BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF010L04

Length=808
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011080124.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    261   3e-81   Sesamum indicum [beniseed]
ref|XP_009586626.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    259   2e-80   Nicotiana tomentosiformis
emb|CDP03802.1|  unnamed protein product                                260   2e-80   Coffea canephora [robusta coffee]
gb|KJB42336.1|  hypothetical protein B456_007G150200                    254   3e-79   Gossypium raimondii
gb|KJB42339.1|  hypothetical protein B456_007G150200                    254   4e-79   Gossypium raimondii
gb|KHG08643.1|  hypothetical protein F383_12346                         254   8e-79   Gossypium arboreum [tree cotton]
gb|KJB42335.1|  hypothetical protein B456_007G150200                    255   1e-78   Gossypium raimondii
ref|XP_007050148.1|  NAD(P)-binding Rossmann-fold superfamily pro...    252   1e-78   
ref|XP_002271401.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    254   3e-78   Vitis vinifera
ref|XP_009395307.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    253   4e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008459972.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    253   6e-78   Cucumis melo [Oriental melon]
ref|XP_007050147.1|  NAD(P)-binding Rossmann-fold superfamily pro...    252   1e-77   
ref|XP_010264829.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    252   1e-77   Nelumbo nucifera [Indian lotus]
gb|AFK48198.1|  unknown                                                 252   2e-77   Lotus japonicus
ref|XP_007050145.1|  NAD(P)-binding Rossmann-fold superfamily pro...    252   2e-77   
ref|XP_004247128.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    251   2e-77   
ref|XP_010036149.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    251   5e-77   Eucalyptus grandis [rose gum]
ref|XP_010936110.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    250   1e-76   Elaeis guineensis
gb|KGN46368.1|  hypothetical protein Csa_6G087960                       250   1e-76   Cucumis sativus [cucumbers]
ref|XP_006355892.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    250   1e-76   Solanum tuberosum [potatoes]
gb|EYU46388.1|  hypothetical protein MIMGU_mgv1a007681mg                249   1e-76   Erythranthe guttata [common monkey flower]
ref|XP_010548735.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    247   1e-75   Tarenaya hassleriana [spider flower]
ref|XP_003542442.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    247   2e-75   Glycine max [soybeans]
ref|XP_010540921.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    246   3e-75   Tarenaya hassleriana [spider flower]
ref|XP_011024495.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    246   4e-75   Populus euphratica
ref|XP_007144408.1|  hypothetical protein PHAVU_007G153700g             245   5e-75   Phaseolus vulgaris [French bean]
ref|XP_008372401.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    245   5e-75   Malus domestica [apple tree]
ref|XP_009335235.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    245   5e-75   Pyrus x bretschneideri [bai li]
gb|ABK94679.1|  unknown                                                 244   1e-74   Populus trichocarpa [western balsam poplar]
ref|XP_002301843.1|  hypothetical protein POPTR_0002s25720g             244   1e-74   Populus trichocarpa [western balsam poplar]
gb|ACJ84721.1|  unknown                                                 244   3e-74   Medicago truncatula
gb|KDP26455.1|  hypothetical protein JCGZ_17613                         243   4e-74   Jatropha curcas
ref|XP_011458045.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    243   6e-74   Fragaria vesca subsp. vesca
ref|XP_009370595.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    243   8e-74   Pyrus x bretschneideri [bai li]
ref|XP_007201067.1|  hypothetical protein PRUPE_ppa006705mg             243   8e-74   
ref|XP_008382707.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    243   1e-73   
gb|ACU23211.1|  unknown                                                 241   3e-73   Glycine max [soybeans]
ref|XP_004495054.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    241   3e-73   Cicer arietinum [garbanzo]
ref|XP_004140669.1|  PREDICTED: ABC transporter C family member 5...    253   3e-72   
gb|EPS69627.1|  hypothetical protein M569_05135                         236   6e-72   Genlisea aurea
ref|XP_002321296.2|  hypothetical protein POPTR_0014s18680g             237   6e-72   
ref|XP_009370589.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    236   3e-71   Pyrus x bretschneideri [bai li]
ref|XP_006854436.1|  hypothetical protein AMTR_s00039p00218660          234   8e-71   Amborella trichopoda
ref|XP_010940664.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    234   2e-70   
gb|EEE58042.1|  hypothetical protein OsJ_08874                          231   2e-70   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004954373.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    233   4e-70   Setaria italica
ref|XP_008789505.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    233   4e-70   Phoenix dactylifera
dbj|BAG95473.1|  unnamed protein product                                230   4e-70   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010091822.1|  hypothetical protein L484_015891                   232   1e-69   Morus notabilis
ref|XP_002453037.1|  hypothetical protein SORBIDRAFT_04g037200          232   1e-69   Sorghum bicolor [broomcorn]
gb|EEC74241.1|  hypothetical protein OsI_09443                          231   2e-69   Oryza sativa Indica Group [Indian rice]
ref|NP_001048516.1|  Os02g0816800                                       231   2e-69   
ref|XP_006648113.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    229   5e-69   
gb|ACF85773.1|  unknown                                                 230   6e-69   Zea mays [maize]
ref|XP_002526534.1|  NADH-ubiquinone oxidoreductase 39 kD subunit...    228   3e-68   
gb|AFW74028.1|  NADH-ubiquinone oxidoreductase subunit                  229   4e-68   
ref|XP_006443722.1|  hypothetical protein CICLE_v10020464mg             228   5e-68   
ref|NP_001149069.1|  LOC100282690                                       227   1e-67   
ref|XP_003570393.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    226   2e-67   
gb|EMT17104.1|  putative NADH dehydrogenase (ubiquinone) 1 alpha ...    220   5e-66   
gb|EMS47161.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    219   7e-66   Triticum urartu
dbj|BAH20309.1|  AT2G20360                                              219   9e-66   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ86608.1|  predicted protein                                      222   1e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010684864.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    221   1e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_565469.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomp...    221   2e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002884196.1|  catalytic/ coenzyme binding protein                219   6e-65   Arabidopsis lyrata subsp. lyrata
ref|XP_010489051.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    218   4e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010415893.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    217   5e-64   Camelina sativa [gold-of-pleasure]
emb|CDY31970.1|  BnaA07g00250D                                          217   7e-64   Brassica napus [oilseed rape]
emb|CDY13877.1|  BnaA09g43790D                                          217   7e-64   Brassica napus [oilseed rape]
emb|CDY39772.1|  BnaA09g10240D                                          216   1e-63   Brassica napus [oilseed rape]
ref|XP_010467837.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    216   2e-63   Camelina sativa [gold-of-pleasure]
ref|XP_009112664.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    216   2e-63   Brassica rapa
emb|CDX81965.1|  BnaC08g36360D                                          216   2e-63   
ref|XP_009117495.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    213   1e-62   Brassica rapa
gb|KJB42340.1|  hypothetical protein B456_007G150200                    213   2e-62   Gossypium raimondii
emb|CDY03308.1|  BnaC09g10400D                                          213   3e-62   
emb|CDY05746.1|  BnaC07g00570D                                          211   9e-62   
ref|XP_009102039.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    210   3e-61   Brassica rapa
ref|XP_006408954.1|  hypothetical protein EUTSA_v10002002mg             205   2e-59   Eutrema salsugineum [saltwater cress]
gb|KDO37085.1|  hypothetical protein CISIN_1g047628mg                   203   2e-59   Citrus sinensis [apfelsine]
gb|KFK40412.1|  hypothetical protein AALP_AA3G370500                    202   4e-58   Arabis alpina [alpine rockcress]
ref|XP_008235764.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    198   7e-57   Prunus mume [ume]
gb|ABK24353.1|  unknown                                                 195   2e-55   Picea sitchensis
gb|KJB42337.1|  hypothetical protein B456_007G150200                    169   3e-46   Gossypium raimondii
gb|KJB42338.1|  hypothetical protein B456_007G150200                    169   4e-46   Gossypium raimondii
ref|XP_009803384.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    153   3e-42   Nicotiana sylvestris
gb|KJB42341.1|  hypothetical protein B456_007G150200                    132   9e-33   Gossypium raimondii
ref|XP_002976090.1|  hypothetical protein SELMODRAFT_104564             130   9e-32   
ref|XP_002968287.1|  hypothetical protein SELMODRAFT_89106              130   1e-31   
ref|XP_001765756.1|  predicted protein                                  129   6e-31   
ref|XP_001757609.1|  predicted protein                                  126   5e-30   
ref|XP_009763970.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    111   5e-25   Nicotiana sylvestris
ref|XP_005651289.1|  NAD(P)-binding protein                             106   5e-23   Coccomyxa subellipsoidea C-169
sp|Q0DWQ7.1|CCB12_ORYSJ  RecName: Full=Cyclin-B1-2; AltName: Full...    103   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74184.1|  hypothetical protein OsI_09314                          103   4e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_001420142.1|  predicted protein                                97.1    8e-20   Ostreococcus lucimarinus CCE9901
emb|CEF99374.1|  NAD(P)-binding domain                                95.9    2e-19   Ostreococcus tauri
ref|XP_003059930.1|  predicted protein                                92.4    3e-18   Micromonas pusilla CCMP1545
ref|WP_026986147.1|  3-beta hydroxysteroid dehydrogenase              86.3    2e-16   Fodinicurvata fenggangensis
ref|XP_002504449.1|  predicted protein                                87.0    3e-16   Micromonas commoda
ref|XP_007510295.1|  predicted protein                                86.7    6e-16   Bathycoccus prasinos
ref|WP_022729668.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    84.0    2e-15   Fodinicurvata sediminis
ref|XP_011401632.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...  79.3    1e-13   Auxenochlorella protothecoides
ref|XP_005850526.1|  hypothetical protein CHLNCDRAFT_34039            79.3    1e-13   Chlorella variabilis
ref|WP_027287982.1|  3-beta hydroxysteroid dehydrogenase              77.0    5e-13   Rhodovibrio salinarum
ref|WP_035069164.1|  3-beta hydroxysteroid dehydrogenase              75.9    1e-12   
ref|WP_039540296.1|  3-beta hydroxysteroid dehydrogenase              74.7    4e-12   Ruegeria sp. ANG-R
ref|WP_038036038.1|  3-beta hydroxysteroid dehydrogenase              73.6    9e-12   
ref|WP_038005934.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...  73.2    1e-11   Thalassobacter
ref|WP_009757683.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    72.4    2e-11   Ahrensia sp. R2A130
dbj|GAK45366.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcompl...  72.4    2e-11   Tepidicaulis marinus
ref|WP_041768854.1|  3-beta hydroxysteroid dehydrogenase              72.4    2e-11   
gb|AEV35208.1|  NADH dehydrogenase (ubiquinone)                       72.4    2e-11   Pseudovibrio sp. FO-BEG1
ref|WP_027845124.1|  3-beta hydroxysteroid dehydrogenase              72.0    3e-11   
ref|WP_012180246.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    72.0    4e-11   Dinoroseobacter shibae
ref|WP_008235576.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    71.6    4e-11   Roseobacter sp. CCS2
ref|WP_044830089.1|  3-beta hydroxysteroid dehydrogenase              71.6    4e-11   Thalassospira sp. HJ
ref|WP_027279004.1|  3-beta hydroxysteroid dehydrogenase              71.6    4e-11   Rhodopseudomonas palustris
gb|EEA95143.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomple...  71.2    6e-11   Pseudovibrio sp. JE062
ref|WP_039459013.1|  hypothetical protein                             70.9    6e-11   
ref|WP_037036496.1|  3-beta hydroxysteroid dehydrogenase              71.2    6e-11   
ref|WP_029621248.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...  71.2    6e-11   Rhizobium/Agrobacterium group
gb|KIE04291.1|  NADH dehydrogenase (Ubiquinone) 1 alpha subcomple...  70.9    6e-11   Candidatus Jidaibacter acanthamoeba
ref|WP_035693857.1|  3-beta hydroxysteroid dehydrogenase              70.9    7e-11   
ref|WP_043948096.1|  3-beta hydroxysteroid dehydrogenase              71.2    7e-11   Candidatus Phaeomarinobacter ectocarpi
ref|WP_037065538.1|  3-beta hydroxysteroid dehydrogenase              70.9    7e-11   Rhizobium leguminosarum
ref|WP_008943960.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    70.9    9e-11   Oceanibaculum indicum
ref|WP_007088365.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    70.9    9e-11   Thalassospira xiamenensis
ref|WP_020043898.1|  hypothetical protein                             70.9    9e-11   
ref|WP_012589203.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    70.9    1e-10   Methylocella silvestris
ref|WP_011661958.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    70.5    1e-10   Rhodopseudomonas palustris
ref|WP_008563283.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    70.5    1e-10   Ruegeria sp. R11
ref|WP_025055104.1|  3-beta hydroxysteroid dehydrogenase              70.5    1e-10   Sulfitobacter noctilucicola
ref|WP_036555293.1|  3-beta hydroxysteroid dehydrogenase              70.1    2e-10   Nisaea denitrificans
ref|WP_035694954.1|  3-beta hydroxysteroid dehydrogenase              70.1    2e-10   Aurantimonas coralicida
ref|WP_040489901.1|  3-beta hydroxysteroid dehydrogenase              70.1    2e-10   
ref|WP_022702351.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    70.1    2e-10   Pseudorhodobacter ferrugineus
gb|EAU41592.1|  putative oxidoreductase protein                       70.1    2e-10   Fulvimarina pelagi HTCC2506
ref|WP_010442913.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    69.7    2e-10   Ruegeria conchae
ref|WP_038460290.1|  hypothetical protein                             69.7    2e-10   
ref|WP_026756898.1|  3-beta hydroxysteroid dehydrogenase              69.7    2e-10   Sediminimonas qiaohouensis
ref|WP_008888927.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    69.7    2e-10   Thalassospira profundimaris
ref|WP_019199324.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    69.7    2e-10   Bradyrhizobiaceae
ref|WP_037247334.1|  3-beta hydroxysteroid dehydrogenase              69.7    2e-10   Roseovarius sp. MCTG156(2b)
gb|EAQ24510.1|  NADH ubiquinone oxidoreductase, putative              69.7    2e-10   Roseovarius sp. 217
ref|WP_040326025.1|  3-beta hydroxysteroid dehydrogenase              69.7    2e-10   
ref|WP_040651183.1|  3-beta hydroxysteroid dehydrogenase              69.7    2e-10   Roseovarius sp. 217
ref|WP_009502685.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    69.7    2e-10   Rhodobacteraceae
ref|WP_021102609.1|  NAD-dependent epimerase/dehydratase              69.7    2e-10   Litoreibacter arenae
ref|WP_007206117.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    69.3    2e-10   Yoonia vestfoldensis
ref|WP_033070199.1|  3-beta hydroxysteroid dehydrogenase              69.7    3e-10   Thalassospira australica
gb|EAS48786.1|  NADH-ubiquinone oxidoreductase                        69.7    3e-10   Aurantimonas manganoxydans SI85-9A1
ref|WP_035569694.1|  3-beta hydroxysteroid dehydrogenase              69.3    3e-10   Hyphomonas adhaerens
ref|WP_027297804.1|  3-beta hydroxysteroid dehydrogenase              68.9    3e-10   Rhodospirillales bacterium URHD0088
ref|WP_014876487.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    69.3    3e-10   Phaeobacter inhibens
ref|WP_042689500.1|  3-beta hydroxysteroid dehydrogenase              69.3    3e-10   Azospirillum sp. B506
ref|WP_037314823.1|  3-beta hydroxysteroid dehydrogenase              69.3    3e-10   Ruegeria halocynthiae
ref|WP_011453372.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    69.3    3e-10   Jannaschia sp. CCS1
ref|WP_038279873.1|  3-beta hydroxysteroid dehydrogenase              68.9    4e-10   alpha proteobacterium Mf 1.05b.01
ref|WP_024514903.1|  3-beta hydroxysteroid dehydrogenase              68.9    4e-10   Bradyrhizobium sp. Tv2a-2
ref|WP_020042805.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    68.9    4e-10   Salipiger mucosus
ref|WP_025063871.1|  3-beta hydroxysteroid dehydrogenase              68.9    4e-10   Sulfitobacter guttiformis
ref|WP_019960527.1|  hypothetical protein                             68.9    4e-10   Woodsholea maritima
ref|WP_027235881.1|  3-beta hydroxysteroid dehydrogenase              68.9    4e-10   Leisingera caerulea
ref|WP_009604313.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    68.6    5e-10   SAR116 cluster alpha proteobacterium HIMB100
ref|WP_002717736.1|  hypothetical protein                             68.6    5e-10   Afipia felis
ref|WP_028286897.1|  3-beta hydroxysteroid dehydrogenase              68.6    6e-10   Pseudooceanicola nanhaiensis
ref|WP_024317749.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...  68.6    6e-10   Rhizobium favelukesii
ref|WP_005979714.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    68.2    6e-10   Ruegeria lacuscaerulensis
ref|WP_028793393.1|  3-beta hydroxysteroid dehydrogenase              68.2    6e-10   Thalassobaculum salexigens
ref|WP_014249039.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    67.8    9e-10   Azospirillum lipoferum
ref|WP_037989144.1|  3-beta hydroxysteroid dehydrogenase              67.8    9e-10   Thalassospira
ref|WP_041801299.1|  3-beta hydroxysteroid dehydrogenase              67.8    1e-09   Rhodopseudomonas palustris
ref|WP_023663859.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    67.8    1e-09   
ref|WP_022673628.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    67.8    1e-09   Sphingopyxis baekryungensis
ref|WP_037942904.1|  3-beta hydroxysteroid dehydrogenase              67.4    1e-09   Sulfitobacter
ref|WP_011909724.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    67.4    1e-09   Rhodobacter
gb|ABD86012.1|  NAD-dependent epimerase/dehydratase                   67.8    1e-09   Rhodopseudomonas palustris BisB18
ref|WP_024512948.1|  3-beta hydroxysteroid dehydrogenase              67.4    1e-09   Bradyrhizobium sp. ARR65
ref|WP_043773282.1|  3-beta hydroxysteroid dehydrogenase              67.4    1e-09   Roseivivax isoporae
ref|WP_043844369.1|  3-beta hydroxysteroid dehydrogenase              67.4    1e-09   Roseivivax marinus
ref|WP_037115283.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...  67.4    1e-09   Rhizobium
ref|WP_022713397.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    67.4    1e-09   Rhizobium mongolense
ref|WP_036515289.1|  3-beta hydroxysteroid dehydrogenase              67.0    2e-09   
ref|WP_039185049.1|  3-beta hydroxysteroid dehydrogenase              67.0    2e-09   Leisingera sp. ANG-M7
ref|WP_040179076.1|  3-beta hydroxysteroid dehydrogenase              67.0    2e-09   Phaeobacter sp. S60
ref|WP_012482360.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    67.0    2e-09   Rhizobium etli
ref|WP_016735020.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    67.0    2e-09   Rhizobium phaseoli
ref|WP_018855187.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    66.6    2e-09   Rhizobium sp. 42MFCr.1
ref|WP_018116836.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...  66.6    2e-09   Rhizobium
ref|WP_039846586.1|  3-beta hydroxysteroid dehydrogenase              66.6    2e-09   
ref|WP_037114878.1|  3-beta hydroxysteroid dehydrogenase              66.6    2e-09   Rhizobium
ref|WP_007529376.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    66.6    2e-09   Rhizobium mesoamericanum
gb|EGE59004.1|  putative NADH dehydrogenase/NADH dehydrogenase (u...  67.0    2e-09   Rhizobium etli CNPAF512
ref|WP_029057708.1|  3-beta hydroxysteroid dehydrogenase              66.6    2e-09   Stappia stellulata
ref|WP_041345268.1|  3-beta hydroxysteroid dehydrogenase              66.6    3e-09   Nitrobacter winogradskyi
ref|WP_024098971.1|  putative nucleoside-diphosphate-sugar epimerase  66.6    3e-09   Phaeobacter gallaeciensis
ref|WP_033963518.1|  3-beta hydroxysteroid dehydrogenase              66.2    3e-09   Sphingomonas
ref|WP_013300115.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    66.2    3e-09   Parvularcula bermudensis
gb|ABA03434.1|  NAD-dependent epimerase/dehydratase                   66.6    3e-09   Nitrobacter winogradskyi Nb-255
ref|WP_036260034.1|  3-beta hydroxysteroid dehydrogenase              66.2    3e-09   Methylocapsa aurea
ref|WP_007118555.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    66.2    3e-09   Sulfitobacter indolifex
ref|WP_009825787.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    66.2    4e-09   Sulfitobacter
ref|WP_023449911.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    66.2    4e-09   Asticcacaulis sp. AC402
ref|WP_005850924.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    66.2    4e-09   Sulfitobacter sp. EE-36
ref|WP_036368672.1|  3-beta hydroxysteroid dehydrogenase              63.2    4e-09   
ref|WP_034992883.1|  3-beta hydroxysteroid dehydrogenase              65.9    4e-09   Beijerinckia mobilis
ref|WP_039712493.1|  3-beta hydroxysteroid dehydrogenase              65.9    4e-09   
ref|WP_037518255.1|  3-beta hydroxysteroid dehydrogenase              65.9    4e-09   Sphingopyxis sp. LC81
ref|XP_005965302.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...  65.9    5e-09   Pantholops hodgsonii [Tibetan antelope]
ref|WP_009796496.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    65.9    5e-09   Nitrobacter sp. Nb-311A
ref|WP_007674128.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    65.9    5e-09   alpha proteobacterium BAL199
ref|WP_015089185.1|  short chain dehydrogenase family protein         65.9    5e-09   Candidatus Endolissoclinum faulkneri
ref|WP_043140566.1|  3-beta hydroxysteroid dehydrogenase              65.9    5e-09   Mameliella alba
ref|WP_028096083.1|  3-beta hydroxysteroid dehydrogenase              65.5    6e-09   Dongia sp. URHE0060
ref|WP_011540134.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    65.5    6e-09   Ruegeria sp. TM1040
ref|WP_037482058.1|  3-beta hydroxysteroid dehydrogenase              65.5    6e-09   Sphingomonas paucimobilis
ref|WP_010406527.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    65.5    6e-09   Sphingomonas echinoides
ref|WP_008596326.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    65.5    6e-09   Nitratireductor pacificus
ref|WP_037964625.1|  3-beta hydroxysteroid dehydrogenase              65.5    6e-09   Sulfitobacter pontiacus
gb|EKE10168.1|  NADH dehydrogenase (Ubiquinone) 1 alpha subcomple...  65.5    6e-09   uncultured bacterium
ref|WP_007811933.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    65.5    6e-09   Roseobacter sp. AzwK-3b
ref|WP_027581325.1|  3-beta hydroxysteroid dehydrogenase              65.5    6e-09   Bradyrhizobium sp. Ai1a-2
ref|WP_007255607.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    65.5    7e-09   Oceanicola granulosus
gb|AIF81505.1|  NADH dehydrogenase (ubiquinone)                       65.1    7e-09   endosymbiont of Acanthamoeba sp. UWC8
ref|WP_028164836.1|  3-beta hydroxysteroid dehydrogenase              65.5    7e-09   Bradyrhizobium elkanii
ref|WP_038541460.1|  hypothetical protein                             65.1    7e-09   
ref|WP_022733802.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    65.5    7e-09   Thalassospira lucentensis
ref|WP_039192493.1|  3-beta hydroxysteroid dehydrogenase              65.5    7e-09   Leisingera sp. ANG-M6
ref|WP_039135139.1|  3-beta hydroxysteroid dehydrogenase              65.1    8e-09   Leisingera sp. ANG-Vp
ref|WP_039147810.1|  3-beta hydroxysteroid dehydrogenase              65.1    8e-09   Leisingera sp. ANG-DT
ref|WP_006271410.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    65.1    8e-09   Asticcacaulis biprosthecium
ref|WP_007799503.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    65.1    8e-09   Rhizobium sp. CF122
ref|WP_029204950.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...  65.1    8e-09   Leisingera
ref|WP_035581487.1|  3-beta hydroxysteroid dehydrogenase              65.1    8e-09   Hyphomonas jannaschiana
ref|WP_037100746.1|  3-beta hydroxysteroid dehydrogenase              65.1    8e-09   Rhizobium alamii
ref|WP_035842520.1|  3-beta hydroxysteroid dehydrogenase              65.1    9e-09   Defluviimonas
ref|WP_034465154.1|  3-beta hydroxysteroid dehydrogenase              65.1    9e-09   Afipia sp. P52-10
ref|WP_037188156.1|  3-beta hydroxysteroid dehydrogenase              65.1    9e-09   Rhizobium sp. YR519
ref|WP_044214941.1|  3-beta hydroxysteroid dehydrogenase              65.1    9e-09   Candidatus Endolissoclinum faulkneri
ref|WP_028034557.1|  3-beta hydroxysteroid dehydrogenase              65.1    9e-09   Chelativorans sp. J32
ref|WP_040174985.1|  3-beta hydroxysteroid dehydrogenase              65.1    1e-08   Phaeobacter piscinae
dbj|BAE57582.1|  unnamed protein product                              62.8    1e-08   Aspergillus oryzae RIB40
ref|WP_019955460.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    65.1    1e-08   Yoonia vestfoldensis
gb|KJB42342.1|  hypothetical protein B456_007G150200                  63.9    1e-08   Gossypium raimondii
ref|WP_004617165.1|  putative nucleoside-diphosphate sugar epimerase  64.7    1e-08   Caulobacter vibrioides
ref|WP_037019716.1|  3-beta hydroxysteroid dehydrogenase              65.1    1e-08   Rhizobiales bacterium YIM 77505
gb|AHC74005.1|  NADH dehydrogenase (Ubiquinone) 1 alpha subcomplex 9  65.1    1e-08   Candidatus Endolissoclinum faulkneri L5
ref|WP_039195170.1|  3-beta hydroxysteroid dehydrogenase              65.1    1e-08   Aureimonas altamirensis
ref|WP_037197314.1|  3-beta hydroxysteroid dehydrogenase              64.7    1e-08   Rhizobium
ref|WP_011642056.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    64.7    1e-08   Maricaulis maris
ref|WP_037130671.1|  3-beta hydroxysteroid dehydrogenase              64.7    1e-08   Rhizobium sp. CF394
ref|WP_037457841.1|  3-beta hydroxysteroid dehydrogenase              64.7    1e-08   Skermanella stibiiresistens
ref|WP_038686352.1|  3-beta hydroxysteroid dehydrogenase              64.7    1e-08   Rhizobium
ref|WP_017966662.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    64.7    1e-08   Rhizobium leguminosarum
ref|WP_025311295.1|  3-beta hydroxysteroid dehydrogenase              64.7    1e-08   Roseibacterium elongatum
ref|WP_034826583.1|  3-beta hydroxysteroid dehydrogenase              64.7    1e-08   Hyphomonas
ref|WP_008035619.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    64.7    1e-08   Rhodobacterales bacterium HTCC2255
ref|WP_011049451.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    64.7    1e-08   Ruegeria pomeroyi
ref|WP_033315105.1|  3-beta hydroxysteroid dehydrogenase              64.3    1e-08   
gb|KCZ50818.1|  hypothetical protein HY2_13305                        64.7    1e-08   Hyphomonas sp. T16B2
ref|WP_025059102.1|  3-beta hydroxysteroid dehydrogenase              64.3    1e-08   Sulfitobacter donghicola
ref|WP_007813453.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    64.3    2e-08   Rhizobium sp. CF142
ref|WP_027283955.1|  3-beta hydroxysteroid dehydrogenase              64.3    2e-08   Rubritepida flocculans
ref|WP_008524875.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    64.3    2e-08   Rhizobium sp. Pop5
ref|WP_029585516.1|  3-beta hydroxysteroid dehydrogenase              64.3    2e-08   Bradyrhizobium sp. URHD0069
gb|ACM02407.1|  NAD-dependent epimerase/dehydratase                   64.3    2e-08   Rhodobacter sphaeroides KD131
ref|WP_011338750.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    64.3    2e-08   Rhodobacter sphaeroides
ref|WP_009563193.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...  64.3    2e-08   Rhodobacter
ref|WP_031554361.1|  3-beta hydroxysteroid dehydrogenase              64.3    2e-08   Parvularcula oceani
ref|WP_005618365.1|  3-beta hydroxysteroid dehydrogenase/isomerase    64.3    2e-08   Epibacterium mobile
ref|WP_014881596.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    64.3    2e-08   Phaeobacter inhibens
ref|WP_035382329.1|  3-beta hydroxysteroid dehydrogenase              63.9    2e-08   Acetobacter tropicalis
ref|WP_027443744.1|  3-beta hydroxysteroid dehydrogenase              63.9    2e-08   Porphyrobacter cryptus
gb|KGB20951.1|  NAD-dependent epimerase/dehydratase                   63.9    2e-08   Acetobacter tropicalis
ref|WP_011508790.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    63.9    2e-08   Nitrobacter hamburgensis
ref|WP_009449172.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    63.9    2e-08   Nitratireductor indicus
gb|ABL97602.1|  NADH-ubiquinone oxidoreductase                        63.9    2e-08   uncultured marine bacterium EB0_39F01
ref|WP_005854527.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    63.9    2e-08   
ref|WP_027574763.1|  3-beta hydroxysteroid dehydrogenase              63.9    2e-08   
ref|WP_021237045.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    63.5    2e-08   
ref|WP_037470301.1|  3-beta hydroxysteroid dehydrogenase              63.5    3e-08   
ref|WP_016552421.1|  NAD-dependent epimerase/dehydratase              63.5    3e-08   
ref|WP_044538016.1|  3-beta hydroxysteroid dehydrogenase              63.5    3e-08   
ref|WP_037267370.1|  3-beta hydroxysteroid dehydrogenase              63.5    3e-08   
gb|KIX16649.1|  3-beta hydroxysteroid dehydrogenase                   63.5    3e-08   
ref|WP_027510598.1|  3-beta hydroxysteroid dehydrogenase              63.5    3e-08   
ref|WP_044427727.1|  3-beta hydroxysteroid dehydrogenase              63.2    3e-08   
ref|WP_023978499.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...  63.2    4e-08   
ref|WP_022571477.1|  putative nucleoside-diphosphate sugar epimerase  63.2    4e-08   
ref|WP_012759831.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    63.2    4e-08   
ref|WP_040133876.1|  3-beta hydroxysteroid dehydrogenase              63.2    4e-08   
ref|WP_017995781.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    63.2    4e-08   
ref|WP_025029733.1|  3-beta hydroxysteroid dehydrogenase              61.6    4e-08   
ref|WP_012654759.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    63.2    4e-08   
ref|WP_010685540.1|  NADH dehydrogenase                               63.2    4e-08   
ref|WP_037159370.1|  3-beta hydroxysteroid dehydrogenase              62.8    5e-08   
ref|WP_009829727.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    62.8    5e-08   
ref|WP_033181246.1|  3-beta hydroxysteroid dehydrogenase              62.8    5e-08   
ref|WP_014132570.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    62.8    5e-08   
ref|WP_002713828.1|  hypothetical protein                             62.8    5e-08   
ref|WP_043924186.1|  3-beta hydroxysteroid dehydrogenase              62.8    5e-08   
ref|WP_038075675.1|  3-beta hydroxysteroid dehydrogenase              62.8    5e-08   
ref|WP_035677962.1|  3-beta hydroxysteroid dehydrogenase              62.8    5e-08   
gb|EGP09699.1|  NAD-dependent epimerase/dehydratase                   62.8    6e-08   
ref|WP_039949916.1|  3-beta hydroxysteroid dehydrogenase              62.8    6e-08   
gb|EDZ48344.1|  3-beta hydroxysteroid dehydrogenase/isomerase         62.8    6e-08   
ref|WP_038328123.1|  hypothetical protein                             62.8    6e-08   
ref|XP_001702653.1|  NADH:ubiquinone oxidoreductase 39 kDa subunit    62.8    6e-08   
ref|WP_008282644.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    62.8    6e-08   
ref|XP_002374929.1|  NADH-ubiquinone oxidoreductase 39 kDa subuni...  62.8    6e-08   
ref|WP_003544730.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    62.8    6e-08   
ref|WP_027540030.1|  3-beta hydroxysteroid dehydrogenase              62.8    6e-08   
ref|WP_003589083.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    62.8    6e-08   
ref|WP_002721585.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    62.8    6e-08   
ref|WP_034514069.1|  3-beta hydroxysteroid dehydrogenase              62.8    6e-08   
ref|WP_035549617.1|  3-beta hydroxysteroid dehydrogenase              62.8    6e-08   
ref|WP_009813247.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    62.4    6e-08   
ref|WP_038378462.1|  3-beta hydroxysteroid dehydrogenase              62.0    6e-08   
ref|WP_035742706.1|  3-beta hydroxysteroid dehydrogenase              62.4    7e-08   
ref|WP_012040577.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    62.4    7e-08   
ref|WP_009177486.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    62.4    7e-08   
ref|WP_015497211.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    62.4    7e-08   
ref|WP_018304478.1|  hypothetical protein                             62.4    7e-08   
ref|WP_018698724.1|  hypothetical protein                             62.4    7e-08   
ref|WP_018269295.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    62.4    8e-08   
ref|WP_020052566.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    62.4    8e-08   
ref|WP_018899326.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    62.4    9e-08   
ref|WP_012520729.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    62.4    9e-08   
ref|WP_028750945.1|  3-beta hydroxysteroid dehydrogenase              62.0    9e-08   
ref|XP_005706979.1|  NADH dehydrogenase                               62.0    9e-08   
ref|WP_007007136.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    62.0    1e-07   
emb|CEJ82865.1|  Putative NADH-ubiquinone oxidoreductase 40 kDa s...  61.6    1e-07   
ref|WP_012384305.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    62.0    1e-07   
ref|WP_035308782.1|  3-beta hydroxysteroid dehydrogenase              62.0    1e-07   
ref|WP_020057796.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    62.0    1e-07   
ref|WP_029206735.1|  hypothetical protein                             60.8    1e-07   
ref|WP_027543723.1|  3-beta hydroxysteroid dehydrogenase              62.0    1e-07   
ref|WP_035048773.1|  3-beta hydroxysteroid dehydrogenase              62.0    1e-07   
ref|WP_007603966.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    62.0    1e-07   
ref|WP_024830819.1|  3-beta hydroxysteroid dehydrogenase              62.0    1e-07   
ref|WP_024322235.1|  3-beta hydroxysteroid dehydrogenase              62.0    1e-07   
ref|WP_015663304.1|  hypothetical protein                             62.0    1e-07   
ref|WP_036556342.1|  3-beta hydroxysteroid dehydrogenase              62.0    1e-07   
emb|CEJ82864.1|  Putative NADH/ubiquinone oxidoreductase              62.0    1e-07   
ref|WP_023452874.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    61.6    1e-07   
ref|WP_027566186.1|  3-beta hydroxysteroid dehydrogenase              61.6    1e-07   
ref|WP_011083542.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...  61.6    1e-07   
ref|WP_014101643.1|  NAD dependent epimerase/dehydratase family p...  61.6    1e-07   
ref|WP_013847829.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    61.6    1e-07   
ref|WP_026607026.1|  3-beta hydroxysteroid dehydrogenase              61.6    1e-07   
ref|WP_024881214.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...  61.6    1e-07   
ref|WP_025425609.1|  3-beta hydroxysteroid dehydrogenase              61.6    1e-07   
ref|WP_037906169.1|  3-beta hydroxysteroid dehydrogenase              61.6    1e-07   
ref|WP_026604801.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...  61.6    1e-07   
dbj|GAL96327.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase        61.6    1e-07   
ref|WP_028745342.1|  3-beta hydroxysteroid dehydrogenase              61.6    2e-07   
dbj|GAA08295.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase        61.6    2e-07   
ref|WP_028172481.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...  61.6    2e-07   
ref|WP_018485276.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    61.6    2e-07   
ref|WP_039904075.1|  3-beta hydroxysteroid dehydrogenase              61.2    2e-07   
emb|CCF21999.1|  putative NADH dehydrogenase/NADH dehydrogenase (...  61.2    2e-07   
ref|WP_034766843.1|  3-beta hydroxysteroid dehydrogenase              61.2    2e-07   
ref|WP_026942916.1|  3-beta hydroxysteroid dehydrogenase              61.2    2e-07   
ref|WP_043073290.1|  3-beta hydroxysteroid dehydrogenase              61.6    2e-07   
ref|WP_035707674.1|  3-beta hydroxysteroid dehydrogenase              61.2    2e-07   
ref|WP_025047295.1|  3-beta hydroxysteroid dehydrogenase              61.2    2e-07   
ref|WP_040464972.1|  3-beta hydroxysteroid dehydrogenase              61.2    2e-07   
ref|WP_018323467.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    61.2    2e-07   
gb|EAQ28235.1|  putative NADH dehydrogenase (ubiquinone) 1 alpha ...  61.2    2e-07   
ref|WP_012318051.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    61.6    2e-07   
ref|WP_027514755.1|  3-beta hydroxysteroid dehydrogenase              61.2    2e-07   
ref|WP_029360442.1|  3-beta hydroxysteroid dehydrogenase              61.6    2e-07   
ref|WP_009028277.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    61.2    2e-07   
ref|WP_019977208.1|  hypothetical protein                             61.2    2e-07   
ref|WP_034796574.1|  3-beta hydroxysteroid dehydrogenase              61.2    2e-07   
ref|WP_011923395.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    61.2    2e-07   
ref|WP_006725017.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    61.2    2e-07   
gb|EWM25568.1|  nadh dehydrogenase                                    60.8    2e-07   
ref|WP_018267837.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    61.2    2e-07   
ref|WP_011423696.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    61.2    2e-07   
ref|WP_009338703.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    60.8    2e-07   
ref|WP_025396797.1|  3-beta hydroxysteroid dehydrogenase              60.8    2e-07   
ref|WP_024587909.1|  3-beta hydroxysteroid dehydrogenase              60.8    2e-07   
ref|WP_008262623.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    60.8    2e-07   
ref|WP_025042801.1|  3-beta hydroxysteroid dehydrogenase              60.8    2e-07   
ref|WP_027256935.1|  3-beta hydroxysteroid dehydrogenase              60.8    2e-07   
ref|WP_035250386.1|  3-beta hydroxysteroid dehydrogenase              60.8    2e-07   
dbj|BAQ47812.1|  3-beta hydroxysteroid dehydrogenase                  61.2    2e-07   
ref|WP_027245189.1|  3-beta hydroxysteroid dehydrogenase              60.8    2e-07   
ref|WP_034804481.1|  3-beta hydroxysteroid dehydrogenase              60.8    2e-07   
ref|WP_018495693.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    60.8    2e-07   
ref|WP_029061954.1|  3-beta hydroxysteroid dehydrogenase              60.8    2e-07   
ref|WP_018069993.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    60.8    2e-07   
ref|WP_028139442.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...  60.8    3e-07   
ref|XP_959794.3|  NADH-ubiquinone oxidoreductase 40 kDa subunit       60.8    3e-07   
emb|CAA39695.1|  40 kD subunit of NADH dehydrogenase                  60.8    3e-07   
ref|XP_009853399.1|  NADH/ubiquinone oxidoreductase                   60.8    3e-07   
ref|WP_008972707.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    60.8    3e-07   
ref|WP_028758381.1|  3-beta hydroxysteroid dehydrogenase              60.8    3e-07   
dbj|BAL73348.1|  oxidoreductase                                       60.1    3e-07   
ref|WP_019906699.1|  hypothetical protein                             60.8    3e-07   
ref|WP_035694152.1|  3-beta hydroxysteroid dehydrogenase              58.2    3e-07   
ref|WP_029873971.1|  3-beta hydroxysteroid dehydrogenase              60.8    3e-07   
ref|WP_024920181.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...  60.5    3e-07   
ref|WP_006023269.1|  hypothetical protein                             60.5    3e-07   
ref|XP_003716394.1|  hypothetical protein MGG_03525                   60.8    3e-07   
ref|WP_024576732.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...  60.5    3e-07   
ref|WP_026613537.1|  3-beta hydroxysteroid dehydrogenase              60.5    3e-07   
ref|WP_018455737.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    60.5    3e-07   
ref|XP_002954591.1|  NADH:ubiquinone oxidoreductase 39 kDa subunit    60.8    3e-07   
ref|XP_005537134.1|  NADH dehydrogenase I alpha subcomplex 9, mit...  60.8    3e-07   
ref|WP_037483117.1|  3-beta hydroxysteroid dehydrogenase              60.5    3e-07   
ref|WP_044662978.1|  3-beta hydroxysteroid dehydrogenase              60.5    3e-07   
ref|WP_018447885.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    60.5    3e-07   
ref|WP_036292653.1|  3-beta hydroxysteroid dehydrogenase              60.5    3e-07   
ref|WP_024338622.1|  3-beta hydroxysteroid dehydrogenase              60.5    3e-07   
ref|WP_035704110.1|  3-beta hydroxysteroid dehydrogenase              60.5    4e-07   
ref|WP_008757424.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    60.5    4e-07   
ref|WP_026872585.1|  3-beta hydroxysteroid dehydrogenase              60.5    4e-07   
gb|KFL47188.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9  60.1    4e-07   
ref|WP_044586365.1|  3-beta hydroxysteroid dehydrogenase              60.1    4e-07   
ref|WP_009160507.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    60.1    4e-07   
ref|WP_037475950.1|  3-beta hydroxysteroid dehydrogenase              60.1    4e-07   
ref|WP_027682062.1|  3-beta hydroxysteroid dehydrogenase              60.1    4e-07   
ref|WP_003570910.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    60.1    4e-07   
ref|WP_023848333.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    60.1    4e-07   
ref|WP_019646220.1|  hypothetical protein                             60.1    5e-07   
ref|WP_012067733.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...  60.1    5e-07   
ref|WP_015466467.1|  NAD-dependent epimerase/dehydratase              60.1    5e-07   
ref|WP_037079590.1|  3-beta hydroxysteroid dehydrogenase              60.1    5e-07   
ref|WP_041747949.1|  3-beta hydroxysteroid dehydrogenase              60.1    5e-07   
ref|WP_007795117.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    60.1    5e-07   
emb|CCG09810.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase        60.1    5e-07   
ref|WP_028731730.1|  3-beta hydroxysteroid dehydrogenase              60.1    5e-07   
ref|WP_023512751.1|  putative nucleoside-diphosphate-sugar epimerase  60.1    5e-07   
ref|WP_041797805.1|  3-beta hydroxysteroid dehydrogenase              60.1    5e-07   
ref|WP_044048851.1|  3-beta hydroxysteroid dehydrogenase              60.1    5e-07   
ref|WP_043231919.1|  3-beta hydroxysteroid dehydrogenase              60.1    5e-07   
ref|WP_015501804.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    60.1    5e-07   
ref|WP_043150031.1|  3-beta hydroxysteroid dehydrogenase              59.7    5e-07   
gb|KFC75616.1|  Dehydrogenase                                         60.1    5e-07   
ref|WP_028337947.1|  3-beta hydroxysteroid dehydrogenase              59.7    6e-07   
ref|WP_018065082.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    59.7    6e-07   
ref|WP_018244432.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    59.7    6e-07   
ref|WP_017269127.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    58.2    6e-07   
gb|KEO61068.1|  hypothetical protein DT23_10935                       59.7    6e-07   
ref|WP_038128501.1|  3-beta hydroxysteroid dehydrogenase              59.7    6e-07   
ref|WP_039533427.1|  3-beta hydroxysteroid dehydrogenase              59.7    6e-07   
ref|WP_025417572.1|  3-beta hydroxysteroid dehydrogenase              59.7    6e-07   
ref|WP_028133575.1|  3-beta hydroxysteroid dehydrogenase              59.7    6e-07   
ref|WP_024810576.1|  3-beta hydroxysteroid dehydrogenase              59.7    7e-07   
ref|WP_027263800.1|  3-beta hydroxysteroid dehydrogenase              59.7    7e-07   
ref|WP_028002286.1|  3-beta hydroxysteroid dehydrogenase              59.7    7e-07   
ref|WP_007702838.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...  59.7    7e-07   
ref|WP_042252735.1|  3-beta hydroxysteroid dehydrogenase              59.7    7e-07   
ref|WP_043760846.1|  3-beta hydroxysteroid dehydrogenase              59.7    7e-07   
ref|WP_013654667.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    59.7    7e-07   
ref|WP_013031229.1|  epimerase                                        59.3    7e-07   
ref|WP_017505465.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    59.7    7e-07   
ref|WP_034833137.1|  3-beta hydroxysteroid dehydrogenase              59.7    7e-07   
gb|AIQ89022.1|  NADH dehydrogenase (Ubiquinone)                       59.7    7e-07   
ref|WP_037556717.1|  3-beta hydroxysteroid dehydrogenase              59.3    7e-07   
ref|WP_043615439.1|  3-beta hydroxysteroid dehydrogenase              59.7    7e-07   
ref|WP_043383532.1|  3-beta hydroxysteroid dehydrogenase              59.7    7e-07   
emb|CEF49462.1|  unnamed protein product                              59.3    7e-07   
ref|WP_022724440.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    59.3    7e-07   
ref|WP_013081141.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    59.3    7e-07   
ref|WP_012561625.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    59.3    7e-07   
ref|WP_026622062.1|  3-beta hydroxysteroid dehydrogenase              59.3    8e-07   
ref|WP_037456465.1|  3-beta hydroxysteroid dehydrogenase              59.3    8e-07   
ref|WP_028955725.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...  59.3    8e-07   
ref|WP_028738716.1|  3-beta hydroxysteroid dehydrogenase              59.3    8e-07   
ref|WP_023431376.1|  NAD-dependent epimerase/dehydratase              59.3    8e-07   
ref|XP_006695237.1|  NADH dehydrogenase (ubiquinone)-like protein     59.3    8e-07   
ref|WP_008205554.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    59.3    9e-07   
ref|XP_002901823.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...  59.3    9e-07   
ref|WP_007598696.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    59.3    9e-07   
ref|WP_037104352.1|  3-beta hydroxysteroid dehydrogenase              59.3    1e-06   
ref|WP_037203650.1|  3-beta hydroxysteroid dehydrogenase              59.3    1e-06   
ref|WP_031269610.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...  58.9    1e-06   
ref|WP_038548505.1|  3-beta hydroxysteroid dehydrogenase              58.9    1e-06   
ref|WP_013165148.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    59.3    1e-06   
ref|WP_011650133.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    58.9    1e-06   
gb|ERP88260.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase         58.9    1e-06   
ref|WP_017962916.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    58.9    1e-06   
ref|WP_043743545.1|  3-beta hydroxysteroid dehydrogenase              58.9    1e-06   
ref|WP_025976179.1|  3-beta hydroxysteroid dehydrogenase              58.9    1e-06   
ref|WP_029011978.1|  3-beta hydroxysteroid dehydrogenase              58.9    1e-06   
ref|WP_008143940.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    58.9    1e-06   
ref|WP_038592623.1|  3-beta hydroxysteroid dehydrogenase              58.9    1e-06   
ref|WP_044418410.1|  3-beta hydroxysteroid dehydrogenase              58.9    1e-06   
ref|WP_027242187.1|  3-beta hydroxysteroid dehydrogenase              58.9    1e-06   
ref|WP_027842051.1|  3-beta hydroxysteroid dehydrogenase              58.9    1e-06   
ref|WP_024846278.1|  3-beta hydroxysteroid dehydrogenase              58.9    1e-06   
ref|WP_026381421.1|  3-beta hydroxysteroid dehydrogenase              58.9    1e-06   
ref|WP_006612334.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    58.9    1e-06   
ref|WP_017990036.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    58.9    1e-06   
ref|WP_025602653.1|  3-beta hydroxysteroid dehydrogenase              58.9    1e-06   



