
Sbjct  736  GHGSPCLDLRRVSSEVADAAAGTDLVVIEGMGRSVHTNWGALFKCDALKLSMIKNQHLAE  795

Query  362  KLIGGKIYDCVCRYE  318
             L GG  ++CVCR++
Sbjct  796  TLFGGNSFECVCRFD  810



>ref|XP_002507494.1| pantothenate kinase [Micromonas sp. RCC299]
 gb|ACO68752.1| pantothenate kinase [Micromonas sp. RCC299]
Length=940

 Score =   129 bits (324),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 85/139 (61%), Gaps = 14/139 (10%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSV---PLMV  552
            PA+NDVTA E+ D++  AA  C I   A   G            G + G +S     L V
Sbjct  805  PAINDVTADEMRDVLRRAAHMCEIVSSAIARG-----------HGKESGNISNDVGKLTV  853

Query  551  VENGCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQR  372
              +G GSPC+D R+VS +L    R  DLI+LEGMGR +HTN+ AKF CD LKLAM+KN R
Sbjct  854  CASGSGSPCLDFRRVSHDLCEATRGVDLIVLEGMGRAVHTNWKAKFCCDTLKLAMIKNSR  913

Query  371  LAEKLIGGKIYDCVCRYEP  315
            LA+ L  GKIYDCVC +EP
Sbjct  914  LAKSLFQGKIYDCVCMFEP  932



>pir||T04627 hypothetical protein F10N7.10 - Arabidopsis thaliana  (fragment)
 emb|CAA16571.1| hypothetical protein [Arabidopsis thaliana]
Length=233

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVTAMELPDIVA AAKHC I R AAE GGLLVDAM N  DG K    S PLMVVEN
Sbjct  139  PALNDVTAMELPDIVAGAAKHCDILRRAAEMGGLLVDAMVNPGDGSKKDSTSAPLMVVEN  198

Query  542  GCGSPCIDLRQVSSE  498
            GCGSPCIDLRQVSSE
Sbjct  199  GCGSPCIDLRQVSSE  213



>ref|XP_007512793.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17393.1| predicted protein [Bathycoccus prasinos]
Length=1064

 Score =   125 bits (315),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 66/141 (47%), Positives = 91/141 (65%), Gaps = 6/141 (4%)
 Frame = -2

Query  722   PALNDVTAMELPDIVAEAAKHCG-IXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVE  546
             PALNDVTA EL  ++  AA+ CG I + A     L  D     +   ++   +  L VV 
Sbjct  923   PALNDVTADELSSLLDRAAETCGGILKSA-----LYFDEDEKEEAPREEERATAKLSVVS  977

Query  545   NGCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLA  366
             +G G PCIDLR+ S EL     + DL++LEGMGR +HTN+NA+F CD+LKLAM+KN RLA
Sbjct  978   SGNGGPCIDLRRASRELIEASENVDLVVLEGMGRAVHTNYNAEFVCDSLKLAMIKNARLA  1037

Query  365   EKLIGGKIYDCVCRYEPAELK  303
             E+L  G+++DCV R++  + K
Sbjct  1038  ERLCRGEMFDCVVRFDDPKKK  1058



>ref|XP_001692949.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP03518.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=673

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 92/137 (67%), Gaps = 2/137 (1%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLL--VDAMNNAQDGFKDGPVSVPLMVV  549
            PA+ND+TA EL  ++A AA+ C + + A EA   +    A++ A         SVPL VV
Sbjct  537  PAINDITAPELRSLLAAAAESCPLLKAAREAAVKVRVPAAVDAAPASPPSASASVPLYVV  596

Query  548  ENGCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
             NG GSPC+DLR++  +LA      DL++LEGMGR +HTNF A+F CD LKLAM+K +RL
Sbjct  597  ANGQGSPCLDLRRIPDKLAEACVGVDLLVLEGMGRAVHTNFKARFTCDVLKLAMIKTERL  656

Query  368  AEKLIGGKIYDCVCRYE  318
            A+KL GG +YDCVC ++
Sbjct  657  AQKLFGGNLYDCVCVFD  673



>ref|XP_005649526.1| fumble-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE24982.1| fumble-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=890

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 79/136 (58%), Gaps = 26/136 (19%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PA+ND+TA EL  ++ + A  C +                          +   L V  N
Sbjct  777  PAINDITAPELRALLNQVAAVCPV--------------------------IKARLYVCGN  810

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G GSPC+DLR+V   LA      DL+++EGMGR +HTN+ +KFKC +LKLAM+KNQ LAE
Sbjct  811  GQGSPCLDLRRVPEALADATVGTDLVVVEGMGRAIHTNYRSKFKCASLKLAMIKNQHLAE  870

Query  362  KLIGGKIYDCVCRYEP  315
            +L GG +YDCVC YEP
Sbjct  871  RLFGGNVYDCVCLYEP  886



>ref|XP_002951581.1| hypothetical protein VOLCADRAFT_61514 [Volvox carteri f. nagariensis]
 gb|EFJ47392.1| hypothetical protein VOLCADRAFT_61514 [Volvox carteri f. nagariensis]
Length=842

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 87/142 (61%), Gaps = 2/142 (1%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PA+ND+TA EL  +++ AA  C + + A EA   +  A+       +       L VV N
Sbjct  697  PAINDITAPELRALLSTAAAVCPVIKAAREAA--IKPAVAGPLGHRQQQQQQGALYVVAN  754

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G GSPC+DLR+V   L       DL+++EGMGR +HTN NAKF CD LKLAM+K +RLA+
Sbjct  755  GQGSPCLDLRRVPDRLGEACVGVDLLVIEGMGRAIHTNLNAKFTCDVLKLAMIKTERLAK  814

Query  362  KLIGGKIYDCVCRYEPAELKAA  297
            KL  G +YDCVC ++  ++  A
Sbjct  815  KLFNGALYDCVCIFDQVKVNDA  836



>gb|KDD72143.1| hypothetical protein H632_c3796p0 [Helicosporidium sp. ATCC 50920]
Length=98

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 64/83 (77%), Gaps = 1/83 (1%)
 Frame = -2

Query  560  LMVVENGCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVK  381
            L +V +G GSPC+DLR++S +LA     ADL+++EGMGR LHTN++ +  C  LKLAM+K
Sbjct  15   LFIVSSGSGSPCLDLRRISCDLADAATGADLVVIEGMGRALHTNYHTRLSCHTLKLAMLK  74

Query  380  NQRLAEKLIGGKIYDCVCRYEPA  312
            N  LA K+ GGK+YDC+CR++PA
Sbjct  75   NAHLA-KMFGGKVYDCICRFDPA  96



>ref|XP_011395801.1| Pantothenate kinase 2 [Auxenochlorella protothecoides]
 gb|KFM22935.1| Pantothenate kinase 2 [Auxenochlorella protothecoides]
Length=951

 Score =   116 bits (291),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 51/87 (59%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -2

Query  560  LMVVENGCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVK  381
            L +V +G GSPC+DLR+VS+E+A     ADL+++EGMGR LHTN++ +F+C ALKLAM+K
Sbjct  858  LYIVSSGHGSPCLDLRRVSAEVAEAAVGADLVVIEGMGRALHTNYHTRFRCAALKLAMLK  917

Query  380  NQRLAEKLIGGKIYDCVCRYEPAELKA  300
            N  LAE+L GGK+YDC+CRY+PA +++
Sbjct  918  NAHLAERLFGGKVYDCICRYDPAPVQS  944



>ref|XP_003078604.1| eukaryotic pantothenate kinase family protein (ISS) [Ostreococcus 
tauri]
 emb|CAL51484.1| Type II pantothenate kinase [Ostreococcus tauri]
Length=901

 Score =   116 bits (290),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 69/141 (49%), Positives = 88/141 (62%), Gaps = 23/141 (16%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PA+ND+TA EL  ++          R AA     L DA+ +             L VV +
Sbjct  779  PAINDITANELEVVL----------RSAASLDLCLSDAITSGA-----------LSVVSS  817

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G GSPC+D R++S++     RDADLIILEGMGR +HTN+ AKF CD LKLAM+KNQRLAE
Sbjct  818  GSGSPCLDFRRLSNDACVAARDADLIILEGMGRAIHTNYRAKFACDTLKLAMIKNQRLAE  877

Query  362  KLIG--GKIYDCVCRYEPAEL  306
            +LIG  G ++DCV R+EP  L
Sbjct  878  QLIGPKGAMWDCVARFEPGSL  898



>ref|XP_001417152.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95445.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=772

 Score =   111 bits (277),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 61/139 (44%), Positives = 81/139 (58%), Gaps = 23/139 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PA+ND+TA EL  I+            A ++G L V +  +                   
Sbjct  655  PAINDITATELTGILQATKSLDSQLEIAIDSGALSVVSSGSG------------------  696

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
               SPC+D R++S+E     RDADLI+LEGMGR +HTN+ A+F CD +KLAM+KNQRLAE
Sbjct  697  ---SPCLDFRRLSNEACVAARDADLIVLEGMGRAIHTNYRAQFSCDTIKLAMIKNQRLAE  753

Query  362  KLIG--GKIYDCVCRYEPA  312
            KL G  G+I+DCV R+E A
Sbjct  754  KLFGPRGEIWDCVVRFEAA  772



>ref|XP_001749703.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ85512.1| predicted protein [Monosiga brevicollis MX1]
Length=1322

 Score =   111 bits (278),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 54/109 (50%), Positives = 75/109 (69%), Gaps = 1/109 (1%)
 Frame = -2

Query  638   AEAGGLLVDAMNNAQDGFKDGPVSVPLMVVENGCGSPCIDLRQVSSELAAXXRDADLIIL  459
             AE   LL+D +    +  ++      L V+ENG GSPCIDL +V  ELA   +DADL+++
Sbjct  1207  AEELRLLLDLVATKDETIRNAWSDGRLCVMENGSGSPCIDLSRVHRELAEASQDADLVVI  1266

Query  458   EGMGRXLHTNFNAKFKCDALKLAMVKNQRLAEKLIGGKIYDCVCRYEPA  312
             EGMGR LHTN++A+F+CD LKLAM+KN  LA++L    +YD VCR++ A
Sbjct  1267  EGMGRALHTNWDARFRCDVLKLAMIKNAWLAKRL-NANMYDVVCRFDEA  1314



>gb|EYU38044.1| hypothetical protein MIMGU_mgv1a0084892mg, partial [Erythranthe 
guttata]
Length=132

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 79/135 (59%), Gaps = 23/135 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+A+     G   G        VD  N              L++  +
Sbjct  9    PSINDVTYTELIEIIAKLKDENGKLLG--------VDTSN--------------LLIANS  46

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS EL+    D DL++LEGMGR L TN  A+FKCD+LK+AMVK+Q +A+
Sbjct  47   GNDLPVIDLTRVSQELSYLASDTDLVVLEGMGRGLETNLYAQFKCDSLKIAMVKHQEVAQ  106

Query  362  KLIGGKIYDCVCRYE  318
              +GG++YDCV +Y+
Sbjct  107  -FLGGRLYDCVIKYD  120



>ref|XP_001619295.1| hypothetical protein NEMVEDRAFT_v1g151759 [Nematostella vectensis]
 gb|EDO27195.1| predicted protein, partial [Nematostella vectensis]
Length=278

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 84/135 (62%), Gaps = 22/135 (16%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDV   EL  ++   AK C   + A ++G L+  A                     +
Sbjct  157  PALNDVMHGELVILIERLAKLCPALKSAVKSGRLVAMA---------------------S  195

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G GSPC+DLR++ ++LAA   +A+L++LEGMGR +HTNF+A+F CD++KLA++KN+ LAE
Sbjct  196  GVGSPCLDLRRIDADLAASCAEAELVLLEGMGRRIHTNFHARFTCDSIKLAVIKNRWLAE  255

Query  362  KLIGGKIYDCVCRYE  318
            +L GG +Y  V ++E
Sbjct  256  RL-GGNMYSVVFKFE  269



>gb|EFN73794.1| Pantothenate kinase 4 [Camponotus floridanus]
Length=781

 Score =   107 bits (268),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 63/142 (44%), Positives = 85/142 (60%), Gaps = 24/142 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVT  EL   + +AAK C + + A E   L+  AM  AQ G               
Sbjct  628  PALNDVTYPELVVTLRDAAKICNVIKQALEDNTLI--AMETAQAG---------------  670

Query  542  GCGSPCIDLRQVSSEL--AAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
                PC+DL +++ +L  A    + DLI++EGMGR LHTNF+AK KCD LKLA+VKN+ L
Sbjct  671  ----PCLDLSRLNLDLCLAMVKHNVDLIVIEGMGRTLHTNFHAKMKCDCLKLAVVKNRWL  726

Query  368  AEKLIGGKIYDCVCRYEPAELK  303
            A +L GG +Y  +C+YEP++ K
Sbjct  727  ALRL-GGDMYAVICKYEPSKTK  747



>ref|XP_011264108.1| PREDICTED: LOW QUALITY PROTEIN: pantothenate kinase 4 [Camponotus 
floridanus]
Length=831

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 63/142 (44%), Positives = 85/142 (60%), Gaps = 24/142 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVT  EL   + +AAK C + + A E   L+  AM  AQ G               
Sbjct  665  PALNDVTYPELVVTLRDAAKICNVIKQALEDNTLI--AMETAQAG---------------  707

Query  542  GCGSPCIDLRQVSSEL--AAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
                PC+DL +++ +L  A    + DLI++EGMGR LHTNF+AK KCD LKLA+VKN+ L
Sbjct  708  ----PCLDLSRLNLDLCLAMVKHNVDLIVIEGMGRTLHTNFHAKMKCDCLKLAVVKNRWL  763

Query  368  AEKLIGGKIYDCVCRYEPAELK  303
            A +L GG +Y  +C+YEP++ K
Sbjct  764  ALRL-GGDMYAVICKYEPSKTK  784



>ref|XP_002078206.1| GD23321 [Drosophila simulans]
 gb|EDX03791.1| GD23321 [Drosophila simulans]
Length=361

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 80/139 (58%), Gaps = 23/139 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVT+ EL  ++ + ++ C +   A   G LLV A                     N
Sbjct  241  PALNDVTSEELRSLLDDCSRECEVLEQAWSQGQLLVYA---------------------N  279

Query  542  GCGSPCIDLRQVSSEL--AAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
            G  SPC+D+R +  EL  A    + DL+++EGMGR LHTN NA+F C+ LKLA++KN+ L
Sbjct  280  GQTSPCLDMRTLPKELCDAIAANETDLLVIEGMGRALHTNLNARFGCETLKLAVIKNKWL  339

Query  368  AEKLIGGKIYDCVCRYEPA  312
            A+ L G  ++  VC++EPA
Sbjct  340  AKYLGGEDMFAVVCKFEPA  358



>ref|XP_002037921.1| GM18528 [Drosophila sechellia]
 gb|EDW54339.1| GM18528 [Drosophila sechellia]
Length=361

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 80/139 (58%), Gaps = 23/139 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVT+ EL  ++ + ++ C +   A   G LLV A                     N
Sbjct  241  PALNDVTSEELRSLLDDCSRECEVLEQAWSQGQLLVYA---------------------N  279

Query  542  GCGSPCIDLRQVSSEL--AAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
            G  SPC+D+R +  EL  A    + DL+++EGMGR LHTN NA+F C+ LKLA++KN+ L
Sbjct  280  GQTSPCLDMRTLPKELCDAIAANETDLLVIEGMGRALHTNLNARFGCETLKLAVIKNKWL  339

Query  368  AEKLIGGKIYDCVCRYEPA  312
            A+ L G  ++  VC++EPA
Sbjct  340  AKYLGGEDMFAVVCKFEPA  358



>ref|XP_011187412.1| PREDICTED: pantothenate kinase 4 [Bactrocera cucurbitae]
Length=363

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 80/139 (58%), Gaps = 24/139 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P+LNDVT+ EL +++ +   HC +   A +   LLV A                     N
Sbjct  246  PSLNDVTSGELTELLDQCCIHCSVLAKARQEQNLLVYA---------------------N  284

Query  542  GCGSPCIDLRQVSSEL--AAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
            G   PC+D+R + SEL  A    + DL+++EGMGR LHTN  AKFKC+ LKLA++KN+ L
Sbjct  285  GQSGPCLDMRTLPSELCDAIQKHETDLLVIEGMGRTLHTNLYAKFKCETLKLAVIKNKWL  344

Query  368  AEKLIGGKIYDCVCRYEPA  312
            AE+L GG  +  +C+YE A
Sbjct  345  AERL-GGDTFAVMCKYEDA  362



>ref|XP_008472729.1| PREDICTED: pantothenate kinase 4 [Diaphorina citri]
Length=610

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 82/136 (60%), Gaps = 22/136 (16%)
 Frame = -2

Query  725  SPALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVE  546
            +PALNDVT  EL  ++ +AA  C I   A  +G L+  AM  AQ G              
Sbjct  495  APALNDVTYSELVVLLRQAATVCHIIANALSSGRLV--AMETAQAG--------------  538

Query  545  NGCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLA  366
                 PC+DL ++  +LA      DLI+LEGMGR +HTN NAKF C++LKLA++KN+ LA
Sbjct  539  -----PCLDLSRLGRDLATELSSIDLIVLEGMGRTVHTNLNAKFTCESLKLAVIKNRWLA  593

Query  365  EKLIGGKIYDCVCRYE  318
            ++L GG+++  VC+YE
Sbjct  594  QRL-GGQMFSVVCKYE  608



>ref|XP_011200749.1| PREDICTED: pantothenate kinase 4 [Bactrocera dorsalis]
Length=363

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 79/139 (57%), Gaps = 24/139 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P+LNDVT+ EL +++ +   HC +   A +   LLV A                     N
Sbjct  246  PSLNDVTSGELSELLDKCCIHCSVLAKAKQEQNLLVYA---------------------N  284

Query  542  GCGSPCIDLRQVSSEL--AAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
            G   PC+D+R + SEL  A    + DL+++EGMGR LHTN  AKFKC+ LKLA++KN+ L
Sbjct  285  GQSGPCLDMRTLPSELCDAIQKHETDLLVIEGMGRTLHTNLYAKFKCETLKLAVIKNKWL  344

Query  368  AEKLIGGKIYDCVCRYEPA  312
            AE L GG  +  +C+YE A
Sbjct  345  AEHL-GGDTFAVICKYEDA  362



>ref|NP_608907.1| CG5828, isoform A [Drosophila melanogaster]
 ref|NP_001260085.1| CG5828, isoform B [Drosophila melanogaster]
 gb|AAF52219.1| CG5828, isoform A [Drosophila melanogaster]
 gb|ACL87102.1| CG5828-PA, partial [synthetic construct]
 gb|AGB92621.1| CG5828, isoform B [Drosophila melanogaster]
Length=361

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 79/139 (57%), Gaps = 23/139 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVT+ EL  ++ + ++ C +   A   G LLV A                     N
Sbjct  241  PALNDVTSEELKSLLDDCSRECEVLEQAWSKGQLLVYA---------------------N  279

Query  542  GCGSPCIDLRQVSSEL--AAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
            G   PC+D+R +  EL  A    + DL+++EGMGR LHTN NA+F C+ LKLA++KN+ L
Sbjct  280  GQTGPCLDMRTLPKELCDAIAANETDLLVIEGMGRALHTNLNARFGCETLKLAVIKNKWL  339

Query  368  AEKLIGGKIYDCVCRYEPA  312
            A+ L G  ++  VC++EPA
Sbjct  340  AKYLGGEDMFAVVCKFEPA  358



>ref|XP_001968771.1| GG25052 [Drosophila erecta]
 gb|EDV57830.1| GG25052 [Drosophila erecta]
Length=361

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 79/139 (57%), Gaps = 23/139 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVT+ EL  ++ + ++ C +   A   G LLV A                     N
Sbjct  241  PALNDVTSEELRSLLDDCSRECEVLEHAWSKGQLLVYA---------------------N  279

Query  542  GCGSPCIDLRQVSSEL--AAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
            G   PC+D+R +  EL  A    + DL+++EGMGR LHTN NA+F C+ LKLA++KN+ L
Sbjct  280  GQTGPCLDMRTLPKELCDAIAANETDLLVIEGMGRALHTNLNARFGCETLKLAVIKNKWL  339

Query  368  AEKLIGGKIYDCVCRYEPA  312
            A+ L G  ++  VC++EPA
Sbjct  340  AKYLGGENMFAVVCKFEPA  358



>gb|AAM52026.1| RE73673p [Drosophila melanogaster]
Length=389

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 79/139 (57%), Gaps = 23/139 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVT+ EL  ++ + ++ C +   A   G LLV A                     N
Sbjct  269  PALNDVTSEELKSLLDDCSRECEVLEQAWSKGQLLVYA---------------------N  307

Query  542  GCGSPCIDLRQVSSEL--AAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
            G   PC+D+R +  EL  A    + DL+++EGMGR LHTN NA+F C+ LKLA++KN+ L
Sbjct  308  GQTGPCLDMRTLPKELCDAIAANETDLLVIEGMGRALHTNLNARFGCETLKLAVIKNKWL  367

Query  368  AEKLIGGKIYDCVCRYEPA  312
            A+ L G  ++  VC++EPA
Sbjct  368  AKYLGGEDMFAVVCKFEPA  386



>ref|XP_005184448.1| PREDICTED: pantothenate kinase 4 [Musca domestica]
Length=364

 Score =   102 bits (253),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 73/136 (54%), Gaps = 22/136 (16%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P+LNDVT  EL  I+   + HC I                      K+   S  L +  N
Sbjct  248  PSLNDVTISELSSILDTCSCHCAI---------------------IKEARTSKRLTIQGN  286

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   PC+D+R +  EL     + DL+++EGMGR LHTN  A F C+ LKLA+VKN+ LA+
Sbjct  287  GQKGPCLDMRTLPQELCNALNETDLLVIEGMGRALHTNLYASFNCETLKLAVVKNKWLAQ  346

Query  362  KLIGGKIYDCVCRYEP  315
            +L GG  +  +CRYEP
Sbjct  347  RL-GGDTFSVICRYEP  361



>ref|XP_011052880.1| PREDICTED: pantothenate kinase 4 isoform X2 [Acromyrmex echinatior]
Length=768

 Score =   104 bits (259),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 65/159 (41%), Positives = 88/159 (55%), Gaps = 26/159 (16%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVT  EL   + +AAK C + R A E   L+  AM  AQ G               
Sbjct  605  PALNDVTYPELVVTLRDAAKICNVIRQALEDNTLI--AMETAQAG---------------  647

Query  542  GCGSPCIDLRQVSSEL--AAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
                PC+D  +++ +L  A    + DLI++EGMGR LHTNFNAK KC+ LKLA++KN+ L
Sbjct  648  ----PCLDFSRLNLDLCLAMVEHNVDLIVIEGMGRTLHTNFNAKMKCECLKLAIIKNRWL  703

Query  368  AEKLIGGKIYDCVCRYEPAELKAAA*DVFFL--ELKKGC  258
            A +L GG +Y  +C+YE +  K    D+      +K GC
Sbjct  704  ALRL-GGDMYAVICKYEQSSSKTKIYDIEIKPEAIKDGC  741



>ref|XP_002001690.1| GI16988 [Drosophila mojavensis]
 gb|EDW11132.1| GI16988 [Drosophila mojavensis]
Length=359

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 79/137 (58%), Gaps = 23/137 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P+LNDVT+ EL +++ + A  C +   A  +G LLV A                     N
Sbjct  242  PSLNDVTSRELSELLDDCACQCDVLDSAWRSGRLLVYA---------------------N  280

Query  542  GCGSPCIDLRQVSSEL--AAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
            G   PC+D+R +  EL  A    + DL+++EGMGR LHTN NA+F C+ LKLA+VKN+ L
Sbjct  281  GQSGPCLDMRTLPRELCDAIAANETDLLVIEGMGRALHTNLNAQFACETLKLAVVKNRWL  340

Query  368  AEKLIGGKIYDCVCRYE  318
            A+ L G K++  +C+YE
Sbjct  341  AKYLGGDKMFAVICKYE  357



>ref|XP_001989026.1| GH11492 [Drosophila grimshawi]
 gb|EDW03893.1| GH11492 [Drosophila grimshawi]
Length=370

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 81/137 (59%), Gaps = 22/137 (16%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P+LNDVT++EL  ++ E A  C I          L  A  ++Q           L+V  N
Sbjct  251  PSLNDVTSVELSLLLDECACECSI----------LAHAWLHSQ----------RLLVYAN  290

Query  542  GCGSPCIDLRQVSSEL--AAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
            G   PC+D+R +  EL  A    + DL+++EGMGR LHTN NA+FKC+ LKLA+VKN+ L
Sbjct  291  GQSGPCLDMRTLPRELCDAITANETDLLVIEGMGRALHTNLNAQFKCETLKLAVVKNRWL  350

Query  368  AEKLIGGKIYDCVCRYE  318
            A+ L G K++  +C+YE
Sbjct  351  AKYLGGDKMFPVICKYE  367



>ref|XP_011052879.1| PREDICTED: pantothenate kinase 4 isoform X1 [Acromyrmex echinatior]
 gb|EGI66382.1| Pantothenate kinase 4 [Acromyrmex echinatior]
Length=808

 Score =   103 bits (258),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 65/159 (41%), Positives = 88/159 (55%), Gaps = 26/159 (16%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVT  EL   + +AAK C + R A E   L+  AM  AQ G               
Sbjct  645  PALNDVTYPELVVTLRDAAKICNVIRQALEDNTLI--AMETAQAG---------------  687

Query  542  GCGSPCIDLRQVSSEL--AAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
                PC+D  +++ +L  A    + DLI++EGMGR LHTNFNAK KC+ LKLA++KN+ L
Sbjct  688  ----PCLDFSRLNLDLCLAMVEHNVDLIVIEGMGRTLHTNFNAKMKCECLKLAIIKNRWL  743

Query  368  AEKLIGGKIYDCVCRYEPAELKAAA*DVFFL--ELKKGC  258
            A +L GG +Y  +C+YE +  K    D+      +K GC
Sbjct  744  ALRL-GGDMYAVICKYEQSSSKTKIYDIEIKPEAIKDGC  781



>ref|XP_004531491.1| PREDICTED: pantothenate kinase 4-like [Ceratitis capitata]
Length=363

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 78/139 (56%), Gaps = 24/139 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P+LNDVT  EL D++ +A  HC +   A +   LL+ A                     N
Sbjct  246  PSLNDVTNRELTDLLIKACTHCSVLAKARQEETLLLYA---------------------N  284

Query  542  GCGSPCIDLRQVSSEL--AAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
            G   PC+D+R + S L  A    + DL+++EGMGR +HTN  AKF C+ LKLA++KN+ L
Sbjct  285  GQSGPCLDMRSLPSALCDAIQEHETDLLVIEGMGRTVHTNLYAKFTCETLKLAVIKNKWL  344

Query  368  AEKLIGGKIYDCVCRYEPA  312
            AE+L GG  +  +C+YE A
Sbjct  345  AERL-GGDTFAIICKYEDA  362



>ref|XP_005645866.1| hypothetical protein COCSUDRAFT_53962 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21322.1| hypothetical protein COCSUDRAFT_53962 [Coccomyxa subellipsoidea 
C-169]
Length=377

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 82/134 (61%), Gaps = 22/134 (16%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++ND+TA EL           G+ + AA +  +L  A+N              L VV +
Sbjct  259  PSINDITADELQ----------GVVQRAAPSDAILGRALNEQM-----------LTVVPS  297

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDLR+VS+E+ +   DADLI+LEGMGR + TN +A+F  D+LKL M+K+Q +A+
Sbjct  298  GNDLPVIDLRKVSAEVISEGSDADLIVLEGMGRGIETNLHAQFTVDSLKLGMIKHQEVAQ  357

Query  362  KLIGGKIYDCVCRY  321
             ++ G++YDCVC+Y
Sbjct  358  -MLNGRLYDCVCKY  370



>ref|XP_008357337.1| PREDICTED: uncharacterized protein At2g17340-like [Malus domestica]
Length=160

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 76/139 (55%), Gaps = 23/139 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I++      G  +G   +                       L++  +
Sbjct  44   PSINDVTYTELIEIISRLKDKNGQLKGVDTS----------------------KLLIANS  81

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  82   GNDLPVIDLSRVSQELAHLASDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  141

Query  362  KLIGGKIYDCVCRYEPAEL  306
              +GG++YDCV +Y    L
Sbjct  142  -FLGGRLYDCVFKYNEVLL  159



>ref|XP_008349020.1| PREDICTED: uncharacterized protein At2g17340-like [Malus domestica]
Length=202