>ref|XP_011080124.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Sesamum indicum]
Length=400

 Score =   261 bits (668),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVASA++A+LKDDGSSMGKVYELGGPEIYT+HQLAELMYD+IREWP YVKVPFPIAKA
Sbjct  256  VVDVASAIVAALKDDGSSMGKVYELGGPEIYTLHQLAELMYDMIREWPHYVKVPFPIAKA  315

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IATPREVLL KVPFP+PTP+IFNLD IEAL+TDT+VS++AL F+DLGIVP KLKGYPVE+
Sbjct  316  IATPREVLLNKVPFPMPTPTIFNLDQIEALSTDTLVSENALKFEDLGIVPCKLKGYPVEF  375

Query  448  LIQYRKGGPQYGSTVSERVSPESY  377
            LIQYRKGGPQYGSTVSE+V+P+S+
Sbjct  376  LIQYRKGGPQYGSTVSEKVTPQSW  399



>ref|XP_009586626.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586627.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586628.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586629.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586630.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
Length=397

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVASA++ASLKD+G SMGKVYELGGP++YTMH+LAELM+D+IREWPRYV VPFPIAKA
Sbjct  253  VADVASAIVASLKDNGISMGKVYELGGPDVYTMHELAELMFDMIREWPRYVNVPFPIAKA  312

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA+PRE LLKKVP P+PTP+IFNLD IEA+TTD +VSKDALTF+DLG+ PHK+KGYPVE+
Sbjct  313  IASPREFLLKKVPAPMPTPTIFNLDAIEAITTDNIVSKDALTFEDLGLAPHKVKGYPVEF  372

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LIQYRKGGP YGSTVSERVSPESYP
Sbjct  373  LIQYRKGGPNYGSTVSERVSPESYP  397



>emb|CDP03802.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 140/161 (87%), Gaps = 16/161 (10%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVASA++A+LKDDGS MGKVYELGGPEI+T+H+LAELM+DVIREWPRYVK+PFP+AKA
Sbjct  258  VIDVASAIVAALKDDGSCMGKVYELGGPEIFTVHELAELMFDVIREWPRYVKIPFPVAKA  317

Query  628  ----------------IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFD  497
                            IA PREVLLKKVPFP+PTPSIFNLD IEALTTDT+VSKDALTFD
Sbjct  318  SYIPLSFCCYSCLLSAIAMPREVLLKKVPFPMPTPSIFNLDAIEALTTDTLVSKDALTFD  377

Query  496  DLGIVPHKLKGYPVEYLIQYRKGGPQYGSTVSERVSPESYP  374
            DLGI PHKLKGYPVE+LIQYRKGGP+YGSTVSE+VSPES+P
Sbjct  378  DLGIAPHKLKGYPVEFLIQYRKGGPKYGSTVSEKVSPESWP  418



>gb|KJB42336.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=345

 Score =   254 bits (650),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVASA++A+LKDDGSSMG VYELGGPEIYT+H+LAELMY+ IREWPRYV +P PIAKA
Sbjct  201  VVDVASAIVAALKDDGSSMGNVYELGGPEIYTVHELAELMYETIREWPRYVNIPLPIAKA  260

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA PREVLLKKVPFPLP P IFNLD I A  TDTVVS++ALTF DLGIVPHKLKGYPVEY
Sbjct  261  IAMPREVLLKKVPFPLPNPDIFNLDQINAFATDTVVSENALTFMDLGIVPHKLKGYPVEY  320

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LIQYRKGGPQ+GSTVSE+V+P+SYP
Sbjct  321  LIQYRKGGPQFGSTVSEKVNPDSYP  345



>gb|KJB42339.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=356

 Score =   254 bits (650),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVASA++A+LKDDGSSMG VYELGGPEIYT+H+LAELMY+ IREWPRYV +P PIAKA
Sbjct  212  VVDVASAIVAALKDDGSSMGNVYELGGPEIYTVHELAELMYETIREWPRYVNIPLPIAKA  271

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA PREVLLKKVPFPLP P IFNLD I A  TDTVVS++ALTF DLGIVPHKLKGYPVEY
Sbjct  272  IAMPREVLLKKVPFPLPNPDIFNLDQINAFATDTVVSENALTFMDLGIVPHKLKGYPVEY  331

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LIQYRKGGPQ+GSTVSE+V+P+SYP
Sbjct  332  LIQYRKGGPQFGSTVSEKVNPDSYP  356



>gb|KHG08643.1| hypothetical protein F383_12346 [Gossypium arboreum]
Length=370

 Score =   254 bits (650),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVASA++A+LKDDGSSMG VYELGGPEIYT+H+LAELMY+ IREWPRYV VP P+AKA
Sbjct  226  VVDVASAIVAALKDDGSSMGNVYELGGPEIYTVHELAELMYETIREWPRYVNVPLPVAKA  285

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA PREVLLKKVPFPLP P IFNLD I A  TDTVVS++ALTF DLGIVPHKLKGYPVEY
Sbjct  286  IAMPREVLLKKVPFPLPNPDIFNLDQIHAFATDTVVSENALTFMDLGIVPHKLKGYPVEY  345

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LIQYRKGGPQ+GSTVSE+V+P+SYP
Sbjct  346  LIQYRKGGPQFGSTVSEKVNPDSYP  370



>gb|KJB42335.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=400

 Score =   255 bits (651),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVASA++A+LKDDGSSMG VYELGGPEIYT+H+LAELMY+ IREWPRYV +P PIAKA
Sbjct  256  VVDVASAIVAALKDDGSSMGNVYELGGPEIYTVHELAELMYETIREWPRYVNIPLPIAKA  315

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA PREVLLKKVPFPLP P IFNLD I A  TDTVVS++ALTF DLGIVPHKLKGYPVEY
Sbjct  316  IAMPREVLLKKVPFPLPNPDIFNLDQINAFATDTVVSENALTFMDLGIVPHKLKGYPVEY  375

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LIQYRKGGPQ+GSTVSE+V+P+SYP
Sbjct  376  LIQYRKGGPQFGSTVSEKVNPDSYP  400



>ref|XP_007050148.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 4 [Theobroma 
cacao]
 gb|EOX94305.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 4 [Theobroma 
cacao]
Length=313

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVASA++A+LKDDG+SMGK YELGGPEI+T+H+LAELM+D+IREWPRYVKVP P+AKA
Sbjct  169  VVDVASAIVAALKDDGTSMGKAYELGGPEIFTVHELAELMHDMIREWPRYVKVPLPVAKA  228

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA PREVLLKKVPFPLP P IFNLD I A  TDT+VS++ALTF DLGIVPHKLKGYPVEY
Sbjct  229  IAMPREVLLKKVPFPLPNPDIFNLDQIHAFATDTIVSENALTFTDLGIVPHKLKGYPVEY  288

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LIQYRKGGPQ+GSTVSE+V+PE +P
Sbjct  289  LIQYRKGGPQFGSTVSEKVNPEYWP  313



>ref|XP_002271401.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Vitis vinifera]
 emb|CBI37199.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   254 bits (648),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A++A+LKDDG+SMGKVYELGGPEI+TMH+LA +MYD IREWPRYVKVPFPIAKA
Sbjct  255  VIDVAAAIMAALKDDGTSMGKVYELGGPEIFTMHELAAVMYDTIREWPRYVKVPFPIAKA  314

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +  PRE+LL KVPFPLPTP +FNLDLI A T+DTVVS++ALTFDDLGIVPHKLKGYP+E+
Sbjct  315  MTLPREILLNKVPFPLPTPGLFNLDLINAFTSDTVVSENALTFDDLGIVPHKLKGYPIEF  374

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            L+ YRKGGPQ+GST+SERV PE++P
Sbjct  375  LLSYRKGGPQFGSTISERVDPEAFP  399



>ref|XP_009395307.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Musa acuminata subsp. malaccensis]
Length=397

 Score =   253 bits (647),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A++ASLKDDGSSMGKVYELGGPE+YT+HQLAELMYD+IREWPRYVK+PFPIAKA
Sbjct  256  VIDVAAAIMASLKDDGSSMGKVYELGGPEVYTLHQLAELMYDMIREWPRYVKIPFPIAKA  315

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IATPRE+LLKKVPFPLP P IFNLD I + T DTVVS +ALTF DLGIVPHKLKGYPVEY
Sbjct  316  IATPRELLLKKVPFPLPNPDIFNLDQINSFTVDTVVSDNALTFKDLGIVPHKLKGYPVEY  375

Query  448  LIQYRKGGPQYGSTVSERVSPE  383
            LI YRKGGP +GSTVSERV+ E
Sbjct  376  LISYRKGGPSFGSTVSERVTAE  397



>ref|XP_008459972.1| PREDICTED: LOW QUALITY PROTEIN: NADH dehydrogenase [ubiquinone] 
1 alpha subcomplex subunit 9, mitochondrial [Cucumis melo]
Length=402

 Score =   253 bits (647),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+ ++++LKDDG+S+GKVYELGGPEIYT+H LAELMYD+IREWPRY+KVPFPIAKA
Sbjct  258  VVDVAAGIVSALKDDGTSIGKVYELGGPEIYTVHDLAELMYDMIREWPRYLKVPFPIAKA  317

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IATPRE+LL KVPFPLPTPSIFNLD I ALT DTVVS+ ALTF+DLGI+PHKLKGYP+E+
Sbjct  318  IATPREILLNKVPFPLPTPSIFNLDQILALTQDTVVSEKALTFNDLGIIPHKLKGYPIEF  377

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LI YRKGGPQ+GSTVSE+VSP+S+P
Sbjct  378  LISYRKGGPQFGSTVSEKVSPDSFP  402



>ref|XP_007050147.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOX94304.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 3 [Theobroma 
cacao]
Length=392

 Score =   252 bits (644),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVASA++A+LKDDG+SMGK YELGGPEI+T+H+LAELM+D+IREWPRYVKVP P+AKA
Sbjct  248  VVDVASAIVAALKDDGTSMGKAYELGGPEIFTVHELAELMHDMIREWPRYVKVPLPVAKA  307

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA PREVLLKKVPFPLP P IFNLD I A  TDT+VS++ALTF DLGIVPHKLKGYPVEY
Sbjct  308  IAMPREVLLKKVPFPLPNPDIFNLDQIHAFATDTIVSENALTFTDLGIVPHKLKGYPVEY  367

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LIQYRKGGPQ+GSTVSE+V+PE +P
Sbjct  368  LIQYRKGGPQFGSTVSEKVNPEYWP  392



>ref|XP_010264829.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nelumbo nucifera]
 ref|XP_010264830.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nelumbo nucifera]
Length=397

 Score =   252 bits (644),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A++A+LKDDG+SMGKVYELGGPE++T+H+LAELM+D IREWPRYVKVPFPIAKA
Sbjct  254  VVDVAAAILAALKDDGTSMGKVYELGGPEVFTVHELAELMFDTIREWPRYVKVPFPIAKA  313

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A+PRE LL KVPFPLPTP IFNLD I ALT DTVVS++ALTF+DLGIVPHKLKGYPVEY
Sbjct  314  LASPREFLLNKVPFPLPTPDIFNLDQINALTVDTVVSENALTFNDLGIVPHKLKGYPVEY  373

Query  448  LIQYRKGGPQYGSTVSERVSPE  383
            LI YRKGGPQ+GST+SERVSP+
Sbjct  374  LISYRKGGPQFGSTISERVSPD  395



>gb|AFK48198.1| unknown [Lotus japonicus]
Length=396

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A+ A+LKDDG+SMGKVYELGGPE+YTMH+LAELMY+VIREWPRYVKVPFPIAKA
Sbjct  252  VVDVANALTAALKDDGTSMGKVYELGGPEVYTMHELAELMYEVIREWPRYVKVPFPIAKA  311

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A+PRE+L+ K+PFPLPTP+IFNLD I ALTTDTVVS++ALTF+DLGI P KLKGYP E+
Sbjct  312  LASPRELLINKLPFPLPTPNIFNLDQIRALTTDTVVSENALTFNDLGINPQKLKGYPTEF  371

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LI YRKGGPQ+GST+SERVSP+++P
Sbjct  372  LISYRKGGPQFGSTISERVSPDAWP  396



>ref|XP_007050145.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007050146.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX94302.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX94303.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
Length=400

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVASA++A+LKDDG+SMGK YELGGPEI+T+H+LAELM+D+IREWPRYVKVP P+AKA
Sbjct  256  VVDVASAIVAALKDDGTSMGKAYELGGPEIFTVHELAELMHDMIREWPRYVKVPLPVAKA  315

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA PREVLLKKVPFPLP P IFNLD I A  TDT+VS++ALTF DLGIVPHKLKGYPVEY
Sbjct  316  IAMPREVLLKKVPFPLPNPDIFNLDQIHAFATDTIVSENALTFTDLGIVPHKLKGYPVEY  375

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LIQYRKGGPQ+GSTVSE+V+PE +P
Sbjct  376  LIQYRKGGPQFGSTVSEKVNPEYWP  400



>ref|XP_004247128.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Solanum lycopersicum]
Length=401

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVASA+++SLKD+G+SMGKVYELGGP+IYTMH LAELM+D+IREWPRYV VPFPIAKA
Sbjct  257  VADVASAIVSSLKDNGTSMGKVYELGGPDIYTMHDLAELMFDMIREWPRYVNVPFPIAKA  316

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA+PRE LL KVP P+P P+IFNLD I+AL TD VVSKDALTF+DLG+ PHK+KGYPVE+
Sbjct  317  IASPREFLLNKVPTPMPVPTIFNLDAIKALATDNVVSKDALTFEDLGLAPHKVKGYPVEF  376

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LIQYRKGGP YGSTVSE++SPESYP
Sbjct  377  LIQYRKGGPNYGSTVSEKMSPESYP  401



>ref|XP_010036149.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Eucalyptus grandis]
 gb|KCW47684.1| hypothetical protein EUGRSUZ_K01422 [Eucalyptus grandis]
Length=394

 Score =   251 bits (640),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+AV+++LKDDGSSMGK+YELGGP+++T+ +LAELMYD+IREWPRYV VPFPIAKA
Sbjct  250  VFDVAAAVVSALKDDGSSMGKIYELGGPDVFTVRELAELMYDMIREWPRYVSVPFPIAKA  309

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
             A PRE+LLKKVPFPLP P IFNLD I ALT DTVVSKDALTF+DLGIVPHK+KGYPVE+
Sbjct  310  FAMPRELLLKKVPFPLPNPDIFNLDQINALTEDTVVSKDALTFNDLGIVPHKVKGYPVEF  369

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LI YRKGGP +GSTVSERVSP++YP
Sbjct  370  LISYRKGGPNFGSTVSERVSPDAYP  394



>ref|XP_010936110.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Elaeis guineensis]
Length=398

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A+IASLKDDGSSMGK+YELGGPE++T+HQLAELMYD+IREWPRYVK+PFPIAKA
Sbjct  255  VVDVAAAIIASLKDDGSSMGKIYELGGPELFTVHQLAELMYDMIREWPRYVKIPFPIAKA  314

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A+PRE LLKKVPFPLP P IFNLD I ALT DT+VS++ALTF DLGIVPHKLKGYPVEY
Sbjct  315  LASPREFLLKKVPFPLPNPDIFNLDQINALTVDTLVSENALTFSDLGIVPHKLKGYPVEY  374

Query  448  LIQYRKGGPQYGSTVSERVSPESY  377
            LI YRKGGP YGSTVSERV+   +
Sbjct  375  LICYRKGGPAYGSTVSERVTGSEF  398



>gb|KGN46368.1| hypothetical protein Csa_6G087960 [Cucumis sativus]
Length=401

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA  ++++LKDDG+S+GKVYELGGPEIY++H LAELM+DVIREWP Y+KVPFPIAKA
Sbjct  257  VVDVAGGIVSALKDDGTSIGKVYELGGPEIYSVHDLAELMFDVIREWPHYLKVPFPIAKA  316

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IATPRE+LL KVPFPLPTP+IFNLD I ALT DTVVS+ ALTF+DLGIVPHKLKGYPVE+
Sbjct  317  IATPREILLNKVPFPLPTPAIFNLDQILALTQDTVVSEKALTFNDLGIVPHKLKGYPVEF  376

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LI YRKGGPQ+GSTVSERV+P+S+P
Sbjct  377  LISYRKGGPQFGSTVSERVNPDSFP  401



>ref|XP_006355892.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Solanum tuberosum]
Length=401

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVASA+++SLKD+G+SMGKVYELGGP+IYTMH LAELM+D+IREWPRYV VPFPIAKA
Sbjct  257  VADVASAIVSSLKDNGTSMGKVYELGGPDIYTMHDLAELMFDMIREWPRYVNVPFPIAKA  316

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA+PRE LL KVP P+P P+IFNLD I+A  TD +VSKDALTF+DLG+ PHK+KGYPVE+
Sbjct  317  IASPREFLLNKVPTPMPVPTIFNLDAIKAFATDNIVSKDALTFEDLGLAPHKVKGYPVEF  376

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LIQYRKGGP YGSTVSE++SPESYP
Sbjct  377  LIQYRKGGPNYGSTVSEKMSPESYP  401



>gb|EYU46388.1| hypothetical protein MIMGU_mgv1a007681mg [Erythranthe guttata]
 gb|EYU46389.1| hypothetical protein MIMGU_mgv1a007681mg [Erythranthe guttata]
Length=399

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVASA+IA+LKDDGSSMGKVYELGGP+IYTMHQLAELM++ IRE+P YVK+PFPIAKA
Sbjct  256  VVDVASAIIAALKDDGSSMGKVYELGGPDIYTMHQLAELMFETIREYPHYVKIPFPIAKA  315

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            I+TPRE+LLKKVPFPLP P+IFNLDLIE+L+TDTVVS++ALTF+DLGI P KLKGYPVE+
Sbjct  316  ISTPRELLLKKVPFPLPVPTIFNLDLIESLSTDTVVSENALTFEDLGIAPRKLKGYPVEF  375

Query  448  LIQYRKGGPQYGSTVSERVSPE  383
            LIQYRKGGP YGSTVSE++SP+
Sbjct  376  LIQYRKGGPNYGSTVSEKISPK  397



>ref|XP_010548735.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Tarenaya hassleriana]
Length=402

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AVI +LKDDG SMGK YELGGPE++T+H+LAELMYD+IREWPRYVKVPFPIAKA
Sbjct  258  VVDVAGAVIQALKDDGISMGKTYELGGPEVFTIHELAELMYDMIREWPRYVKVPFPIAKA  317

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A+PREV+L KVPFPLPTP IFNLD I ALTTDT+VS +ALTF DLGIVPHKLKGYPVEY
Sbjct  318  LASPREVMLNKVPFPLPTPQIFNLDQINALTTDTLVSDNALTFQDLGIVPHKLKGYPVEY  377

Query  448  LIQYRKGGPQYGSTVSERV  392
            LIQYRKGGPQ+GSTVSE+V
Sbjct  378  LIQYRKGGPQFGSTVSEKV  396



>ref|XP_003542442.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Glycine max]
 gb|KHN48948.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Glycine soja]
Length=396

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A+ + LKDDG+SMGK+YELGGPEI+T+H+LA++M+D IREWPRYVKVPFPIAKA
Sbjct  252  VIDVAAALTSLLKDDGTSMGKIYELGGPEIFTVHELADVMFDTIREWPRYVKVPFPIAKA  311

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +ATPRE+LL KVPFPLP P I NLD I+ALTTDTVVS++ALTF+DLGIVPHKLKGYP+E+
Sbjct  312  LATPREILLNKVPFPLPVPEILNLDKIQALTTDTVVSENALTFNDLGIVPHKLKGYPIEF  371

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LI YRKGGPQ+GST+SERV+P+S+P
Sbjct  372  LISYRKGGPQFGSTISERVTPDSWP  396



>ref|XP_010540921.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Tarenaya hassleriana]
Length=402

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV+ +LKDDGSSMGK YELGGPE++T+H+LAELM+D+IREWPRYVKVPFPIAK 
Sbjct  258  VVDVAGAVVQALKDDGSSMGKTYELGGPEVFTIHELAELMFDMIREWPRYVKVPFPIAKV  317

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A+PREVLL K+PFPLPTP IFNLD I ALTTDT+VS +ALTF DLGI PHKLKGYPVEY
Sbjct  318  MASPREVLLNKLPFPLPTPQIFNLDQINALTTDTLVSGNALTFQDLGIAPHKLKGYPVEY  377

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LIQYRKGGPQ+GSTVSE+V  + YP
Sbjct  378  LIQYRKGGPQFGSTVSEKVPTDFYP  402



>ref|XP_011024495.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Populus euphratica]
Length=399

 Score =   246 bits (627),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A+IA+LKDDGSSMGKVYELGGPEI+T+H+LA+LMYDVIREWPRYVKVPFPIAKA
Sbjct  255  VVDVAAAIIAALKDDGSSMGKVYELGGPEIFTVHELADLMYDVIREWPRYVKVPFPIAKA  314

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +ATPR VL+ KVPFPLPTP+IFNLD I ALT ++VVS++ALTF DLGIVPHKLKGYP+E+
Sbjct  315  LATPRAVLINKVPFPLPTPNIFNLDEINALTINSVVSENALTFSDLGIVPHKLKGYPIEF  374

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LI YRKGGPQ+GST+SERVSP+S+P
Sbjct  375  LISYRKGGPQFGSTISERVSPDSFP  399



>ref|XP_007144408.1| hypothetical protein PHAVU_007G153700g [Phaseolus vulgaris]
 gb|ESW16402.1| hypothetical protein PHAVU_007G153700g [Phaseolus vulgaris]
Length=394

 Score =   245 bits (626),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A+   LKDDG+SMGK YELGGP+I+T+H LAELMY+ IREWPRYVKVPFPIAKA
Sbjct  252  VVDVAAALTTVLKDDGTSMGKTYELGGPDIFTVHDLAELMYETIREWPRYVKVPFPIAKA  311

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +ATPRE+LL KVPFPLP P IFNLD I+ALTTDT+VS++ALTF+DLGIVPHKLKGYP+E+
Sbjct  312  LATPREILLNKVPFPLPNPDIFNLDKIQALTTDTIVSENALTFNDLGIVPHKLKGYPIEF  371

Query  448  LIQYRKGGPQYGSTVSERVSPES  380
            LI YRKGGPQ+GST+SER+SP++
Sbjct  372  LISYRKGGPQFGSTISERISPDA  394



>ref|XP_008372401.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Malus domestica]
Length=399

 Score =   245 bits (626),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A++A+LKDDG+SMGK+YELGGPE++TMHQLAELM+D IREWPRYVKVP PIAKA
Sbjct  255  VVDVAGAIVAALKDDGTSMGKIYELGGPEVFTMHQLAELMFDTIREWPRYVKVPLPIAKA  314

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +  PRE+LL KVPFPLP P IFN D I A  TDT+VS++ALTF DLG+VPHKLKGYP+EY
Sbjct  315  MGAPREILLNKVPFPLPNPEIFNRDQILAQATDTLVSENALTFSDLGLVPHKLKGYPIEY  374

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LIQ+RKGGP YGSTVSERVSP+++P
Sbjct  375  LIQFRKGGPNYGSTVSERVSPDAWP  399



>ref|XP_009335235.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Pyrus x bretschneideri]
Length=399

 Score =   245 bits (626),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A++A+LKDDG+SMGKVYELGGPE++TMHQLAELM+D IREWPRYVKVP PIAKA
Sbjct  255  VVDVAGAIVAALKDDGTSMGKVYELGGPEVFTMHQLAELMFDTIREWPRYVKVPLPIAKA  314

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +  PRE+LL KVPFPLP P IFN D I A  TDT+VS++ALTF+DLG+VPHKLKGYP+E+
Sbjct  315  MGAPREILLNKVPFPLPNPEIFNRDQILAQETDTLVSENALTFNDLGLVPHKLKGYPIEF  374

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LIQ+RKGGP YGSTVSERVSP+++P
Sbjct  375  LIQFRKGGPNYGSTVSERVSPDAWP  399



>gb|ABK94679.1| unknown [Populus trichocarpa]
Length=399

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A+IA+LKDDGSSMGKVYELGGPEI+T+H+LA+LM+DVIREWPRYVKVPFPIAKA
Sbjct  255  VVDVAAAIIAALKDDGSSMGKVYELGGPEIFTVHELADLMHDVIREWPRYVKVPFPIAKA  314

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +ATPR VL+ KVPFPLP P IFNLD I ALT D+VVS++ALTF+DLGIVPHKLKGYP+E+
Sbjct  315  LATPRAVLINKVPFPLPAPKIFNLDEINALTIDSVVSENALTFNDLGIVPHKLKGYPIEF  374

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LI YRKGGPQ+GST+SERVSP+S+P
Sbjct  375  LISYRKGGPQFGSTISERVSPDSFP  399



>ref|XP_002301843.1| hypothetical protein POPTR_0002s25720g [Populus trichocarpa]
 gb|EEE81116.1| hypothetical protein POPTR_0002s25720g [Populus trichocarpa]
Length=399

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A+IA+LKDDGSSMGKVYELGGPEI+T+H+LA+LM+DVIREWPRYVKVPFPIAKA
Sbjct  255  VVDVAAAIIAALKDDGSSMGKVYELGGPEIFTVHELADLMHDVIREWPRYVKVPFPIAKA  314

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +ATPR VL+ KVPFPLP P IFNLD I ALT D+VVS++ALTF+DLGIVPHKLKGYP+E+
Sbjct  315  LATPRAVLINKVPFPLPAPKIFNLDEINALTIDSVVSENALTFNDLGIVPHKLKGYPIEF  374

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LI YRKGGPQ+GST+SERVSP+S+P
Sbjct  375  LISYRKGGPQFGSTISERVSPDSFP  399



>gb|ACJ84721.1| unknown [Medicago truncatula]
 gb|AFK38059.1| unknown [Medicago truncatula]
 gb|KEH42458.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Medicago truncatula]
Length=396

 Score =   244 bits (622),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A+  +LKDDG+SMGK+YELGGPEI+T+HQLAE+MYDVIREWPRYV VP PIAKA
Sbjct  252  VVDVAAALTTALKDDGTSMGKIYELGGPEIFTVHQLAEIMYDVIREWPRYVNVPLPIAKA  311

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +ATPRE+ L K+PFPLP P +FNLD I A   DTVVS++ALTF+DLGIVPHKLKGYP+E+
Sbjct  312  LATPRELFLNKLPFPLPKPEMFNLDQIHAYAADTVVSENALTFNDLGIVPHKLKGYPIEF  371

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LIQYRKGGPQ+GST+SE+VSP+++P
Sbjct  372  LIQYRKGGPQFGSTISEKVSPDAWP  396



>gb|KDP26455.1| hypothetical protein JCGZ_17613 [Jatropha curcas]
Length=396

 Score =   243 bits (621),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -1

Query  775  LKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKK  596
            LKDDG+SMGKVYELGGPEI+T+H+LAELM+D IREWPRYVK+PFPIAKA+A PREVLL K
Sbjct  263  LKDDGTSMGKVYELGGPEIFTVHELAELMFDTIREWPRYVKIPFPIAKALAMPREVLLNK  322

Query  595  VPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGPQY  416
            VPFPLPTP+I NLD I AL+ DTVVSKDALTF DLGIVPHKLKGYPVE+LI YRKGGPQ+
Sbjct  323  VPFPLPTPNILNLDEINALSVDTVVSKDALTFHDLGIVPHKLKGYPVEFLISYRKGGPQF  382

Query  415  GSTVSERVSPESYP  374
            GSTVSERVSP+S+P
Sbjct  383  GSTVSERVSPDSFP  396



>ref|XP_011458045.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Fragaria vesca subsp. vesca]
Length=397

 Score =   243 bits (619),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A++++L+DDG+SMGKVYELGGP++YT+HQLAELM+D+IREWP YVK+P PIAKA
Sbjct  253  VADVAGAIVSALQDDGTSMGKVYELGGPDVYTVHQLAELMFDMIREWPHYVKIPIPIAKA  312

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA PRE+LLKKVPFPLP P IFNLD I A   DTVVS++ALTF+DLGI+PHK+KGYP+E+
Sbjct  313  IAMPREILLKKVPFPLPNPEIFNLDQILAQAPDTVVSENALTFNDLGILPHKIKGYPIEF  372

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LIQYRKGGP +GSTVSE+VSP+SYP
Sbjct  373  LIQYRKGGPNFGSTVSEKVSPDSYP  397



>ref|XP_009370595.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Pyrus x bretschneideri]
Length=399

 Score =   243 bits (619),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A++A+LKDDG+SMGK+YELGGPE++TMHQLAELM+D IREWPRYVKVP PIAKA
Sbjct  255  VVDVAGAIVAALKDDGTSMGKIYELGGPEVFTMHQLAELMFDTIREWPRYVKVPLPIAKA  314

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            I  PRE+LL KVPFPLP P IFN D I A  TDT+VS++ALTF DLG+VPHKLKGYP+E+
Sbjct  315  IGAPREILLNKVPFPLPNPEIFNRDQILAQATDTLVSENALTFSDLGLVPHKLKGYPIEF  374

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LIQ+RKGGP YGSTVSER SP ++P
Sbjct  375  LIQFRKGGPNYGSTVSERGSPHAWP  399



>ref|XP_007201067.1| hypothetical protein PRUPE_ppa006705mg [Prunus persica]
 gb|EMJ02266.1| hypothetical protein PRUPE_ppa006705mg [Prunus persica]
Length=399

 Score =   243 bits (619),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A++A+LKDDG+SMGKVYELGGPE++T+HQLAELM++ IREWP YVKVP PIAKA
Sbjct  255  VVDVAGAIVAALKDDGTSMGKVYELGGPEVFTVHQLAELMFETIREWPHYVKVPLPIAKA  314

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA PRE+LL KVPFPLP P IFN D I A  TDTVVS+++LTF DLG+VPHKLKGYPVE+
Sbjct  315  IAAPREILLNKVPFPLPNPEIFNRDQILAQATDTVVSENSLTFSDLGLVPHKLKGYPVEF  374

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LIQYRKGGP YGSTVSERVSP+++P
Sbjct  375  LIQYRKGGPNYGSTVSERVSPDAWP  399



>ref|XP_008382707.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Malus domestica]
Length=437

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A++A+LKDDG+SMGKVYELGGPE +TMHQLAELM+D IREWPRYVKVP PIAKA
Sbjct  293  VVDVAGAIVAALKDDGTSMGKVYELGGPEXFTMHQLAELMFDTIREWPRYVKVPLPIAKA  352

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +  PRE+LL KVPFPLP P IFN D I A  TDT+VS++AL+F+DLG+VPHKLKGYP+E+
Sbjct  353  MGAPREILLNKVPFPLPNPEIFNRDQILAQATDTLVSENALSFNDLGLVPHKLKGYPIEF  412

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LIQ+RKGGP YGSTVSERVSP+++P
Sbjct  413  LIQFRKGGPNYGSTVSERVSPDAWP  437



>gb|ACU23211.1| unknown [Glycine max]
Length=396

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A+ + LKDDG+SMGK+YELGGPEI+T+H+LA++M+D IREWPRYVKVPFPIAKA
Sbjct  252  VIDVAAALTSLLKDDGTSMGKIYELGGPEIFTVHELADVMFDTIREWPRYVKVPFPIAKA  311

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +ATPRE+LL KVPFPLP P I NLD I+ALTTDTVVS++ALTF+DLGIVPHKLK YP+E+
Sbjct  312  LATPREILLNKVPFPLPVPEILNLDKIQALTTDTVVSENALTFNDLGIVPHKLKEYPIEF  371

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LI YRKGGPQ+GST+SERV+P+ +P
Sbjct  372  LISYRKGGPQFGSTISERVTPDFWP  396



>ref|XP_004495054.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Cicer arietinum]
Length=396

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A+ A+LKDDG+SMGK YELGGPEI+T+H+LA++M+DVIREWPRYV VP PIAKA
Sbjct  252  VVDVAAALTAALKDDGTSMGKTYELGGPEIFTVHELADIMFDVIREWPRYVNVPLPIAKA  311

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +ATPRE+LL KVPFPLP P +FNLD I A  TDTVVS++ALTF+DLGIVPHKLKGYP+EY
Sbjct  312  LATPRELLLNKVPFPLPKPEMFNLDQIHAFATDTVVSENALTFNDLGIVPHKLKGYPIEY  371

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LI +RKGGP++GSTVSE+VSPE +P
Sbjct  372  LISHRKGGPRFGSTVSEKVSPEDWP  396



>ref|XP_004140669.1| PREDICTED: ABC transporter C family member 5-like [Cucumis sativus]
 ref|XP_004157617.1| PREDICTED: ABC transporter C family member 5-like [Cucumis sativus]
Length=1752

 Score =   253 bits (645),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  808   VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
             V DVA  ++++LKDDG+S+GKVYELGGPEIY++H LAELM+DVIREWP Y+KVPFPIAKA
Sbjct  1608  VVDVAGGIVSALKDDGTSIGKVYELGGPEIYSVHDLAELMFDVIREWPHYLKVPFPIAKA  1667

Query  628   IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
             IATPRE+LL KVPFPLPTP+IFNLD I ALT DTVVS+ ALTF+DLGIVPHKLKGYPVE+
Sbjct  1668  IATPREILLNKVPFPLPTPAIFNLDQILALTQDTVVSEKALTFNDLGIVPHKLKGYPVEF  1727

Query  448   LIQYRKGGPQYGSTVSERVSPESYP  374
             LI YRKGGPQ+GSTVSERV+P+S+P
Sbjct  1728  LISYRKGGPQFGSTVSERVNPDSFP  1752



>gb|EPS69627.1| hypothetical protein M569_05135, partial [Genlisea aurea]
Length=360

 Score =   236 bits (603),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVASA++++LKDDG SMGKVYELGGP+IYT+H+LAELM+D IREWPRY+ VP+PIAKA
Sbjct  216  VVDVASAIVSALKDDGRSMGKVYELGGPDIYTVHELAELMFDTIREWPRYLNVPYPIAKA  275

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA PRE  LKKVPFPLPTP IFNLD I+  ++DT+VS++AL F DLGI P KLKGYPVEY
Sbjct  276  IAVPREFFLKKVPFPLPTPKIFNLDQIKEFSSDTLVSENALKFQDLGIAPRKLKGYPVEY  335

Query  448  LIQYRKGGPQYGSTVSERVSPESY  377
            LIQYRKGGPQYGSTVSE+  P S+
Sbjct  336  LIQYRKGGPQYGSTVSEKELPRSW  359



>ref|XP_002321296.2| hypothetical protein POPTR_0014s18680g [Populus trichocarpa]
 gb|EEE99611.2| hypothetical protein POPTR_0014s18680g [Populus trichocarpa]
Length=384

 Score =   237 bits (605),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 134/148 (91%), Gaps = 3/148 (2%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V D+A+A+IA+LKDDG+SMGKVYELGGPEI+T+H+LAELMYDVIREWPRYVKVPFPIAKA
Sbjct  237  VVDIAAAIIAALKDDGTSMGKVYELGGPEIFTVHELAELMYDVIREWPRYVKVPFPIAKA  296

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDA---LTFDDLGIVPHKLKGYP  458
             ATPRE+LL KVPFPLP P +FNLD I +LT DTVVS++    LTF DLGIVPHKLKGYP
Sbjct  297  FATPREILLNKVPFPLPNPKMFNLDEINSLTMDTVVSENGEFTLTFSDLGIVPHKLKGYP  356

Query  457  VEYLIQYRKGGPQYGSTVSERVSPESYP  374
            VE+LI YRKGGPQ+GST+SERVSP+S+P
Sbjct  357  VEFLISYRKGGPQFGSTISERVSPDSFP  384



>ref|XP_009370589.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Pyrus x bretschneideri]
Length=422

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A++A+LKDDG+SMGK+YELGGPE++TMHQLAELM+D IREWPRYVKVP PIAKA
Sbjct  255  VVDVAGAIVAALKDDGTSMGKIYELGGPEVFTMHQLAELMFDTIREWPRYVKVPLPIAKA  314

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            I  PRE+LL KVPFPLP P IFN D I A  TDT+VS++ALTF DLG+VPHKLKGYP+E+
Sbjct  315  IGAPREILLNKVPFPLPNPEIFNRDQILAQATDTLVSENALTFSDLGLVPHKLKGYPIEF  374

Query  448  LIQYRKGGPQYGSTVSER  395
            LIQ+RKGGP YGSTVSER
Sbjct  375  LIQFRKGGPNYGSTVSER  392



>ref|XP_006854436.1| hypothetical protein AMTR_s00039p00218660 [Amborella trichopoda]
 gb|ERN15903.1| hypothetical protein AMTR_s00039p00218660 [Amborella trichopoda]
Length=397

 Score =   234 bits (598),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V D A+A+IASLKDDG+SMGK YELGGPE++T+HQLAELMYD IREWPRYVKVPFPIAKA
Sbjct  253  VVDAAAAIIASLKDDGTSMGKTYELGGPEVFTVHQLAELMYDTIREWPRYVKVPFPIAKA  312

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A+PRE+LL+KVPFPLPTP +FNLD I +LT DTVVS+ ALTF++LGIVP KLKGYP+E+
Sbjct  313  LASPREILLRKVPFPLPTPDVFNLDYINSLTVDTVVSEKALTFENLGIVPRKLKGYPIEF  372

Query  448  LIQYRKGGPQYGSTVSERVSPESY  377
            LI YRKGGPQYGSTVSERV+   Y
Sbjct  373  LISYRKGGPQYGSTVSERVTGPEY  396



>ref|XP_010940664.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Elaeis guineensis]
Length=398

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V D A+A+IASLKDDGSSMGKVYELGGP+++T+HQLAELMYD+IREWPRYVKVPFPIAKA
Sbjct  255  VVDAAAAIIASLKDDGSSMGKVYELGGPDVFTLHQLAELMYDMIREWPRYVKVPFPIAKA  314

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A+PRE LL KVPFPLP P IFNLD I A T DTVVS++ALT  DLGIVPHKLKGYPVEY
Sbjct  315  LASPREFLLNKVPFPLPNPDIFNLDQINAFTVDTVVSENALTLSDLGIVPHKLKGYPVEY  374

Query  448  LIQYRKGGPQYGSTVSERVSPESY  377
            LI YRKGGP YGSTVSER++   +
Sbjct  375  LICYRKGGPAYGSTVSERITRSDF  398



>gb|EEE58042.1| hypothetical protein OsJ_08874 [Oryza sativa Japonica Group]
Length=310

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A++ SLKDDG+SMGK YELGGPEIYT+H+LAELMY+ IREWPRY+ VP PIA+A
Sbjct  167  VVDVAAAIVNSLKDDGTSMGKTYELGGPEIYTVHELAELMYETIREWPRYIDVPLPIARA  226

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA+PRE+LL KVPFPLPTPSIFN D I A + DT+VS +ALTF DLGIVPHKLKGYPVE+
Sbjct  227  IASPREMLLNKVPFPLPTPSIFNKDQINAFSVDTLVSDNALTFSDLGIVPHKLKGYPVEF  286

Query  448  LIQYRKGGPQYGSTVSERV  392
            L+ YRKGGP +GSTVSE++
Sbjct  287  LVCYRKGGPAFGSTVSEKI  305



>ref|XP_004954373.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Setaria italica]
Length=408

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A++ SLKDDG+SMGK+YELGGPEIYT+H+LAELMY+ IREWPRYV VP P+A+A
Sbjct  265  VIDVAAAIVNSLKDDGTSMGKIYELGGPEIYTVHELAELMYETIREWPRYVNVPLPVARA  324

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA+PRE+LL KVPFPLPTPSIFNLD I A + D +VS+DALTF+DLGI+P KLKGYPVEY
Sbjct  325  IASPREMLLNKVPFPLPTPSIFNLDQINAFSVDNLVSEDALTFEDLGIMPQKLKGYPVEY  384

Query  448  LIQYRKGGPQYGSTVSERV  392
            L+ YRKGGP +GSTVSE++
Sbjct  385  LLSYRKGGPAFGSTVSEKM  403



>ref|XP_008789505.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Phoenix dactylifera]
Length=398

 Score =   233 bits (594),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V D A+A+IASLKDDGSSMGKVYELGGP+++T+HQLAELMYD+IREWPRYVKVPFP+AKA
Sbjct  255  VVDAAAAIIASLKDDGSSMGKVYELGGPDVFTVHQLAELMYDMIREWPRYVKVPFPVAKA  314

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A+PRE LL KVPFPLP P IFNLD I ALT DTVVS++ALT  DLGIVPHKLKGYPVEY
Sbjct  315  LASPREFLLNKVPFPLPNPDIFNLDQINALTVDTVVSENALTLSDLGIVPHKLKGYPVEY  374

Query  448  LIQYRKGGPQYGSTVSERVSPESY  377
            LI YRKGGP YG+TVSERV+   +
Sbjct  375  LICYRKGGPAYGATVSERVTRSDF  398



>dbj|BAG95473.1| unnamed protein product [Oryza sativa Japonica Group]
Length=311

 Score =   230 bits (587),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A++ SLKDDG+SMGK YELGGPEIYT+H+LAELMY+ IREWPRY+ VP PIA+A
Sbjct  168  VVDVAAAIVNSLKDDGTSMGKTYELGGPEIYTVHELAELMYETIREWPRYIDVPLPIARA  227

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA+PRE+LL KVPFPLPTPSIFN D I A + DT+VS +ALTF DLGIVPHKLKGYPVE+
Sbjct  228  IASPREMLLNKVPFPLPTPSIFNKDQINAFSVDTLVSDNALTFSDLGIVPHKLKGYPVEF  287

Query  448  LIQYRKGGPQYGSTVSERV  392
            L+ YRKGGP +GSTVSE++
Sbjct  288  LVCYRKGGPAFGSTVSEKI  306



>ref|XP_010091822.1| hypothetical protein L484_015891 [Morus notabilis]
 gb|EXB46030.1| hypothetical protein L484_015891 [Morus notabilis]
Length=399

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -1

Query  775  LKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKK  596
            LKDDG+SMGK+YELGGPE++T+H+LAELMY+ IREWPRY+KVPFPIAKAIATPRE+LL K
Sbjct  266  LKDDGTSMGKIYELGGPEVFTVHELAELMYETIREWPRYLKVPFPIAKAIATPREILLNK  325

Query  595  VPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGPQY  416
            VPFPLP P IFNLD I A TTDTVVS++ALTF+DL I+PHKLKGYP+E+L  YRKGGPQ+
Sbjct  326  VPFPLPKPDIFNLDQILAQTTDTVVSENALTFNDLEIMPHKLKGYPIEFLACYRKGGPQF  385

Query  415  GSTVSERVSPESYP  374
            GST+SERVSP+++P
Sbjct  386  GSTISERVSPDAWP  399



>ref|XP_002453037.1| hypothetical protein SORBIDRAFT_04g037200 [Sorghum bicolor]
 gb|EES06013.1| hypothetical protein SORBIDRAFT_04g037200 [Sorghum bicolor]
Length=408

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A++ SLKDDG+SMGK+YELGGPEIYT+H+LAELMY+ IREWPRYV VP P+A+A
Sbjct  265  VIDVAAAIVNSLKDDGTSMGKIYELGGPEIYTVHELAELMYETIREWPRYVNVPLPVARA  324

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA+PRE+LL KVPFPLPTPSIFNLD I A   D +VS+DALTF+DLGI+P KLKGYPVE+
Sbjct  325  IASPREMLLNKVPFPLPTPSIFNLDQINAFAVDNLVSEDALTFEDLGIMPQKLKGYPVEF  384

Query  448  LIQYRKGGPQYGSTVSERV  392
            L+ YRKGGP +GSTVSE++
Sbjct  385  LVSYRKGGPSFGSTVSEKM  403



>gb|EEC74241.1| hypothetical protein OsI_09443 [Oryza sativa Indica Group]
Length=408

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A++ SLKDDG+SMGK YELGGPEIYT+H+LAELMY+ IREWPRY+ VP PIA+A
Sbjct  265  VVDVAAAIVNSLKDDGTSMGKTYELGGPEIYTVHELAELMYETIREWPRYIDVPLPIARA  324

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA+PRE+LL KVPFPLPTPSIFN D I A + DT+VS +ALTF DLGIVPHKLKGYPVE+
Sbjct  325  IASPREMLLNKVPFPLPTPSIFNKDQINAFSVDTLVSDNALTFSDLGIVPHKLKGYPVEF  384

Query  448  LIQYRKGGPQYGSTVSERV  392
            L+ YRKGGP +GSTVSE++
Sbjct  385  LVCYRKGGPAFGSTVSEKI  403



>ref|NP_001048516.1| Os02g0816800 [Oryza sativa Japonica Group]
 dbj|BAD21515.1| putative NADH dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAD22016.1| putative NADH dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAF10430.1| Os02g0816800 [Oryza sativa Japonica Group]
Length=408

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A++ SLKDDG+SMGK YELGGPEIYT+H+LAELMY+ IREWPRY+ VP PIA+A
Sbjct  265  VVDVAAAIVNSLKDDGTSMGKTYELGGPEIYTVHELAELMYETIREWPRYIDVPLPIARA  324

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA+PRE+LL KVPFPLPTPSIFN D I A + DT+VS +ALTF DLGIVPHKLKGYPVE+
Sbjct  325  IASPREMLLNKVPFPLPTPSIFNKDQINAFSVDTLVSDNALTFSDLGIVPHKLKGYPVEF  384

Query  448  LIQYRKGGPQYGSTVSERV  392
            L+ YRKGGP +GSTVSE++
Sbjct  385  LVCYRKGGPAFGSTVSEKI  403



>ref|XP_006648113.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Oryza brachyantha]
Length=360

 Score =   229 bits (583),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A++ SLKDDG+SMGK YELGGPEIYT+H+LAELMY+ IREWPRY+ VP P+A+A
Sbjct  217  VVDVAAAIVNSLKDDGTSMGKTYELGGPEIYTVHELAELMYETIREWPRYINVPLPVARA  276

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            I++PRE+LL KVPFPLP+PSIFNLD I A + D +VS++ALTF DLGI+PHKLKGYPVE+
Sbjct  277  ISSPREMLLNKVPFPLPSPSIFNLDQINAFSVDNLVSENALTFADLGIMPHKLKGYPVEF  336

Query  448  LIQYRKGGPQYGSTVSERV  392
            L+ YRKGGP +GSTVSE++
Sbjct  337  LVCYRKGGPAFGSTVSEKI  355



>gb|ACF85773.1| unknown [Zea mays]
 gb|ACR35734.1| unknown [Zea mays]
Length=407

 Score =   230 bits (586),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A++ SLKDDG+SMGK+YELGGPEIYT+H+LAELMY+ IREWPRYV VP P+A+A
Sbjct  264  VIDVAAAIVNSLKDDGTSMGKIYELGGPEIYTVHELAELMYETIREWPRYVNVPLPVARA  323

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA+PRE+LL KVPFPLPTPSIFNLD I A   D +VS+DALTF+DL I+P KLKGYPVEY
Sbjct  324  IASPREMLLNKVPFPLPTPSIFNLDQINAFAVDNLVSEDALTFEDLSIMPQKLKGYPVEY  383

Query  448  LIQYRKGGPQYGSTVSERV  392
            L+ YRKGGP +GSTVSE++
Sbjct  384  LVSYRKGGPSFGSTVSEKM  402



>ref|XP_002526534.1| NADH-ubiquinone oxidoreductase 39 kD subunit, putative [Ricinus 
communis]
 gb|EEF35812.1| NADH-ubiquinone oxidoreductase 39 kD subunit, putative [Ricinus 
communis]
Length=394

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A+IA+LKDDGSSMGK+YELGGPEI T+H+LAE+M+D+IREWPRYVKVPFPIAKA
Sbjct  256  VVDVAAAIIAALKDDGSSMGKIYELGGPEILTVHELAEIMFDMIREWPRYVKVPFPIAKA  315

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IATPREVL+ KVPFPLPTP+IFNLD I ALT DTVVS++ALTF DLGI+PHKLKGYPVEY
Sbjct  316  IATPREVLINKVPFPLPTPNIFNLDEIIALTMDTVVSENALTFHDLGIMPHKLKGYPVEY  375

Query  448  LIQYRKGGPQYGST  407
            LI YRKGGPQ+GST
Sbjct  376  LISYRKGGPQFGST  389



>gb|AFW74028.1| NADH-ubiquinone oxidoreductase subunit [Zea mays]
Length=460

 Score =   229 bits (585),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A++ SLKDDG+SMGK+YELGGPEIYT+H+LAELMY+ IREWPRYV VP P+A+A
Sbjct  317  VIDVAAAIVNSLKDDGTSMGKIYELGGPEIYTVHELAELMYETIREWPRYVNVPLPVARA  376

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA+PRE+LL KVPFPLPTPSIFNLD I A   D +VS+DALTF+DL I+P KLKGYPVEY
Sbjct  377  IASPREMLLNKVPFPLPTPSIFNLDQINAFAVDNLVSEDALTFEDLSIMPQKLKGYPVEY  436

Query  448  LIQYRKGGPQYGSTVSERV  392
            L+ YRKGGP +GSTVSE++
Sbjct  437  LVSYRKGGPSFGSTVSEKM  455



>ref|XP_006443722.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
 ref|XP_006443723.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
 ref|XP_006479428.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like isoform X1 [Citrus sinensis]
 gb|ESR56962.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
 gb|ESR56963.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
Length=400

 Score =   228 bits (580),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -1

Query  775  LKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKK  596
            LKDDG+SMGK+YELGGP+I+T+H+LAELMYD IRE+P YVKVPFP+AKA+A PRE+LLKK
Sbjct  267  LKDDGTSMGKIYELGGPDIFTVHELAELMYDTIREYPHYVKVPFPVAKAVAMPREILLKK  326

Query  595  VPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGPQY  416
            VPFPLP P +FNLD I A T+DT+VS +ALTF DLGIVPHKLKGYP EYLI YRKGGP++
Sbjct  327  VPFPLPRPGLFNLDEINAYTSDTIVSDNALTFQDLGIVPHKLKGYPTEYLIWYRKGGPKF  386

Query  415  GSTVSERVSPESYP  374
            GSTVSER++PE++P
Sbjct  387  GSTVSERINPEAWP  400



>ref|NP_001149069.1| LOC100282690 [Zea mays]
 gb|ACG34074.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Zea mays]
Length=407

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A++ SLKDDG+SMGK+YEL GPEIYT+H+LAELMY+ IREWPRYV VP P+A+A
Sbjct  264  VIDVAAAIVNSLKDDGTSMGKIYELEGPEIYTVHELAELMYETIREWPRYVNVPLPVARA  323

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA+PRE+LL KVPFPLPTPSIFNLD I A   D +VS+DALTF+DL I+P KLKGYPVEY
Sbjct  324  IASPREMLLNKVPFPLPTPSIFNLDQINAFAVDNLVSEDALTFEDLSIMPQKLKGYPVEY  383

Query  448  LIQYRKGGPQYGSTVSERV  392
            L+ YRKGGP +GSTVSE++
Sbjct  384  LVSYRKGGPSFGSTVSEKM  402



>ref|XP_003570393.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Brachypodium distachyon]
Length=412

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A++ SLKDDG+SMGK YELGGP+IYT+H LAELM++ IREWPRYV VPFPIA+A
Sbjct  265  VVDVAAAIVNSLKDDGTSMGKTYELGGPDIYTVHDLAELMFETIREWPRYVNVPFPIARA  324

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA+PRE+LL KVPFPLPTPSIFNLD I AL+ D +VS++ALTF DL I PHKLKGYPVE+
Sbjct  325  IASPREMLLNKVPFPLPTPSIFNLDQINALSVDNLVSENALTFADLEIRPHKLKGYPVEF  384

Query  448  LIQYRKGGPQYGSTVSERVS  389
            L+ YRKGGP +GSTVSE++ 
Sbjct  385  LVCYRKGGPSFGSTVSEKMG  404



>gb|EMT17104.1| putative NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 
9, mitochondrial [Aegilops tauschii]
Length=315

 Score =   220 bits (560),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A++ SLKDDG+SMGK YELGGP+IYT+H LAE+M++ IRE+PRYV +PFPIAKA
Sbjct  168  VVDVAAAIVNSLKDDGTSMGKTYELGGPDIYTVHDLAEMMFETIREYPRYVNIPFPIAKA  227