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 76/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT +EL +I+++     G  +G   +                       L++  +
Sbjct  86   PSINDVTYIELIEIISKLKDKNGTLKGVDTS----------------------KLLIANS  123

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +V  ELA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  124  GNDLPVIDLSRVPQELAYLASDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHSEVAQ  183

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  184  -FLGGRLYDCVFKY  196



>gb|ADE76712.1| unknown [Picea sitchensis]
Length=370

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 80/134 (60%), Gaps = 20/134 (15%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++  +   +  G     G  VDA N              L++V +
Sbjct  252  PSINDVTYSELVEIISKVKE---MKDGREYILG--VDAKN--------------LLIVNS  292

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL  VS ELA    DADL++LEGMGR + TN  A+FKCD+LKL MVK+  +AE
Sbjct  293  GSDLPVIDLSYVSPELAYISNDADLVVLEGMGRAIETNLYAQFKCDSLKLGMVKHPEVAE  352

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  353  -FLGGRLYDCVIKY  365



>ref|XP_010025652.1| PREDICTED: uncharacterized protein At2g17340-like [Eucalyptus 
grandis]
 gb|KCW62357.1| hypothetical protein EUGRSUZ_H04996 [Eucalyptus grandis]
Length=367

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 79/134 (59%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++     G   G        VDA N              L++  +
Sbjct  252  PSINDVTYPELIEIISKLKDENGKLMG--------VDASN--------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL QVS ELA    DADL+I+EGMGR + TN  A+FKCD+LK+AMVK+  +A+
Sbjct  290  GNDLPVIDLAQVSQELAFLAADADLVIMEGMGRGIETNLYAQFKCDSLKIAMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVFKY  362



>ref|XP_010090711.1| hypothetical protein L484_013733 [Morus notabilis]
 gb|EXB40430.1| hypothetical protein L484_013733 [Morus notabilis]
Length=301

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 78/134 (58%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+A+     G   G        VDA N              L++  +
Sbjct  186  PSINDVTYPELIEIIAKLKDERGQLMG--------VDASN--------------LLIANS  223

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  224  GNDLPVIDLTRVSQELAFLASDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  283

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  284  -FLGGRLYDCVFKY  296



>ref|XP_001962564.1| GF14376 [Drosophila ananassae]
 gb|EDV31785.1| GF14376 [Drosophila ananassae]
Length=361

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 79/139 (57%), Gaps = 23/139 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVT+ EL  ++ E A  C +   A ++  LLV A                     N
Sbjct  242  PALNDVTSRELEALLDECAPECEVIAEAWKSRRLLVYA---------------------N  280

Query  542  GCGSPCIDLRQVSSEL--AAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
            G   PC+D+R +  EL  A    + DL+++EGMGR LHTN NA+F C+ LKLA++KN+ L
Sbjct  281  GQSGPCLDMRTLPPELCDAIAANETDLLVIEGMGRALHTNLNARFGCETLKLAVIKNRWL  340

Query  368  AEKLIGGKIYDCVCRYEPA  312
            A+ L G  ++  +C++EPA
Sbjct  341  AKYLGGEAMFAVICKFEPA  359



>ref|XP_011088725.1| PREDICTED: uncharacterized protein At2g17340 [Sesamum indicum]
Length=364

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 80/134 (60%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+A+     G   G        VDA N              L++V +
Sbjct  249  PSINDVTYDELIEIIAKLKDENGKLFG--------VDASN--------------LLIVNS  286

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL ++S ELA    DADL+ILEGMGR + TN  A+F+CD++K+AMVK+  +A+
Sbjct  287  GNDLPVIDLTRLSQELAYLASDADLVILEGMGRGIETNLYAQFRCDSMKIAMVKHPEVAQ  346

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  347  -FLGGRLYDCVIKY  359



>ref|XP_004290081.1| PREDICTED: uncharacterized protein At2g17340-like [Fragaria vesca 
subsp. vesca]
Length=367

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 77/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+A+   + G  +G        VD  N              L +  +
Sbjct  252  PSINDVTYHELIEIIAKLKDNHGKLKG--------VDTTN--------------LFIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL  VS ELA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLASVSQELAYLASDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVFKY  362



>gb|ACU19479.1| unknown [Glycine max]
Length=364

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 77/135 (57%), Gaps = 23/135 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P+LNDVT  EL +I+++     G   G + +                       L++  +
Sbjct  251  PSLNDVTYAELLEIISKLKDEEGCLMGVSTSN----------------------LIIANS  288

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    DADL+ILEGMGR + TN  A+FKCD+LK+AMVK+  +AE
Sbjct  289  GNDLPVIDLTRVSQELAYLANDADLVILEGMGRGIETNLYAQFKCDSLKIAMVKHPEVAE  348

Query  362  KLIGGKIYDCVCRYE  318
              +G ++YDCV +Y+
Sbjct  349  -FLGSRLYDCVIKYD  362



>ref|XP_003556399.1| PREDICTED: uncharacterized protein At2g17340-like [Glycine max]
Length=364

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 77/135 (57%), Gaps = 23/135 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P+LNDVT  EL +I+++     G   G + +                       L++  +
Sbjct  251  PSLNDVTYAELLEIISKLKDEEGCLMGVSTSN----------------------LIIANS  288

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    DADL+ILEGMGR + TN  A+FKCD+LK+AMVK+  +AE
Sbjct  289  GNDLPVIDLTRVSQELAYLANDADLVILEGMGRGIETNLYAQFKCDSLKIAMVKHPEVAE  348

Query  362  KLIGGKIYDCVCRYE  318
              +G ++YDCV +Y+
Sbjct  349  -FLGSRLYDCVIKYD  362



>gb|KJE93934.1| pantothenate kinase 4, variant [Capsaspora owczarzaki ATCC 30864]
Length=788

 Score =   101 bits (252),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 55/137 (40%), Positives = 80/137 (58%), Gaps = 22/137 (16%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PA+ND+T  E+  +   AA                     N    F++G  +  L  V +
Sbjct  672  PAINDITHREIQALSERAA---------------------NIVPEFREGLANGKLQFVPS  710

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G GSPC+DL +V   +A    +ADL ++ GMGR +HTNF+A+F+ +ALKLA++KNQR+ E
Sbjct  711  GSGSPCLDLGRVDERVAEAAAEADLTVIVGMGRVVHTNFHARFRHEALKLAVIKNQRVGE  770

Query  362  KLIGGKIYDCVCRYEPA  312
            +  GG I+D VC+YEPA
Sbjct  771  QF-GGSIFDVVCKYEPA  786



>ref|XP_002051981.1| GJ24127 [Drosophila virilis]
 gb|EDW64136.1| GJ24127 [Drosophila virilis]
Length=362

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 77/137 (56%), Gaps = 23/137 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P+LNDVT+ EL  ++ + A  C I   A  +  LLV A                     N
Sbjct  245  PSLNDVTSRELSALLDDCACQCSILDSAWRSHRLLVYA---------------------N  283

Query  542  GCGSPCIDLRQVSSEL--AAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
            G   PC+D+R +  EL  A    + DL+++EGMGR LHTN NA+F C+ LKLA+VKN+ L
Sbjct  284  GQSGPCLDMRTLPRELCDAIAANETDLLVIEGMGRALHTNLNAQFACETLKLAVVKNRWL  343

Query  368  AEKLIGGKIYDCVCRYE  318
            A+ L G K++  +C+YE
Sbjct  344  AKYLGGDKMFAVICKYE  360



>gb|KHN05036.1| Hypothetical protein glysoja_013943 [Glycine soja]
Length=351

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 77/135 (57%), Gaps = 23/135 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P+LNDVT  EL +I+++     G   G + +                       L++  +
Sbjct  238  PSLNDVTYAELLEIISKLKDEEGCLMGVSTSN----------------------LIIANS  275

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    DADL+ILEGMGR + TN  A+FKCD+LK+AMVK+  +AE
Sbjct  276  GNDLPVIDLTRVSQELAYLANDADLVILEGMGRGIETNLYAQFKCDSLKIAMVKHPEVAE  335

Query  362  KLIGGKIYDCVCRYE  318
              +G ++YDCV +Y+
Sbjct  336  -FLGSRLYDCVIKYD  349



>ref|XP_004347393.1| pantothenate kinase 4 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE93933.1| pantothenate kinase 4 [Capsaspora owczarzaki ATCC 30864]
Length=806

 Score =   101 bits (252),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 55/137 (40%), Positives = 80/137 (58%), Gaps = 22/137 (16%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PA+ND+T  E+  +   AA                     N    F++G  +  L  V +
Sbjct  690  PAINDITHREIQALSERAA---------------------NIVPEFREGLANGKLQFVPS  728

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G GSPC+DL +V   +A    +ADL ++ GMGR +HTNF+A+F+ +ALKLA++KNQR+ E
Sbjct  729  GSGSPCLDLGRVDERVAEAAAEADLTVIVGMGRVVHTNFHARFRHEALKLAVIKNQRVGE  788

Query  362  KLIGGKIYDCVCRYEPA  312
            +  GG I+D VC+YEPA
Sbjct  789  QF-GGSIFDVVCKYEPA  804



>ref|XP_009011203.1| hypothetical protein HELRODRAFT_109215 [Helobdella robusta]
 gb|ESO10934.1| hypothetical protein HELRODRAFT_109215 [Helobdella robusta]
Length=834

 Score =   100 bits (249),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 61/137 (45%), Positives = 78/137 (57%), Gaps = 24/137 (18%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P LNDVT  EL  +    AK C              D +N A     DG     L+V+E+
Sbjct  701  PVLNDVTYHELIILTKRLAKQC--------------DVINLA---LNDGR----LLVMES  739

Query  542  GCGSPCIDLRQVSSELAAXXRD--ADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
            G GSPC+DLR +  +L     +   DLIILEGMGR +HTN  AKF CD LK+ ++KN+ L
Sbjct  740  GQGSPCLDLRYIDYDLGQKMMELNTDLIILEGMGRSIHTNLFAKFSCDVLKVTILKNKWL  799

Query  368  AEKLIGGKIYDCVCRYE  318
            AE  IGGK++D V +YE
Sbjct  800  AES-IGGKMFDVVFKYE  815



>ref|XP_002088669.1| GE11338 [Drosophila yakuba]
 gb|EDW88381.1| GE11338 [Drosophila yakuba]
Length=361

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 78/139 (56%), Gaps = 23/139 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVT+ EL  ++ + ++ C +   A   G LLV A                     N
Sbjct  241  PALNDVTSEELRSLLDDCSRECEVLGQAWSKGQLLVYA---------------------N  279

Query  542  GCGSPCIDLRQVSSEL--AAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
            G   PC+D+R +  EL  A    + DL+++EGMGR LHTN NA+F C+ LKLA++KN+ L
Sbjct  280  GQTGPCLDMRTLPKELCDAIAANETDLLVIEGMGRALHTNLNARFGCETLKLAVIKNKWL  339

Query  368  AEKLIGGKIYDCVCRYEPA  312
            A+ L G  ++  VC++E A
Sbjct  340  AKYLGGENMFAVVCKFEAA  358



>ref|XP_006283971.1| hypothetical protein CARUB_v10005094mg [Capsella rubella]
 gb|EOA16869.1| hypothetical protein CARUB_v10005094mg [Capsella rubella]
Length=367

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 78/134 (58%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT +EL +I+++     G   G        VD  N              L++  +
Sbjct  252  PSINDVTYIELAEILSKLKDESGQLMG--------VDTSN--------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS E+A    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLARVSQEVAYLSTDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVIKY  362



>ref|XP_004996233.1| pantothenate kinase 4 [Salpingoeca rosetta]
 gb|EGD82050.1| pantothenate kinase 4 [Salpingoeca rosetta]
Length=1161

 Score =   100 bits (250),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 60/129 (47%), Positives = 73/129 (57%), Gaps = 22/129 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P LND+T  EL  +V   AK               +D +      F D   +  L V+ N
Sbjct  687  PVLNDITFPELSALVQGVAK---------------LDPV------FSDAIAAGALRVLPN  725

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G GSPCIDL +V   LA    DADL+ILEGMGR +HTN++A   CD LKLAM+KN  LA 
Sbjct  726  GTGSPCIDLNRVGLTLAQHVHDADLVILEGMGRAIHTNYDASMTCDTLKLAMIKNAWLAN  785

Query  362  KLIGGKIYD  336
            KL GG+IYD
Sbjct  786  KL-GGEIYD  793



>ref|XP_010270546.1| PREDICTED: uncharacterized protein At2g17340 [Nelumbo nucifera]
Length=367

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 77/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+A+     G   G        VD  N              L++  +
Sbjct  252  PSINDVTYAELLEIIAKLKDENGQLVG--------VDTSN--------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLSRVSQELAYLASDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVFKY  362



>gb|EPS59987.1| hypothetical protein M569_14816, partial [Genlisea aurea]
Length=362

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 81/138 (59%), Gaps = 23/138 (17%)
 Frame = -2

Query  725  SPALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVE  546
            +P++NDVT  EL D+V+E            E GGL             +G     L++V 
Sbjct  248  TPSINDVTYSELIDVVSELKD---------EEGGL-------------EGVDCSRLLIVN  285

Query  545  NGCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLA  366
            +G   P IDL +VS ELA    DADL+++EGMGR + TN  A+FKCD++K+ MVK+  +A
Sbjct  286  SGNDLPVIDLTRVSPELAYAAEDADLVVMEGMGRGIETNLYAQFKCDSMKIGMVKHVEVA  345

Query  365  EKLIGGKIYDCVCRYEPA  312
            +  +GG++YDCV ++  A
Sbjct  346  Q-FLGGRLYDCVIKFNEA  362



>ref|XP_004495429.1| PREDICTED: uncharacterized protein At2g17340-like [Cicer arietinum]
Length=361

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 79/135 (59%), Gaps = 23/135 (17%)
 Frame = -2

Query  725  SPALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVE  546
            SP++NDVT  EL +I+++            E G LL  + +N             L +  
Sbjct  247  SPSINDVTYPELIEIISKLKD---------EEGNLLGVSTSN-------------LFIAN  284

Query  545  NGCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLA  366
            +G   P IDL +VS ELA    DADL+ILEGMGR + TN  A+FKCD++K+AMVK+  +A
Sbjct  285  SGNDLPIIDLTKVSPELACHASDADLVILEGMGRSIETNLYAQFKCDSIKIAMVKHPEVA  344