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A+PRE+LL KVPFPLPTPSIFNLD I+ALT D +VS++AL+F DL I PHKLKGYP E+
Sbjct  228  MASPREMLLNKVPFPLPTPSIFNLDHIKALTVDNLVSENALSFADLEIKPHKLKGYPTEF  287

Query  448  LIQYRKGGPQYGSTVSERV  392
            L+ YRKGGP +GSTVSE++
Sbjct  288  LVCYRKGGPSFGSTVSEKM  306



>gb|EMS47161.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Triticum urartu]
Length=315

 Score =   219 bits (558),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A++ SLKDDG+SMGK YELGGP+IYT+H LAE+M++ IRE+PRYV +PFPIAKA
Sbjct  168  VVDVAAAIVNSLKDDGTSMGKTYELGGPDIYTVHDLAEMMFETIREYPRYVNLPFPIAKA  227

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A+PRE+LL KVPFPLPTPSIFNLD I+ALT D +VS++AL+F DL I PHKLKGYP E+
Sbjct  228  MASPREMLLNKVPFPLPTPSIFNLDQIKALTVDNLVSENALSFADLEIKPHKLKGYPTEF  287

Query  448  LIQYRKGGPQYGSTVSERV  392
            L+ YRKGGP +GSTVSE++
Sbjct  288  LVCYRKGGPSFGSTVSEKM  306



>dbj|BAH20309.1| AT2G20360 [Arabidopsis thaliana]
Length=335

 Score =   219 bits (559),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = -1

Query  775  LKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKK  596
            LKDDGSSMGK YELGGP+++T H+LAE+MYD+IREWPRYVK+PFPIAKA+A PR+ ++ K
Sbjct  202  LKDDGSSMGKTYELGGPDVFTTHELAEIMYDMIREWPRYVKLPFPIAKAMAAPRDFMVNK  261

Query  595  VPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGPQY  416
            VPFPLP+P IFNLD I ALTTDT+VS +AL F DL +VPHKLKGYPVE+LIQYRKGGP +
Sbjct  262  VPFPLPSPQIFNLDQINALTTDTLVSDNALKFQDLDLVPHKLKGYPVEFLIQYRKGGPNF  321

Query  415  GSTVSERVSPESYP  374
            GSTVSE++  + YP
Sbjct  322  GSTVSEKIPTDFYP  335



>dbj|BAJ86608.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96242.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88789.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=413

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A++ SLKDDG+SMGK YELGGP++YT+H LAE+MY+ IRE+PRYV +PFPIAKA
Sbjct  266  VVDVAAAIVNSLKDDGTSMGKTYELGGPDVYTVHDLAEMMYETIREYPRYVNLPFPIAKA  325

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A+PRE+LL KVPFPLPTPSIFNLD I+AL+ D +VS++ALTF DL I PHKLKGYP E+
Sbjct  326  MASPREMLLNKVPFPLPTPSIFNLDQIKALSVDNLVSENALTFADLEIKPHKLKGYPTEF  385

Query  448  LIQYRKGGPQYGSTVSERVSPE  383
            L+ YRKGGP +GSTVSE++  E
Sbjct  386  LVCYRKGGPSFGSTVSEKMGSE  407



>ref|XP_010684864.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Beta vulgaris subsp. vulgaris]
Length=395

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A++A+LKDDGSSMGK YELGGP+++T+HQLAELMY+ IRE+P YVK+P  IAK 
Sbjct  251  VVDVAGAIVAALKDDGSSMGKTYELGGPDVFTIHQLAELMYETIREYPHYVKIPSLIAKG  310

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            ++TPRE+LL KVPFPLP+P+IFNLD I AL+ DTVVS  ALTF DL I PHKL+GYPVEY
Sbjct  311  VSTPRELLLNKVPFPLPSPTIFNLDQIHALSVDTVVSDKALTFADLDIAPHKLRGYPVEY  370

Query  448  LIQYRKGGPQYGSTVSERVSPESY  377
            L  YRKGGPQ+GST+SERVS + +
Sbjct  371  LSCYRKGGPQFGSTISERVSTDPW  394



>ref|NP_565469.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 [Arabidopsis 
thaliana]
 sp|Q9SK66.2|NDUA9_ARATH RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK59545.1| putative NADH-ubiquinone oxireductase [Arabidopsis thaliana]
 gb|AAK93749.1| putative NADH-ubiquinone oxireductase [Arabidopsis thaliana]
 gb|AAD21752.2| putative NADH-ubiquinone oxireductase [Arabidopsis thaliana]
 gb|AAT68351.1| hypothetical protein At2g20360 [Arabidopsis thaliana]
 gb|AAX23820.1| hypothetical protein At2g20360 [Arabidopsis thaliana]
 gb|AEC06997.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 [Arabidopsis 
thaliana]
Length=402

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = -1

Query  775  LKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKK  596
            LKDDGSSMGK YELGGP+++T H+LAE+MYD+IREWPRYVK+PFPIAKA+A PR+ ++ K
Sbjct  269  LKDDGSSMGKTYELGGPDVFTTHELAEIMYDMIREWPRYVKLPFPIAKAMAAPRDFMVNK  328

Query  595  VPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGPQY  416
            VPFPLP+P IFNLD I ALTTDT+VS +AL F DL +VPHKLKGYPVE+LIQYRKGGP +
Sbjct  329  VPFPLPSPQIFNLDQINALTTDTLVSDNALKFQDLDLVPHKLKGYPVEFLIQYRKGGPNF  388

Query  415  GSTVSERVSPESYP  374
            GSTVSE++  + YP
Sbjct  389  GSTVSEKIPTDFYP  402



>ref|XP_002884196.1| catalytic/ coenzyme binding protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60455.1| catalytic/ coenzyme binding protein [Arabidopsis lyrata subsp. 
lyrata]
Length=402

 Score =   219 bits (559),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -1

Query  775  LKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKK  596
            LKDDGSSMGK YELGGP+++T H+LAE+MYD+IREWPRYVK+PFPIAKA+A PR+ ++ K
Sbjct  269  LKDDGSSMGKTYELGGPDVFTTHELAEIMYDMIREWPRYVKLPFPIAKAMAAPRDFMVNK  328

Query  595  VPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGPQY  416
            VPFPLP+P IFNLD I ALTTDT+VS  AL F DL +VPHKLKGYPVE+LIQYRKGGP +
Sbjct  329  VPFPLPSPQIFNLDQINALTTDTLVSDKALKFQDLDLVPHKLKGYPVEFLIQYRKGGPNF  388

Query  415  GSTVSERVSPESYP  374
            GSTVSE++  + YP
Sbjct  389  GSTVSEKIPTDFYP  402



>ref|XP_010489051.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Camelina sativa]
Length=403

 Score =   218 bits (554),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -1

Query  775  LKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKK  596
            LKDDGSSMGK YELGGP+++T H+LAE+MYD+IREWPRYV +PFPIAKA+A PR+ ++ K
Sbjct  270  LKDDGSSMGKTYELGGPDVFTTHELAEIMYDMIREWPRYVNLPFPIAKAMAAPRDFMVNK  329

Query  595  VPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGPQY  416
            VPFPLP+P IFNLD I  LTTDT+VS +AL F DL +VPHKLKGYPVE+LIQYRKGGP +
Sbjct  330  VPFPLPSPQIFNLDQINTLTTDTLVSDNALKFQDLDLVPHKLKGYPVEFLIQYRKGGPNF  389

Query  415  GSTVSERVSPESYP  374
            GSTVSE++  + YP
Sbjct  390  GSTVSEKIPTDFYP  403



>ref|XP_010415893.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Camelina sativa]
Length=403

 Score =   217 bits (553),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -1

Query  775  LKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKK  596
            LKDDGSSMGK YELGGP+++T H+LAE+MYD+IREWPRYV +PFPIAKA+A PR+ ++ K
Sbjct  270  LKDDGSSMGKTYELGGPDVFTTHELAEIMYDMIREWPRYVNLPFPIAKAMAAPRDFMVNK  329

Query  595  VPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGPQY  416
            VPFPLP+P IFNLD I  LTTDT+VS +AL F DL +VPHKLKGYPVE+LIQYRKGGP +
Sbjct  330  VPFPLPSPQIFNLDQINTLTTDTLVSDNALKFQDLDLVPHKLKGYPVEFLIQYRKGGPNF  389

Query  415  GSTVSERVSPESYP  374
            GSTVSE++  + YP
Sbjct  390  GSTVSEKIPTDFYP  403



>emb|CDY31970.1| BnaA07g00250D [Brassica napus]
Length=402

 Score =   217 bits (552),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = -1

Query  775  LKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKK  596
            LKDDGSSMGK YELGGP+++T H LAE+M+D+IREWPRYVK+PFPIAKA+A PR+ ++ K
Sbjct  269  LKDDGSSMGKTYELGGPDVFTPHDLAEIMFDMIREWPRYVKLPFPIAKAMAGPRDFMVNK  328

Query  595  VPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGPQY  416
            VPFPLP+P IFNLD I ALTTDT+VS +ALTF DL +VPHKLKGYPVE+LIQYRKGGP +
Sbjct  329  VPFPLPSPQIFNLDQINALTTDTLVSDEALTFQDLDLVPHKLKGYPVEFLIQYRKGGPNF  388

Query  415  GSTVSERVSPESY  377
            GSTVSE++  + Y
Sbjct  389  GSTVSEKIPTDFY  401



>emb|CDY13877.1| BnaA09g43790D [Brassica napus]
Length=403

 Score =   217 bits (552),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = -1

Query  775  LKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKK  596
            LKDDGSSMGK+YELGGP+++T H LAE+M+D+IREWPRYVK+PFPIAKA+A PR+ ++ K
Sbjct  270  LKDDGSSMGKIYELGGPDVFTPHDLAEIMFDMIREWPRYVKLPFPIAKAMAGPRDFMVNK  329

Query  595  VPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGPQY  416
            VPFPLP+P IFNLD I ALTTDT+VS  ALTF DL +VPHKLKGYPVE+LIQYRKGGP +
Sbjct  330  VPFPLPSPQIFNLDQINALTTDTLVSDKALTFQDLDLVPHKLKGYPVEFLIQYRKGGPNF  389

Query  415  GSTVSERVSPESY  377
            GSTVSE++  + Y
Sbjct  390  GSTVSEKIPTDFY  402



>emb|CDY39772.1| BnaA09g10240D [Brassica napus]
Length=403

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = -1

Query  775  LKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKK  596
            LKDDGSSMGK YELGGP+++T H LAE+M+D+IREWPRYVK+PFPIAKA+A PR+ ++ K
Sbjct  270  LKDDGSSMGKTYELGGPDVFTPHDLAEIMFDMIREWPRYVKLPFPIAKAMAGPRDFMVNK  329

Query  595  VPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGPQY  416
            VPFPLP+P IFNLD I ALTTDT+VS  ALTF DL +VPHKLKGYPVE+LIQYRKGGP +
Sbjct  330  VPFPLPSPQIFNLDQINALTTDTLVSDKALTFQDLDLVPHKLKGYPVEFLIQYRKGGPNF  389

Query  415  GSTVSERVSPESY  377
            GSTVSE++  + Y
Sbjct  390  GSTVSEKIPTDFY  402



>ref|XP_010467837.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Camelina sativa]
Length=403

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -1

Query  775  LKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKK  596
            LKDDGSSMGK YELGGP+++T H+LAE+MYD+IREWPRYV +PFPIAKA+A PR+ ++ K
Sbjct  270  LKDDGSSMGKTYELGGPDVFTTHELAEIMYDMIREWPRYVNLPFPIAKAMAAPRDFMVNK  329

Query  595  VPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGPQY  416
            VPFPLP+P IFNLD I  LTTDT+VS +A  F DL +VPHKLKGYPVE+LIQYRKGGP +
Sbjct  330  VPFPLPSPQIFNLDQINTLTTDTLVSDNAFKFQDLDLVPHKLKGYPVEFLIQYRKGGPNF  389

Query  415  GSTVSERVSPESYP  374
            GSTVSE++  + YP
Sbjct  390  GSTVSEKIPTDFYP  403



>ref|XP_009112664.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Brassica rapa]
Length=403

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = -1

Query  775  LKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKK  596
            LKDDGSSMGK YELGGP+++T H LAE+M+D+IREWPRYVK+PFPIAKA+A PR+ ++ K
Sbjct  270  LKDDGSSMGKTYELGGPDVFTPHDLAEIMFDMIREWPRYVKLPFPIAKAMAGPRDFMVNK  329

Query  595  VPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGPQY  416
            VPFPLP+P IFNLD I ALTTDT+VS  ALTF DL +VPHKLKGYPVE+LIQYRKGGP +
Sbjct  330  VPFPLPSPQIFNLDQINALTTDTLVSDKALTFQDLDLVPHKLKGYPVEFLIQYRKGGPNF  389

Query  415  GSTVSERVSPESY  377
            GSTVSE++  + Y
Sbjct  390  GSTVSEKIPTDFY  402



>emb|CDX81965.1| BnaC08g36360D [Brassica napus]
Length=403

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = -1

Query  775  LKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKK  596
            LKDDGSSMGK YELGGP+++T H LAE+M+D+IREWPRYVK+PFPIAKA+A PR+ ++ K
Sbjct  270  LKDDGSSMGKTYELGGPDVFTPHDLAEIMFDMIREWPRYVKLPFPIAKAMAGPRDFMVNK  329

Query  595  VPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGPQY  416
            VPFPLP+P IFNLD I ALTTDT+VS  ALTF DL +VPHKLKGYPVE+LIQYRKGGP +
Sbjct  330  VPFPLPSPQIFNLDQINALTTDTLVSDKALTFQDLDLVPHKLKGYPVEFLIQYRKGGPNF  389

Query  415  GSTVSERVSPESY  377
            GSTVSE++  + Y
Sbjct  390  GSTVSEKIPTDFY  402



>ref|XP_009117495.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Brassica rapa]
Length=403

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = -1

Query  775  LKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKK  596
            LKDDGSSMGK YELGGP+++T H LAE+M+D+IREWPRYVK+PFPIAKA+A PR+ ++ K
Sbjct  270  LKDDGSSMGKTYELGGPDVFTPHDLAEIMFDMIREWPRYVKLPFPIAKAMAGPRDFMVNK  329

Query  595  VPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGPQY  416
            VPFPLP+P IFNLD I ALT DT+VS  ALTF DL +VPHKLKGYPVE+LIQYRKGGP +
Sbjct  330  VPFPLPSPQIFNLDQINALTIDTLVSDKALTFQDLDLVPHKLKGYPVEFLIQYRKGGPNF  389

Query  415  GSTVSERVSPESY  377
            GSTVSE++  + Y
Sbjct  390  GSTVSEKIPTDFY  402



>gb|KJB42340.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=383

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 115/145 (79%), Gaps = 17/145 (12%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVASA++A+LKDDGSSMG                  LMY+ IREWPRYV +P PIAKA
Sbjct  256  VVDVASAIVAALKDDGSSMG-----------------NLMYETIREWPRYVNIPLPIAKA  298

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA PREVLLKKVPFPLP P IFNLD I A  TDTVVS++ALTF DLGIVPHKLKGYPVEY
Sbjct  299  IAMPREVLLKKVPFPLPNPDIFNLDQINAFATDTVVSENALTFMDLGIVPHKLKGYPVEY  358

Query  448  LIQYRKGGPQYGSTVSERVSPESYP  374
            LIQYRKGGPQ+GSTVSE+V+P+SYP
Sbjct  359  LIQYRKGGPQFGSTVSEKVNPDSYP  383



>emb|CDY03308.1| BnaC09g10400D [Brassica napus]
Length=402

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = -1

Query  775  LKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKK  596
            LKDDGSSMGK YELGGP+++T   LAE+M+D+IREWPRYVK+PFPIAKA+A PR+ ++ K
Sbjct  269  LKDDGSSMGKTYELGGPDVFTPRDLAEIMFDMIREWPRYVKLPFPIAKAMAGPRDFMVNK  328

Query  595  VPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGPQY  416
            VPFPLP+P IFNLD I ALTTDT+VS  ALTF DL +VPHKLKGYPVE+LIQYRKGGP +
Sbjct  329  VPFPLPSPQIFNLDQINALTTDTLVSDKALTFQDLDLVPHKLKGYPVEFLIQYRKGGPNF  388

Query  415  GSTVSERVSPESY  377
            GSTVSE++  + Y
Sbjct  389  GSTVSEKIPTDFY  401



>emb|CDY05746.1| BnaC07g00570D [Brassica napus]
Length=402

 Score =   211 bits (538),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = -1

Query  775  LKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKK  596
            LKDDGSSMGK YELGGP+++T H LAE+M+D+IREWPRYVK+PFPIAKA+A  R+ ++ K
Sbjct  269  LKDDGSSMGKTYELGGPDVFTPHDLAEIMFDMIREWPRYVKLPFPIAKAMAGTRDFMVNK  328

Query  595  VPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGPQY  416
            VPFPLP+P IFNLD I  LTTDT+VS  ALTF DL +VPHKLKGYPVE+LIQYRKGGP +
Sbjct  329  VPFPLPSPQIFNLDQINTLTTDTLVSDKALTFQDLDLVPHKLKGYPVEFLIQYRKGGPNF  388

Query  415  GSTVSERVSPESY  377
            GSTVSE++  + Y
Sbjct  389  GSTVSEKIPTDFY  401



>ref|XP_009102039.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Brassica rapa]
Length=402

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = -1

Query  775  LKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKK  596
            LKDDGSSMGK YELGGP+++T H LAE+M+D+IREWPRYVK+PFPIAKA+A PR+ ++ K
Sbjct  269  LKDDGSSMGKTYELGGPDVFTPHDLAEIMFDMIREWPRYVKLPFPIAKAMAGPRDFMVNK  328

Query  595  VPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGPQY  416
            VP PLP+P IFN D I ALTTDT+VS  ALTF DL +VPHKLKGYPVE+LIQYRKGGP +
Sbjct  329  VPSPLPSPQIFNRDQINALTTDTLVSDKALTFQDLDLVPHKLKGYPVEFLIQYRKGGPNF  388

Query  415  GSTVSERVSPESY  377
            GSTVSE++  + Y
Sbjct  389  GSTVSEKIPTDFY  401



>ref|XP_006408954.1| hypothetical protein EUTSA_v10002002mg [Eutrema salsugineum]
 gb|ESQ50407.1| hypothetical protein EUTSA_v10002002mg [Eutrema salsugineum]
Length=402

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = -1

Query  775  LKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKK  596
            LKDDGSSMGK YELGGP+++    LAE+M+D+IRE PRYVK+PFPIAK +A PR+ ++ K
Sbjct  269  LKDDGSSMGKTYELGGPDVFNAQDLAEIMFDMIRERPRYVKLPFPIAKVMAGPRDFMVNK  328

Query  595  VPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGPQY  416
            VPFPLP+P +FNLD I ALTTDT+VS  ALTF DL +VPHKLKGYPVE+LIQYRKGGP +
Sbjct  329  VPFPLPSPQVFNLDQINALTTDTLVSDKALTFQDLDLVPHKLKGYPVEFLIQYRKGGPNF  388

Query  415  GSTVSERVSPESY  377
            GSTVSE++  + Y
Sbjct  389  GSTVSEKIPTDFY  401



>gb|KDO37085.1| hypothetical protein CISIN_1g047628mg, partial [Citrus sinensis]
Length=327

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -1

Query  775  LKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKK  596
            LKDDG+SMGK+YELGGP+I+T+H+LAELMYD IRE+P YVKVPFP+AKA+A PRE+LLKK
Sbjct  208  LKDDGTSMGKIYELGGPDIFTVHELAELMYDTIREYPHYVKVPFPVAKAVAMPREILLKK  267

Query  595  VPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGPQY  416
            VPFPLP P +FNLD I A T+DT+VS +ALTF DLGIVPHKLKGYP EYLI YRKGGP++
Sbjct  268  VPFPLPRPGLFNLDEINAYTSDTIVSDNALTFQDLGIVPHKLKGYPTEYLIWYRKGGPKF  327



>gb|KFK40412.1| hypothetical protein AALP_AA3G370500 [Arabis alpina]
Length=404

 Score =   202 bits (513),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A+IA+LKDDGSSMGK YELGGP+++    LAE+M+D+IRE PRYVK+PFPIAK 
Sbjct  260  VVDVAAAIIAALKDDGSSMGKTYELGGPDVFNARDLAEIMFDMIREVPRYVKLPFPIAKV  319

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A PR+ ++ KVPFPLP P +FNLD I A T DT+VS  ALTF DL +VPHKLKGYPVE+
Sbjct  320  MAGPRDFMVNKVPFPLPCPQVFNLDQINASTIDTLVSDKALTFQDLDLVPHKLKGYPVEF  379

Query  448  LIQYRKGGPQYGSTVSERVSPESY  377
            LIQYRKGGP +GSTVSE++  + Y
Sbjct  380  LIQYRKGGPNFGSTVSEKIPTDFY  403



>ref|XP_008235764.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Prunus mume]
Length=387

 Score =   198 bits (503),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A++A+LKDDG+SMGKVYELGGPE++T+HQLAELM++ IREWP YVKVP PIAKA
Sbjct  255  VVDVAGAIVAALKDDGTSMGKVYELGGPEVFTVHQLAELMFETIREWPHYVKVPLPIAKA  314

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA PRE+LL KVPFPLP P IFN D I A  TDTVVS+++LTF DLG+VPHKLKGYPVE+
Sbjct  315  IAAPREILLNKVPFPLPNPEIFNRDQILAQATDTVVSENSLTFSDLGLVPHKLKGYPVEF  374



>gb|ABK24353.1| unknown [Picea sitchensis]
Length=401

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A+IA+LKDDG+S+GK YELGGP+++T+ QL  LM+++IRE PR++K+P PIA+ 
Sbjct  258  VIDVAAAIIAALKDDGTSIGKTYELGGPDVFTIDQLVHLMFEMIREEPRFIKIPIPIARL  317

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            I++PRE LL KVPFPLPTP IFN D +++L  D VVS+DALTF DL +VPHKLKGYP+E+
Sbjct  318  ISSPREFLLNKVPFPLPTPEIFNQDYVDSLLADNVVSQDALTFTDLSVVPHKLKGYPIEF  377

Query  448  LIQYRKGGPQYGSTVSERVSPESY  377
            L QYR GGP +G+T+ ER+S   +
Sbjct  378  LFQYRTGGPSFGATLGERISGAGF  401



>gb|KJB42337.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=358

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVASA++A+LKDDGSSMG VYELGGPEIYT+H+LAELMY+ IREWPRYV +P PIAKA
Sbjct  256  VVDVASAIVAALKDDGSSMGNVYELGGPEIYTVHELAELMYETIREWPRYVNIPLPIAKA  315

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDA  509
            IA PREVLLKKVPFPLP P IFNLD I A  TDTVVS++ 
Sbjct  316  IAMPREVLLKKVPFPLPNPDIFNLDQINAFATDTVVSENG  355



>gb|KJB42338.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=367

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVASA++A+LKDDGSSMG VYELGGPEIYT+H+LAELMY+ IREWPRYV +P PIAKA
Sbjct  256  VVDVASAIVAALKDDGSSMGNVYELGGPEIYTVHELAELMYETIREWPRYVNIPLPIAKA  315

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDA  509
            IA PREVLLKKVPFPLP P IFNLD I A  TDTVVS++ 
Sbjct  316  IAMPREVLLKKVPFPLPNPDIFNLDQINAFATDTVVSENG  355



>ref|XP_009803384.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana sylvestris]
Length=147

 Score =   153 bits (386),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -1

Query  661  YVKVPFPIAKAIATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIV  482
            Y+     + +AIA+PRE LL KVP P+PTP+IFNLD IEAL TD +VSKDALTF+DLG+ 
Sbjct  52   YLHFGLFLFQAIASPREFLLNKVPAPMPTPTIFNLDAIEALATDNIVSKDALTFEDLGLA  111

Query  481  PHKLKGYPVEYLIQYRKGGPQYGSTVSERVSPESYP  374
            PHK+KGYPVE+LIQYRKGGP YGSTVSERVSPESYP
Sbjct  112  PHKVKGYPVEFLIQYRKGGPNYGSTVSERVSPESYP  147



>gb|KJB42341.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=312

 Score =   132 bits (333),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -1

Query  601  KKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGP  422
            K +PFPLP P IFNLD I A  TDTVVS++ALTF DLGIVPHKLKGYPVEYLIQYRKGGP
Sbjct  237  KYMPFPLPNPDIFNLDQINAFATDTVVSENALTFMDLGIVPHKLKGYPVEYLIQYRKGGP  296

Query  421  QYGSTVSERVSPESYP  374
            Q+GSTVSE+V+P+SYP
Sbjct  297  QFGSTVSEKVNPDSYP  312



>ref|XP_002976090.1| hypothetical protein SELMODRAFT_104564, partial [Selaginella 
moellendorffii]
 gb|EFJ22995.1| hypothetical protein SELMODRAFT_104564, partial [Selaginella 
moellendorffii]
Length=353

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 91/134 (68%), Gaps = 1/134 (1%)
 Frame = -1

Query  808  VTDVASAVIASLKD-DGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAK  632
            V DVA+A +A++K+ +G  +GKVYELGGP++YT+H+L   M++V+RE PR + +P P+A+
Sbjct  217  VLDVAAAFLAAVKEKEGIHVGKVYELGGPDVYTIHELLLWMFEVLREKPRIINIPLPLAE  276

Query  631  AIATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVE  452
            A++  RE   K+VP PLP         I++L  D VVS DALTF++LGI P  L G   E
Sbjct  277  AVSRVREFFFKRVPVPLPQLWPCYRHYIDSLKVDQVVSPDALTFEELGIKPRPLGGLATE  336

Query  451  YLIQYRKGGPQYGS  410
            YL  YR+GGP  G 
Sbjct  337  YLFYYREGGPHMGQ  350



>ref|XP_002968287.1| hypothetical protein SELMODRAFT_89106, partial [Selaginella moellendorffii]
 gb|EFJ30541.1| hypothetical protein SELMODRAFT_89106, partial [Selaginella moellendorffii]
Length=362

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 91/134 (68%), Gaps = 1/134 (1%)
 Frame = -1

Query  808  VTDVASAVIASLKD-DGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAK  632
            V DVA+A +A++K+ +G  +GKVYELGGP++YT+H+L   M++V+RE PR + +P P+A+
Sbjct  226  VLDVAAAFLAAVKEKEGIHVGKVYELGGPDVYTIHELLLWMFEVLREKPRIINIPLPLAE  285

Query  631  AIATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVE  452
            A++  RE   K+VP PLP         I++L  D VVS DALTF++LGI P  L G   E
Sbjct  286  AVSRVREFFFKRVPVPLPQLWPCYRHYIDSLKVDQVVSPDALTFEELGIKPRPLGGLATE  345

Query  451  YLIQYRKGGPQYGS  410
            YL  YR+GGP  G 
Sbjct  346  YLFYYREGGPHMGQ  359



>ref|XP_001765756.1| predicted protein [Physcomitrella patens]
 gb|EDQ69347.1| predicted protein [Physcomitrella patens]
Length=405

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = -1

Query  775  LKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKK  596
            ++D+G SMGK +ELGGP+++T+++L  LM++ IRE+PR V +P P+ +  A PRE+ +K+
Sbjct  274  IRDEGFSMGKTFELGGPDVFTVNELVALMFEAIREYPRVVHIPMPLCQIAAMPRELAMKR  333

Query  595  VPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGPQY  416
               P+P    F+ D ++ L  D +VS+DA+   DLGI  HK+ G  +E+L  YR GGP  
Sbjct  334  -GIPIPFSPSFSKDYLDQLACDLIVSQDAMGLADLGITSHKIGGLTIEHLNAYRTGGPSV  392

Query  415  GSTVSERVSPESY  377
            G+TV E V    +
Sbjct  393  GTTVGESVHGAGF  405



>ref|XP_001757609.1| predicted protein [Physcomitrella patens]
 gb|EDQ77666.1| predicted protein [Physcomitrella patens]
Length=393

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = -1

Query  775  LKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKK  596
            ++D+G SMGK +ELGGP+++T++ L  L+++ IRE PR V +P  +A+ +A PREV +K+
Sbjct  262  IRDEGFSMGKTFELGGPDVFTVNDLVTLVFEAIREHPRVVHIPMALAQLLAMPREVAMKR  321

Query  595  VPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGPQY  416
               P+P    F+ D ++ L+ D VVS DA+   DLG+  HK+ G  +E+L  YR GGP  
Sbjct  322  -GIPIPFSPTFSKDYLDQLSCDLVVSSDAMGLADLGVTSHKIGGLTIEHLNAYRTGGPSV  380

Query  415  GSTVSERVSPESY  377
            G+TV E +    +
Sbjct  381  GTTVGESIHGAGF  393



>ref|XP_009763970.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Nicotiana sylvestris]
Length=314

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVASA++ASLKD+G SMGKVYELGGP++YTMH+LAELM+D+IREWPRYV VPFPIAKA
Sbjct  253  VADVASAIVASLKDNGISMGKVYELGGPDVYTMHELAELMFDMIREWPRYVNVPFPIAKA  312



>ref|XP_005651289.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
 gb|EIE26745.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
Length=378

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 82/129 (64%), Gaps = 4/129 (3%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AVI SLK    ++GK Y L GPE+ T+ Q+ EL+Y  IRE      +P P+A+ 
Sbjct  234  VRDVADAVIHSLKTK-EALGKEYFLAGPEVLTVKQIVELVYTTIREPISTFNLPLPVARL  292

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKL-KGYPVE  452
            +A PRE L K   FP+P  ++F  D IE +T D V+  + LT+ DL +VP K+ +G+P+E
Sbjct  293  LAVPREKLFKM--FPIPVNTMFTADYIEEMTQDHVLPPNVLTYADLEVVPKKVTEGFPIE  350

Query  451  YLIQYRKGG  425
            +L  YR GG
Sbjct  351  HLRHYRVGG  359



>sp|Q0DWQ7.1|CCB12_ORYSJ RecName: Full=Cyclin-B1-2; AltName: Full=G2/mitotic-specific 
cyclin-B1-2; Short=CycB1;2 [Oryza sativa Japonica Group]
Length=391

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A++ SLKDDG+SMGK Y LGGPEIYT+H LAELMY+ I EWPRY+ VP PIA+A
Sbjct  326  VVDVAAAIVNSLKDDGTSMGKSYGLGGPEIYTVHDLAELMYETICEWPRYIDVPLPIARA  385

Query  628  IATP  617
            IA+P
Sbjct  386  IASP  389



>gb|EEC74184.1| hypothetical protein OsI_09314 [Oryza sativa Indica Group]
Length=366

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A++ SLKDDG+SMGK Y LGGPEIYT+H LAELMY+ I EWPRY+ VP PIA+A
Sbjct  301  VVDVAAAIVNSLKDDGTSMGKSYGLGGPEIYTVHDLAELMYETICEWPRYIDVPLPIARA  360

Query  628  IATPR  614
            IA+P 
Sbjct  361  IASPE  365



>ref|XP_001420142.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98435.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=366

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 80/133 (60%), Gaps = 2/133 (2%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A+   + D+ +S G+ YEL G ++YT  +LA+++   IR       +P  I KA
Sbjct  220  VDDVAVAIRQIVHDELTS-GRTYELAGNKVYTFDELAKMVLKTIRTRKSTAYIPSFIMKA  278

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLK-GYPVE  452
            ++ P E LL++VPFP+PTP       I+A + D V   D+L F DLGI P+ ++ GY ++
Sbjct  279  LSCPHEWLLRRVPFPMPTPLGLTRSYIDAQSRDYVKRADSLGFSDLGIEPNNIENGYVLD  338

Query  451  YLIQYRKGGPQYG  413
            YL  +R GG Q G
Sbjct  339  YLRSFRAGGYQVG  351



>emb|CEF99374.1| NAD(P)-binding domain [Ostreococcus tauri]
Length=359

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 79/133 (59%), Gaps = 2/133 (2%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A+   + D+ +S G+ YEL G ++YT+H LA+L+    R       +P  I +A
Sbjct  219  VDDVAVAIRQIVHDELTS-GRTYELAGKKVYTVHDLAKLVLRTARSRRSTAYIPSFIMRA  277

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLK-GYPVE  452
            ++ P E LL+KVPFP+PTP       I+A + D V + D L F DLGI P+ ++ GY ++
Sbjct  278  LSCPHEFLLRKVPFPMPTPVGLTRSYIDAQSRDYVKAPDTLGFSDLGIDPNDIENGYVLD  337

Query  451  YLIQYRKGGPQYG  413
            YL  +R GG   G
Sbjct  338  YLRSFRAGGYALG  350



>ref|XP_003059930.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55882.1| predicted protein [Micromonas pusilla CCMP1545]
Length=353

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 79/139 (57%), Gaps = 3/139 (2%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIR--EWPRYVKVPFPIA  635
            V DVA A+ A + D+ S+ G+ +EL G +I TM  + ++   +IR     R V VP  I 
Sbjct  213  VDDVALAIRAIVHDE-STAGRTFELCGEKILTMEDMLKMTQSIIRAQNASRIVYVPSFIL  271

Query  634  KAIATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPV  455
            K +A P E LL +VPFPLPTP+      I+A   D +    +  F +LGIVP KL+G  +
Sbjct  272  KMLAAPHEFLLNRVPFPLPTPTGLTRSYIDAQGEDYLKDPKSEGFKELGIVPAKLEGVVI  331

Query  454  EYLIQYRKGGPQYGSTVSE  398
            +YL  +R GG   G+T  +
Sbjct  332  DYLRAFRFGGYDVGATAGQ  350



>ref|WP_026986147.1| 3-beta hydroxysteroid dehydrogenase [Fodinicurvata fenggangensis]
Length=313

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 70/128 (55%), Gaps = 10/128 (8%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A + +L+D     GK YELGGP +Y+  +L ELM   IR     V VPF +AK 
Sbjct  191  VGDVADAAVQTLQDT-KCQGKTYELGGPRVYSFKELMELMLKTIRRKRLLVPVPFGMAKV  249

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            + +  ++L    PF   T      D +E L  D +VSKDALT +DLGI  H  +     Y
Sbjct  250  MGSVAQLL----PFAPITA-----DQVELLKNDNIVSKDALTLEDLGIEKHSAEVIIPTY  300

Query  448  LIQYRKGG  425
            L +YR GG
Sbjct  301  LDRYRPGG  308



>ref|XP_002504449.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65707.1| predicted protein [Micromonas sp. RCC299]
Length=390

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 78/134 (58%), Gaps = 3/134 (2%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIRE--WPRYVKVPFPIA  635
            V DVA A+ A ++D+  + G+ +EL G ++YTM  +   +   IR   +P+ + VP  I 
Sbjct  247  VDDVALAIQAIVEDE-ETAGQTFELAGDKVYTMEDMLRFVQKTIRTPGYPKILYVPSFIL  305

Query  634  KAIATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPV  455
            +A+  P E LL+KVPFPLPTP+      I+A + + + +     F+ LGI P KL+G  +
Sbjct  306  RALGAPHEFLLRKVPFPLPTPTGLTKSYIDAQSVNYLKNPRVPGFEQLGIKPAKLEGVVI  365

Query  454  EYLIQYRKGGPQYG  413
            +YL  +R GG   G
Sbjct  366  DYLRAFRFGGYDAG  379



>ref|XP_007510295.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18640.1| predicted protein [Bathycoccus prasinos]
Length=431

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 71/129 (55%), Gaps = 2/129 (2%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIR-EWPRYVKVPFPIAK  632
            V DVA A I+ +  D  ++GK Y L G + +TM +LA+L  D  R    R   +P  + K
Sbjct  283  VDDVAIA-ISQMPYDEETVGKEYVLAGEKTFTMEELAKLTVDAGRFRSARVAYIPKFVYK  341

Query  631  AIATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVE  452
             ++ P E LL +VPFPLPTP       ++A   D V   + L F +LG+ P K+ G  ++
Sbjct  342  LLSAPHEFLLNRVPFPLPTPKGLTRSFVDAQDADYVKKPNELGFKELGMTPAKMDGITID  401

Query  451  YLIQYRKGG  425
            YL  YR GG
Sbjct  402  YLRSYRSGG  410



>ref|WP_022729668.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Fodinicurvata 
sediminis]
Length=313

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 69/128 (54%), Gaps = 10/128 (8%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A + +L+D     GK YELGGP  Y+  +L ELM   IR     V VPF +AK 
Sbjct  191  VGDVADAAVQTLQDT-KCHGKTYELGGPRTYSFKELMELMLKTIRRKRLLVPVPFGMAKI  249

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            + +  ++L    PF   T      D +E L  D +VSKDALT +DLGI  H  +     Y
Sbjct  250  MGSVAQLL----PFAPITA-----DQVELLKNDNIVSKDALTLEDLGIEKHSAEVIIPTY  300

Query  448  LIQYRKGG  425
            L +YR GG
Sbjct  301  LDRYRPGG  308



>ref|XP_011401632.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Auxenochlorella protothecoides]
 gb|KFM28596.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Auxenochlorella protothecoides]
Length=378

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 77/146 (53%), Gaps = 6/146 (4%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV  S++++G++ GK Y L GPE+ T+ QLA+L Y  IRE    + VP  +A+ 
Sbjct  227  VRDVAQAVFNSMQEEGAA-GKTYALAGPEVLTLSQLADLTYHTIREPHNVLPVPEKLAEL  285

Query  628  IATPREVLLKKVPFP----LPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKL-KG  464
             + P   L  K PF       + S+  L   +         +  LT +DLG+ P ++ +G
Sbjct  286  ASRPLGWLGTKTPFRANPFFSSDSVAELARGDFTLAAATADQPLLTIEDLGVAPRRVTEG  345

Query  463  YPVEYLIQYRKGGPQYGSTVSERVSP  386
            +P+E+L  YR GG   G+      +P
Sbjct  346  HPIEFLRYYRSGGYDMGAVAEVDSAP  371



>ref|XP_005850526.1| hypothetical protein CHLNCDRAFT_34039 [Chlorella variabilis]
 gb|EFN58424.1| hypothetical protein CHLNCDRAFT_34039 [Chlorella variabilis]
Length=415

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 75/141 (53%), Gaps = 7/141 (5%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A++ SLK    S+G+ Y L GP++ T+ QL    Y  IRE    V +P  +A  
Sbjct  258  VRDVAAAIMNSLKTY-DSLGQTYYLAGPDVMTVAQLVAFTYHTIRERNASVPMPAAVAGV  316

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALT---TDTVVSKDALTFDDLGIVPHKL-KGY  461
            +A   + L +    PL  P +F+ D I  +     D V+    L F+ L + PH++ +G 
Sbjct  317  LAKGWDALGRST--PLRGPLMFSSDFIAEMKGGWGDYVMPSGVLGFEHLDVEPHRVAEGI  374

Query  460  PVEYLIQYRKGGPQYGSTVSE  398
            P+EYL  YR GG  +GS   E
Sbjct  375  PIEYLRHYRSGGYDFGSLAEE  395



>ref|WP_027287982.1| 3-beta hydroxysteroid dehydrogenase [Rhodovibrio salinarum]
Length=320

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 68/128 (53%), Gaps = 10/128 (8%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A +  + +   + GK YELGGP+IYT  QL E++   IR     + +PF +A+ 
Sbjct  191  VGDVADAAMVCVHES-KTKGKTYELGGPQIYTFKQLMEILLKEIRRKRLLLPIPFGVAQV  249

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
             A   E+L    P PL T      D +  L  D VV K AL+F  LG+ P  ++     Y
Sbjct  250  QAGIAELL----PKPLLT-----RDQVTLLKQDNVVQKGALSFKTLGLEPQAIEAILPTY  300

Query  448  LIQYRKGG  425
            LI+YR GG
Sbjct  301  LIRYRPGG  308



>ref|WP_035069164.1| 3-beta hydroxysteroid dehydrogenase, partial [Caulobacteraceae 
bacterium PMMR1]
Length=316

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 4/126 (3%)
 Frame = -1

Query  802  DVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIA  623
            DV  A++ SL +  S+ G+++ELGGP IYT  +L +L+ +  +     V +PF +A+ I 
Sbjct  192  DVGEAIVRSL-EQASAGGRIFELGGPAIYTFKELMQLVLNETQRRRALVPLPFEVARLIG  250

Query  622  TPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLI  443
               +VL   +P  +P P     D +E L  D VV+  ALT  DLG+ P  ++     YL 
Sbjct  251  VAGDVLSAVLPV-IPPP--LTTDQVELLKRDNVVAPGALTLADLGVTPTAVEAVVPTYLW  307

Query  442  QYRKGG  425
            ++R GG
Sbjct  308  RFRPGG  313



>ref|WP_039540296.1| 3-beta hydroxysteroid dehydrogenase [Ruegeria sp. ANG-R]
 gb|KIC40448.1| 3-beta hydroxysteroid dehydrogenase [Ruegeria sp. ANG-R]
Length=327

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 70/131 (53%), Gaps = 4/131 (3%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A +  +   G +   VYELGGPE+ +   L + M DVI      V +PF +AK 
Sbjct  189  VDDVAQAAVQGVL--GKATAGVYELGGPEVKSFRALMQQMLDVIHRRRIIVGLPFWVAKI  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A   +++ K V F L   +I   D ++ L  D VV++DA  F DLGI P  L     EY
Sbjct  247  MAGVLDIV-KFVSFQLFPNNILTRDQLKNLRRDNVVAEDARGFADLGIEPATLDSILPEY  305

Query  448  LIQYRKGGPQY  416
            L ++R  G QY
Sbjct  306  LWKFRPSG-QY  315



>ref|WP_038036038.1| 3-beta hydroxysteroid dehydrogenase, partial [Thermopetrobacter 
sp. TC1]
Length=316

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 71/132 (54%), Gaps = 14/132 (11%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A + +L+D+  S GK  ELGGPE++T  +L E M  VIR     V VPF +AK 
Sbjct  187  VEDVAKAAVKALEDETLS-GKTLELGGPEVWTFRELMEYMLMVIRRRRMLVSVPFGVAKV  245

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKGY  461
            +A P + L    P P  TP     D ++ L  + VVS  A     T + +GI P  ++  
Sbjct  246  MAWPAQFL----PGPPLTP-----DQVKMLMRNNVVSDKARAEGRTLEGIGIEPDGIEAV  296

Query  460  PVEYLIQYRKGG  425
              +YL++YR  G
Sbjct  297  VPDYLVRYRPAG  308



>ref|WP_038005934.1| MULTISPECIES: 3-beta hydroxysteroid dehydrogenase [Thalassobacter]
 gb|KGK79763.1| 3-beta hydroxysteroid dehydrogenase [Thalassobacter stenotrophicus]
 gb|KGL01318.1| 3-beta hydroxysteroid dehydrogenase [Thalassobacter sp. 16PALIMAR09]
Length=329

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 69/131 (53%), Gaps = 4/131 (3%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A +  +   G++   +YELGGP++ T  QL E M  V+R     + VPF  A+ 
Sbjct  189  VDDVAAAAVKGVT--GAAKPGIYELGGPDVETFKQLMERMLKVVRRRALVLTVPFFAARI  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A   +  ++     L T S    D ++ L  D VVS DA++F DLGI P  +      Y
Sbjct  247  MAAVLD-FVQIASLGLFTNSQITRDQVKQLANDNVVSPDAMSFADLGIEPTDMDAVLETY  305

Query  448  LIQYRKGGPQY  416
            L Q+R  G QY
Sbjct  306  LWQFRPNG-QY  315



>ref|WP_009757683.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Ahrensia sp. R2A130]
 gb|EFL90794.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 9 
[Ahrensia sp. R2A130]
Length=320

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 68/132 (52%), Gaps = 14/132 (11%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A IA+  D+    G  +ELGGPE+ T  +  E M DVI      V +PFPIA A
Sbjct  191  VGDVAKA-IANAADEKLEAGSTWELGGPEVLTFRECMERMLDVIDRKRALVSLPFPIASA  249

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDAL----TFDDLGIVPHKLKGY  461
            + +    LL+  P    TP       +E L +D VVS D++    T +D G+ P  L   
Sbjct  250  MGS----LLQFAPGAPITPG-----QVEMLKSDNVVSDDSITQNRTLEDAGVEPTALSAV  300

Query  460  PVEYLIQYRKGG  425
               YL+++RK G
Sbjct  301  LPTYLVRFRKHG  312



>dbj|GAK45366.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 9 
[alpha proteobacterium MA2]
Length=323

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 72/132 (55%), Gaps = 14/132 (11%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVASA++A+L+++  + GK+YELGGPE+++  +L E M + IR     V +PF +AK 
Sbjct  195  VKDVASAILAALENE-EARGKIYELGGPEVFSFKELMERMLEEIRRKRVLVTLPFGLAK-  252

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKGY  461
                   L+ +V   LP P +   D +E L  D VVS +A     T   LG+    L   
Sbjct  253  -------LMGRVAGLLPNPPL-TADQVELLKRDNVVSDEAREEERTLAALGVPATGLDSV  304

Query  460  PVEYLIQYRKGG  425
               YL ++R+ G
Sbjct  305  LSTYLYRFRRTG  316



>ref|WP_041768854.1| 3-beta hydroxysteroid dehydrogenase [Pseudovibrio sp. FO-BEG1]
Length=326

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 77/142 (54%), Gaps = 15/142 (11%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A IA+  ++    GK+YELGGP++ T  +  +LM +VI      V +PF +A+ 
Sbjct  195  VGDVALA-IANAAENKVETGKIYELGGPQVATFKECLQLMMNVILRRRMLVSLPFLMARI  253

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKGY  461
             A      L+ +P P+ T     +D +  L +D VVSK+A     TF+ LGI PH ++  
Sbjct  254  QAK----FLQMLPKPMLT-----VDQVNLLKSDNVVSKEAQAEKRTFEGLGIEPHSMEAI  304

Query  460  PVEYLIQYRKGGPQYGSTVSER  395
               YL ++R  G QY S  S +
Sbjct  305  LPTYLDKFRPRG-QYDSQKSAK  325



>gb|AEV35208.1| NADH dehydrogenase (ubiquinone) [Pseudovibrio sp. FO-BEG1]
Length=328

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 77/142 (54%), Gaps = 15/142 (11%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A IA+  ++    GK+YELGGP++ T  +  +LM +VI      V +PF +A+ 
Sbjct  197  VGDVALA-IANAAENKVETGKIYELGGPQVATFKECLQLMMNVILRRRMLVSLPFLMARI  255

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKGY  461
             A      L+ +P P+ T     +D +  L +D VVSK+A     TF+ LGI PH ++  
Sbjct  256  QAK----FLQMLPKPMLT-----VDQVNLLKSDNVVSKEAQAEKRTFEGLGIEPHSMEAI  306

Query  460  PVEYLIQYRKGGPQYGSTVSER  395
               YL ++R  G QY S  S +
Sbjct  307  LPTYLDKFRPRG-QYDSQKSAK  327



>ref|WP_027845124.1| 3-beta hydroxysteroid dehydrogenase [Mastigocoleus testarum]
Length=324

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 75/144 (52%), Gaps = 15/144 (10%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV  +L+D G+S GK+YELGGP +Y+  +L +++ D  +       VP+PIA+ 
Sbjct  191  VDDVADAVCVALEDTGTS-GKIYELGGPRVYSFKELMQIVLDETQRKRLLAPVPWPIAR-  248

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDAL----TFDDLGIVPHKLKGY  461
                   L  ++   LP P +   D ++ L TD VVS+ A+    T  DLGI    ++  
Sbjct  249  -------LQGRILGLLPNP-LLTHDQVKMLETDNVVSEAAIAEKRTLGDLGIEATSVEAI  300

Query  460  PVEYLIQYRKGGPQYGSTVSERVS  389
               YL  YR+ G QY   +    +
Sbjct  301  VPSYLWMYRRQG-QYAEDIRRETA  323



>ref|WP_012180246.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Dinoroseobacter 
shibae]
 gb|ABV95323.1| ubiquinone dependent NADH dehydrogenase [Dinoroseobacter shibae 
DFL 12 = DSM 16493]
Length=327

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 71/132 (54%), Gaps = 6/132 (5%)
 Frame = -1

Query  808  VTDVA-SAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAK  632
            V DVA +AV A+L   G +   +YELGGP++ +  +L   M  VI      V VPFP+A 
Sbjct  189  VDDVARAAVKAAL---GQAKPGIYELGGPDVNSFRELMAHMLSVIDRRRLIVNVPFPVAH  245

Query  631  AIATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVE  452
             +    + L++K+   +    +   D +  L  D VV+ DA+ FDDLGI P  L+    E
Sbjct  246  VMGMTLD-LVQKLSLGIIHNGMLTHDQVRNLAKDNVVAADAMGFDDLGIEPVALEAVLPE  304

Query  451  YLIQYRKGGPQY  416
            YL ++R  G QY
Sbjct  305  YLWRFRPAG-QY  315



>ref|WP_008235576.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Roseobacter sp. 
CCS2]
 gb|EBA11194.1| NADH-ubiquinone oxidoreductase, putative [Roseobacter sp. CCS2]
Length=326

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 73/131 (56%), Gaps = 5/131 (4%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A +  +   G + G VYELGGP+++T  +L +LM DVIR     V  PF +A+ 
Sbjct  189  VDDVAAAAVKGVL--GEAEGGVYELGGPDVHTFRELMQLMLDVIRRRRLIVNTPFWMARV  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A     L++K+ F L    +   D +  L  D VV+ DA +F  LG+ P  ++    +Y
Sbjct  247  MAFGFG-LVRKLSFGLIKGPV-TKDQVINLAVDNVVADDARSFAALGMQPTAMEAVLPDY  304

Query  448  LIQYRKGGPQY  416
            L ++R  G QY
Sbjct  305  LWRFRPSG-QY  314



>ref|WP_044830089.1| 3-beta hydroxysteroid dehydrogenase [Thalassospira sp. HJ]
 gb|KJE33705.1| 3-beta hydroxysteroid dehydrogenase [Thalassospira sp. HJ]
Length=335

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 70/131 (53%), Gaps = 13/131 (10%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A +A+L  +G S GK YELGGPE Y+   L + M  + R+    + VPF     
Sbjct  209  VGDVADAFVAAL-TEGKSAGKTYELGGPETYSFMALLQDMLRITRQRAILMPVPF----W  263

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A+ +   L+ +P P  TP     D +  L TD VVS+ A  F +LGI P+ L+     Y
Sbjct  264  LASIKAFFLQFLPVPPITP-----DQVRLLKTDNVVSEGADGFAELGITPNSLEAIAPSY  318

Query  448  LIQY---RKGG  425
            L ++   RK G
Sbjct  319  LKRFCPPRKSG  329



>ref|WP_027279004.1| 3-beta hydroxysteroid dehydrogenase [Rhodopseudomonas palustris]
Length=328

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 67/126 (53%), Gaps = 14/126 (11%)
 Frame = -1

Query  751  GKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKKVPFPLP-T  575
            G +YELGGPE+ TM ++ E++  VI    R + +PF +AKA A    +LL+  P  L  T
Sbjct  211  GAIYELGGPEVLTMREVIEIILQVIHRRRRLLSLPFGLAKAQA----MLLQFAPGILQLT  266

Query  574  PSIFNLDLIEALTTDTVVS---KDA-LTFDDLGIVPHKLKGYPVEYLIQYRKGGPQYGST  407
            P     D +E L  D VVS   KDA LT   LGI P  L+     YL ++RK G      
Sbjct  267  P-----DQVELLKVDNVVSDAAKDAGLTLQGLGITPDSLEAVAPSYLWRFRKTGEFSNGA  321

Query  406  VSERVS  389
             SER S
Sbjct  322  GSERRS  327



>gb|EEA95143.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 9 
[Pseudovibrio sp. JE062]
Length=328

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 75/137 (55%), Gaps = 15/137 (11%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A IA+  ++    GK+YELGGP++ T  +  +LM +VI      V +PF +A+ 
Sbjct  197  VGDVALA-IANAAENKVETGKIYELGGPQVATFKECLQLMMNVILRKRMLVSLPFLMARI  255

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKGY  461
             A      L+ +P P+ T     +D +  L +D VVSK+A     TF+ LGI PH ++  
Sbjct  256  QAK----FLQMLPKPMLT-----VDQVNLLKSDNVVSKEAQAEKRTFEGLGIEPHSMEAI  306

Query  460  PVEYLIQYRKGGPQYGS  410
               YL ++R  G QY S
Sbjct  307  LPTYLDKFRPRG-QYDS  322



>ref|WP_039459013.1| hypothetical protein, partial [endosymbiont of Acanthamoeba sp. 
UWC36]
Length=305

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 68/121 (56%), Gaps = 10/121 (8%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV   L  D +  GKV+ELGG ++YT+ ++ EL++ +I +    V +PF  AK 
Sbjct  195  VVDVAEAVGRCLVKD-NICGKVFELGGSKVYTLREIYELVFKLIGKKKPLVSIPFIFAKV  253

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A     +L  +P PL T      D +E L TD V+ K   +F++LG+ P  ++    EY
Sbjct  254  MAA----ILSLLPRPLLT-----CDQVELLKTDNVIVKTKNSFEELGLTPTSMEAVLSEY  304

Query  448  L  446
            +
Sbjct  305  I  305



>ref|WP_037036496.1| 3-beta hydroxysteroid dehydrogenase [Pseudovibrio sp. JE062]
Length=326

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 75/137 (55%), Gaps = 15/137 (11%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A IA+  ++    GK+YELGGP++ T  +  +LM +VI      V +PF +A+ 
Sbjct  195  VGDVALA-IANAAENKVETGKIYELGGPQVATFKECLQLMMNVILRKRMLVSLPFLMARI  253

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKGY  461
             A      L+ +P P+ T     +D +  L +D VVSK+A     TF+ LGI PH ++  
Sbjct  254  QAK----FLQMLPKPMLT-----VDQVNLLKSDNVVSKEAQAEKRTFEGLGIEPHSMEAI  304

Query  460  PVEYLIQYRKGGPQYGS  410
               YL ++R  G QY S
Sbjct  305  LPTYLDKFRPRG-QYDS  320



>ref|WP_029621248.1| MULTISPECIES: 3-beta hydroxysteroid dehydrogenase [Rhizobium]
 gb|KEQ03966.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium sp. R1-200B4]
 gb|KEQ04550.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium sp. R2-400B4]
Length=326

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 71/133 (53%), Gaps = 14/133 (11%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGS-SMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAK  632
            V DVA AV  +L  DG+ + GK+YELGGPE+ T  +  EL+   IR     V +PF IA 
Sbjct  194  VEDVAQAV--ALGVDGTIAGGKIYELGGPEVLTFRECMELVLHTIRRQRPLVSLPFGIAS  251

Query  631  AIATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDAL----TFDDLGIVPHKLKG  464
             + +   ++      PL TP I + D +  L  D VVS+DA+    T + +GI P  L  
Sbjct  252  MLGSVASLI------PLITPPITS-DQVALLRHDNVVSEDAIRDGRTLEGMGIRPTLLSS  304

Query  463  YPVEYLIQYRKGG  425
                YL+QYR  G
Sbjct  305  VVPSYLVQYRPQG  317



>gb|KIE04291.1| NADH dehydrogenase (Ubiquinone) 1 alpha subcomplex subunit 9 
[endosymbiont of Acanthamoeba sp. UWC36]
Length=307

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 68/121 (56%), Gaps = 10/121 (8%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV   L  D +  GKV+ELGG ++YT+ ++ EL++ +I +    V +PF  AK 
Sbjct  196  VVDVAEAVGRCLVKD-NICGKVFELGGSKVYTLREIYELVFKLIGKKKPLVSIPFIFAKV  254

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A     +L  +P PL T      D +E L TD V+ K   +F++LG+ P  ++    EY
Sbjct  255  MAA----ILSLLPRPLLT-----CDQVELLKTDNVIVKTKNSFEELGLTPTSMEAVLSEY  305

Query  448  L  446
            +
Sbjct  306  I  306



>ref|WP_035693857.1| 3-beta hydroxysteroid dehydrogenase, partial [Azospirillum halopraeferens]
Length=313

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 65/128 (51%), Gaps = 8/128 (6%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A++ +L  D  + G+ YELGGP +YT  QL E M   IR     V VP+  A  
Sbjct  193  VGDVADAIVGALTAD-DAAGRTYELGGPGVYTFRQLMERMLGEIRRKRLLVPVPWGAAGT  251

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +      +L+KVP   P   +   D +E L  D VV+ DA    +LG+ P  L+     Y
Sbjct  252  LGG----ILEKVPLGAP---LLTRDQVEMLRHDNVVAADAPGLKELGVTPTALEVILPTY  304

Query  448  LIQYRKGG  425
            L ++  GG
Sbjct  305  LFRFIVGG  312



>ref|WP_043948096.1| 3-beta hydroxysteroid dehydrogenase [Candidatus Phaeomarinobacter 
ectocarpi]
Length=323

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 73/139 (53%), Gaps = 15/139 (11%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV  +L+D  S+ GK YELGGP +Y+  +L +++ D  +       +P+ IA+ 
Sbjct  191  VDDVADAVCTALEDT-STQGKTYELGGPTVYSFKELMQIVLDETQRKRILAPIPWSIAR-  248

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDAL----TFDDLGIVPHKLKGY  461
                   L  ++   LP P +  LD +  L TD VVS++A     T +DLGI P  ++  
Sbjct  249  -------LQGRILGLLPAP-LLTLDQVRMLETDNVVSEEATSQNRTIEDLGITPKSVEAI  300

Query  460  PVEYLIQYRKGGPQYGSTV  404
               YL  YR+ G QY   +
Sbjct  301  VPGYLWMYRRQG-QYAEDI  318



>ref|WP_037065538.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium leguminosarum]
Length=326

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 67/139 (48%), Gaps = 16/139 (12%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV  +++    + GK+YELGGPE+ T  +  E M  V     R V +PF +A  
Sbjct  194  VVDVAEAVAKAVEGK-VAGGKIYELGGPEVLTFRECLEAMLKVTCRTNRLVSIPFSLASL  252

Query  628  IATPREVLLKKVPFPLP--TPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLK  467
            I +    +   VPF  P  TP     D +  L  D VVSKDA     T   LGI P  + 
Sbjct  253  IGS----VASLVPFVAPPITP-----DQVRLLKKDNVVSKDAEADGRTLKGLGIAPTMVS  303

Query  466  GYPVEYLIQYRKGGPQYGS  410
                 YL+QYR  G   GS
Sbjct  304  SVLPSYLVQYRPHGQYTGS  322



>ref|WP_008943960.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Oceanibaculum 
indicum]
 gb|EKE76880.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Oceanibaculum 
indicum P24]
Length=316

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 69/128 (54%), Gaps = 10/128 (8%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV+  L D   + GK+YELGGP+ Y+   L ELM   I      V VPF IA+ 
Sbjct  192  VGDVADAVLRVLSDP-KAQGKIYELGGPKTYSFKALMELMLATIGRSRLLVPVPFGIAEL  250

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
             A+    +L+ +P P  T      D +  L  D VVS+ ALT  DLGI P  ++     Y
Sbjct  251  QAS----VLQLLPVPPLT-----RDQVTLLKRDNVVSEGALTLADLGIEPTTVEVILPAY  301

Query  448  LIQYRKGG  425
            + ++R+GG
Sbjct  302  MERFRRGG  309



>ref|WP_007088365.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Thalassospira 
xiamenensis]
 gb|AJD54250.1| NADH-ubiquinone oxidoreductase 40 kDa subunit [Thalassospira 
xiamenensis M-5 = DSM 17429]
Length=335

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 69/131 (53%), Gaps = 13/131 (10%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A + +L + G S GK YELGGPE+Y+   L   M  + R+    + VPF     
Sbjct  209  VADVAEAFVTALVE-GKSAGKTYELGGPEVYSFMGLLRDMLQITRQRAILMPVPF----W  263

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A+ +   L+ +P PL TP     D +  L TD VVS  A  F +LGI P+ ++     Y
Sbjct  264  LASIKAFFLQFLPKPLLTP-----DQVRLLKTDNVVSDGAEGFAELGITPNSVEAIAPTY  318

Query  448  LIQY---RKGG  425
            L ++   RK G
Sbjct  319  LKRFCPPRKSG  329



>ref|WP_020043898.1| hypothetical protein [alpha proteobacterium SCGC AAA298-K06]
Length=327

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 70/133 (53%), Gaps = 4/133 (3%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV  +L D  SS+  VYELGGP + T  +L + M  VI+     + VPF +A+ 
Sbjct  189  VGDVAVAVEKALLD--SSVCGVYELGGPNVETFSELMKRMLGVIQRRRLMLNVPFFVAEI  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +    + L+K V   L   +I   D ++ L  D VVS +A    DL I P  ++    EY
Sbjct  247  MGQTLD-LIKAVSLGLFPNNILTQDQVKNLKNDNVVSANAKNLGDLDIKPTAMETVLPEY  305

Query  448  LIQYRKGGPQYGS  410
            L +YR  G QY S
Sbjct  306  LWRYRVSG-QYAS  317



>ref|WP_012589203.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Methylocella silvestris]
 gb|ACK49133.1| NADH dehydrogenase (ubiquinone) [Methylocella silvestris BL2]
Length=335

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 68/136 (50%), Gaps = 8/136 (6%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSM-GKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAK  632
            V DVA A  A+L  DG +  G +YELGGPE+ TM ++ E +  V     R V + F  A+
Sbjct  197  VGDVARA--AALALDGKAKPGAIYELGGPEVATMRRIMEFVLKVTERKRRLVTLSFDQAR  254

Query  631  AIATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDAL----TFDDLGIVPHKLKG  464
            ++    EVL K     LP       D +E L  D VVSK A+    T   LG+ P   + 
Sbjct  255  SVGGVTEVLSKLSLGLLPKMFEITRDQVELLKHDNVVSKAAIVEGRTLQGLGLAPESFEA  314

Query  463  YPVEYLIQYRKGGPQY  416
            +   YL +YR  G QY
Sbjct  315  FTPTYLTRYRATG-QY  329



>ref|WP_011661958.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhodopseudomonas 
palustris]
 gb|ABJ04464.1| NAD-dependent epimerase/dehydratase [Rhodopseudomonas palustris 
BisA53]
Length=328

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 75/145 (52%), Gaps = 15/145 (10%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV A+  +  +  G VYELGGPE+ TM ++ E +  +I+     + +PF +AK 
Sbjct  193  VGDVAQAV-ATAVEGLAKPGAVYELGGPEVLTMREVIEAILQIIQRRRTLLSLPFGLAKL  251

Query  628  IATPREVLLKKVPFPLP-TPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKG  464
             A     LL+  P  L  TP     D +E L  D VVS+ A    LT   LGI P  L+ 
Sbjct  252  QAA----LLQFAPGILQLTP-----DQVELLKVDNVVSEAAKAAGLTLQGLGIAPDSLQA  302

Query  463  YPVEYLIQYRKGGPQYGSTVSERVS  389
                YL ++RK G   G  ++ER S
Sbjct  303  MAPSYLWRFRKTGQFAGKPIAERPS  327



>ref|WP_008563283.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Ruegeria sp. R11]
 gb|EEB72893.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Ruegeria sp. R11]
Length=329

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 61/116 (53%), Gaps = 2/116 (2%)
 Frame = -1

Query  763  GSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKKVPFP  584
            G +   VYELGGPE+ +   L + M DVI      V +P PIAK +A   + LL+ V F 
Sbjct  202  GKAAAGVYELGGPEVKSFGALMQQMLDVINRRRLVVSLPGPIAKLVALGFD-LLQFVSFQ  260

Query  583  LPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGPQY  416
            L    +   D ++ L  D VVS DA  F+DLGI P        +YL ++R  G QY
Sbjct  261  LIENKMLTRDQLKNLKLDNVVSADAKGFEDLGIRPVTAGSVLPDYLWKFRPAG-QY  315



>ref|WP_025055104.1| 3-beta hydroxysteroid dehydrogenase [Sulfitobacter sp. NB-77]
 gb|KIN62657.1| NADH-ubiquinone oxidoreductase [Sulfitobacter sp. NB-77]
Length=328

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 71/131 (54%), Gaps = 4/131 (3%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V D+A A +  +   G++ G +YELGGPE  T   L E M +V+      + +P  IA  
Sbjct  189  VDDIARAAVMGVT--GAAPGGIYELGGPETDTFRGLMERMLNVVHRRRLILNLPKWIAGI  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A   + +L+ V F L T ++   D ++ L+ D VV+  A+ F DLGI P  ++    +Y
Sbjct  247  MAFSFD-MLQAVTFGLLTNNMLTRDQLKNLSNDNVVADGAMGFADLGIQPVAMESVLADY  305

Query  448  LIQYRKGGPQY  416
            L ++R  G QY
Sbjct  306  LWRFRPSG-QY  315



>ref|WP_036555293.1| 3-beta hydroxysteroid dehydrogenase [Nisaea denitrificans]
Length=317

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 66/128 (52%), Gaps = 10/128 (8%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A +A+L  D ++ G+ YELGGP  Y+   L EL+        R V++PF +A  
Sbjct  192  VDDVARAALAALTSD-AAEGQTYELGGPTTYSFRDLMELVVAQTGRKCRLVQIPFWLASL  250

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
             AT  E+        LPTP +   D +  L +D VVS+ A T  D GI P   +     Y
Sbjct  251  EATFLEL--------LPTPPL-TRDQVVLLKSDNVVSEGAATLADFGIKPTACEAILPTY  301

Query  448  LIQYRKGG  425
            L ++R GG
Sbjct  302  LDRFRSGG  309



>ref|WP_035694954.1| 3-beta hydroxysteroid dehydrogenase [Aurantimonas coralicida]
Length=334

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 71/143 (50%), Gaps = 20/143 (14%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A IA   D     G+VYELGGPE+ T  Q+ E M  +I     +V +PF  A +
Sbjct  193  VGDVAEA-IADTVDGKVPGGRVYELGGPEVLTFRQMMEEMLRIIERKRNFVTIPFGAAAS  251

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDAL----TFDDLGIVPHKLKGY  461
            +A     L++ +P    TP     D +  L TD VVS+DA+    T +  GI P  +   
Sbjct  252  MAK----LMRFLPGAPLTP-----DQVTQLQTDNVVSQDAIEDGRTLEAFGIRPRTVDAI  302