Query  365  EKLIGGKIYDCVCRY  321
            E L G ++YDCV +Y
Sbjct  345  EYL-GSRLYDCVIKY  358



>ref|XP_001652140.1| AAEL006648-PA [Aedes aegypti]
 gb|EAT41729.1| AAEL006648-PA [Aedes aegypti]
Length=357

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 74/135 (55%), Gaps = 22/135 (16%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P LND+T  EL D++ +    C I   A E G L +    N Q+G               
Sbjct  243  PTLNDITEDELQDLIRQCCSKCAIINEAYEQGMLQI--FGNEQNG---------------  285

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
                PC+D R ++ EL      +DL+I+ GM R LHTN NAKF C+ LKLA+VKN+ LA+
Sbjct  286  ----PCLDFRLLTPELCDEILQSDLLIIVGMARALHTNLNAKFTCETLKLAVVKNEWLAK  341

Query  362  KLIGGKIYDCVCRYE  318
            +L GG+ +  +C+YE
Sbjct  342  RL-GGETFSVICKYE  355



>gb|ENN72915.1| hypothetical protein YQE_10483, partial [Dendroctonus ponderosae]
Length=354

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 77/135 (57%), Gaps = 22/135 (16%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P+LNDVT  EL      AAK C I          L +A+NN Q           L+ +EN
Sbjct  239  PSLNDVTYKELNRYCRSAAKQCNI----------LKNAINNGQ-----------LLTLEN  277

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   PC+DL+ + SEL     ++DLIILEGMGR +HTN N +F  D+L++A++KN+ LA+
Sbjct  278  GQKGPCLDLKNLPSELCDLMAESDLIILEGMGRSIHTNLNTEFTVDSLRMAVLKNEWLAK  337

Query  362  KLIGGKIYDCVCRYE  318
             L G   +  + +Y+
Sbjct  338  SL-GAHQFSVIFKYQ  351



>ref|XP_007143901.1| hypothetical protein PHAVU_007G111800g [Phaseolus vulgaris]
 gb|ESW15895.1| hypothetical protein PHAVU_007G111800g [Phaseolus vulgaris]
Length=421

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 75/135 (56%), Gaps = 23/135 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P+LNDVT  EL +I++      G   G + +                       L++  +
Sbjct  308  PSLNDVTYSELTEIISRLKDEEGCLMGVSTSN----------------------LLIANS  345

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    D DL+ILEGMGR + TN  A+FKCD+LK+AMVK+  +AE
Sbjct  346  GNDLPIIDLTRVSQELACLTNDVDLVILEGMGRGIETNLYAQFKCDSLKIAMVKHPEVAE  405

Query  362  KLIGGKIYDCVCRYE  318
              +G ++YDCV +Y+
Sbjct  406  -FLGSRLYDCVIKYD  419



>ref|XP_007043093.1| Uncharacterized protein TCM_007589 [Theobroma cacao]
 gb|EOX98924.1| Uncharacterized protein TCM_007589 [Theobroma cacao]
Length=367

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 77/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++     G   G        VD  N              L++  +
Sbjct  252  PSINDVTYPELVEIISKLKDKNGKLVG--------VDTSN--------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS EL     DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+Q +A+
Sbjct  290  GNDLPVIDLTRVSQELGYLASDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHQEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVFKY  362



>ref|XP_002014710.1| GL18804 [Drosophila persimilis]
 gb|EDW28706.1| GL18804 [Drosophila persimilis]
Length=363

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 76/137 (55%), Gaps = 23/137 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P+LNDVT+ EL  ++ E A  C +   A  +  LLV A                     N
Sbjct  245  PSLNDVTSRELSALLDECAGECAVLSSAWSSARLLVYA---------------------N  283

Query  542  GCGSPCIDLRQVSSEL--AAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
            G   PC+D+R +  +L  A    + DL+++EGMGR LHTN NA F C+ LKLA++KN+ L
Sbjct  284  GQSGPCLDMRTLPRDLCDAIAANETDLLVIEGMGRALHTNLNAHFSCETLKLAVIKNRWL  343

Query  368  AEKLIGGKIYDCVCRYE  318
            A+ L G +++  +C+YE
Sbjct  344  AKYLGGDEMFAVICKYE  360



>ref|XP_001356515.2| GA19161 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL33579.2| GA19161 [Drosophila pseudoobscura pseudoobscura]
Length=363

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 76/137 (55%), Gaps = 23/137 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P+LNDVT+ EL  ++ E A  C +   A  +  LLV A                     N
Sbjct  245  PSLNDVTSRELSALLDECAGECAVLSSAWSSARLLVYA---------------------N  283

Query  542  GCGSPCIDLRQVSSEL--AAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
            G   PC+D+R +  +L  A    + DL+++EGMGR LHTN NA F C+ LKLA++KN+ L
Sbjct  284  GQSGPCLDMRTLPRDLCDAIAANETDLLVIEGMGRALHTNLNAHFSCETLKLAVIKNRWL  343

Query  368  AEKLIGGKIYDCVCRYE  318
            A+ L G +++  +C+YE
Sbjct  344  AKYLGGDEMFAVICKYE  360



>gb|AAM63225.1| unknown [Arabidopsis thaliana]
Length=367

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 80/139 (58%), Gaps = 23/139 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT +EL +I+++     G   G        VD  N              L++  +
Sbjct  252  PSINDVTYIELAEILSKLKDENGQLMG--------VDTSN--------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS E+A    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLARVSQEVAYLSSDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRYEPAEL  306
              +GG++YDCV +Y   ++
Sbjct  350  -FLGGRLYDCVIKYNEVQI  367



>ref|XP_006384863.1| pantothenate kinase-related family protein [Populus trichocarpa]
 gb|ERP62660.1| pantothenate kinase-related family protein [Populus trichocarpa]
Length=367

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 77/137 (56%), Gaps = 23/137 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+A+     G   G        VD  N              L+V  +
Sbjct  252  PSINDVTYTELIEIIAKLKDENGQLMG--------VDMSN--------------LLVANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS  LA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLTRVSQVLAYLASDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRYEPA  312
              +GG++YDCV +Y  A
Sbjct  350  -FLGGRLYDCVFKYSEA  365



>ref|XP_008382502.1| PREDICTED: uncharacterized protein At2g17340-like [Malus domestica]
Length=368

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 76/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT +EL +I+++     G  +G   +                       L++  +
Sbjct  252  PSINDVTYIELIEIISKLKDKNGTLKGVDTSK----------------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +V  ELA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLSRVPQELAYLASDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHSEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVFKY  362



>gb|AFK47314.1| unknown [Lotus japonicus]
Length=366

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 78/137 (57%), Gaps = 23/137 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++     G   G + +                       L++  +
Sbjct  252  PSINDVTYSELIEIISKLKDEEGRLVGVSTSN----------------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    DADL+ILEGMGR + TN  A+FKC++LK+ MVK+ ++AE
Sbjct  290  GNDLPVIDLTRVSQELAYLASDADLVILEGMGRGIETNLYAQFKCNSLKIGMVKHPQVAE  349

Query  362  KLIGGKIYDCVCRYEPA  312
              +GG++YDCV +Y  A
Sbjct  350  -FLGGRLYDCVFKYNEA  365



>ref|XP_009341504.1| PREDICTED: uncharacterized protein At2g17340-like [Pyrus x bretschneideri]
Length=368

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 77/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++     G  +G        VD                 L++  +
Sbjct  252  PSINDVTYTELIEIISKLKDKNGQLKG--------VDTSK--------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLSRVSQELAHLASDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVFKY  362



>gb|KHG04221.1| hypothetical protein F383_29469 [Gossypium arboreum]
Length=324

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 77/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++     G   G        VD  N              L++  +
Sbjct  209  PSINDVTYPELIEIISKLKDESGKLIG--------VDTSN--------------LLIANS  246

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL ++S ELA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  247  GNDLPVIDLTRISQELAYLASDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  306

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  307  -FLGGRLYDCVFKY  319



>gb|KJB79742.1| hypothetical protein B456_013G064800 [Gossypium raimondii]
Length=330

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 77/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++     G   G        VD  N              L++  +
Sbjct  215  PSINDVTYPELIEIISKLKDESGKLIG--------VDTSN--------------LLIANS  252

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  253  GNDLPVIDLTRVSQELAYLASDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  312

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  313  -FLGGRLYDCVFKY  325



>ref|NP_567984.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL32984.1| unknown protein [Arabidopsis thaliana]
 gb|AAN28872.1| At4g35360/F23E12_80 [Arabidopsis thaliana]
 gb|AEE86503.1| uncharacterized protein AT4G35360 [Arabidopsis thaliana]
Length=367

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 80/139 (58%), Gaps = 23/139 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT +EL +I+++     G   G        VD  N              L++  +
Sbjct  252  PSINDVTYIELAEILSKLNDENGQLMG--------VDTSN--------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS E+A    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLARVSQEVAYLSSDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRYEPAEL  306
              +GG++YDCV +Y   ++
Sbjct  350  -FLGGRLYDCVIKYNEVQI  367



>ref|XP_002867075.1| hypothetical protein ARALYDRAFT_491111 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43334.1| hypothetical protein ARALYDRAFT_491111 [Arabidopsis lyrata subsp. 
lyrata]
Length=367

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 78/134 (58%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT +EL +I+++     G   G        VD  N              L++  +
Sbjct  252  PSINDVTYIELAEILSKLKDENGQLMG--------VDTSN--------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS E+A    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLARVSQEVAYLSTDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVIKY  362



>gb|KFK30177.1| hypothetical protein AALP_AA7G227700 [Arabis alpina]
Length=367

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 77/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++     G   G        VD  N              L++  +
Sbjct  252  PSINDVTYTELAEILSKLKDENGQLMG--------VDTSN--------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS E+A    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLSRVSQEVAYLSTDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVIKY  362



>ref|XP_010530975.1| PREDICTED: uncharacterized protein At2g17340 [Tarenaya hassleriana]
Length=367

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 76/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +IV++     G   G        VD                 L++  +
Sbjct  252  PSINDVTYTELIEIVSKLKDENGQLMG--------VDTSK--------------LLIASS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLTRVSQELAYLSSDADLVILEGMGRGIETNLYARFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVFKY  362



>ref|XP_010432289.1| PREDICTED: uncharacterized protein At2g17340-like [Camelina sativa]
 ref|XP_010437482.1| PREDICTED: uncharacterized protein At2g17340-like [Camelina sativa]
Length=367

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 78/134 (58%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT +EL +I+++     G   G        VD  N              L++  +
Sbjct  252  PSINDVTYIELAEILSKLKDENGQLMG--------VDTSN--------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS E+A    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLARVSQEVAYLSTDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVIKY  362



>ref|XP_010446932.1| PREDICTED: uncharacterized protein At2g17340-like [Camelina sativa]
Length=367

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 78/134 (58%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT +EL +I+++     G   G        VD  N              L++  +
Sbjct  252  PSINDVTYIELAEILSKLKDENGQLMG--------VDTSN--------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS E+A    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLARVSQEVAYLSTDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVIKY  362



>gb|KJB79743.1| hypothetical protein B456_013G064800 [Gossypium raimondii]
Length=367

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 77/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++     G   G        VD  N              L++  +
Sbjct  252  PSINDVTYPELIEIISKLKDESGKLIG--------VDTSN--------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLTRVSQELAYLASDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVFKY  362



>gb|KJB79741.1| hypothetical protein B456_013G064800 [Gossypium raimondii]
Length=367

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 77/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++     G   G        VD  N              L++  +
Sbjct  252  PSINDVTYPELIEIISKLKDESGKLIG--------VDTSN--------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLTRVSQELAYLASDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVFKY  362



>ref|XP_006412112.1| hypothetical protein EUTSA_v10025517mg [Eutrema salsugineum]
 gb|ESQ53565.1| hypothetical protein EUTSA_v10025517mg [Eutrema salsugineum]
Length=368

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 77/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++     G   G        VD  N              L++  +
Sbjct  252  PSINDVTYTELAEILSKLKDENGQLMG--------VDTTN--------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS E+A    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLARVSQEVAYLSTDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVIKY  362



>ref|XP_002283109.1| PREDICTED: uncharacterized protein At2g17340 [Vitis vinifera]
 emb|CBI37726.3| unnamed protein product [Vitis vinifera]
Length=367

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 77/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+A+     G   G        VD  N              L++  +
Sbjct  252  PSINDVTYPELIEIIAKLKDENGQLVG--------VDTSN--------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL ++S ELA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLTRISQELAYLASDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHLEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVFKY  362



>ref|XP_008357317.1| PREDICTED: uncharacterized protein At2g17340-like [Malus domestica]
Length=368

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 76/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I++      G  +G        VD                 L++  +
Sbjct  252  PSINDVTYTELIEIISRLKDKNGQLKG--------VDTSK--------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLSRVSQELAHLASDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVFKY  362



>ref|XP_003622334.1| hypothetical protein MTR_7g034640 [Medicago truncatula]
Length=185

 Score = 94.4 bits (233),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 77/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++            E G LL             G  +  L++  +
Sbjct  72   PSINDVTYSELIEIISKLKD---------EEGRLL-------------GVSTSKLLIANS  109

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA+   D DL+ILEGMGR + TN  A+FKCD++K+AMVK+  +AE
Sbjct  110  GNDLPVIDLTKVSQELASLTSDVDLVILEGMGRGIETNLYAQFKCDSMKIAMVKHPEVAE  169

Query  362  KLIGGKIYDCVCRY  321
              +  ++YDCV +Y
Sbjct  170  -FLESRMYDCVIKY  182



>ref|XP_006365309.1| PREDICTED: uncharacterized protein At2g17340-like [Solanum tuberosum]
Length=367

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 79/138 (57%), Gaps = 25/138 (18%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLL-VDAMNNAQDGFKDGPVSVPLMVVE  546
            P++NDVT  EL +I+++            E G L+ VD  N              L+V  
Sbjct  252  PSINDVTYPELVEIISKLKD---------EHGKLIDVDTSN--------------LLVAN  288

Query  545  NGCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLA  366
            +G   P IDL  VS ELA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A
Sbjct  289  SGNDLPVIDLTTVSQELAYLASDADLVILEGMGRGIETNLYARFKCDSLKIGMVKHPEVA  348