Query  460  PVEYLIQYRKGG------PQYGS  410
               YL+++RK G      PQ G 
Sbjct  303  LPTYLVRFRKHGQFTHPQPQAGG  325



>ref|WP_040489901.1| 3-beta hydroxysteroid dehydrogenase, partial [Fulvimarina pelagi]
Length=323

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 69/132 (52%), Gaps = 14/132 (11%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV  ++ D+  + G VYELGGPE+ +  QL E M  VI    R+V +PF +A +
Sbjct  193  VVDVAEAVAKTV-DNEVAGGTVYELGGPEVLSFRQLMEEMLRVINRKRRFVSIPFSLAGS  251

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDAL----TFDDLGIVPHKLKGY  461
            +A       + VP    TP     D ++ L  D VVS++A+    T D  GI P  +   
Sbjct  252  MAQ----FAQYVPGAPLTP-----DQVKQLQNDNVVSEEAIADGRTLDAFGIRPRTVDSI  302

Query  460  PVEYLIQYRKGG  425
               YL+++R  G
Sbjct  303  LPTYLVRFRPQG  314



>ref|WP_022702351.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Pseudorhodobacter 
ferrugineus]
Length=328

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 68/133 (51%), Gaps = 4/133 (3%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A +  +   G++   VYELGGP++ T   L + M  VI+     V +PF  A  
Sbjct  189  VDDVAKAAV--MGATGTAAPGVYELGGPDVATFRDLMKQMLAVIQRSRLVVNIPFIFANV  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A   +  L      L +  +   D +++L +D VVS  A TF DLGI P  ++    EY
Sbjct  247  MAAGFD-FLSFATGGLISNGVLTRDQVKSLRSDNVVSDGAKTFADLGITPVTMESVLPEY  305

Query  448  LIQYRKGGPQYGS  410
            L +YR  G QY +
Sbjct  306  LWRYRASG-QYAA  317



>gb|EAU41592.1| putative oxidoreductase protein [Fulvimarina pelagi HTCC2506]
Length=335

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 69/132 (52%), Gaps = 14/132 (11%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV  ++ D+  + G VYELGGPE+ +  QL E M  VI    R+V +PF +A +
Sbjct  193  VVDVAEAVAKTV-DNEVAGGTVYELGGPEVLSFRQLMEEMLRVINRKRRFVSIPFSLAGS  251

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDAL----TFDDLGIVPHKLKGY  461
            +A       + VP    TP     D ++ L  D VVS++A+    T D  GI P  +   
Sbjct  252  MAQ----FAQYVPGAPLTP-----DQVKQLQNDNVVSEEAIADGRTLDAFGIRPRTVDSI  302

Query  460  PVEYLIQYRKGG  425
               YL+++R  G
Sbjct  303  LPTYLVRFRPQG  314



>ref|WP_010442913.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Ruegeria conchae]
Length=327

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 68/131 (52%), Gaps = 4/131 (3%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A +  +   G +   VYELGGPE+ +   L + M +VI      + +PF  AK 
Sbjct  189  VDDVAQAAVQGVL--GKASAGVYELGGPEVKSFRGLMQQMLEVIHRRRIIIGMPFLAAKI  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A   +++ K V F L   +I   D +  L  D VV++DA  F DLGI P  L     EY
Sbjct  247  MAGVLDIV-KFVSFQLFPNNILTRDQVRNLRRDNVVAEDAKGFVDLGIEPATLDSILPEY  305

Query  448  LIQYRKGGPQY  416
            L ++R  G QY
Sbjct  306  LWKFRPSG-QY  315



>ref|WP_038460290.1| hypothetical protein [Candidatus Caedibacter acanthamoebae]
 gb|AIL13087.1| hypothetical protein IM40_05525 [Candidatus Caedibacter acanthamoebae]
Length=308

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 68/125 (54%), Gaps = 10/125 (8%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            + DV  A+I +  +   S GK+YELGG +IY   +L E+M  +I+     + +P+ IAK+
Sbjct  191  IGDVVEAMITA-ANQPESQGKIYELGGDKIYAFKELFEIMLKIIQLKRLLLPLPYFIAKS  249

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            I    E         LPTP  F  D ++ L  D +++  +LTF DLGI+P  L+     Y
Sbjct  250  IGFFCEF--------LPTPP-FTRDQVKLLKKDNILNNSSLTFRDLGIIPSALESILPRY  300

Query  448  LIQYR  434
            L +Y+
Sbjct  301  LSRYK  305



>ref|WP_026756898.1| 3-beta hydroxysteroid dehydrogenase [Sediminimonas qiaohouensis]
Length=330

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 67/131 (51%), Gaps = 4/131 (3%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A +  L  +G +   +YELGGPE+ T   L + M  ++      V +PF IA+ 
Sbjct  189  VDDVAHAAV--LGVEGQAAPGIYELGGPEVETFRALMQRMLKIVHRRRLIVNMPFFIARV  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A   + +++K    L T  +   D +  L  D VVS+ A  FD LGI P  +     EY
Sbjct  247  MAFGFD-MVQKATLGLITNGVLTRDQLHNLRRDNVVSEGAQGFDALGITPKSMATILPEY  305

Query  448  LIQYRKGGPQY  416
            L ++R  G QY
Sbjct  306  LWRFRPSG-QY  315



>ref|WP_008888927.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Thalassospira 
profundimaris]
 gb|EKF10305.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Thalassospira 
profundimaris WP0211]
Length=335

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 69/131 (53%), Gaps = 13/131 (10%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A + +L + G S GK YELGGPE Y+   L + M  + R+    + VPF     
Sbjct  209  VGDVADAFVTALME-GKSAGKTYELGGPETYSFMALLQDMLRITRQRAILMPVPF----W  263

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A+ +   L+ +P P  TP     D +  L TD VVS+ A  F +LGI P+ L+     Y
Sbjct  264  LASIKAFFLQFLPVPPLTP-----DQVRLLKTDNVVSEGADGFAELGITPNSLEAIAPSY  318

Query  448  LIQY---RKGG  425
            L ++   RK G
Sbjct  319  LKRFCPPRKSG  329



>ref|WP_019199324.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Afipia birgiae]
Length=322

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 70/133 (53%), Gaps = 15/133 (11%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+AV A+  D  +  G  YELGGPEI TM ++ +L+ ++ R     + +PFP+AK 
Sbjct  193  VGDVATAV-ANAVDGKTRPGATYELGGPEIMTMREIIDLILNITRRNRMLMSLPFPLAKI  251

Query  628  IATPREVLLKKVPFPLP-TPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKG  464
                +   L+  P  L  TP     + +E L +D VVS  A    LT + LGI P  L  
Sbjct  252  ----QSYFLQFAPGDLKLTP-----NQVELLRSDNVVSDTAKAAGLTLEGLGITPDSLAA  302

Query  463  YPVEYLIQYRKGG  425
                YL +YRK G
Sbjct  303  VAPSYLWRYRKTG  315



>ref|WP_037247334.1| 3-beta hydroxysteroid dehydrogenase [Roseovarius sp. MCTG156(2b)]
Length=327

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 68/131 (52%), Gaps = 5/131 (4%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A +  +   G +   +YELGGPE+ T   L + M +VIR     V +PF +A +
Sbjct  189  VDDVAQAAVMGVT--GQAAPGIYELGGPEVATFRALMQQMLEVIRRRRMIVNIPFGVAAS  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A   E L++     L  P I   D + +L  D VVS+ A +F+ LGI P  +     +Y
Sbjct  247  MAAAME-LVQTTTLGLVPPQI-TRDQVRSLRVDNVVSEGAKSFESLGISPVAMGAVLPDY  304

Query  448  LIQYRKGGPQY  416
            L  +R  G QY
Sbjct  305  LWPFRPAG-QY  314



>gb|EAQ24510.1| NADH ubiquinone oxidoreductase, putative [Roseovarius sp. 217]
Length=335

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 68/133 (51%), Gaps = 5/133 (4%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A +  +   G +   +YELGGPE+ +   L + M  VIR     V +PF +A  
Sbjct  197  VDDVAQAAV--MGAMGQAAPGIYELGGPEVASFRALMQQMLGVIRRSRLIVNIPFGVAAI  254

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A   E L++ V   L  P I   D + +L  D VVS+ A  FD LGI P  L     +Y
Sbjct  255  LAGVME-LVQTVTLGLIPPQI-TRDQVRSLRVDNVVSEQAKGFDSLGISPTALGAVLPDY  312

Query  448  LIQYRKGGPQYGS  410
            L ++R  G QY +
Sbjct  313  LWRFRPAG-QYSA  324



>ref|WP_040326025.1| 3-beta hydroxysteroid dehydrogenase [Aurantimonas manganoxydans]
Length=334

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 71/143 (50%), Gaps = 20/143 (14%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A IA   D     G+VYELGGPE+ T  Q+ E M  +I     +V +PF  A +
Sbjct  193  VGDVAEA-IADTVDGKVPGGRVYELGGPEVLTFRQMMEEMLRIIERKRSFVTIPFGAAAS  251

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDAL----TFDDLGIVPHKLKGY  461
            +A     L++ +P    TP     D +  L TD VVS+DA+    T +  GI P  +   
Sbjct  252  MAK----LMRFLPGAPLTP-----DQVTQLQTDNVVSQDAIEDGRTLEAFGIRPRTVDAI  302

Query  460  PVEYLIQYRKGG------PQYGS  410
               YL+++RK G      PQ G 
Sbjct  303  LPTYLVRFRKHGQFTHPQPQAGG  325



>ref|WP_040651183.1| 3-beta hydroxysteroid dehydrogenase [Roseovarius sp. 217]
Length=327

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 68/133 (51%), Gaps = 5/133 (4%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A +  +   G +   +YELGGPE+ +   L + M  VIR     V +PF +A  
Sbjct  189  VDDVAQAAV--MGAMGQAAPGIYELGGPEVASFRALMQQMLGVIRRSRLIVNIPFGVAAI  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A   E L++ V   L  P I   D + +L  D VVS+ A  FD LGI P  L     +Y
Sbjct  247  LAGVME-LVQTVTLGLIPPQI-TRDQVRSLRVDNVVSEQAKGFDSLGISPTALGAVLPDY  304

Query  448  LIQYRKGGPQYGS  410
            L ++R  G QY +
Sbjct  305  LWRFRPAG-QYSA  316



>ref|WP_009502685.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Citreicella sp. 
357]
 gb|EIE52822.1| NADH-ubiquinone oxidoreductase, putative [Citreicella sp. 357]
Length=327

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 65/133 (49%), Gaps = 9/133 (7%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A +  L   G +   +YELGGP++ T     E M  VIR     V +PF IA  
Sbjct  189  VDDVAHAAV--LGATGKAAAGIYELGGPDVGTFRAFIEQMLTVIRRRRWIVNIPFGIAWV  246

Query  628  IATPREVL--LKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPV  455
            +    E L  L    FP P  S    D + +L +D VVS+ A  F DLGI P   +    
Sbjct  247  MGKGFETLAGLTGGLFPAPITS----DQVASLKSDNVVSQGARGFADLGITPTSSEAVLP  302

Query  454  EYLIQYRKGGPQY  416
            +YL ++R  G QY
Sbjct  303  DYLWRFRPSG-QY  314



>ref|WP_021102609.1| NAD-dependent epimerase/dehydratase [Thalassobacter arenae]
 gb|EPX77538.1| NAD-dependent epimerase/dehydratase [Thalassobacter arenae DSM 
19593]
Length=329

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 70/131 (53%), Gaps = 5/131 (4%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A   ++   G +   +YELGGPE+ T   L + M D++R     V +PF IA  
Sbjct  189  VDDVAQAATKAVL--GEAKPGIYELGGPEVATFRDLMQTMLDMVRRRRLIVNIPFFIAGI  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            + +  + L+ K+ F L    +   D +  L  D VV++DA+TF DLGI    L+    +Y
Sbjct  247  MGSAFD-LVNKISFGLINGPL-TRDQVRNLKRDNVVAEDAMTFADLGIRRTALEAIIPDY  304

Query  448  LIQYRKGGPQY  416
            L ++R  G QY
Sbjct  305  LWRFRPSG-QY  314



>ref|WP_007206117.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Loktanella vestfoldensis]
 gb|EAQ08216.1| NADH ubiquinone oxidoreductase, putative [Loktanella vestfoldensis 
SKA53]
Length=326

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 69/131 (53%), Gaps = 5/131 (4%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A +  +   G   G +YELGGP++ T  +L + M  V+R     + +PF  A+ 
Sbjct  189  VDDVAAAAVKGVL--GEVPGGIYELGGPDVATFRELMQTMLAVVRRRRMILNMPFWAARI  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A    + L+ V   L TP +   D +E L  D VVS  A  F DLGIVP  +     +Y
Sbjct  247  MAGAFNI-LRIVSLGLVTPPV-TRDQVENLALDNVVSDGAKGFADLGIVPTAMMAVLPDY  304

Query  448  LIQYRKGGPQY  416
            L ++R  G QY
Sbjct  305  LWRFRPSG-QY  314



>ref|WP_033070199.1| 3-beta hydroxysteroid dehydrogenase [Thalassospira australica]
Length=335

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 71/131 (54%), Gaps = 13/131 (10%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A + +L + G S GK YELGGPE Y+   L + M  + R+  R + +P P+   
Sbjct  209  VGDVADAFVTALTE-GKSAGKTYELGGPETYSFMALLQDMLRITRQ--RAILMPVPL--W  263

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A+ +   L+ +P P  TP     D +  L TD VVS+ A  F +LGI P+ L+     Y
Sbjct  264  LASIKAFFLQFLPVPPLTP-----DQVRLLKTDNVVSEGADGFAELGITPNSLEAIAPSY  318

Query  448  LIQY---RKGG  425
            L ++   RK G
Sbjct  319  LKRFCPPRKSG  329



>gb|EAS48786.1| NADH-ubiquinone oxidoreductase [Aurantimonas manganoxydans SI85-9A1]
Length=369

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 71/143 (50%), Gaps = 20/143 (14%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A IA   D     G+VYELGGPE+ T  Q+ E M  +I     +V +PF  A +
Sbjct  228  VGDVAEA-IADTVDGKVPGGRVYELGGPEVLTFRQMMEEMLRIIERKRSFVTIPFGAAAS  286

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDAL----TFDDLGIVPHKLKGY  461
            +A     L++ +P    TP     D +  L TD VVS+DA+    T +  GI P  +   
Sbjct  287  MAK----LMRFLPGAPLTP-----DQVTQLQTDNVVSQDAIEDGRTLEAFGIRPRTVDAI  337

Query  460  PVEYLIQYRKGG------PQYGS  410
               YL+++RK G      PQ G 
Sbjct  338  LPTYLVRFRKHGQFTHPQPQAGG  360



>ref|WP_035569694.1| 3-beta hydroxysteroid dehydrogenase [Hyphomonas adhaerens]
 gb|KCZ84945.1| putative NADH-quinone oxidoreductase [Hyphomonas adhaerens MHS-3]
Length=329

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 66/111 (59%), Gaps = 8/111 (7%)
 Frame = -1

Query  802  DVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRY-VKVPFPIAKAI  626
            DVA A+  S+ DD ++ GK YELGGP +YTM+++ + +   I   PR+ + +PF +AK I
Sbjct  193  DVAEAIAVSVDDD-TTAGKTYELGGPRVYTMNEIYDFICKTISR-PRFKISLPFVLAKPI  250

Query  625  ATPREVLLKKV-PFP---LPTPSIFNLDLIEALTTDTVVSKDALTFDDLGI  485
                  + + V PF    L  P +   D +E L TD VV+ DALT +DLG+
Sbjct  251  GYLSGAVWRYVPPFSWGFLGQPPVTG-DQVEMLKTDNVVADDALTLEDLGV  300



>ref|WP_027297804.1| 3-beta hydroxysteroid dehydrogenase [Rhodospirillales bacterium 
URHD0088]
Length=317

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 64/128 (50%), Gaps = 10/128 (8%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV+A+L DD +S G+ YELGGP IYT   L EL+    R     V VP+ +A+ 
Sbjct  191  VGDVADAVMAAL-DDPASAGQTYELGGPRIYTFKALMELILAETRRKRLLVPVPWAVAR-  248

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
                     +     L       LD + +L  D +V   A T  DLGI P  ++     Y
Sbjct  249  --------CQGALLQLLPNPPLTLDQVRSLERDNIVPPGARTLKDLGITPDTVEAIVPAY  300

Query  448  LIQYRKGG  425
            L +YR+GG
Sbjct  301  LDRYRRGG  308



>ref|WP_014876487.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Phaeobacter gallaeciensis]
 gb|AFO89384.1| putative NAD dependent epimerase [Phaeobacter gallaeciensis 2.10]
Length=329

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 70/131 (53%), Gaps = 4/131 (3%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A +++L   G +   VYELGGPE+ +   L + M +VI      + +P PIAK 
Sbjct  189  VDDVAKAAVSALL--GQAKPGVYELGGPEVKSFGALMQQMLEVIDRRRLVLSLPGPIAKL  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A   +V ++ V F L    +   D ++ L  D VVS  A  FD+LGI P  L     +Y
Sbjct  247  VALGFDV-MQFVSFQLIENKMLTRDQLKNLEADNVVSDGAKGFDELGIRPVSLASVLPDY  305

Query  448  LIQYRKGGPQY  416
            L ++R  G QY
Sbjct  306  LWKFRPSG-QY  315



>ref|WP_042689500.1| 3-beta hydroxysteroid dehydrogenase [Azospirillum sp. B506]
Length=323

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 71/139 (51%), Gaps = 13/139 (9%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V D+A AV+A+L  D +S GK YELGGP +YT  +L +L    I      V +P+  A++
Sbjct  193  VGDLADAVVAALDSD-ASRGKTYELGGPRVYTFRELLDLTQKAILRHRPLVTIPWNAAES  251

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPV--  455
            +A     +L+KVP   P       D +  L  D VVS  AL F DLGI   +L    V  
Sbjct  252  LAG----ILEKVPVLAPA---LTRDQVALLKQDNVVSPGALGFKDLGIA--ELASCEVIL  302

Query  454  -EYLIQYRKGGPQYGSTVS  401
              YL ++  GG   G T S
Sbjct  303  PTYLSRFIVGGKFSGQTNS  321



>ref|WP_037314823.1| 3-beta hydroxysteroid dehydrogenase [Ruegeria halocynthiae]
Length=327

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 68/131 (52%), Gaps = 4/131 (3%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A +   +  G +   +YELGGPE+ +   L + M DVI      + +PF +A+ 
Sbjct  189  VDDVAKAAVQGAQ--GQAEAGIYELGGPEVKSFRALMQQMLDVIYRRRVIIGMPFWVARI  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A+  ++ LK   F L    I   D ++ L  D VVS  A  F DLGI P  L+    +Y
Sbjct  247  MASVLDI-LKFASFQLFPNHILTRDQLKNLRRDNVVSDGAKGFADLGIEPAALESILPDY  305

Query  448  LIQYRKGGPQY  416
            L ++R  G QY
Sbjct  306  LWKFRPSG-QY  315



>ref|WP_011453372.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Jannaschia sp. 
CCS1]
 gb|ABD53163.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Jannaschia sp. 
CCS1]
Length=327

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 64/128 (50%), Gaps = 4/128 (3%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A  A L   G + G +YELGGP+  T  QL + M  VIR     V +PF +A  
Sbjct  189  VDDVAQA--AQLGVKGEAHG-IYELGGPDAETFRQLMQRMLGVIRRRRLIVNIPFVVANI  245

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +    + LL K+   L    I   D + +L +D VVS DA T  DLGI    ++    +Y
Sbjct  246  MGFSFD-LLSKLTGGLFHNGILTRDQVRSLRSDNVVSDDAQTLADLGIQATAMEAVLEDY  304

Query  448  LIQYRKGG  425
            L  YR  G
Sbjct  305  LWPYRPSG  312



>ref|WP_038279873.1| 3-beta hydroxysteroid dehydrogenase [alpha proteobacterium Mf 
1.05b.01]
Length=328

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 78/140 (56%), Gaps = 17/140 (12%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPR---YVKVPFPI  638
            V DVA+A+  +L+    + GKV ELGGPE+ T    AELM   ++E  R    VK+P   
Sbjct  201  VKDVAAAMTIALQQPQWN-GKVLELGGPEVAT---FAELMEITLKETGRSRPLVKLPSFA  256

Query  637  AKAIATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYP  458
            AKA+A+    +L+ +P PL T     +D +E L  D VVS  AL F DLGI P  +    
Sbjct  257  AKAMAS----VLQFLPAPLLT-----VDQVELLKHDNVVSDGALGFSDLGIEPSAMSAIL  307

Query  457  VEYLIQYRKGGPQYGSTVSE  398
              YL ++R+ G Q+   V++
Sbjct  308  PAYLYRFRRTG-QFADGVAD  326



>ref|WP_024514903.1| 3-beta hydroxysteroid dehydrogenase [Bradyrhizobium sp. Tv2a-2]
Length=322

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 70/133 (53%), Gaps = 15/133 (11%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVASAV A   D  +  G  YELGGPEI +M ++ E + D+       V +PF IA+ 
Sbjct  193  VGDVASAV-ADAVDGKAKAGATYELGGPEILSMREIMETILDITDRERMLVSLPFGIARF  251

Query  628  IATPREVLLKKVPFPLP-TPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKG  464
                +  +L+  P  L  TP     D +E L +D VVS+ A    LT + LGI P  L+G
Sbjct  252  ----QSHVLQFAPGALKLTP-----DQVELLRSDNVVSQAAKDAGLTLEGLGITPDSLEG  302

Query  463  YPVEYLIQYRKGG  425
               +YL ++R  G
Sbjct  303  VAPQYLWRFRPAG  315



>ref|WP_020042805.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Salipiger mucosus]
 gb|EPX79806.1| NAD-dependent epimerase/dehydratase [Salipiger mucosus DSM 16094]
Length=327

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 67/135 (50%), Gaps = 13/135 (10%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A +  +   G + G  YELGGP++ T  +L   M ++IR     V +PF IA  
Sbjct  189  VDDVARAAVMGVT--GEAAGGTYELGGPDVDTFRELISQMLEIIRRRRLLVNIPFGIASV  246

Query  628  IATPREVLLK----KVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGY  461
            +    E + +     VP  + +  + N      L  D VVS+ A  F+ LG  P  ++  
Sbjct  247  MGRVFETVSRLTGGLVPAQITSDQVIN------LRHDNVVSEGARGFETLGFEPASMEAV  300

Query  460  PVEYLIQYRKGGPQY  416
              EYL ++RKGG QY
Sbjct  301  LPEYLWRFRKGG-QY  314



>ref|WP_025063871.1| 3-beta hydroxysteroid dehydrogenase [Sulfitobacter guttiformis]
 gb|KIN74344.1| NADH-ubiquinone oxidoreductase [Sulfitobacter guttiformis KCTC 
32187]
Length=327

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 67/128 (52%), Gaps = 4/128 (3%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A +  +   G+  G +YELGGP       L  LM +VIR     + +PF  AK 
Sbjct  189  VDDVAQAAVMGVV--GNVKG-IYELGGPVTMNFRDLMALMLEVIRRRRLVLNIPFFAAKV  245

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A   + +L+KV   L +  +   D ++ L  D VV++ A+ FDDLGI P  +     EY
Sbjct  246  MAFGFD-MLEKVTLGLLSNGMITRDQVKNLRRDNVVAETAMGFDDLGITPVAMVSVLPEY  304

Query  448  LIQYRKGG  425
            L ++R  G
Sbjct  305  LWRFRPSG  312



>ref|WP_019960527.1| hypothetical protein [Woodsholea maritima]
Length=328

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 71/129 (55%), Gaps = 8/129 (6%)
 Frame = -1

Query  802  DVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIA  623
            DVA AV+A+ +DD  + G+ +ELGGP +YT  ++ E + +V       + +PF  A  + 
Sbjct  194  DVAGAVLAAFEDD-KAQGRTFELGGPRVYTFKEILEFILEVTYRKRFLIPLPFFAAGILG  252

Query  622  TPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALT---FDDLGIVPHKLKGYPVE  452
               ++ L  +PF  P   +   D ++ L +D VV+KD ++     DLGI P  ++     
Sbjct  253  QVFDI-LGALPFVKP---LITSDQVKLLKSDNVVNKDDVSIGQLSDLGIKPETMESIVPA  308

Query  451  YLIQYRKGG  425
            YL+ YR+GG
Sbjct  309  YLVPYREGG  317



>ref|WP_027235881.1| 3-beta hydroxysteroid dehydrogenase [Leisingera caerulea]
Length=329

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 68/131 (52%), Gaps = 4/131 (3%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A +  L   G + G +YELGGPE+ +  +L E M +VI      + +P   A  
Sbjct  189  VDDVAKAAV--LGATGEAEGGIYELGGPEVKSFRELMEQMLEVIHRRRLILSLPRFAAWL  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A   + +L+   F L    +   D + +L +D VVS+ A  F DLGI P  L+    +Y
Sbjct  247  VAFGFD-MLQAASFQLIANKVLTRDQLRSLKSDNVVSEGAKGFSDLGISPVSLEAVLPDY  305

Query  448  LIQYRKGGPQY  416
            L ++R  G QY
Sbjct  306  LWKFRPSG-QY  315



>ref|WP_009604313.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [SAR116 cluster 
alpha proteobacterium HIMB100]
 gb|EHI49131.1| putative nucleoside-diphosphate sugar epimerase [SAR116 cluster 
alpha proteobacterium HIMB100]
Length=315

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 65/128 (51%), Gaps = 10/128 (8%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV+A+L  +  + G++Y+LGGP+ Y+  +L     D +      + VPF +A  
Sbjct  194  VGDVAGAVLAALTTE-EARGQIYQLGGPQTYSFAELMRFTLDCVGRRRLLLPVPFAVASL  252

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
             A    +L        P P +  LD ++ L  D +  K A    DLGIVP  ++G    Y
Sbjct  253  PAAFASLL--------PNPPL-TLDQLKLLKVDNICKKSAPGLADLGIVPTAIEGVVPAY  303

Query  448  LIQYRKGG  425
            L+ +R GG
Sbjct  304  LMPFRPGG  311



>ref|WP_002717736.1| hypothetical protein [Afipia felis]
 gb|EKS30141.1| hypothetical protein HMPREF9697_02669 [Afipia felis ATCC 53690]
Length=321

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 66/133 (50%), Gaps = 15/133 (11%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVASA IA   D  +  G  YELGGPE+ TM +  EL+  V    P  V +PF +AK 
Sbjct  192  VGDVASA-IADAVDGKTKAGATYELGGPEVMTMREAIELILRVAERDPMLVPLPFGLAKL  250

Query  628  IATPREVLLKKVPFPLP-TPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKG  464
             A      L+  P  L  TP     D +E L TD VVS  A    LT + LGI P  +  
Sbjct  251  QAA----FLQFAPGDLKLTP-----DQVEMLKTDNVVSDAAKSAGLTLEGLGIAPESMAA  301

Query  463  YPVEYLIQYRKGG  425
                YL ++RK G
Sbjct  302  VLPSYLWRFRKTG  314



>ref|WP_028286897.1| 3-beta hydroxysteroid dehydrogenase [Oceanicola nanhaiensis]
Length=327

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 71/133 (53%), Gaps = 4/133 (3%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A  A +  +G + G +YELGGP++ T  +L + M DV++     + +P  +A+ 
Sbjct  189  VDDVAAA--AQMGIEGRAPGGIYELGGPDVNTFRELMQQMLDVVQRRRMIINMPMFVAR-  245

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA     + +   F L    I   D ++ L+TD VVS     F+DLGI P  ++    +Y
Sbjct  246  IAAFFLDMAQAATFGLFHNGILTRDQVKQLSTDNVVSGRHKGFEDLGIEPMAVEAVLPDY  305

Query  448  LIQYRKGGPQYGS  410
            L  YR  G QY +
Sbjct  306  LWPYRPSG-QYAA  317



>ref|WP_024317749.1| MULTISPECIES: 3-beta hydroxysteroid dehydrogenase [Rhizobium]
 emb|CDM56065.1| NADH dehydrogenase/NADH dehydrogenase(ubiquinone) protein [Rhizobium 
sp. LPU83]
Length=326

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 66/137 (48%), Gaps = 12/137 (9%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV  +++    ++G+VYELGGPE+ T  +  E+M        R V +PF IA  
Sbjct  194  VVDVAEAVAKAVEGK-VAVGEVYELGGPEVLTFRECLEIMLKATWRKNRLVSIPFGIASL  252

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKGY  461
            I +    +   VPF  P       D +  L  D +VSKDA     T   +G+ P  +   
Sbjct  253  IGS----IASLVPFITPP---ITADQVRLLKKDNIVSKDAEAEDRTLKGIGVTPTLVSSV  305

Query  460  PVEYLIQYRKGGPQYGS  410
               YL+QYR  G   GS
Sbjct  306  IGSYLVQYRPHGQYTGS  322



>ref|WP_005979714.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Ruegeria lacuscaerulensis]
 gb|EEX09004.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Silicibacter lacuscaerulensis 
ITI-1157]
Length=327

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 70/131 (53%), Gaps = 4/131 (3%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A +  +   G +   +YELGGPE+ T  +L + M +VI      + +PF + + 
Sbjct  189  VDDVAQAAVKGVL--GQAEPGIYELGGPEVKTFRELMQQMLEVIHRRRIIIGLPFWVGRI  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A   +++ K V F L   +I   D ++ L  D VVS+ A  F DLGI P  L+    EY
Sbjct  247  MAGVLDIV-KFVSFQLFPNNILTRDQLKNLRRDNVVSEGAKGFADLGIEPTTLESVLPEY  305

Query  448  LIQYRKGGPQY  416
            L ++R  G QY
Sbjct  306  LWKFRPSG-QY  315



>ref|WP_028793393.1| 3-beta hydroxysteroid dehydrogenase [Thalassobaculum salexigens]
Length=317

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 71/133 (53%), Gaps = 20/133 (15%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V +VA AV+A+L+   ++ G+ YELGGPEIY+  +L E++        + V +PF  A  
Sbjct  191  VDNVADAVMAALETP-AAKGQTYELGGPEIYSFRELMEMVLKETNRKAKLVNLPFWAASI  249

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVE-  452
             A   E+        LP+P +   D +E L +D VV+ DA T  DLG+     K  PVE 
Sbjct  250  QAAFLEL--------LPSP-MLTRDQVELLKSDNVVAADAKTLADLGV-----KATPVEV  295

Query  451  ----YLIQYRKGG  425
                YL ++R GG
Sbjct  296  IVPTYLDKFRPGG  308



>ref|WP_014249039.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Azospirillum lipoferum]
 emb|CBS88060.1| putative NAD-dependent epimerase/dehydratase [Azospirillum lipoferum 
4B]
Length=323

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 60/108 (56%), Gaps = 8/108 (7%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V ++A AV+A+L+ D  S GK YELGGP +Y+  +L EL    I+     V +P+ IA++
Sbjct  193  VGNLADAVVAALESD-DSRGKTYELGGPRVYSFRELLELTQKDIQRHRPLVTIPWNIAES  251

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGI  485
            +A      L+KVP   P       D +  L  D VVS  AL F DLGI
Sbjct  252  LAG----FLEKVPVLAPA---LTRDQVALLRQDNVVSPTALGFKDLGI  292



>ref|WP_037989144.1| 3-beta hydroxysteroid dehydrogenase [Thalassospira permensis]
 gb|KEO57852.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Thalassospira 
permensis NBRC 106175]
Length=335

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 68/131 (52%), Gaps = 13/131 (10%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A + +L + G S GK YELGGPE+Y+   L   M  + R+    + VPF     
Sbjct  209  VADVAEAFVTALVE-GKSAGKTYELGGPEVYSFMGLLRDMLQITRQRAILMPVPF----W  263

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A+ +   L+ +P PL T      D +  L TD VVS  A  F +LGI P+ ++     Y
Sbjct  264  LASIKAFFLQLLPKPLLT-----TDQVRLLKTDNVVSDGAEGFAELGITPNSVEAIAPTY  318

Query  448  LIQY---RKGG  425
            L ++   RK G
Sbjct  319  LKRFCPPRKSG  329



>ref|WP_041801299.1| 3-beta hydroxysteroid dehydrogenase [Rhodopseudomonas palustris]
Length=327

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 69/133 (52%), Gaps = 15/133 (11%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+AV A   D  +  G  YELGGPE+ TM Q+ E++ DVI+     + +PF +A+ 
Sbjct  193  VGDVATAV-AQAVDGKAKPGATYELGGPEVLTMRQVIEIILDVIQRRRILLSLPFGLARL  251

Query  628  IATPREVLLKKVPFPLP-TPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKG  464
             A     LL+  P PL  TP     D +  L  D VVS+ A    LT   LGI P  L+ 
Sbjct  252  QAQ----LLQFAPGPLKLTP-----DQVALLQVDNVVSEAAQAAGLTLQGLGIPPDSLQA  302

Query  463  YPVEYLIQYRKGG  425
                YL ++R  G
Sbjct  303  IAPSYLWRFRATG  315



>ref|WP_023663859.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhodobacter sp. 
CACIA14H1]
 gb|ESW62356.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhodobacter sp. 
CACIA14H1]
Length=328

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 64/133 (48%), Gaps = 4/133 (3%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A +  +K  G +   +YELGGP++ T   L   M  VI      V VPF +A  
Sbjct  189  VDDVAQAAVKGIK--GEAAPGIYELGGPDVDTFRDLMRQMLAVIHRRRLIVNVPFFVASI  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +    + LL+ V   L    +   D +  L +D VVS  A T  DLGI P  +     EY
Sbjct  247  MGGAFD-LLQAVTLGLFRNGLITRDQVRNLKSDNVVSPGARTLADLGITPTAVGAVLPEY  305

Query  448  LIQYRKGGPQYGS  410
            L +YR  G QY +
Sbjct  306  LWRYRPSG-QYAA  317



>ref|WP_022673628.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Sphingopyxis baekryungensis]
Length=313

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 65/126 (52%), Gaps = 9/126 (7%)
 Frame = -1

Query  802  DVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIA  623
            DVA+A++ +L    +  GK YELGGPE+ +M +L   + + I +   YV+VP  +A  + 
Sbjct  188  DVAAAILIALDQHSAHRGKTYELGGPEVLSMLELNRWIGEQIGKERLYVEVPHAVAFGLT  247

Query  622  TPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLI  443
                         LP P I   D +  L  D VV+  ALT +DLG  P  L     +YL+
Sbjct  248  LGTRW--------LPNPPITE-DQLTMLGHDNVVADGALTLEDLGRKPTPLIAVAPDYLV  298

Query  442  QYRKGG  425
            +YRK G
Sbjct  299  KYRKHG  304



>ref|WP_037942904.1| 3-beta hydroxysteroid dehydrogenase [Sulfitobacter sp. CB2047]
 gb|KFC24884.1| 3-beta hydroxysteroid dehydrogenase [Sulfitobacter sp. CB2047]
Length=327

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 65/131 (50%), Gaps = 4/131 (3%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A  A L   G +   +YELGGPE+ +   L + M DV+      V +P  +AK 
Sbjct  189  VDDVAHA--AELAVTGKAAAGIYELGGPEVESFRGLMQRMLDVVNRRRMVVALPTFVAKV  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA   +V L+ V   L   +    D ++ L  D VV + A  FD LGI P  +     EY
Sbjct  247  IAFGLDV-LQSVTLGLVKNNTLTRDQVKNLAHDNVVGEGAQGFDALGISPVSMGSVLPEY  305

Query  448  LIQYRKGGPQY  416
            L ++R  G QY
Sbjct  306  LWRFRPSG-QY  315



>ref|WP_011909724.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhodobacter sphaeroides]
 gb|ABP71663.1| NADH dehydrogenase [Rhodobacter sphaeroides ATCC 17025]
Length=328

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 64/133 (48%), Gaps = 4/133 (3%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A +A +   G +   +YELGGP+  +   L +++  VI      V VPF +A+ 
Sbjct  189  VDDVAQAAVAGVL--GRAAPGIYELGGPDAESFRALMQMLLRVIERRKMIVNVPFGVARL  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A   + LL+ V   L        D +  L  D VVS  A    DLGI P  ++    EY
Sbjct  247  MAATLD-LLQTVTLGLLANKTLTRDQVRNLARDNVVSPGARGLADLGISPTAMEAVLPEY  305

Query  448  LIQYRKGGPQYGS  410
            L  YR  G QY S
Sbjct  306  LWSYRPSG-QYAS  317



>gb|ABD86012.1| NAD-dependent epimerase/dehydratase [Rhodopseudomonas palustris 
BisB18]
Length=349

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 69/133 (52%), Gaps = 15/133 (11%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+AV A   D  +  G  YELGGPE+ TM Q+ E++ DVI+     + +PF +A+ 
Sbjct  215  VGDVATAV-AQAVDGKAKPGATYELGGPEVLTMRQVIEIILDVIQRRRILLSLPFGLARL  273

Query  628  IATPREVLLKKVPFPLP-TPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKG  464
             A     LL+  P PL  TP     D +  L  D VVS+ A    LT   LGI P  L+ 
Sbjct  274  QAQ----LLQFAPGPLKLTP-----DQVALLQVDNVVSEAAQAAGLTLQGLGIPPDSLQA  324

Query  463  YPVEYLIQYRKGG  425
                YL ++R  G
Sbjct  325  IAPSYLWRFRATG  337



>ref|WP_024512948.1| 3-beta hydroxysteroid dehydrogenase [Bradyrhizobium sp. ARR65]
Length=322

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 69/133 (52%), Gaps = 15/133 (11%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVASA IA   D  +  G  YELGGPE+ +M ++ EL+ ++       V +PF +AK 
Sbjct  193  VGDVASA-IAEAADGKTRPGATYELGGPEVLSMREIMELILEITDRDRALVSLPFGLAKF  251

Query  628  IATPREVLLKKVPFPLP-TPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKG  464
             A      L+  P  L  TP     D +E L TD VVS+ A    LT + LGI P  L+ 
Sbjct  252  QA----AFLQFAPGALKLTP-----DQVELLRTDNVVSEAAKAAGLTLEGLGITPDSLEA  302

Query  463  YPVEYLIQYRKGG  425
               +YL ++R  G
Sbjct  303  IAPQYLWRFRPAG  315



>ref|WP_043773282.1| 3-beta hydroxysteroid dehydrogenase [Roseivivax isoporae]
 gb|ETX27695.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Roseivivax isoporae 
LMG 25204]
Length=327

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 69/131 (53%), Gaps = 5/131 (4%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A +A +   G++   +YELGGP++ T  +L + M  ++R     + VPFP+A  
Sbjct  189  VDDVARAAVAGIL--GTAAPGIYELGGPDVNTFRELMQQMLRIVRRRKLILNVPFPVASL  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +      LL+K+ F L  P +   D +  L  D VVS     F DLGI P  L+    +Y
Sbjct  247  MGGAFG-LLQKMSFGLILPPL-TRDQVANLKRDNVVSGTHPGFADLGIEPVSLEAVLPDY  304

Query  448  LIQYRKGGPQY  416
            L ++R  G QY
Sbjct  305  LWRFRPSG-QY  314



>ref|WP_043844369.1| 3-beta hydroxysteroid dehydrogenase [Roseivivax atlanticus]
 gb|ETW12944.1| ubiquinone dependent NADH dehydrogenase [Roseivivax atlanticus]
Length=329

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 66/131 (50%), Gaps = 5/131 (4%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A +  +   G +   +YELGGP++ T  +L   M  VIR     V VPF  A  
Sbjct  191  VDDVAQAAVKGVL--GQAAPGIYELGGPDVNTFRELMVYMLSVIRRRCLIVNVPFWAASI  248

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +    + LL+K+ F +  P+I   D +  L  D VV     TF DLGI P  L+    EY
Sbjct  249  MGRGFD-LLQKLSFDMIDPAI-TRDQVANLRRDNVVGDGVKTFADLGIEPTSLEAVVPEY  306

Query  448  LIQYRKGGPQY  416
            L ++R  G QY
Sbjct  307  LWRFRPSG-QY  316



>ref|WP_037115283.1| MULTISPECIES: 3-beta hydroxysteroid dehydrogenase [Rhizobium]
 gb|KEC72238.1| NADH dehydrogenase/NADH dehydrogenase (ubiquinone) protein [Rhizobium 
leguminosarum bv. phaseoli CCGM1]
Length=326

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 64/139 (46%), Gaps = 16/139 (12%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV A   D    +GKVYELGGPE+ +  +  E M  V     R V +PF IA  
Sbjct  194  VEDVAEAV-ARAVDGKVPVGKVYELGGPEVLSFRECLETMLKVTSRKNRLVSLPFGIASM  252

Query  628  IATPREVLLKKVPFPLP--TPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLK  467
            I +    +   +PF  P  TP     D +  L  D VVS +A     T   LGI P    
Sbjct  253  IGS----IASLIPFVTPPITP-----DQVRLLKRDNVVSAEAEAEGRTLKGLGIAPTMAA  303

Query  466  GYPVEYLIQYRKGGPQYGS  410
                 YL+QYR  G   GS
Sbjct  304  SVLESYLVQYRPHGQYTGS  322



>ref|WP_022713397.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium mongolense]
Length=326

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 64/137 (47%), Gaps = 12/137 (9%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV  +++   +S G +YELGGPE+ T  +  ++M  +     R V +PF IA  
Sbjct  194  VEDVAEAVARAVEGKAAS-GTIYELGGPEVLTFRECLQVMLKITARKNRLVSIPFTIASL  252

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVS----KDALTFDDLGIVPHKLKGY  461
            I +    +   +PF  P       D +  L  D VVS     D LT   LG+ P  L   
Sbjct  253  IGS----VASLIPFVKPP---ITADQVRLLKRDNVVSTKAETDGLTLKALGVTPTMLTSV  305

Query  460  PVEYLIQYRKGGPQYGS  410
               YL+ YR  G   GS
Sbjct  306  LPSYLVHYRPHGQYTGS  322



>ref|WP_036515289.1| 3-beta hydroxysteroid dehydrogenase [Oceanicaulis sp. HL-87]
Length=315

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 65/126 (52%), Gaps = 5/126 (4%)
 Frame = -1

Query  802  DVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIA  623
            DV +A++A+L+   ++ GK YELGGP  Y+  QL + +   I+     V VP+  A  I 
Sbjct  189  DVGAAILAALESP-AAQGKTYELGGPATYSFKQLLQYITATIQRPRLLVPVPWLAAYGIG  247

Query  622  TPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLI  443
               E+    +PF    P++   D +  L TD VVS       DLGI P  ++     YL 
Sbjct  248  FAGEIA-GALPF---VPTVLTRDQVTLLKTDNVVSGTLPGLSDLGIRPDSVEAIVPSYLY  303

Query  442  QYRKGG  425
            ++RKGG
Sbjct  304  RFRKGG  309



>ref|WP_039185049.1| 3-beta hydroxysteroid dehydrogenase [Leisingera sp. ANG-M7]
 gb|KIC36078.1| 3-beta hydroxysteroid dehydrogenase [Leisingera sp. ANG-M7]
Length=329

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 68/138 (49%), Gaps = 3/138 (2%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A +      G + G VYELGGPE+ T   L E M +VI      + +P   AK 
Sbjct  189  VDDVAKAAVKGAL--GEAQGGVYELGGPEVKTFRALMEQMLEVIHRRRVIISLPGFAAKL  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A   +V L+ V F L    +   D +++L +D VVS  A  F DLGI P  +     +Y
Sbjct  247  VAFGFDV-LQFVSFQLIENKMLTRDQLKSLKSDNVVSDGAKGFADLGIDPVTVGSVLPDY  305

Query  448  LIQYRKGGPQYGSTVSER  395
            L ++R  G     T S R
Sbjct  306  LWKFRPSGQYDEMTSSAR  323



>ref|WP_040179076.1| 3-beta hydroxysteroid dehydrogenase [Phaeobacter sp. S60]
 gb|KII17441.1| 3-beta hydroxysteroid dehydrogenase [Phaeobacter sp. S60]
Length=329

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 61/110 (55%), Gaps = 2/110 (2%)
 Frame = -1

Query  745  VYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKKVPFPLPTPSI  566
            VYELGGPE+ +   L + M +VI      + +P PIAK +A   +V+ + V F L    +
Sbjct  208  VYELGGPEVKSFGALMQQMLEVIDRRRLVLSLPGPIAKLVALGFDVM-QFVSFQLIENKM  266

Query  565  FNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGPQY  416
               D ++ L  D VVS+DA  FD+LGI P  L     +YL ++R  G QY
Sbjct  267  LTRDQLKNLEADNVVSEDAKGFDELGIHPVSLASVLPDYLWKFRPSG-QY  315



>ref|WP_012482360.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium etli]
 gb|ACE89344.1| probable NADH dehydrogenase/NADH dehydrogenase (ubiquinone) protein 
[Rhizobium etli CIAT 652]
Length=326

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 63/139 (45%), Gaps = 16/139 (12%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV A   D     GKVYELGGPE+ +  +  E M  V     R V +PF IA  
Sbjct  194  VEDVAEAV-ARAVDGKVPAGKVYELGGPEVLSFRECLETMLKVTSRKNRLVSLPFGIASM  252

Query  628  IATPREVLLKKVPFPLP--TPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLK  467
            I +    +   +PF  P  TP     D +  L  D VVS +A     T   LGI P    
Sbjct  253  IGS----IASLIPFVTPPITP-----DQVRLLKRDNVVSAEAESEGRTLKGLGIAPTMAA  303

Query  466  GYPVEYLIQYRKGGPQYGS  410
                 YL+QYR  G   GS
Sbjct  304  SVLESYLVQYRPHGQYTGS  322



>ref|WP_016735020.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium phaseoli]
Length=326

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 63/139 (45%), Gaps = 16/139 (12%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV A   D     GKVYELGGPE+ +  +  E M  V     R V +PF IA  
Sbjct  194  VEDVAEAV-ARAVDGKVPAGKVYELGGPEVLSFRECLETMLKVTSRKNRLVSLPFGIASM  252

Query  628  IATPREVLLKKVPFPLP--TPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLK  467
            I +    +   +PF  P  TP     D +  L  D VVS +A     T   LGI P    
Sbjct  253  IGS----IASLIPFVTPPITP-----DQVRLLKRDNVVSAEAESEGRTLKGLGIAPTMAA  303

Query  466  GYPVEYLIQYRKGGPQYGS  410
                 YL+QYR  G   GS
Sbjct  304  SVLESYLVQYRPHGQYTGS  322



>ref|WP_018855187.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium sp. 
42MFCr.1]
Length=326

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 67/137 (49%), Gaps = 12/137 (9%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV  +++    + G+VYELGGPE+ T  +  E+M        R V +PF IA  
Sbjct  194  VVDVAEAVAKAVEGK-VTAGQVYELGGPEVLTFRECLEVMLKTTWRKNRLVSLPFGIASL  252

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKGY  461
            I +   ++      P  TP I + D +  L  D VVSK+A     T   +G+ P  +   
Sbjct  253  IGSIASLI------PFVTPPITS-DQVRLLKKDNVVSKEAETEGRTLKGIGVTPTLVNSV  305

Query  460  PVEYLIQYRKGGPQYGS  410
               YL+QYR  G   GS
Sbjct  306  IGSYLVQYRPHGQYTGS  322



>ref|WP_018116836.1| MULTISPECIES: 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium]
Length=326

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 67/137 (49%), Gaps = 12/137 (9%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV  +++    + G+VYELGGPE+ T  +  E+M        R V +PF IA  
Sbjct  194  VVDVAEAVAKAVEGK-VTAGQVYELGGPEVLTFRECLEVMLKTTWRKNRLVSLPFGIASL  252

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKGY  461
            I +   ++      P  TP I + D +  L  D VVSK+A     T   +G+ P  +   
Sbjct  253  IGSIASLI------PFVTPPITS-DQVRLLKKDNVVSKEAETEGRTLKGIGVTPTLVNSV  305

Query  460  PVEYLIQYRKGGPQYGS  410
               YL+QYR  G   GS
Sbjct  306  IGSYLVQYRPHGQYTGS  322



>ref|WP_039846586.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium gallicum]
 gb|AJD39699.1| NAD-dependent nucleoside-diphosphate-sugar epimerase protein 
[Rhizobium gallicum bv. gallicum R602]
Length=326

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 64/137 (47%), Gaps = 12/137 (9%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV  +++   +  G +YELGGPE+ T  +  ++M  +     R V +PF IA  
Sbjct  194  VEDVAEAVARAVEGKAAG-GTIYELGGPEVLTFRECLQVMLKITARKNRLVSIPFSIASL  252

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVS----KDALTFDDLGIVPHKLKGY  461
            I +    +   VPF  P       D +  L  D VVS     D LT   LG+ P  L   
Sbjct  253  IGS----VASLVPFVKPP---ITADQVRLLKRDNVVSTKAETDGLTLKALGVTPTMLTSV  305

Query  460  PVEYLIQYRKGGPQYGS  410
               YL++YR  G   GS
Sbjct  306  LPSYLVRYRPHGQYTGS  322



>ref|WP_037114878.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium sp. OV201]
Length=326

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 65/137 (47%), Gaps = 12/137 (9%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV  +++    + G++YELGGPE+ T  +  E+M        R V +PF IA  
Sbjct  194  VVDVAEAVAKAVEGK-VAGGEIYELGGPEVLTFRECLEIMLKATWRKNRLVSIPFGIASL  252

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKGY  461
            I +    +   VPF  P       D +  L  D +VSKDA     T   +G+ P  +   
Sbjct  253  IGS----IASLVPFITPP---ITADQVRLLKKDNIVSKDAEAEDRTLKGIGVTPTLVSSV  305

Query  460  PVEYLIQYRKGGPQYGS  410
               YL+QYR  G   GS
Sbjct  306  IGSYLVQYRPHGQYTGS  322



>ref|WP_007529376.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium mesoamericanum]
 emb|CCM74073.1| NAD-dependent epimerase/dehydratase [Rhizobium mesoamericanum 
STM3625]
Length=326

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 12/137 (9%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV  +++    + G+VYELGGPE+ T  +  E+M    R   R V +PF IA  
Sbjct  194  VVDVAQAVARAVEGK-VTAGEVYELGGPEVLTFRECLEIMLKATRRKNRLVSLPFSIASL  252

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKGY  461
            +      +   VPF  P       D +  L  D +VSK+A     T   +G+ P  +   
Sbjct  253  MGN----IASLVPFVTPP---ITADQVRLLKKDNIVSKEAEAEGRTLKGIGVTPTLVSSV  305

Query  460  PVEYLIQYRKGGPQYGS  410
               YL+ YR  G   GS
Sbjct  306  IGSYLVHYRPQGQYTGS  322



>gb|EGE59004.1| putative NADH dehydrogenase/NADH dehydrogenase (ubiquinone) protein 
[Rhizobium etli CNPAF512]
Length=396

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 65/139 (47%), Gaps = 16/139 (12%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV  ++ D    +GKVYELGGPE+ +  +  E M  V     R V +PF IA  
Sbjct  264  VEDVAEAVARAV-DGKVPVGKVYELGGPEVLSFRECLETMLKVTSRKNRLVSLPFGIASM  322

Query  628  IATPREVLLKKVPFPLP--TPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLK  467
            I +    +   +PF  P  TP     D +  L  D VVS +A     T   LGI P    
Sbjct  323  IGS----IASLIPFVTPPITP-----DQVRLLKRDNVVSAEAEAEGRTLKGLGIAPTMAA  373

Query  466  GYPVEYLIQYRKGGPQYGS  410
                 YL+QYR  G   GS
Sbjct  374  SVLESYLVQYRPHGQYTGS  392



>ref|WP_029057708.1| 3-beta hydroxysteroid dehydrogenase [Stappia stellulata]
Length=330

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 73/135 (54%), Gaps = 15/135 (11%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV  ++ D  ++ G +YELGGPEI T  +  ELM +VIR     V +PF +A+ 
Sbjct  200  VGDVAEAVAMAV-DGQTARGTIYELGGPEIKTFKECLELMLEVIRRKRLLVTLPFSVARV  258

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDAL----TFDDLGIVPHKLKGY  461
             A+  +         LP+P +  +D +E L +D VV ++A+    T + LGI    L   
Sbjct  259  QASVMQW--------LPSPPL-TVDQVELLKSDNVVCEEAIADGRTLEGLGIEGRTLMAI  309

Query  460  PVEYLIQYRKGGPQY  416
               YL ++R+ G QY
Sbjct  310  LPTYLERFREHG-QY  323



>ref|WP_041345268.1| 3-beta hydroxysteroid dehydrogenase [Nitrobacter winogradskyi]
Length=322

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 69/133 (52%), Gaps = 15/133 (11%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+AV A   D  +  G VYELGGP++ +M ++  ++  VI      V VPF +A+ 
Sbjct  193  VGDVATAV-ADAVDGRTKAGAVYELGGPDVLSMREIMRIILRVIERERMLVPVPFLMARL  251

Query  628  IATPREVLLKKVPFPLP-TPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKG  464
            +A      L+  P PL  TP     D +  L TD VVS  A    LT   LGI P  ++ 
Sbjct  252  MAMG----LQFAPGPLKLTP-----DQVALLRTDNVVSNTATAAGLTLQGLGIAPDSMEA  302

Query  463  YPVEYLIQYRKGG  425
               +YL ++RK G
Sbjct  303  VVPQYLWRFRKAG  315



>ref|WP_024098971.1| putative nucleoside-diphosphate-sugar epimerase [Phaeobacter 
gallaeciensis]
 gb|AHD11386.1| putative nucleoside-diphosphate-sugar epimerase [Phaeobacter 
gallaeciensis DSM 26640]
Length=329

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 60/110 (55%), Gaps = 2/110 (2%)
 Frame = -1

Query  745  VYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKKVPFPLPTPSI  566
            VYELGGPE+ +   L + M +VI      + +P PIAK +A   +V+ + V F L    +
Sbjct  208  VYELGGPEVKSFGALMQQMLEVIDRRRLVLSLPGPIAKLVALGFDVM-QFVSFQLIENKM  266

Query  565  FNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGPQY  416
               D ++ L  D VVS DA  FD+LGI P  L     +YL ++R  G QY
Sbjct  267  LTRDQLKNLGADNVVSDDAKGFDELGIHPVSLASVLPDYLWKFRPSG-QY  315



>ref|WP_033963518.1| 3-beta hydroxysteroid dehydrogenase [Sphingomonas sp. Ant H11]
Length=310

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 63/129 (49%), Gaps = 13/129 (10%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV+A++++   S GK  ELGGP+I +M  L   +   +R  P  V++P  I  A
Sbjct  186  VGDVADAVVAAIENPALSAGKTLELGGPDILSMGALVRWIAKAVRRTPHIVELPDAIGGA  245

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVV-SKDALTFDDLGIVPHKLKGYPVE  452
            IA           F     +    D  + L  D VV + + LT   LGI P  L      
Sbjct  246  IAA----------FGFLPGAPITSDQWKMLANDNVVTTTNGLT--ALGITPTPLDAVAAG  293

Query  451  YLIQYRKGG  425
            +L+QYRKGG
Sbjct  294  WLVQYRKGG  302



>ref|WP_013300115.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Parvularcula bermudensis]
 gb|ADM09141.1| NADH-ubiquinone oxidoreductase 39 kDa subunit precursor, putative 
[Parvularcula bermudensis HTCC2503]
Length=324

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 67/132 (51%), Gaps = 9/132 (7%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V +VA  V A+L DD    G+ YELGGPEI T  +L +LM  +I      +  P P+A  
Sbjct  190  VDNVADCVAAAL-DDLDLRGRTYELGGPEIMTFKELMQLMLKIIGRRRILLPTPLPVASL  248

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVV--SKDAL--TFDDLGIVPHKLKGY  461
            I    +V +  +PF  P       D ++ L  D VV  +KD    T +D GI P  L+  
Sbjct  249  IGNVGDV-VGSLPFVTPP---LTSDQVKLLRRDNVVGLTKDETLGTIEDFGISPETLEAI  304

Query  460  PVEYLIQYRKGG  425
               YL++YRK G
Sbjct  305  LPTYLVRYRKQG  316



>gb|ABA03434.1| NAD-dependent epimerase/dehydratase [Nitrobacter winogradskyi 
Nb-255]
Length=353

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 70/133 (53%), Gaps = 15/133 (11%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+AV A   D  +  G VYELGGP++ +M ++  ++  VI      V VPF +A+ 
Sbjct  224  VGDVATAV-ADAVDGRTKAGAVYELGGPDVLSMREIMRIILRVIERERMLVPVPFLMARL  282

Query  628  IATPREVLLKKVPFPLP-TPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKG  464
            +A    + L+  P PL  TP     D +  L TD VVS  A    LT   LGI P  ++ 
Sbjct  283  MA----MGLQFAPGPLKLTP-----DQVALLRTDNVVSNTATAAGLTLQGLGIAPDSMEA  333

Query  463  YPVEYLIQYRKGG  425
               +YL ++RK G
Sbjct  334  VVPQYLWRFRKAG  346



>ref|WP_036260034.1| 3-beta hydroxysteroid dehydrogenase [Methylocapsa aurea]
Length=335

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 65/132 (49%), Gaps = 5/132 (4%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A+  +++   ++ G  YELGGP+I T+ ++ E + ++         + F  AK 
Sbjct  197  VGDVATAIALAVEGKATA-GATYELGGPDIATLRRIIEFILEITERKRWLAPISFEQAKL  255

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDAL----TFDDLGIVPHKLKGY  461
            I    E   K      P     + D +E L TD VVS+ A+    T D LGI P   + +
Sbjct  256  IGGVTEFAKKASLGLFPELLTISPDQVELLQTDNVVSRQAIAERRTLDGLGITPESFEAF  315

Query  460  PVEYLIQYRKGG  425
               YL +YRK G
Sbjct  316  TPSYLYRYRKTG  327



>ref|WP_007118555.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Oceanibulbus indolifex]
 gb|EDQ06486.1| NADH-ubiquinone oxidoreductase, putative [Oceanibulbus indolifex 
HEL-45]
Length=328

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 68/131 (52%), Gaps = 4/131 (3%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A   +L  +G +   VYELGGP++ T   L + M  VI      + +P+ +AK 
Sbjct  189  VDDVAKAAETAL--EGRAASGVYELGGPDVDTFRGLMQRMLHVIHRRRLVLNMPWFVAKM  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A   + +L+ + F L T  +   D ++ L  D VV+  A  F +LGI P  +     +Y
Sbjct  247  VAFGFD-MLQAITFGLFTNKMLTRDQVKNLRNDNVVADGARGFTELGITPTAMDAVLPDY  305

Query  448  LIQYRKGGPQY  416
            L ++R  G QY
Sbjct  306  LWRFRPSG-QY  315



>ref|WP_009825787.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Sulfitobacter 
sp. NAS-14.1]
 gb|EAP81297.1| NADH ubiquinone oxidoreductase, putative [Sulfitobacter sp. NAS-14.1]
Length=327

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 65/131 (50%), Gaps = 4/131 (3%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A  A L   G +   +YELGGPE+ +   L + M DV+      V +P  +AK 
Sbjct  189  VDDVAHA--AELAVTGKAPAGIYELGGPEVESFRGLMQRMLDVVNRRRMVVALPTFVAKV  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA   +V L+ V   L   +    D ++ L  D VV + A  FD LGI P  +     EY
Sbjct  247  IAFGLDV-LQSVTLGLVKNNTLTRDQVKNLAHDNVVGEGARGFDALGISPVSMGSVLPEY  305

Query  448  LIQYRKGGPQY  416
            L ++R  G QY
Sbjct  306  LWRFRPSG-QY  315



>ref|WP_023449911.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Asticcacaulis 
sp. AC402]
 gb|ESQ74840.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Asticcacaulis 
sp. AC402]
Length=323

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 68/135 (50%), Gaps = 14/135 (10%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPR-YVKVPFPIAK  632
            V DVA+AV  +L   GS  GKVYELGGPE++    L   +   I + PR  V  PF +A+
Sbjct  190  VGDVAAAVAKTLGHAGS-YGKVYELGGPEVFAFKDLISYVGQEIMQ-PRPQVWAPFFVAR  247

Query  631  AIATPREV------LLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKL  470
             I    +V      L+  VP PL T      D +  L  D VV+K AL   DLGI    +
Sbjct  248  MIGLAGDVQAGIHGLVSAVPAPLLTT-----DQVLLLQIDNVVAKGALGLKDLGIAATAV  302

Query  469  KGYPVEYLIQYRKGG  425
            +     YL ++RK G
Sbjct  303  ESIVPTYLWRFRKNG  317



>ref|WP_005850924.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Sulfitobacter 
sp. EE-36]
 gb|EAP85801.1| NADH ubiquinone oxidoreductase, putative [Sulfitobacter sp. EE-36]
Length=327

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 64/131 (49%), Gaps = 4/131 (3%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A  A L   G +   +YELGGPE+ +   L + M DV+      V +P  +A+ 
Sbjct  189  VDDVAHA--AELAVTGKAAAGIYELGGPEVESFRGLMQRMLDVVNRRRMVVALPTFVARV  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA   +V L+ V   L   +    D ++ L  D VV   A  FD LGI P  +     EY
Sbjct  247  IAFGLDV-LQSVTLGLVKNNTLTRDQVKNLAHDNVVGGGAQGFDALGISPVSMGSVLPEY  305

Query  448  LIQYRKGGPQY  416
            L ++R  G QY
Sbjct  306  LWRFRPSG-QY  315



>ref|WP_036368672.1| 3-beta hydroxysteroid dehydrogenase, partial [Microvirga lupini]
Length=129

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 62/126 (49%), Gaps = 10/126 (8%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DV +   A L +  +S GK+YE GGP +YT  +L   +   IR  P  V VPF +A+ 
Sbjct  14   VEDVVAGFAAILANP-ASHGKIYEFGGPRVYTFKELIGFVCARIRAQPLLVPVPFWVAEL  72

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +      LL+  P      +    D ++ L TD VVS    T  D+GI P  L+    EY
Sbjct  73   LGG----LLQVFP-----DAPLTRDQVQLLRTDKVVSGSEPTLGDVGIEPKVLEAIVPEY  123

Query  448  LIQYRK  431
            L  YR+
Sbjct  124  LSAYRR  129



>ref|WP_034992883.1| 3-beta hydroxysteroid dehydrogenase [Beijerinckia mobilis]
Length=336

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 69/134 (51%), Gaps = 9/134 (7%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV  SL  +    G +YELGGPEI +M ++ E +   I      + +PFP+AK 
Sbjct  197  VGDVAKAVAGSLNGN-VKTGTIYELGGPEIRSMREIMEFILATIERQRLLLPIPFPLAKL  255

Query  628  IATPREVLLKKVPFPLPTPSIFNL--DLIEALTTDTVVSKDA----LTFDDLGIVPHKLK  467
            +A   E+  + +   L  PS F+L  D +E L  D +VS++A     +    G+ P   +
Sbjct  256  VAFGTEI-AEALSLGL-FPSTFSLTRDQVELLRRDNIVSEEAKAEGRSLQAFGLEPESFE  313

Query  466  GYPVEYLIQYRKGG  425
                 YL ++RK G
Sbjct  314  TIVPTYLYRFRKAG  327



>ref|WP_039712493.1| 3-beta hydroxysteroid dehydrogenase [Scytonema millei]
 gb|KIF22970.1| 3-beta hydroxysteroid dehydrogenase [Scytonema millei VB511283]
Length=324

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 66/127 (52%), Gaps = 7/127 (6%)
 Frame = -1

Query  802  DVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIA  623
            DVA AV  +++   ++ GK YELGGP++YT  +L E + +        + VPFPIA A+ 
Sbjct  196  DVADAVANAIQTPATA-GKTYELGGPKVYTFKELMEFILETTDRKRFLIPVPFPIATALG  254

Query  622  TPREVLLKKVPFPLPTPSIF-NLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYL  446
                 L+ ++   LP    F   D +  L +D VV+  A   +DLG+ P  ++     YL
Sbjct  255  -----LMGEIAGMLPLVDPFLTRDQVTQLKSDNVVAPRAKGIEDLGVTPQTVEAIVPAYL  309

Query  445  IQYRKGG  425
            + YR  G
Sbjct  310  VPYRDKG  316



>ref|WP_037518255.1| 3-beta hydroxysteroid dehydrogenase [Sphingopyxis sp. LC81]
 gb|KGB51948.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Sphingopyxis sp. 
LC81]
Length=312

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 62/128 (48%), Gaps = 11/128 (9%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV+A+L     + GK +ELGGP++ TM +L   + D     P +V VP  +A A
Sbjct  188  VGDVADAVVAALGS--GAAGKTFELGGPQVLTMAELLRWVADATGRRPLFVDVPDFVASA  245

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A+          F     +    D  + L  D VV+  A    +LG+ P  L      +
Sbjct  246  LAS---------GFGWAPGAPITKDQWQMLQRDNVVAAGAADLAELGVTPTSLGSVAEGW  296

Query  448  LIQYRKGG  425
            L+QYR+ G
Sbjct  297  LVQYRRHG  304



>ref|XP_005965302.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Pantholops hodgsonii]
Length=321

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 69/135 (51%), Gaps = 8/135 (6%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAEL-MYDVIREWPRYVKVPFPIAK  632
            V DVA+ VIA    D +++G  YELGGP +YTM ++ EL + +  R+ P    VP+P+A 
Sbjct  189  VGDVAT-VIAQAVSDPAAVGVTYELGGPTVYTMREILELILTETGRKRP-LAPVPWPVAS  246

Query  631  AIATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVE  452
             I +  +     +P   P       D +E L TD V         + G+VP  ++     
Sbjct  247  LIGSLGDFQASILPLAPP----LTTDQVEMLKTDNVAEAGLPGLAEAGVVPTAVEAVIPS  302

Query  451  YLIQYRKGGPQYGST  407
            YL +YRKGG QY  T
Sbjct  303  YLYRYRKGG-QYAPT  316



>ref|WP_009796496.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Nitrobacter sp. 
Nb-311A]
 gb|EAQ37017.1| NAD-dependent epimerase/dehydratase [Nitrobacter sp. Nb-311A]
Length=322

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 61/114 (54%), Gaps = 14/114 (12%)
 Frame = -1

Query  751  GKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKKVPFPLP-T  575
            G VYELGGPE+ +M ++ +++  VI      V +PF    AIA  + + L+  P PL  T
Sbjct  211  GAVYELGGPEVLSMREIMQIILRVIERERMLVPLPF----AIARLKAMFLQFAPGPLKLT  266