Query  365  EKLIGGKIYDCVCRYEPA  312
            +  +GG++YDCV +Y  A
Sbjct  349  Q-FLGGRLYDCVFKYNEA  365



>ref|XP_002886110.1| hypothetical protein ARALYDRAFT_480618 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62369.1| hypothetical protein ARALYDRAFT_480618 [Arabidopsis lyrata subsp. 
lyrata]
Length=367

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 76/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++ND+T  EL +I+++     G   G        VD                 L++  +
Sbjct  252  PSINDITYTELTEILSQLKDENGQLIG--------VDTSK--------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +AE
Sbjct  290  GNDLPVIDLARVSQELAYLSSDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHLEVAE  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVFKY  362



>emb|CDP14484.1| unnamed protein product [Coffea canephora]
Length=367

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 77/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL DIV++   + G   G        VD  N              L +  +
Sbjct  252  PSINDVTYPELIDIVSKLKDNQGKLAG--------VDTSN--------------LFIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL ++S ELA    DA+L+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLTRISQELAYLASDAELVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVFKY  362



>ref|XP_002155967.2| PREDICTED: uncharacterized protein LOC100203531, partial [Hydra 
vulgaris]
Length=748

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 56/141 (40%), Positives = 81/141 (57%), Gaps = 22/141 (16%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PA+NDV   EL  +    A+ C I R A      L D M               L ++E 
Sbjct  630  PAINDVIYSELIIVCERVAEMCPIIRNA------LSDEM---------------LCIMET  668

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G  S C+DL ++  +LAA  R+ADLI+LEGMGR +HTN+ A+FKC+ ++ A++KN  LAE
Sbjct  669  GSSSACLDLLRIEIKLAAVMRNADLILLEGMGRCIHTNYMAEFKCEVIRCAVLKNPWLAE  728

Query  362  KLIGGKIYDCVCRYEPAELKA  300
            +L GGK++D + +Y    L +
Sbjct  729  RL-GGKLFDVIFKYTRPSLSS  748



>ref|XP_009340789.1| PREDICTED: uncharacterized protein At2g17340-like [Pyrus x bretschneideri]
Length=368

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 76/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++     G  +G        VD                 L++  +
Sbjct  252  PSINDVTYTELIEIISKLKGKNGTLKG--------VDTSK--------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +V  ELA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLSRVPQELAYLASDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHSEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVFKY  362



>ref|XP_004514973.1| PREDICTED: uncharacterized protein At2g17340-like [Cicer arietinum]
Length=367

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 78/134 (58%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++            E G L+             G  S  L++  +
Sbjct  252  PSINDVTYSELVEIISKLKD---------EEGNLV-------------GVSSSNLLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    DADL++LEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLTRVSQELAYLASDADLVVLEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVFKY  362



>ref|XP_010690567.1| PREDICTED: uncharacterized protein At2g17340 [Beta vulgaris subsp. 
vulgaris]
Length=364

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 79/137 (58%), Gaps = 23/137 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +IV++            E+G L+             G  +  L++  +
Sbjct  249  PSINDVTYTELFEIVSKLKD---------ESGQLM-------------GVDTSKLLIANS  286

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL  VS ELA    DADL++LEGMGR + TN  A+FKCD++K+ MVK+  +A+
Sbjct  287  GNDLPVIDLTSVSQELAYLASDADLVVLEGMGRGIETNLYAQFKCDSIKIGMVKHPEVAQ  346

Query  362  KLIGGKIYDCVCRYEPA  312
              +GG++YDCV +Y  A
Sbjct  347  -FLGGRLYDCVFKYSEA  362



>ref|XP_009333785.1| PREDICTED: uncharacterized protein At2g17340-like [Pyrus x bretschneideri]
Length=368

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 76/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++     G  +G        VD                 L++  +
Sbjct  252  PSINDVTYTELIEIISKLKDKNGQLKG--------VDTSK--------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    DADL+ILEGMGR + TN  A+FKCD LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLSRVSQELAHLASDADLVILEGMGRGIETNLYAQFKCDFLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVFKY  362



>ref|XP_006299544.1| hypothetical protein CARUB_v10015717mg [Capsella rubella]
 gb|EOA32442.1| hypothetical protein CARUB_v10015717mg [Capsella rubella]
Length=367

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 76/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++ND+T  EL +I+++     G   G        VD                 L++  +
Sbjct  252  PSINDITYTELTEILSQLKDENGQLIG--------VDTSK--------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    DADL+I+EGMGR + TN  A+FKCD+LK+ MVK+  +AE
Sbjct  290  GNDLPVIDLSRVSQELAYLSSDADLVIVEGMGRGIETNLYAQFKCDSLKIGMVKHLEVAE  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVIKY  362



>ref|XP_004338527.1| pantothenate kinase, putative [Acanthamoeba castellanii str. 
Neff]
 gb|ELR16514.1| pantothenate kinase, putative [Acanthamoeba castellanii str. 
Neff]
Length=361

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 79/136 (58%), Gaps = 22/136 (16%)
 Frame = -2

Query  725  SPALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVE  546
            +PALND+T  EL  ++ + A               LVD +    D  +DG     L +V 
Sbjct  243  TPALNDITHPELVQVMDQVA---------------LVDTI--LADAVRDGR----LKLVA  281

Query  545  NGCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLA  366
            +G G P IDL QVS ELA     ADL+ILEGMGR L +N +A+FKCD +KLAMVK+  +A
Sbjct  282  SGNGCPLIDLGQVSVELAEEADSADLVILEGMGRALQSNHSARFKCDVMKLAMVKDAHVA  341

Query  365  EKLIGGKIYDCVCRYE  318
            EKL G  +  C CR+E
Sbjct  342  EKL-GCPLMACFCRFE  356



>ref|XP_002886109.1| hypothetical protein ARALYDRAFT_900074 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62368.1| hypothetical protein ARALYDRAFT_900074 [Arabidopsis lyrata subsp. 
lyrata]
Length=361

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 79/139 (57%), Gaps = 23/139 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PA+NDVT  EL DIV++            +  G L+            G  +  L++  +
Sbjct  246  PAINDVTYTELTDIVSQLK----------DGNGQLI------------GVDTSKLLIANS  283

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G     IDL +VS ELA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  284  GNDLAVIDLSRVSHELAYLSSDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHVEVAQ  343

Query  362  KLIGGKIYDCVCRYEPAEL  306
              +GG++YDCV +Y   ++
Sbjct  344  -FLGGRLYDCVFKYNEVQI  361



>gb|EAW56099.1| pantothenate kinase 4, isoform CRA_c [Homo sapiens]
Length=166

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 87/145 (60%), Gaps = 25/145 (17%)
 Frame = -2

Query  734  QTXSPALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLM  555
            ++ SPALNDVT  E   IVAE           A    ++  A+   +           L+
Sbjct  44   RSSSPALNDVTHSE-SLIVAER---------IAGMDPVVHSALQEER-----------LL  82

Query  554  VVENGCGSPCIDLRQVSSELAAXXRD--ADLIILEGMGRXLHTNFNAKFKCDALKLAMVK  381
            +V+ G  SPC+DL ++   LAA  R+  ADL+++EGMGR +HTN++A  +C++LKLA++K
Sbjct  83   LVQTGSSSPCLDLSRLDKGLAALVRERGADLVVIEGMGRAVHTNYHAALRCESLKLAVIK  142

Query  380  NQRLAEKLIGGKIYDCVCRYE-PAE  309
            N  LAE+L GG+++  + +YE PAE
Sbjct  143  NAWLAERL-GGRLFSVIFKYEVPAE  166



>gb|KHN27854.1| Hypothetical protein glysoja_033002 [Glycine soja]
Length=324

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 76/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++     G   G + +                       L++  +
Sbjct  209  PSINDVTCSELVEIISKLKDEDGQLVGVSTSN----------------------LLIANS  246

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  247  GNDLPVIDLTRVSQELAYLASDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  306

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  307  -FLGGRLYDCVFKY  319



>ref|XP_009102804.1| PREDICTED: uncharacterized protein At2g17340 [Brassica rapa]
 emb|CDX75497.1| BnaA01g02050D [Brassica napus]
Length=367

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 77/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++     G   G        VD  N              L++  +
Sbjct  252  PSINDVTYTELAEILSKLKDENGQLMG--------VDISN--------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS E+A    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLARVSQEVAYLSTDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVIKY  362



>ref|XP_007201314.1| hypothetical protein PRUPE_ppa007505mg [Prunus persica]
 gb|EMJ02513.1| hypothetical protein PRUPE_ppa007505mg [Prunus persica]
Length=365

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 77/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++ND+T  EL +I+++   + G  +G        VD  N              L +  +
Sbjct  251  PSINDITYPELIEIISKLKDNEGKLKG--------VDTSN--------------LFIANS  288

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL  VS E+A    DADL+I+EGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  289  GNDMPVIDLSSVSQEIAYLASDADLVIMEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  348

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  349  -FLGGRLYDCVFKY  361



>ref|XP_969975.2| PREDICTED: pantothenate kinase 4 [Tribolium castaneum]
 gb|EFA03794.1| hypothetical protein TcasGA2_TC013906 [Tribolium castaneum]
Length=355

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 71/138 (51%), Gaps = 22/138 (16%)
 Frame = -2

Query  725  SPALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVE  546
            SPALNDVT  EL     +AA  C I   +   G L                     + VE
Sbjct  239  SPALNDVTWHELKQYSQQAASQCPILEKSLRTGQL---------------------VTVE  277

Query  545  NGCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLA  366
            NG   PC+DL  +S EL      ADL++LEGMGR +HTN  AKF  D++KLA++KN  LA
Sbjct  278  NGQKGPCLDLSNLSPELCRLMSGADLVVLEGMGRAVHTNLYAKFNVDSVKLAVLKNDWLA  337

Query  365  EKLIGGKIYDCVCRYEPA  312
            + L G + +  +  YE A
Sbjct  338  KSL-GAQQFSVIFNYEAA  354



>ref|XP_002514412.1| pantothenate kinase, putative [Ricinus communis]
 gb|EEF48008.1| pantothenate kinase, putative [Ricinus communis]
Length=367

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 76/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++     G   G        VD  N              L++  +
Sbjct  252  PSINDVTYPELIEIISKLKDENGQLVG--------VDTSN--------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    DADL+I EGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLTRVSQELAYLSTDADLVIFEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVFKY  362



>ref|XP_006299401.1| hypothetical protein CARUB_v10015561mg [Capsella rubella]
 gb|EOA32299.1| hypothetical protein CARUB_v10015561mg [Capsella rubella]
Length=367

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 76/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PA+ND+T  EL +I+++     G   G        VD                 L++V +
Sbjct  252  PAINDITYTELTEILSQLKDENGELIG--------VDTSK--------------LLIVNS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P +DL +VS ELA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK   +A 
Sbjct  290  GNDLPVLDLSRVSQELAYLAADADLVILEGMGRGIGTNLYAQFKCDSLKIGMVKYLEVA-  348

Query  362  KLIGGKIYDCVCRY  321
            K +GG++YDCV +Y
Sbjct  349  KFLGGRLYDCVIKY  362



>gb|KFK40120.1| hypothetical protein AALP_AA3G333000 [Arabis alpina]
Length=357

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 77/138 (56%), Gaps = 23/138 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++     G   G        VD              +  L+V  +
Sbjct  242  PSINDVTYTELTEILSQLKDENGQLMG--------VD--------------TSKLLVANS  279

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G     IDL +VS ELA    DADL+I+EGMGR + TN  A+FKCD+LK+ MVK+  +AE
Sbjct  280  GNDLAVIDLSRVSQELADLSYDADLVIIEGMGRAIETNLYAQFKCDSLKIGMVKHLEVAE  339

Query  362  KLIGGKIYDCVCRYEPAE  309
              +GG++YDCV +Y   E
Sbjct  340  -FLGGRLYDCVFKYNEVE  356



>ref|XP_001752572.1| predicted protein [Physcomitrella patens]
 gb|EDQ82811.1| predicted protein [Physcomitrella patens]
Length=371

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 81/137 (59%), Gaps = 19/137 (14%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++ND+T  EL  ++++A KH       +  G   VDA +              LMV+ +
Sbjct  252  PSINDITYEELVQVISKA-KHVTSDGKESFYG---VDAQH--------------LMVLNS  293

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P +DL  +S ELA    DADL+++EGMGR + TN  A+FKCD+L + MVK++ +A+
Sbjct  294  GSDLPVLDLSHISPELAYAAEDADLVVMEGMGRGIETNLYAQFKCDSLNIGMVKHKEVAD  353

Query  362  KLIGGKIYDCVCRYEPA  312
              +GG++YDCV ++  A
Sbjct  354  -FLGGRLYDCVIKFTEA  369



>ref|XP_004495428.1| PREDICTED: uncharacterized protein At2g17340-like [Cicer arietinum]
Length=432

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 79/134 (59%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++            E G LL  + +N             L++  +
Sbjct  319  PSINDVTYSELIEIISKLKD---------EEGRLLGVSTSN-------------LLIANS  356

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    DADL+ILEGMGR + TN +A FKCD++K+AMVK+  +AE
Sbjct  357  GNDLPVIDLAKVSQELACLASDADLVILEGMGRGIETNLDAHFKCDSIKIAMVKHPEVAE  416

Query  362  KLIGGKIYDCVCRY  321
              +G ++YDCV +Y
Sbjct  417  -FLGSRMYDCVIKY  429



>ref|XP_010467504.1| PREDICTED: uncharacterized protein At2g17340 [Camelina sativa]
Length=367

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 76/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++ND+T  EL +I+++     G   G        VD                 L++  +
Sbjct  252  PSINDITYTELTEILSQLKDENGQLIG--------VDTSK--------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    DADL+I+EGMGR + TN  A+FKCD+LK+ MVK+  +AE
Sbjct  290  GNDLPVIDLSRVSQELAYLSSDADLVIVEGMGRGIETNLYAQFKCDSLKIGMVKHVEVAE  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVFKY  362



>gb|AES75860.2| pantothenate kinase [Medicago truncatula]
Length=367

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 76/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++     G   G + +                       L++  +
Sbjct  252  PSINDVTYSELVEIISKLKDEEGNLVGVSTSN----------------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    DADL++LEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLARVSQELAYLASDADLVVLEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVLKY  362



>ref|XP_008235825.1| PREDICTED: uncharacterized protein At2g17340-like [Prunus mume]
Length=365

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 77/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++ND+T  EL +I+++   + G  +G        VD  N              L +  +
Sbjct  251  PSINDITYPELIEIISKLKDNEGKLKG--------VDTSN--------------LFIANS  288

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL  VS E+A    DADL+I+EGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  289  GNDLPVIDLSSVSQEIAYLASDADLVIMEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  348

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  349  -FLGGRLYDCVFKY  361



>ref|XP_003690310.1| PREDICTED: LOW QUALITY PROTEIN: pantothenate kinase 4-like [Apis 
florea]
Length=784

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 60/143 (42%), Positives = 83/143 (58%), Gaps = 25/143 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVT  EL   + +A+  C + R A +   L+  AM  AQ G               
Sbjct  636  PALNDVTYSELVVTLRDASNICKVIRHALKENRLI--AMETAQAG---------------  678

Query  542  GCGSPCIDLRQVSSEL--AAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
                PC+DL +++ +L  A    + DLI+LEGMGR LHTNF+AK  C+ LKLA+VKN+ L
Sbjct  679  ----PCLDLSRLNLDLCLAMVKHNVDLIVLEGMGRTLHTNFHAKMTCECLKLAVVKNRWL  734

Query  368  AEKLIGGKIYDCVCRYE-PAELK  303
            A +L GG +Y  +C+YE P ++K
Sbjct  735  ARRL-GGDMYAVICKYEKPIKIK  756



>gb|KDP47020.1| hypothetical protein JCGZ_10747 [Jatropha curcas]
Length=367

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 77/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+ +     G   G        VDA N              L++  +
Sbjct  252  PSINDVTYPELIEIILKLKDGSGQLVG--------VDASN--------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLTRVSQELAYLCSDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVFKY  362



>emb|CDX69133.1| BnaC01g03200D [Brassica napus]
Length=367

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 77/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++ND+T  EL +I+++     G   G        VD  N              L++  +
Sbjct  252  PSINDITYTELAEILSKLKDENGELMG--------VDISN--------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS E+A    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLARVSQEVAYLSTDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVIKY  362



>ref|XP_006299387.1| hypothetical protein CARUB_v10015546mg [Capsella rubella]
 gb|EOA32285.1| hypothetical protein CARUB_v10015546mg [Capsella rubella]
Length=361

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 76/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PA+NDVT  EL DIV++            E G LL             G  +  L++  +
Sbjct  246  PAINDVTYTELTDIVSQLKD---------ENGQLL-------------GVDTSKLLIANS  283

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G     IDL +VS ELA    DADL+ILEGMGR + TN  A+FKCD+L + MVK+  +A+
Sbjct  284  GNDLAVIDLSRVSQELAYLSSDADLVILEGMGRGIETNLYAQFKCDSLNIGMVKHIEVAQ  343

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  344  -FLGGRLYDCVFKY  356



>ref|XP_004249007.1| PREDICTED: uncharacterized protein At2g17340 [Solanum lycopersicum]
Length=367

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 77/137 (56%), Gaps = 23/137 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++     G   G        VD  N              L+V  +
Sbjct  252  PSINDVTYPELVEIISKLKDEHGKLIG--------VDTSN--------------LLVANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL  VS ELA    DADL+I+EGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLTTVSQELAYLASDADLVIVEGMGRGIETNLYARFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRYEPA  312
              +GG++YDCV ++  A
Sbjct  350  -FLGGRLYDCVFKFNEA  365



>ref|XP_002424875.1| Pantothenate kinase, putative [Pediculus humanus corporis]
 gb|EEB12137.1| Pantothenate kinase, putative [Pediculus humanus corporis]
Length=817

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 56/138 (41%), Positives = 78/138 (57%), Gaps = 24/138 (17%)
 Frame = -2

Query  725  SPALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVE  546
            SPALNDV   EL  ++    K C I R A E G L+  AM + Q G              
Sbjct  697  SPALNDVIHSELLVLLNSVKKICPIIREAEEKGFLI--AMESGQTG--------------  740

Query  545  NGCGSPCIDLRQVSSELAAXX--RDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQR  372
                 PC+DL ++   L      R ADLI++EGMGR +HTN N  FKC++LK+A++KNQ 
Sbjct  741  -----PCLDLSRLKKNLCEEMIRRKADLIVIEGMGRSVHTNLNTNFKCESLKVAVIKNQW  795

Query  371  LAEKLIGGKIYDCVCRYE  318
            LA++L GG ++  +C+Y+
Sbjct  796  LAKRL-GGNMFSVLCQYK  812



>ref|XP_010928426.1| PREDICTED: uncharacterized protein At2g17340-like isoform X2 
[Elaeis guineensis]
Length=366

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 74/134 (55%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL DI+++     G   G   +G                      L+V  +
Sbjct  250  PSINDVTYPELIDIISKLKDENGQLVGVDASG----------------------LLVANS  287

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL  VS ELA    DADL+ILEGMGR + TN  A+ KCD++K+ MVK+  +A+
Sbjct  288  GNDLPVIDLTSVSPELAYLASDADLVILEGMGRAIETNLYAQMKCDSIKIGMVKHPEVAQ  347

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  348  -FLGGRLYDCVFKY  360



>ref|XP_002500562.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61820.1| predicted protein [Micromonas sp. RCC299]
Length=381

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 75/136 (55%), Gaps = 22/136 (16%)
 Frame = -2

Query  719  ALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVENG  540
            ++NDVTA EL D++   A+       A + G +                      V  +G
Sbjct  265  SINDVTAAELEDLLPRVAELDETFAEAVKCGAI---------------------AVCSSG  303

Query  539  CGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAEK  360
               P IDLR+VS  LAA   DAD +ILEGMGR + TN  A F CDAL++ MVK+  +A+ 
Sbjct  304  SDLPVIDLRRVSKRLAAVVDDADFVILEGMGRAIETNLEAAFDCDALRIGMVKHPEVAQC  363

Query  359  LIGGKIYDCVCRYEPA  312
            L GG++YDCVCR+E A
Sbjct  364  L-GGELYDCVCRFEAA  378



>ref|XP_010467503.1| PREDICTED: uncharacterized protein At2g17340-like [Camelina sativa]
Length=361

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 76/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PA+NDVT  EL DIV++            E G LL             G  +  L++  +
Sbjct  246  PAINDVTYTELTDIVSQLKD---------EDGQLL-------------GVDTSKLLIANS  283

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G     IDL +VS ELA    DADL+ILEGMGR + TN  A+FKCD+L + MVK+  +A+
Sbjct  284  GNDLAVIDLSRVSQELAYLASDADLVILEGMGRGIETNLYAQFKCDSLNIGMVKHVEVAQ  343

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  344  -FLGGRLYDCVFKY  356



>ref|XP_010928425.1| PREDICTED: uncharacterized protein At2g17340-like isoform X1 
[Elaeis guineensis]
Length=368

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 74/134 (55%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL DI+++     G   G   +G                      L+V  +
Sbjct  252  PSINDVTYPELIDIISKLKDENGQLVGVDASG----------------------LLVANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL  VS ELA    DADL+ILEGMGR + TN  A+ KCD++K+ MVK+  +A+
Sbjct  290  GNDLPVIDLTSVSPELAYLASDADLVILEGMGRAIETNLYAQMKCDSIKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVFKY  362



>ref|XP_009053272.1| hypothetical protein LOTGIDRAFT_116077 [Lottia gigantea]
 gb|ESO96157.1| hypothetical protein LOTGIDRAFT_116077 [Lottia gigantea]
Length=780

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 55/145 (38%), Positives = 81/145 (56%), Gaps = 24/145 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P LNDVT  EL                      +LV  +        D  +S  L+V+EN
Sbjct  652  PTLNDVTYSELV---------------------ILVKKVAAISSQINDALLSERLLVMEN  690

Query  542  GCGSPCIDLRQVSSELAAXXR--DADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
            G GSPC+DLR +  +L    +  + DL+ILEGMGR +HTNF A+F CD LK+A++KN+ L
Sbjct  691  GQGSPCLDLRLIDYDLVNTMKKLETDLVILEGMGRAVHTNFQARFSCDVLKIAVIKNKWL  750

Query  368  AEKLIGGKIYDCVCRYEPAELKAAA  294
            A +L GG +++ + ++E A   A++
Sbjct  751  ANRL-GGDMFNVMFKFEKARQIASS  774



>gb|KIH53051.1| hypothetical protein ANCDUO_16832, partial [Ancylostoma duodenale]
Length=145

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 78/138 (57%), Gaps = 24/138 (17%)
 Frame = -2

Query  725  SPALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVE  546
            SPALND+T  E+  +V +            EA   L DA++N +           LM   
Sbjct  8    SPALNDLTYNEMIAMVPQIR----------EADDFLRDAVDNQR-----------LMFEH  46

Query  545  NGCGSPCIDLRQVSSEL--AAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQR  372
            +G GSPC+DLR+V S L         D +++EGMGR LHTN +A F CD+LK A++K Q 
Sbjct  47   SGQGSPCLDLRKVHSVLNRRVLEEQVDFVVIEGMGRALHTNLHAHFVCDSLKAAVIKTQW  106

Query  371  LAEKLIGGKIYDCVCRYE  318
            LA+++ GG+I+  V ++E
Sbjct  107  LADRM-GGEIFSVVFKFE  123



>ref|XP_006610071.1| PREDICTED: pantothenate kinase 4-like isoform X1 [Apis dorsata]
Length=787

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 83/143 (58%), Gaps = 25/143 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVT  EL   + +A+  C + R A +   L+  AM  AQ G               
Sbjct  639  PALNDVTYSELVVTLRDASNICKVIRRALKENRLI--AMETAQAG---------------  681

Query  542  GCGSPCIDLRQVSSEL--AAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
                PC+DL +++ +L  A    D DLI+LEGMGR LHTNF+AK  C+ LKLA+VKN+ L
Sbjct  682  ----PCLDLSRLNLDLCLAMVKHDVDLIVLEGMGRTLHTNFHAKMTCECLKLAVVKNRWL  737

Query  368  AEKLIGGKIYDCVCRYE-PAELK  303
            A +L GG +Y  +C+YE P ++K
Sbjct  738  ARRL-GGDMYAVICKYEKPIKVK  759



>ref|XP_011040827.1| PREDICTED: uncharacterized protein At2g17340-like [Populus euphratica]
Length=367

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 76/137 (55%), Gaps = 23/137 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+A+     G   G        VD  N              L+V  +
Sbjct  252  PSINDVTYTELIEIIAKLKDENGQLMG--------VDTSN--------------LLVANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS  LA    DA L+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLTRVSQVLAYLASDAGLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRYEPA  312
              +GG++YDCV +Y  A
Sbjct  350  -FLGGRLYDCVFKYSEA  365



>ref|XP_011340652.1| PREDICTED: pantothenate kinase 4 [Cerapachys biroi]
 gb|EZA61834.1| Pantothenate kinase [Cerapachys biroi]
Length=842

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 57/137 (42%), Positives = 80/137 (58%), Gaps = 24/137 (18%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVT  EL   + +AAK C + + A E   L+   M  AQ G               
Sbjct  676  PALNDVTYPELVVTLRDAAKICDVIKQALEDNTLI--PMETAQAG---------------  718

Query  542  GCGSPCIDLRQVSSEL--AAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
                PC+DL +++ +L  A    + DL+++EGMGR LHTNF+AK KC+ LKLA++KN+ L
Sbjct  719  ----PCLDLSRLNLDLCLAMVKHNVDLVVIEGMGRTLHTNFHAKMKCECLKLAVIKNRWL  774

Query  368  AEKLIGGKIYDCVCRYE  318
            A +L GG +Y  +C+YE
Sbjct  775  ALRL-GGDMYAVICKYE  790



>gb|EHJ77585.1| hypothetical protein KGM_11112 [Danaus plexippus]
Length=356

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 76/141 (54%), Gaps = 24/141 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVT +EL +++  A++ C +   A   G L+V +                     N
Sbjct  236  PALNDVTNVELQEVLQHASQICPVLAAAMATGDLVVRS---------------------N  274

Query  542  GCGSPCIDLRQVSSELAA--XXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
            G   PC+D R VS +L      R  DLIILEGMGR LHTN NA+   D+LKLA+VKN  L
Sbjct  275  GQRGPCLDFRTVSVDLCTEMKMRGVDLIILEGMGRALHTNLNARLAVDSLKLAVVKNAWL  334

Query  368  AEKLIGGKIYDCVCRYEPAEL  306
            A++L GG ++  +  YE   L
Sbjct  335  AQRL-GGPLFSVIFIYEEKPL  354



>ref|XP_006610072.1| PREDICTED: pantothenate kinase 4-like isoform X2 [Apis dorsata]
Length=784

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 83/143 (58%), Gaps = 25/143 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVT  EL   + +A+  C + R A +   L+  AM  AQ G               
Sbjct  636  PALNDVTYSELVVTLRDASNICKVIRRALKENRLI--AMETAQAG---------------  678

Query  542  GCGSPCIDLRQVSSEL--AAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
                PC+DL +++ +L  A    D DLI+LEGMGR LHTNF+AK  C+ LKLA+VKN+ L
Sbjct  679  ----PCLDLSRLNLDLCLAMVKHDVDLIVLEGMGRTLHTNFHAKMTCECLKLAVVKNRWL  734

Query  368  AEKLIGGKIYDCVCRYE-PAELK  303
            A +L GG +Y  +C+YE P ++K
Sbjct  735  ARRL-GGDMYAVICKYEKPIKVK  756



>gb|AAS76704.1| At2g17320 [Arabidopsis thaliana]
 gb|AAS92336.1| At2g17320 [Arabidopsis thaliana]
Length=361

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 77/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PA+NDVT  EL DIV++            +  G L+            G  +  L++  +
Sbjct  246  PAINDVTYTELTDIVSQLK----------DGNGQLI------------GVDTSKLLIANS  283

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G     IDL +VS ELA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  284  GNDLAVIDLSRVSHELAYLSSDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHVEVAQ  343

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV ++
Sbjct  344  -FLGGRLYDCVFKF  356



>ref|NP_179324.2| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAH20092.1| AT2G17320 [Arabidopsis thaliana]
 gb|AEC06613.1| uncharacterized protein AT2G17320 [Arabidopsis thaliana]
Length=361

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 77/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PA+NDVT  EL DIV++            +  G L+            G  +  L++  +
Sbjct  246  PAINDVTYTELTDIVSQLK----------DGNGQLI------------GVDTSKLLIANS  283

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G     IDL +VS ELA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  284  GNDLAVIDLSRVSHELAYLSSDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHVEVAQ  343

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV ++
Sbjct  344  -FLGGRLYDCVFKF  356



>gb|ELT88727.1| hypothetical protein CAPTEDRAFT_118737 [Capitella teleta]
Length=777

 Score = 96.7 bits (239),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 55/136 (40%), Positives = 79/136 (58%), Gaps = 24/136 (18%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVT  E+  I  + A+ C   + A   G L++                     +E+
Sbjct  649  PALNDVTYNEMTLIAKKVAEICPHIQSALLEGRLII---------------------MES  687

Query  542  GCGSPCIDLRQVSSELAAXXRD--ADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
            G GSPC+DLR +  +L+   ++  ADLI+LEGMGR +HTN NA F C++LK A++KNQ L
Sbjct  688  GQGSPCLDLRYIDHDLSEKMKELGADLIVLEGMGRAIHTNLNAAFSCESLKAAVLKNQWL  747

Query  368  AEKLIGGKIYDCVCRY  321
            AE+L GG ++  V +Y
Sbjct  748  AERL-GGDMFSVVFKY  762



>ref|XP_009150843.1| PREDICTED: uncharacterized protein At2g17340-like isoform X1 
[Brassica rapa]
 emb|CDX87995.1| BnaA06g25860D [Brassica napus]
Length=361

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 76/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PA+NDVT  EL +I+++                       N +DG   G  +  L V  +
Sbjct  248  PAINDVTYTELTEILSQL----------------------NDEDGQLIGVDTSNLQVANS  285

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G     IDL +VS ELA    DADL+I+EGMGR + TN  A+FKCD+LK+ MVK+  +AE
Sbjct  286  GNDLAVIDLSRVSQELADISADADLVIIEGMGRGIETNLYAQFKCDSLKIGMVKHIEVAE  345

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  346  -FLGGRLYDCVFKY  358



>pdb|1XFI|A Chain A, X-Ray Structure Of Gene Product From Arabidopsis Thaliana 
At2g17340
 pdb|2Q40|A Chain A, Ensemble Refinement Of The Protein Crystal Structure 
Of Gene Product From Arabidopsis Thaliana At2g17340
Length=367

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 78/134 (58%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++ND+T  EL +I+++            E G LL             G  +  L++  +
Sbjct  252  PSINDITCTELTEILSQLKD---------ENGQLL-------------GVDTSKLLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    DADL+I+EGMGR + TN  A+FKCD+LK+ MVK+  +AE
Sbjct  290  GNDLPVIDLSRVSQELAYLSSDADLVIVEGMGRGIETNLYAQFKCDSLKIGMVKHLEVAE  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV ++
Sbjct  350  -FLGGRLYDCVFKF  362



>ref|XP_006364340.1| PREDICTED: uncharacterized protein At2g17340-like isoform X1 
[Solanum tuberosum]
Length=364

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 75/134 (56%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++     G   G        VD  N              L+V  +
Sbjct  249  PSINDVTYPELVEIISKLKDEQGKLVG--------VDTSN--------------LLVANS  286

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL  +S ELA    DADL+ILEGMGR + TN  A+F+CD+LK+ MVK+  + E
Sbjct  287  GNDLPVIDLTGISQELAYLASDADLVILEGMGRGIETNLYAQFRCDSLKIGMVKHPEVVE  346

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  347  -FLGGRLYDCVFKY  359



>ref|XP_008799277.1| PREDICTED: uncharacterized protein At2g17340-like isoform X2 
[Phoenix dactylifera]
Length=271

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 74/134 (55%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++     G   G   +G                      L+V  +
Sbjct  155  PSINDVTYPELIEIISKLKDENGQLVGVDASG----------------------LLVANS  192

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL  VS ELA    DADL+ILEGMGR + TN  A+ KCD++K+ MVK+  +A+
Sbjct  193  GNDLPVIDLTSVSPELAYLASDADLVILEGMGRAIETNLYAQMKCDSIKIGMVKHPEVAQ  252

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  253  -FLGGRLYDCVFKY  265



>gb|AAM63619.1| unknown [Arabidopsis thaliana]
Length=367

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 78/134 (58%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++ND+T  EL +I+++            E G LL             G  +  L++  +
Sbjct  252  PSINDITHTELTEILSQLKD---------ENGQLL-------------GVDTSKLLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P I+L +VS ELA    DADL+I+EGMGR + TN  A+FKCD+LK+ MVK+  +AE
Sbjct  290  GNDLPVIBLSRVSQELAYLSSDADLVIVEGMGRGIETNLYAQFKCDSLKIGMVKHLEVAE  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV ++
Sbjct  350  -FLGGRLYDCVFKF  362



>ref|NP_565412.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q949P3.1|Y2734_ARATH RecName: Full=Uncharacterized protein At2g17340 [Arabidopsis 
thaliana]
 gb|AAK93654.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20316.1| unknown protein [Arabidopsis thaliana]
 gb|AEC06614.1| uncharacterized protein AT2G17340 [Arabidopsis thaliana]
Length=367

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 78/134 (58%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++ND+T  EL +I+++            E G LL             G  +  L++  +
Sbjct  252  PSINDITCTELTEILSQLKD---------ENGQLL-------------GVDTSKLLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    DADL+I+EGMGR + TN  A+FKCD+LK+ MVK+  +AE
Sbjct  290  GNDLPVIDLSRVSQELAYLSSDADLVIVEGMGRGIETNLYAQFKCDSLKIGMVKHLEVAE  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV ++
Sbjct  350  -FLGGRLYDCVFKF  362



>ref|XP_006680154.1| hypothetical protein BATDEDRAFT_89522 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF79438.1| hypothetical protein BATDEDRAFT_89522 [Batrachochytrium dendrobatidis 
JAM81]
Length=753

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 53/137 (39%), Positives = 79/137 (58%), Gaps = 22/137 (16%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PA+ND+TA EL  +V + ++   I R A   G                      + V   
Sbjct  639  PAVNDITATELEALVIKISRIDPIIRDAWTTG---------------------RIQVFGT  677

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G  SPC+DL +VS +L++   DADL+++EGMGR +HTN+ AKF  D+LK+A+ KN ++A 
Sbjct  678  GSCSPCLDLMRVSKDLSSFAADADLVVIEGMGRAIHTNYFAKFTVDSLKIAVFKNPQIAS  737

Query  362  KLIGGKIYDCVCRYEPA  312
            +L G K+YD +C +E A
Sbjct  738  EL-GAKMYDGMCLFEKA  753



>gb|KGB34411.1| Pantothenate kinase 4 [Schistosoma haematobium]
Length=842

 Score = 96.7 bits (239),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 56/139 (40%), Positives = 78/139 (56%), Gaps = 24/139 (17%)
 Frame = -2

Query  725  SPALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVE  546
            SPA+ND+T  EL     E   H       A    L+ +++NN Q           LM+ E
Sbjct  721  SPAINDITYQEL-----ELLLHM-----IASFEPLIAESLNNGQ-----------LMLAE  759

Query  545  NGCGSPCIDLRQVSSELA--AXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQR  372
            NG  SPC+D R ++S L   A     DLI++EGMGR +H N NAKF  D LK+A++KN  
Sbjct  760  NGQTSPCLDFRLIASSLVQLAEREQVDLIVIEGMGRAIHCNLNAKFTVDTLKIAVIKNSW  819

Query  371  LAEKLIGGKIYDCVCRYEP  315
            LA +L GG++Y  + ++EP
Sbjct  820  LARRL-GGQLYGVIFKFEP  837



>ref|XP_008451197.1| PREDICTED: uncharacterized protein At2g17340-like [Cucumis melo]
Length=367

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 77/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++     G   G        VD  N              L+V  +
Sbjct  252  PSINDVTYNELIEILSKLKDDHGQLMG--------VDTSN--------------LLVANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS EL+    DADL++LEGMGR + TN  A+FKCD+LK+ MVK+  +AE
Sbjct  290  GNDLPVIDLIRVSQELSYLAADADLVVLEGMGRGIETNLYAQFKCDSLKIGMVKHLEVAE  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVFKY  362



>ref|NP_001242288.1| uncharacterized protein LOC100804454 [Glycine max]
 gb|ACU20862.1| unknown [Glycine max]
Length=367

 Score = 94.0 bits (232),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 75/134 (56%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++     G   G + +                       L++  +
Sbjct  252  PSINDVTCSELVEIISKLKDEDGQLVGVSTSN----------------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    DADL+ LEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLTRVSQELAYLASDADLVTLEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVFKY  362



>ref|XP_003622335.1| hypothetical protein MTR_7g034660 [Medicago truncatula]
Length=368

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 78/135 (58%), Gaps = 23/135 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++            E G LL  + +N             L++  +
Sbjct  255  PSINDVTYSELIEIISQLKD---------EEGRLLGVSTSN-------------LLIANS  292

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    D DL+ILEGMGR + TN  A+F+CD++K+AMVKN  +A 
Sbjct  293  GSDLPAIDLTKVSQELACLATDVDLVILEGMGRGIETNLYAQFRCDSMKIAMVKNTGVA-  351

Query  362  KLIGGKIYDCVCRYE  318
            K +  ++YDCV +Y+
Sbjct  352  KFLKSRMYDCVIKYD  366



>ref|XP_006561827.1| PREDICTED: pantothenate kinase 4 isoform X5 [Apis mellifera]
Length=784

 Score = 96.3 bits (238),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 59/143 (41%), Positives = 82/143 (57%), Gaps = 25/143 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVT  EL   + +A+  C + R A +   L+   M  AQ G               
Sbjct  636  PALNDVTYSELVVTLRDASNICKVIRHALKENRLI--PMETAQAG---------------  678

Query  542  GCGSPCIDLRQVSSEL--AAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
                PC+DL +++ +L  A    + DLI+LEGMGR LHTNF+AK  C+ LKLA+VKN+ L
Sbjct  679  ----PCLDLSRLNLDLCLAMVKHNVDLIVLEGMGRTLHTNFHAKMTCECLKLAVVKNRWL  734

Query  368  AEKLIGGKIYDCVCRYE-PAELK  303
            A +L GG +Y  +C+YE P ++K
Sbjct  735  ARRL-GGDMYAVICKYEKPIKMK  756



>ref|XP_003622333.1| hypothetical protein MTR_7g034640 [Medicago truncatula]
 gb|KEH42821.1| pantothenate kinase [Medicago truncatula]
Length=367

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 77/134 (57%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++            E G LL             G  +  L++  +
Sbjct  254  PSINDVTYSELIEIISKLKD---------EEGRLL-------------GVSTSKLLIANS  291

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA+   D DL+ILEGMGR + TN  A+FKCD++K+AMVK+  +AE
Sbjct  292  GNDLPVIDLTKVSQELASLTSDVDLVILEGMGRGIETNLYAQFKCDSMKIAMVKHPEVAE  351

Query  362  KLIGGKIYDCVCRY  321
              +  ++YDCV +Y
Sbjct  352  -FLESRMYDCVIKY  364



>gb|KDR11647.1| hypothetical protein L798_13976, partial [Zootermopsis nevadensis]
Length=693

 Score = 95.9 bits (237),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 83/144 (58%), Gaps = 25/144 (17%)
 Frame = -2

Query  725  SPALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVE  546
            +PALNDVT  EL  ++ +AA  C +   A  AG L+  AM  AQ G              
Sbjct  567  APALNDVTHPELVVVLKQAAAICQVIHKALNAGTLM--AMETAQAG--------------  610

Query  545  NGCGSPCIDLRQVSSELA--AXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQR  372
                 PC+DL +++ +LA        DLI+LEGMGR LHTN  AKF C+ LK+A++KN+ 
Sbjct  611  -----PCLDLSRLNLDLANAMSSEGVDLIVLEGMGRALHTNLEAKFTCECLKVAVIKNRW  665

Query  371  LAEKLIGGKIYDCVCRYE-PAELK  303
            LA +L GG ++  +C+YE P E+K
Sbjct  666  LATRL-GGDMFSVLCKYEHPNEVK  688



>ref|XP_006561823.1| PREDICTED: pantothenate kinase 4 isoform X1 [Apis mellifera]
 ref|XP_006561824.1| PREDICTED: pantothenate kinase 4 isoform X2 [Apis mellifera]
 ref|XP_006561825.1| PREDICTED: pantothenate kinase 4 isoform X3 [Apis mellifera]
 ref|XP_006561826.1| PREDICTED: pantothenate kinase 4 isoform X4 [Apis mellifera]
Length=787

 Score = 96.3 bits (238),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 59/143 (41%), Positives = 82/143 (57%), Gaps = 25/143 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PALNDVT  EL   + +A+  C + R A +   L+   M  AQ G               
Sbjct  639  PALNDVTYSELVVTLRDASNICKVIRHALKENRLI--PMETAQAG---------------  681

Query  542  GCGSPCIDLRQVSSEL--AAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
                PC+DL +++ +L  A    + DLI+LEGMGR LHTNF+AK  C+ LKLA+VKN+ L
Sbjct  682  ----PCLDLSRLNLDLCLAMVKHNVDLIVLEGMGRTLHTNFHAKMTCECLKLAVVKNRWL  737

Query  368  AEKLIGGKIYDCVCRYE-PAELK  303
            A +L GG +Y  +C+YE P ++K
Sbjct  738  ARRL-GGDMYAVICKYEKPIKMK  759



>gb|ERL90334.1| hypothetical protein D910_07683 [Dendroctonus ponderosae]
 gb|ERL96090.1| hypothetical protein D910_01000 [Dendroctonus ponderosae]
Length=860

 Score = 96.3 bits (238),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 52/122 (43%), Positives = 71/122 (58%), Gaps = 21/122 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P+LNDVT  EL      AAK C I          L +A+NN Q           L+ +EN
Sbjct  239  PSLNDVTYKELNRYCRSAAKQCNI----------LKNAINNGQ-----------LLTLEN  277

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   PC+DL+ + SEL     ++DLIILEGMGR +HTN N +F  D+L++A++KN+ LA+
Sbjct  278  GQKGPCLDLKNLPSELCDLMAESDLIILEGMGRSIHTNLNTEFTVDSLRMAVLKNEWLAK  337

Query  362  KL  357
             L
Sbjct  338  SL  339



>ref|XP_008799268.1| PREDICTED: uncharacterized protein At2g17340-like isoform X1 
[Phoenix dactylifera]
Length=368

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 74/134 (55%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++     G   G   +G                      L+V  +
Sbjct  252  PSINDVTYPELIEIISKLKDENGQLVGVDASG----------------------LLVANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL  VS ELA    DADL+ILEGMGR + TN  A+ KCD++K+ MVK+  +A+
Sbjct  290  GNDLPVIDLTSVSPELAYLASDADLVILEGMGRAIETNLYAQMKCDSIKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVFKY  362



>ref|XP_003555531.2| PREDICTED: uncharacterized protein At2g17340-like isoform X1 
[Glycine max]
Length=424

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 74/135 (55%), Gaps = 23/135 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  +L +I+ +     G   G + +                       L++  +
Sbjct  311  PSINDVTYSDLIEIIPKLKDEEGRLTGVSTSN----------------------LLIANS  348

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    D DL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +AE
Sbjct  349  GNDLPVIDLTRVSQELAYLANDVDLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAE  408

Query  362  KLIGGKIYDCVCRYE  318
              +G ++YDCV +Y+
Sbjct  409  -FLGSRLYDCVIKYD  422



>ref|XP_001952497.2| PREDICTED: pantothenate kinase 4 [Acyrthosiphon pisum]
Length=761

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 55/136 (40%), Positives = 76/136 (56%), Gaps = 22/136 (16%)
 Frame = -2

Query  725  SPALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVE  546
            +PALNDVT  EL  ++ + A  C I     + G L   +M  AQ                
Sbjct  642  APALNDVTHSELVVLLRQIAAICPIISKGLDEGRL--KSMETAQ----------------  683

Query  545  NGCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLA  366
               G PC+DL ++  ELA      DLI+LEGMGR +HTN  A+F CD LKLA++KN+ LA
Sbjct  684  ---GGPCLDLSRLERELANELITVDLILLEGMGRAVHTNIEAEFVCDCLKLAIIKNRWLA  740

Query  365  EKLIGGKIYDCVCRYE  318
            ++L GG ++  VC++E
Sbjct  741  KRL-GGDMFSVVCKFE  755



>ref|XP_011000862.1| PREDICTED: uncharacterized protein At2g17340-like [Populus euphratica]
Length=367

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 74/134 (55%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+A+     G   G   +                       L++  +
Sbjct  252  PSINDVTYTELIEIIAKLKDENGQLMGVNTSN----------------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS  LA    DADL++LEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLTRVSQVLAYLASDADLVVLEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVFKY  362



>gb|KDO68379.1| hypothetical protein CISIN_1g017689mg [Citrus sinensis]
Length=297

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 74/134 (55%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++     G   G   +                       L++  +
Sbjct  182  PSINDVTYPELIEIMSKLKDEKGQLMGVDTS----------------------KLLIANS  219

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL  VS ELA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  220  GNDLPVIDLTAVSQELAYLASDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  279

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  280  -FLGGRLYDCVFKY  292



>gb|KDO68380.1| hypothetical protein CISIN_1g017689mg [Citrus sinensis]
 gb|KDO68381.1| hypothetical protein CISIN_1g017689mg [Citrus sinensis]
 gb|KDO68382.1| hypothetical protein CISIN_1g017689mg [Citrus sinensis]
Length=281

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 74/134 (55%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++     G   G   +                       L++  +
Sbjct  166  PSINDVTYPELIEIMSKLKDEKGQLMGVDTS----------------------KLLIANS  203

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL  VS ELA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  204  GNDLPVIDLTAVSQELAYLASDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  263

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  264  -FLGGRLYDCVFKY  276



>ref|XP_006606399.1| PREDICTED: uncharacterized protein At2g17340-like isoform X2 
[Glycine max]
 ref|XP_006606400.1| PREDICTED: uncharacterized protein At2g17340-like isoform X3 
[Glycine max]
Length=353

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 74/135 (55%), Gaps = 23/135 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  +L +I+ +     G   G + +                       L++  +
Sbjct  240  PSINDVTYSDLIEIIPKLKDEEGRLTGVSTSN----------------------LLIANS  277

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS ELA    D DL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +AE
Sbjct  278  GNDLPVIDLTRVSQELAYLANDVDLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAE  337

Query  362  KLIGGKIYDCVCRYE  318
              +G ++YDCV +Y+
Sbjct  338  -FLGSRLYDCVIKYD  351



>ref|XP_002064615.1| GK23730 [Drosophila willistoni]
 gb|EDW75601.1| GK23730 [Drosophila willistoni]
Length=360

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 75/137 (55%), Gaps = 22/137 (16%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P+LNDVT+ EL  ++ E +  C I + A                       S  L+V  N
Sbjct  241  PSLNDVTSRELRSLLDECSCQCAILKDAWLQ--------------------SHRLLVYAN  280

Query  542  GCGSPCIDLRQVSSEL--AAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRL  369
            G   PC+D+R +  +L  A    + DL+I+EGMGR LHTN NA F C+ LKL ++KN+ L
Sbjct  281  GQTGPCLDMRTLPRDLCEAIATNETDLLIIEGMGRALHTNLNAHFACETLKLVVIKNRWL  340

Query  368  AEKLIGGKIYDCVCRYE  318
            A+ L G +++  +C+YE
Sbjct  341  AKYLGGDEMFAVICKYE  357



>gb|ESA02283.1| hypothetical protein GLOINDRAFT_337485 [Rhizophagus irregularis 
DAOM 181602]
Length=773

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 53/135 (39%), Positives = 76/135 (56%), Gaps = 22/135 (16%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PA+ND+T  EL ++VA  A          E   L+  A             S  + V+E 
Sbjct  628  PAINDITFEELSEVVASIA----------ELDSLVAAAW-----------ASKKISVMET  666

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G  S C+DLR+++ +L    +D DLI+LEGMGR +HTN+NAKF C++LK+A+ KN   A 
Sbjct  667  GSASLCLDLRRINEDLVEACQDVDLIVLEGMGRAIHTNYNAKFTCESLKIAVFKNAATAT  726

Query  362  KLIGGKIYDCVCRYE  318
            +L G  +YD +  YE
Sbjct  727  EL-GAHMYDAIVLYE  740



>gb|EXX62049.1| pantothenate kinase [Rhizophagus irregularis DAOM 197198w]
 gb|EXX73216.1| pantothenate kinase [Rhizophagus irregularis DAOM 197198w]
Length=773

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 53/135 (39%), Positives = 76/135 (56%), Gaps = 22/135 (16%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PA+ND+T  EL ++VA  A          E   L+  A             S  + V+E 
Sbjct  628  PAINDITFEELSEVVASIA----------ELDSLVAAAW-----------ASKKISVMET  666

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G  S C+DLR+++ +L    +D DLI+LEGMGR +HTN+NAKF C++LK+A+ KN   A 
Sbjct  667  GSASLCLDLRRINEDLVEACQDVDLIVLEGMGRAIHTNYNAKFTCESLKIAVFKNAATAT  726

Query  362  KLIGGKIYDCVCRYE  318
            +L G  +YD +  YE
Sbjct  727  EL-GAHMYDAIVLYE  740



>ref|XP_009771830.1| PREDICTED: uncharacterized protein At2g17340-like [Nicotiana 
sylvestris]
Length=367

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 76/137 (55%), Gaps = 23/137 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++     G   G        VD  N              L+V  +
Sbjct  252  PSINDVTYTELVEIISKLKDEHGKLIG--------VDTSN--------------LLVANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL  VS ELA    DADL+ILEGMGR + TN  A+FKC +LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLTTVSQELAYLASDADLVILEGMGRGIETNLYAQFKCASLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRYEPA  312
              +GG++YDCV ++  A
Sbjct  350  -FLGGRLYDCVFKFNEA  365



>gb|KHN30541.1| Hypothetical protein glysoja_029978 [Glycine soja]
Length=237

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 71/135 (53%), Gaps = 23/135 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P+LNDVT  EL  I+++     G   G   +                       L++  +
Sbjct  124  PSLNDVTYAELIKIISKLKDEEGRLVGVGTSN----------------------LLIANS  161

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL +VS EL     D DL+ILEGMGR + TN  A+FKCD+LK+AMVK+  + E
Sbjct  162  GNDLPVIDLTRVSQELGNLANDLDLVILEGMGRGIETNLYAQFKCDSLKIAMVKHPEVTE  221

Query  362  KLIGGKIYDCVCRYE  318
              +G + YDCV +Y+
Sbjct  222  -FLGSRFYDCVIKYD  235



>ref|XP_005850909.1| hypothetical protein CHLNCDRAFT_19893 [Chlorella variabilis]
 gb|EFN58807.1| hypothetical protein CHLNCDRAFT_19893 [Chlorella variabilis]
Length=350

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 76/141 (54%), Gaps = 30/141 (21%)
 Frame = -2

Query  722  PALNDVTAMEL----PDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLM  555
            P++ND+TA EL    P I A  ++ C                          G  +  L 
Sbjct  233  PSINDITAAELEALLPQICAADSELC-------------------------KGVSTRQLQ  267

Query  554  VVENGCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQ  375
            VV +G G P IDL ++S ELA     ADL++LEGMGR + TN +A+F CDA+ L M+K+ 
Sbjct  268  VVASGSGLPVIDLSKISPELAEAAAGADLVVLEGMGRSIETNLHARFSCDAVNLGMIKHP  327

Query  374  RLAEKLIGGKIYDCVCRYEPA  312
             +A  L GG+++DCVC+  PA
Sbjct  328  EVAAAL-GGRLFDCVCQLRPA  347



>emb|CDY07861.1| BnaC03g47610D [Brassica napus]
Length=363

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 75/134 (56%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PA+NDVT  EL +I+++                         +DG   G  +  L++  +
Sbjct  248  PAINDVTYTELTEILSQLKD----------------------EDGQLIGVDTSKLVIANS  285

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G     IDL  VS ELA    DADL+I+EGMGR + TN  A+FKCD+LK+ MVK+  +AE
Sbjct  286  GNDLAVIDLSSVSQELADISSDADLVIIEGMGRGIETNLYAQFKCDSLKIGMVKHIEVAE  345

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  346  -FLGGRLYDCVFKY  358



>ref|XP_007152408.1| hypothetical protein PHAVU_004G127600g [Phaseolus vulgaris]
 gb|ESW24402.1| hypothetical protein PHAVU_004G127600g [Phaseolus vulgaris]
Length=367

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 75/133 (56%), Gaps = 23/133 (17%)
 Frame = -2

Query  719  ALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVENG  540
            ++NDVT  EL +I+++     G   G + +                       L++  +G
Sbjct  253  SINDVTCSELVEIISKLKDEQGHLVGVSTSN----------------------LLISNSG  290

Query  539  CGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAEK  360
               P IDL +VS ELA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+ 
Sbjct  291  NDLPVIDLTRVSQELAYLASDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ-  349

Query  359  LIGGKIYDCVCRY  321
             +GG++YDCV +Y
Sbjct  350  FLGGRLYDCVFKY  362



>ref|XP_006422408.1| hypothetical protein CICLE_v10028695mg [Citrus clementina]
 ref|XP_006486580.1| PREDICTED: uncharacterized protein At2g17340-like [Citrus sinensis]
 gb|ESR35648.1| hypothetical protein CICLE_v10028695mg [Citrus clementina]
 gb|KDO68375.1| hypothetical protein CISIN_1g017689mg [Citrus sinensis]
Length=367

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 74/134 (55%), Gaps = 23/134 (17%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            P++NDVT  EL +I+++     G   G   +                       L++  +
Sbjct  252  PSINDVTYPELIEIMSKLKDEKGQLMGVDTSK----------------------LLIANS  289

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G   P IDL  VS ELA    DADL+ILEGMGR + TN  A+FKCD+LK+ MVK+  +A+
Sbjct  290  GNDLPVIDLTAVSQELAYLASDADLVILEGMGRGIETNLYAQFKCDSLKIGMVKHPEVAQ  349

Query  362  KLIGGKIYDCVCRY  321
              +GG++YDCV +Y
Sbjct  350  -FLGGRLYDCVFKY  362



>ref|XP_009304208.1| PREDICTED: pantothenate kinase 4 isoform X8 [Danio rerio]
Length=389

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 79/138 (57%), Gaps = 26/138 (19%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNA-QDGFKDGPVSVPLMVVE  546
            PALNDVT  EL  I+ E                  + AM+   Q  FK+      L +V+
Sbjct  266  PALNDVTNSEL-QILTER-----------------IAAMDPVIQSAFKEDR----LALVQ  303

Query  545  NGCGSPCIDLRQVSSELAAXXRD--ADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQR  372
            NG  SPC+DL ++   LA   R+   DL+I+EGMGR +HTN+ A   C++LKLA++KN  
Sbjct  304  NGSSSPCLDLSRLDKVLATVVRERGTDLVIIEGMGRAIHTNYYAMLSCESLKLAVIKNSW  363

Query  371  LAEKLIGGKIYDCVCRYE  318
            LAE+L GGKI+  V +YE
Sbjct  364  LAERL-GGKIFSVVFKYE  380



>gb|EXX73217.1| pantothenate kinase [Rhizophagus irregularis DAOM 197198w]
Length=744

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 53/135 (39%), Positives = 76/135 (56%), Gaps = 22/135 (16%)
 Frame = -2

Query  722  PALNDVTAMELPDIVAEAAKHCGIXRGAAEAGGLLVDAMNNAQDGFKDGPVSVPLMVVEN  543
            PA+ND+T  EL ++VA  A          E   L+  A             S  + V+E 
Sbjct  599  PAINDITFEELSEVVASIA----------ELDSLVAAAW-----------ASKKISVMET  637

Query  542  GCGSPCIDLRQVSSELAAXXRDADLIILEGMGRXLHTNFNAKFKCDALKLAMVKNQRLAE  363
            G  S C+DLR+++ +L    +D DLI+LEGMGR +HTN+NAKF C++LK+A+ KN   A 
Sbjct  638  GSASLCLDLRRINEDLVEACQDVDLIVLEGMGRAIHTNYNAKFTCESLKIAVFKNAATAT  697

Query  362  KLIGGKIYDCVCRYE  318
            +L G  +YD +  YE
Sbjct  698  EL-GAHMYDAIVLYE  711



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1354032766515