Query  574  PSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKGYPVEYLIQYRKGG  425
            P     D +E L TD VVS  A    LT   LGI P  ++    +YL ++RK G
Sbjct  267  P-----DQVELLKTDNVVSNAAIAAGLTLQGLGITPDSMEAVVPQYLWRFRKAG  315



>ref|WP_007674128.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [alpha proteobacterium 
BAL199]
 gb|EDP64286.1| NADH-ubiquinone oxidoreductase 40 kDa subunit [alpha proteobacterium 
BAL199]
Length=317

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 64/132 (48%), Gaps = 10/132 (8%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A +A L D   + G  +ELGGP IYT  QL ELM    R   + + +PF  A  
Sbjct  191  VDDVADAALAVL-DRSDAAGATFELGGPTIYTFRQLLELMQAHTRRNRKLLPLPFWAAS-  248

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
                   LL  V   LP P +   D +E L  D +VS  A T  DLGI P  ++     Y
Sbjct  249  -------LLGGVLELLPVPPV-TRDQVELLKRDNIVSAGAKTLADLGIEPTPVELILPSY  300

Query  448  LIQYRKGGPQYG  413
            + ++R GG   G
Sbjct  301  MDKFRVGGRYSG  312



>ref|WP_015089185.1| short chain dehydrogenase family protein [Candidatus Endolissoclinum 
faulkneri]
 gb|AFX99687.1| short chain dehydrogenase family protein [Candidatus Endolissoclinum 
faulkneri L2]
Length=314

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 70/128 (55%), Gaps = 10/128 (8%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V D+A A+IA+L +  ++ G+ YE+GGP +Y+  +L E++          +++PF     
Sbjct  191  VIDLAEAIIAAL-NTPAAYGQTYEVGGPSVYSFRELMEIILKETNRKVLLIRIPF----W  245

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
             A+ + +LL+  P P+ T      D +E L  D +VS DA T +DL I P  ++     Y
Sbjct  246  FASLKALLLELTPNPILTR-----DQVELLKMDNIVSHDAKTINDLFIKPTPIEIIIPTY  300

Query  448  LIQYRKGG  425
            L +YR GG
Sbjct  301  LNKYRPGG  308



>ref|WP_043140566.1| 3-beta hydroxysteroid dehydrogenase [Ponticoccus sp. UMTAT08]
 gb|KHQ53530.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Ponticoccus sp. 
UMTAT08]
Length=327

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 67/131 (51%), Gaps = 5/131 (4%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A +  +   G +   +YELGGP++ T  +L ++M DVIR       +PF  A  
Sbjct  189  VDDVAQAAVKGVL--GQAEPGIYELGGPDVMTFRELMQVMLDVIRRRRLVANIPFFAASV  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            I    + L++ +   L  P+    D + +L  D V ++ A  F DLGI P  ++    +Y
Sbjct  247  IGAVSD-LVQSLSLGL-IPAQITADQVRSLRQDNVTAEGARGFSDLGISPMSVQAVLPDY  304

Query  448  LIQYRKGGPQY  416
            L ++R  G QY
Sbjct  305  LWRFRPSG-QY  314



>ref|WP_028096083.1| 3-beta hydroxysteroid dehydrogenase [Dongia sp. URHE0060]
Length=316

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 65/128 (51%), Gaps = 7/128 (5%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A+  ++++  +  GK+YELGGP IY+  +L  +M   I        +PF    A
Sbjct  191  VLDVAEAISRAIENPAAYGGKIYELGGPRIYSFRELMTVMLAEIGRKRWLCSMPF----A  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A+ +  +L+ +PF  P      +D ++ L  D VV   A  F  LGI P  L+     Y
Sbjct  247  LASLQGAVLQAIPFIQPP---LTVDQVKLLKRDNVVGPQAAGFKSLGITPTALEPILPTY  303

Query  448  LIQYRKGG  425
            L +YR  G
Sbjct  304  LDRYRPHG  311



>ref|WP_011540134.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Ruegeria sp. TM1040]
 gb|ABF65552.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Ruegeria sp. TM1040]
Length=329

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 66/131 (50%), Gaps = 4/131 (3%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A +A L   G +    YELGGPE+ +  +L   M DVI      V +P  +A+ 
Sbjct  189  VDDVAKAAVAGLT--GQAAAGTYELGGPEVKSFTELMSQMLDVIHRRRLVVSLPNFVARL  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A   + + + V F L T  +   D ++ L  D VVS+ A    DLGI P  +     +Y
Sbjct  247  MAFGFD-MAQAVTFGLFTNGLLTRDQLKNLQNDNVVSEGAKGLADLGIEPVTMGSVLPDY  305

Query  448  LIQYRKGGPQY  416
            L ++R  G QY
Sbjct  306  LWKFRPSG-QY  315



>ref|WP_037482058.1| 3-beta hydroxysteroid dehydrogenase [Sphingomonas paucimobilis]
 gb|EZP73655.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Sphingomonas paucimobilis]
Length=315

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 63/128 (49%), Gaps = 10/128 (8%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A++ ++ D G+  GK YELGGP  ++M +L   +   I      V VP P+A  
Sbjct  190  VGDVAQAIVNAVSDPGAHGGKTYELGGPRQFSMMELNGWIAKAIGRERSLVAVPAPVASM  249

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA        K+ F LP   I   D    L  D VVS  A    +LG+ P  ++     +
Sbjct  250  IA--------KLGF-LPGAPITQ-DQYAMLQKDNVVSPGAPGLAELGVAPTPMEAVAQNW  299

Query  448  LIQYRKGG  425
            L++YR+ G
Sbjct  300  LVRYRRHG  307



>ref|WP_010406527.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Sphingomonas echinoides]
Length=310

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 63/128 (49%), Gaps = 13/128 (10%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV+A+L+    + GK +ELGGP++ +M  L   +   +R  P  V++P  +  A
Sbjct  186  VGDVADAVVAALEHPALASGKTFELGGPDVLSMGALVRWIAKAVRRTPPIVELPDAVGGA  245

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVS-KDALTFDDLGIVPHKLKGYPVE  452
            IA           F     +    D  + L  D VVS K+ LT   LGI P  L      
Sbjct  246  IAA----------FGFLPGAPITADQWKMLANDNVVSGKNGLT--ALGITPTPLDAVAAG  293

Query  451  YLIQYRKG  428
            +L+QYRKG
Sbjct  294  WLVQYRKG  301



>ref|WP_008596326.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Nitratireductor 
pacificus]
 gb|EKF19243.1| NAD-dependent epimerase/dehydratase [Nitratireductor pacificus 
pht-3B]
Length=324

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 63/132 (48%), Gaps = 14/132 (11%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA  V A   D     GKVYELGGPE+ T  +  E M +VI     +V +P+ +A+ 
Sbjct  195  VGDVAE-VYARSVDGTLKGGKVYELGGPEVLTFRECMEQMLEVIHRKRWFVSIPWSVARL  253

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVS----KDALTFDDLGIVPHKLKGY  461
                   +L K+P  L T     LD +E L  D VVS    KD  T   LGI  H L   
Sbjct  254  QGR----ILGKLPGHLLT-----LDQVEQLRHDNVVSEAAAKDKRTLAGLGIAQHSLAAM  304

Query  460  PVEYLIQYRKGG  425
               YL ++R  G
Sbjct  305  LPAYLWRFRPAG  316



>ref|WP_037964625.1| 3-beta hydroxysteroid dehydrogenase [Sulfitobacter pontiacus]
 gb|KAJ30518.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Sulfitobacter 
pontiacus 3SOLIMAR09]
Length=327

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 65/131 (50%), Gaps = 4/131 (3%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A  A L   G +   +YELGGPE+ +   L + M DV+      V +P  +AK 
Sbjct  189  VDDVAHA--AELAVTGKAPAGIYELGGPEVESFRGLMQRMLDVVNRRRMVVALPTFMAKV  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            IA   +V L+ V   L   +    D ++ L  D VV + A  FD LGI P  +     EY
Sbjct  247  IAFGLDV-LQSVTLGLVKNNTLTRDQVKNLAHDNVVGEGAQGFDALGISPVSMGSVLPEY  305

Query  448  LIQYRKGGPQY  416
            L ++R  G QY
Sbjct  306  LWRFRPSG-QY  315



>gb|EKE10168.1| NADH dehydrogenase (Ubiquinone) 1 alpha subcomplex subunit 9 
[uncultured bacterium]
Length=308

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 65/129 (50%), Gaps = 12/129 (9%)
 Frame = -1

Query  808  VTDVASAVI-ASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAK  632
            V DVA   + A+ K +  S GK YELGG EIYT  QL   +   I      + VPF +A+
Sbjct  189  VGDVAECFLKAAFKKE--SRGKTYELGGTEIYTFKQLMAYLLKTIYRKRLLLPVPFSLAR  246

Query  631  AIATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVE  452
             +AT  + L    P P  TP     D +E L ++T VS  AL   DLG+    ++     
Sbjct  247  IMATFAQFL----PTPPLTP-----DQVELLKSNTTVSSKALIAKDLGVHVKAMEALAPF  297

Query  451  YLIQYRKGG  425
            YL +YR GG
Sbjct  298  YLKRYRPGG  306



>ref|WP_007811933.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Roseobacter sp. 
AzwK-3b]
 gb|EDM73212.1| NADH ubiquinone oxidoreductase, putative [Roseobacter sp. AzwK-3b]
Length=327

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 68/131 (52%), Gaps = 5/131 (4%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A  A++  +G +   +YELGGP++ T   L E M  VIR     V +PF +A  
Sbjct  189  VDDVAHA--AAMAVEGKASPGIYELGGPDVSTFRALMEEMLGVIRRRRLIVNIPFRMATI  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A   E+  + +   L  P I   D + +L  D VVS+ A  F DLGI P   +    +Y
Sbjct  247  MAGAMEI-GETLSLGLVPPQI-TRDQVRSLRVDNVVSEGARGFADLGIKPTATEAVLPDY  304

Query  448  LIQYRKGGPQY  416
            L ++R  G QY
Sbjct  305  LWRFRPAG-QY  314



>ref|WP_027581325.1| 3-beta hydroxysteroid dehydrogenase [Bradyrhizobium sp. Ai1a-2]
Length=329

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 66/132 (50%), Gaps = 13/132 (10%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+AV A   D  +     YELGGPE+ TM ++ E + D+       V +PF +A+ 
Sbjct  193  VGDVATAV-ADAVDGKTRPAATYELGGPEVLTMREIMETILDITDRDRALVSLPFGLARF  251

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKGY  461
            +A     LL+  P  L        D +E L  D VVS  A    LTF+ LGI P  L+  
Sbjct  252  MAA----LLQFAPGALK----LTADQVELLRKDNVVSDTAKAAGLTFEGLGIAPDSLEAI  303

Query  460  PVEYLIQYRKGG  425
              +YL ++R  G
Sbjct  304  APQYLWRFRPAG  315



>ref|WP_007255607.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Oceanicola granulosus]
 gb|EAR52873.1| NADH-ubiquinone oxidoreductase [Oceanicola granulosus HTCC2516]
Length=334

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 71/131 (54%), Gaps = 5/131 (4%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A  A+L  +G +   +YELGGP++ T   L   M DVI      V VPF +A+ 
Sbjct  189  VDDVAKA--AALAVEGKAAPGIYELGGPDVNTFSVLMREMLDVILRRRLIVNVPFGLARL  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A+   V L+ +   L TP +   D +E L +D +V+  A  F +LGI P  ++    +Y
Sbjct  247  MASGFTV-LRFLSLGLFTPPL-TRDQVENLRSDNIVADGARGFAELGIQPKSMEAILPDY  304

Query  448  LIQYRKGGPQY  416
            L ++R  G QY
Sbjct  305  LWRFRPTG-QY  314



>gb|AIF81505.1| NADH dehydrogenase (ubiquinone) [endosymbiont of Acanthamoeba 
sp. UWC8]
Length=306

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 65/121 (54%), Gaps = 10/121 (8%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V+DVA AV   L  D +  GKV+ELGG ++YT+ ++ EL++ +I +    V +PF  AK 
Sbjct  195  VSDVAKAVGRCLVKD-NICGKVFELGGSKVYTLREIYELIFKLIGKKKPLVSIPFIFAKV  253

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +AT            L    +   D +E L TD ++ K+   F++LG+ P  ++    EY
Sbjct  254  MATVL---------TLLPRPLLTCDQVELLKTDNIIVKNKNGFEELGLTPTSMEAVLSEY  304

Query  448  L  446
            +
Sbjct  305  I  305



>ref|WP_028164836.1| 3-beta hydroxysteroid dehydrogenase [Bradyrhizobium elkanii]
Length=329

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 66/132 (50%), Gaps = 13/132 (10%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+AV A   D  +  G  YELGGPE+ TM ++ E + ++       V +PF +A+ 
Sbjct  193  VGDVATAV-ADAVDGKTKPGATYELGGPEVLTMREIMETILEITDRDRALVSLPFGLARI  251

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKGY  461
            +A      L+  P  L        D +E L  D VVS  A    LTF+ LGI P  L+  
Sbjct  252  LAA----FLQFAPGALK----LTADQVELLRKDNVVSDTAKAAGLTFEGLGITPDSLEAI  303

Query  460  PVEYLIQYRKGG  425
              +YL ++R  G
Sbjct  304  APQYLWRFRPAG  315



>ref|WP_038541460.1| hypothetical protein, partial [endosymbiont of Acanthamoeba sp. 
UWC8]
Length=305

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 65/121 (54%), Gaps = 10/121 (8%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V+DVA AV   L  D +  GKV+ELGG ++YT+ ++ EL++ +I +    V +PF  AK 
Sbjct  195  VSDVAKAVGRCLVKD-NICGKVFELGGSKVYTLREIYELIFKLIGKKKPLVSIPFIFAKV  253

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +AT            L    +   D +E L TD ++ K+   F++LG+ P  ++    EY
Sbjct  254  MATVL---------TLLPRPLLTCDQVELLKTDNIIVKNKNGFEELGLTPTSMEAVLSEY  304

Query  448  L  446
            +
Sbjct  305  I  305



>ref|WP_022733802.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Thalassospira 
lucentensis]
Length=335

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 69/131 (53%), Gaps = 13/131 (10%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A + +L + G S GK YELGGPE+Y+   L   M  + R+    + VPF     
Sbjct  209  VGDVADAFMTALVE-GKSAGKTYELGGPEVYSFMGLLRDMLHITRQRAILMPVPF----W  263

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A+ +   L+ +P P  T     LD +  L TD VVS+ +  F +LGI P+ ++     Y
Sbjct  264  LASIKAFFLQLLPVPPLT-----LDQVRLLKTDNVVSEGSDGFAELGITPNSVEAIAPTY  318

Query  448  LIQY---RKGG  425
            L ++   RK G
Sbjct  319  LKRFCPPRKSG  329



>ref|WP_039192493.1| 3-beta hydroxysteroid dehydrogenase [Leisingera sp. ANG-M6]
 gb|KIC27972.1| 3-beta hydroxysteroid dehydrogenase [Leisingera sp. ANG-M6]
Length=329

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 66/129 (51%), Gaps = 4/129 (3%)
 Frame = -1

Query  802  DVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIA  623
            DVA A +      G + G VYELGGPE+ T   L E M +VI      + +P   AK +A
Sbjct  191  DVAKAAVKGAL--GEAEGGVYELGGPEVKTFRALMEQMLEVIHRRRVIISLPGFAAKLVA  248

Query  622  TPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLI  443
               +V L+ V F L    +   D +++L +D VVS  A  F DLGI P  +     +YL 
Sbjct  249  FGFDV-LQFVSFQLIENKMLTRDQLKSLKSDNVVSDGAKGFADLGIDPVTVGSVLPDYLW  307

Query  442  QYRKGGPQY  416
            ++R  G QY
Sbjct  308  KFRPSG-QY  315



>ref|WP_039135139.1| 3-beta hydroxysteroid dehydrogenase [Leisingera sp. ANG-Vp]
 gb|KIC13450.1| 3-beta hydroxysteroid dehydrogenase [Leisingera sp. ANG-Vp]
Length=330

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 66/135 (49%), Gaps = 4/135 (3%)
 Frame = -1

Query  802  DVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIA  623
            DVA A +  +   G + G +YELGGPE+ +   L E M +VI      + +P P A  +A
Sbjct  191  DVAKAAVKGVL--GEAAGGIYELGGPEVKSFRALMEQMLEVIHRRRLILSLPRPAAFLVA  248

Query  622  TPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLI  443
               +V L+   F L    I   D + +L +D VVS  A  F DLGI P  +     +YL 
Sbjct  249  FGFDV-LQFASFQLIENKILTRDQLRSLKSDNVVSDGAKGFADLGISPVTVGSVLPDYLW  307

Query  442  QYRKGGPQYGSTVSE  398
            ++R  G QY    S 
Sbjct  308  KFRPSG-QYDEMTSS  321



>ref|WP_039147810.1| 3-beta hydroxysteroid dehydrogenase [Leisingera sp. ANG-DT]
 gb|KIC18464.1| 3-beta hydroxysteroid dehydrogenase [Leisingera sp. ANG-DT]
Length=329

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 66/129 (51%), Gaps = 4/129 (3%)
 Frame = -1

Query  802  DVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIA  623
            DVA A +      G + G VYELGGPE+ T   L E M +VI      + +P   AK +A
Sbjct  191  DVAKAAVKGAL--GEAEGGVYELGGPEVKTFRALMEQMLEVIHRRRVIISLPGFAAKLVA  248

Query  622  TPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLI  443
               +V L+ V F L    +   D +++L +D VVS  A  F DLGI P  +     +YL 
Sbjct  249  FGFDV-LQFVSFQLIENKMLTRDQLKSLKSDNVVSDGAKGFADLGIDPVTVGSVLPDYLW  307

Query  442  QYRKGGPQY  416
            ++R  G QY
Sbjct  308  KFRPSG-QY  315



>ref|WP_006271410.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Asticcacaulis 
biprosthecium]
 gb|EGF92235.1| NADH dehydrogenase ubiquinone 1 alpha subcomplex subunit 9 [Asticcacaulis 
biprosthecum C19]
Length=323

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 68/135 (50%), Gaps = 14/135 (10%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPR-YVKVPFPIAK  632
            V DVA AV  +L  + S+ GKVYELGGPE++    L   +   I++ PR  V  PF +A+
Sbjct  190  VGDVAGAVAKTL-GNASAYGKVYELGGPEVFAFKDLIAYVGKEIQQ-PRPLVWAPFFVAR  247

Query  631  AIATPREV------LLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKL  470
             I    +V      +L  VP PL T      D +  L  D VV K AL   DLGI    +
Sbjct  248  MIGLAGDVQAGVHGMLSVVPAPLLTT-----DQVLLLQKDNVVPKGALGLKDLGIAATAV  302

Query  469  KGYPVEYLIQYRKGG  425
            +     YL ++RK G
Sbjct  303  ESIAPTYLWRFRKNG  317



>ref|WP_007799503.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium sp. 
CF122]
 gb|EJL51308.1| putative nucleoside-diphosphate sugar epimerase [Rhizobium sp. 
CF122]
Length=326

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 66/137 (48%), Gaps = 12/137 (9%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV  ++++   + G+VYELGGPE+ T  +  E+M        R V +PF IA  
Sbjct  194  VVDVAEAVAKAVENK-VTAGEVYELGGPEVLTFRECLEIMLKATWRKNRLVSLPFGIASL  252

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKGY  461
            I     ++      P  TP I   D +  L  + +VSK+A     T   +GI P  +   
Sbjct  253  IGRVASLV------PFITPPI-TADQVRLLKKNNIVSKEAEAEGRTLKGIGITPTLVSSV  305

Query  460  PVEYLIQYRKGGPQYGS  410
               YL+QYR  G   GS
Sbjct  306  IGSYLVQYRPHGQYTGS  322



>ref|WP_029204950.1| MULTISPECIES: 3-beta hydroxysteroid dehydrogenase [Leisingera]
 gb|KIC24441.1| 3-beta hydroxysteroid dehydrogenase [Leisingera sp. ANG-S3]
 gb|KIC33130.1| 3-beta hydroxysteroid dehydrogenase [Leisingera sp. ANG-S5]
 gb|KIC53158.1| 3-beta hydroxysteroid dehydrogenase [Leisingera sp. ANG-S]
 gb|KID07246.1| 3-beta hydroxysteroid dehydrogenase [Leisingera sp. ANG1]
Length=329

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 66/129 (51%), Gaps = 4/129 (3%)
 Frame = -1

Query  802  DVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIA  623
            DVA A +      G + G VYELGGPE+ T   L E M +VI      + +P   AK +A
Sbjct  191  DVAKAAVKGAL--GEAEGGVYELGGPEVKTFRALMEQMLEVIHRRRVIISLPGFAAKLVA  248

Query  622  TPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLI  443
               +V L+ V F L    +   D +++L +D VVS  A  F DLGI P  +     +YL 
Sbjct  249  FGFDV-LQFVSFQLIENKMLTRDQLKSLKSDNVVSDGAKGFADLGIDPVTVGSVLPDYLW  307

Query  442  QYRKGGPQY  416
            ++R  G QY
Sbjct  308  KFRPSG-QY  315



>ref|WP_035581487.1| 3-beta hydroxysteroid dehydrogenase [Hyphomonas jannaschiana]
 gb|KCZ88641.1| putative NADH-quinone oxidoreductase [Hyphomonas jannaschiana 
VP2]
Length=329

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 73/132 (55%), Gaps = 9/132 (7%)
 Frame = -1

Query  802  DVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRY-VKVPFPIAKAI  626
            DVA A+  ++ DD S+ GK YELGGP +YTM+++ + +   I + PR+ V +PF  AK +
Sbjct  193  DVAEAIAVAV-DDASTEGKTYELGGPRVYTMNEIYDFICATI-DRPRFKVTLPFFAAKPL  250

Query  625  ATPREVLLKKV-PFP---LPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVP-HKLKGY  461
                  + + V PF    L  P +   D +E L TD VV+ DALT  DLG+     ++  
Sbjct  251  GYLSGAVWRYVPPFSWGFLGQPPVTG-DQVEMLKTDNVVADDALTLADLGVTTLESVEAI  309

Query  460  PVEYLIQYRKGG  425
               YL ++R  G
Sbjct  310  VPTYLWRFRDYG  321



>ref|WP_037100746.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium alamii]
Length=326

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 64/139 (46%), Gaps = 16/139 (12%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV A   D     GK+YELGGPE+ T  +  E +  V     R + +PF IA  
Sbjct  194  VEDVAEAV-ARAVDGKVEGGKIYELGGPEVLTFRECLETILKVTVRKNRLISLPFSIASL  252

Query  628  IATPREVLLKKVPFPLP--TPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLK  467
            I +    +   VPF  P  TP     D ++ L  D VVSK A     T   LGI P    
Sbjct  253  IGS----IASLVPFIAPPITP-----DQVKLLKHDNVVSKAAEAEGRTLKGLGITPTMAT  303

Query  466  GYPVEYLIQYRKGGPQYGS  410
                 YL+QYR  G   GS
Sbjct  304  SVLDSYLVQYRPHGQYTGS  322



>ref|WP_035842520.1| 3-beta hydroxysteroid dehydrogenase [Defluviimonas sp. 20V17]
 gb|KDB03560.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Defluviimonas 
sp. 20V17]
Length=328

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 63/128 (49%), Gaps = 3/128 (2%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A +A +  +G +   +YELGGPE+ T+ +    + + IR     V +PF +   
Sbjct  189  VDDVAQAAVAGV--EGRAQPGIYELGGPEVRTLRETCVWLLNEIRRRRLIVNLPFWLGAL  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +    + LL+ +   L    I   D + +L  D VVS  A T  DLG+ P   +    +Y
Sbjct  247  MGGAFD-LLQTLSGGLLVNRILTRDQVRSLRHDNVVSDGARTLRDLGVAPTPFEAVVGDY  305

Query  448  LIQYRKGG  425
            L +YR  G
Sbjct  306  LWRYRPAG  313



>ref|WP_034465154.1| 3-beta hydroxysteroid dehydrogenase [Afipia sp. P52-10]
 gb|ETR77702.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Afipia sp. P52-10]
Length=321

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 68/133 (51%), Gaps = 15/133 (11%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V +VA A+  +++    S G  YELGGP++ TM ++ EL+  +I      V VPF +AK 
Sbjct  192  VGNVAQALADAVEGKAQS-GATYELGGPDVLTMREVQELVLTIIERRRLLVPVPFGLAKL  250

Query  628  IATPREVLLKKVPFPLP-TPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKG  464
             A      L+  P PL  TP     D +E L +D VVS+ A    LT   LGI P  L  
Sbjct  251  KAA----FLQFAPGPLKLTP-----DQVELLRSDNVVSQTAKDAGLTLQGLGITPDALSH  301

Query  463  YPVEYLIQYRKGG  425
                YL ++R+ G
Sbjct  302  IAPSYLWRFRRTG  314



>ref|WP_037188156.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium sp. YR519]
Length=326

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 67/137 (49%), Gaps = 12/137 (9%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V D+A AV  +++      GKVYELGGPE+ T  +  E +          V +PF +A  
Sbjct  194  VMDIAEAVAKAVEGK-VEGGKVYELGGPEVLTFRECLEAVLKATSRKNPLVSIPFGLASL  252

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKGY  461
            I +   ++      PL  P I + D +  L TD VVSK+A     T  D+G+VP  +   
Sbjct  253  IGSVASLV------PLIKPPITS-DQVRLLKTDNVVSKEAEAEGRTLKDIGVVPTMVGSV  305

Query  460  PVEYLIQYRKGGPQYGS  410
               YL+QYR  G   GS
Sbjct  306  VDSYLVQYRPQGQYTGS  322



>ref|WP_044214941.1| 3-beta hydroxysteroid dehydrogenase [Candidatus Endolissoclinum 
faulkneri]
Length=319

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 69/128 (54%), Gaps = 10/128 (8%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V D+A A+IA+L +  ++ G+ YELGGP IY++  L E++          +K+PF ++  
Sbjct  191  VIDLAEAIIAAL-NTPAAYGQTYELGGPAIYSLRDLIEIILKETNRKVSLIKLPFWLSSL  249

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
             A+    LL+  P P+ T      D +E L  D VVS  A TF+DL I P  ++     Y
Sbjct  250  KAS----LLELAPNPILTR-----DQVELLKMDNVVSCGAKTFNDLFINPTPIEIIIPSY  300

Query  448  LIQYRKGG  425
            L +YR  G
Sbjct  301  LNKYRPSG  308



>ref|WP_028034557.1| 3-beta hydroxysteroid dehydrogenase [Chelativorans sp. J32]
Length=323

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 64/132 (48%), Gaps = 14/132 (11%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA  V A   D     G +YELGGP++ T  +  E M +VI     ++ VP+P+A+ 
Sbjct  195  VGDVAE-VYARSVDGTLKPGAIYELGGPQVLTFRECMEEMLEVIERKRAFISVPWPLAR-  252

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKGY  461
                   L  +V   LP P +  LD +  L  D VVS++A    LT + LGI  H L   
Sbjct  253  -------LQARVLGLLPNP-LLTLDQVRMLAVDNVVSEEASRRGLTLEGLGISRHALATI  304

Query  460  PVEYLIQYRKGG  425
               YL  YR  G
Sbjct  305  LPTYLWTYRPAG  316



>ref|WP_040174985.1| 3-beta hydroxysteroid dehydrogenase [Phaeobacter sp. S26]
 gb|KII13026.1| 3-beta hydroxysteroid dehydrogenase [Phaeobacter sp. S26]
Length=329

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 60/110 (55%), Gaps = 2/110 (2%)
 Frame = -1

Query  745  VYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIATPREVLLKKVPFPLPTPSI  566
            VYELGGPE+ +   L + M +VI      + +P PIAK +A   +V L+ V F L    +
Sbjct  208  VYELGGPEVKSFGALMQQMLEVIDRRRLVLSLPGPIAKLVALGFDV-LQFVSFQLIENKM  266

Query  565  FNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLIQYRKGGPQY  416
               D ++ L  D VVS+DA  F +LGI P  L     +YL ++R  G QY
Sbjct  267  LTRDQLKNLEADNVVSEDAKGFHELGIHPVSLASVLPDYLWKFRPSG-QY  315



>dbj|BAE57582.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EIT76769.1| NADH-ubiquinone oxidoreductase 39 kDa subunit, putative [Aspergillus 
oryzae 3.042]
 gb|KDE80269.1| NADH-ubiquinone oxidoreductase 39 kDa subunit, putative [Aspergillus 
oryzae 100-8]
Length=176

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 67/126 (53%), Gaps = 9/126 (7%)
 Frame = -1

Query  802  DVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKAIA  623
            DV +A+   L DD S+ G+ +EL GP+ Y+  ++AEL+   I +  R++ VP PI K +A
Sbjct  35   DVGNALERMLHDD-STAGQTFELYGPKEYSTAEIAELVDREIVKHRRHINVPKPILKPVA  93

Query  622  TPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEYLI  443
                 L K + +P+ +P     D +E    D V+  +A TF DLGI P  L      YL+
Sbjct  94   ---HYLNKLLWWPIISP-----DEVEREFIDQVIDPNAKTFKDLGIEPVDLATLTFHYLL  145

Query  442  QYRKGG  425
             YR   
Sbjct  146  GYRSAS  151



>ref|WP_019955460.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Loktanella vestfoldensis]
Length=326

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 65/131 (50%), Gaps = 5/131 (4%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA+A +  +   G   G +YELGGP++ T   L + M  V+R     V +PF  A+ 
Sbjct  189  VDDVAAAAVKGVL--GEVPGGIYELGGPDVATFRDLMQQMLAVVRRRRLIVNIPFWAARI  246

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
            +A    + L+ V   L TP +   D +  L  D VV   A  F DLGI P  L     +Y
Sbjct  247  MAGAFNI-LRIVSLGLVTPPV-TRDQVANLAVDNVVGDGAKGFADLGIKPTALMAVLPDY  304

Query  448  LIQYRKGGPQY  416
            L ++R  G QY
Sbjct  305  LWRFRPSG-QY  314



>gb|KJB42342.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=234

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = -1

Query  469  KGYPVEYLIQYRKGGPQYGSTVSERVSPESYP  374
            +GYPVEYLIQYRKGGPQ+GSTVSE+V+P+SYP
Sbjct  203  EGYPVEYLIQYRKGGPQFGSTVSEKVNPDSYP  234



>ref|WP_004617165.1| putative nucleoside-diphosphate sugar epimerase [Caulobacter 
vibrioides]
 gb|ENZ82704.1| putative nucleoside-diphosphate sugar epimerase [Caulobacter 
crescentus OR37]
Length=321

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 69/135 (51%), Gaps = 8/135 (6%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAEL-MYDVIREWPRYVKVPFPIAK  632
            V DVA AVIA    D +++G  YELGGP +YTM ++ EL + +  R+ P    VP+P+A 
Sbjct  189  VGDVA-AVIAKAVSDPAAVGVTYELGGPTVYTMREILELILTETGRKRP-LAPVPWPVAS  246

Query  631  AIATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVE  452
             I +  ++    +P   P       D +E L +D V         + G+ P  ++     
Sbjct  247  LIGSLGDIQASILPLAPP----LTTDQVEMLKSDNVAEAGLPGLAEAGVTPTAVEAVIPS  302

Query  451  YLIQYRKGGPQYGST  407
            YL +YRKGG QY  T
Sbjct  303  YLYRYRKGG-QYAPT  316



>ref|WP_037019716.1| 3-beta hydroxysteroid dehydrogenase [Rhizobiales bacterium YIM 
77505]
Length=369

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 70/133 (53%), Gaps = 8/133 (6%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA A+  ++  DGS     YELGGPEI ++ Q+ E +  V       + +P P+A+A
Sbjct  196  VGDVAEAIARAV--DGSVAPGTYELGGPEILSLRQIVEYVLKVTGRRRLILPLPPPVARA  253

Query  628  IATPREVL-LKKVPFPLPTPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKG  464
             A+  EVL L  + F LP   +   D +  L  D +VS +A     T + LGI P  L+ 
Sbjct  254  QASITEVLDLLTLGF-LPEEFVLTRDQVVQLERDNIVSAEARGSGRTLEGLGIRPTALEA  312

Query  463  YPVEYLIQYRKGG  425
                YL+++RK G
Sbjct  313  VAPSYLVRFRKTG  325



>gb|AHC74005.1| NADH dehydrogenase (Ubiquinone) 1 alpha subcomplex 9 [Candidatus 
Endolissoclinum faulkneri L5]
Length=335

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 69/128 (54%), Gaps = 10/128 (8%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V D+A A+IA+L +  ++ G+ YELGGP IY++  L E++          +K+PF ++  
Sbjct  207  VIDLAEAIIAAL-NTPAAYGQTYELGGPAIYSLRDLIEIILKETNRKVSLIKLPFWLSSL  265

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDALTFDDLGIVPHKLKGYPVEY  449
             A+    LL+  P P+ T      D +E L  D VVS  A TF+DL I P  ++     Y
Sbjct  266  KAS----LLELAPNPILTR-----DQVELLKMDNVVSCGAKTFNDLFINPTPIEIIIPSY  316

Query  448  LIQYRKGG  425
            L +YR  G
Sbjct  317  LNKYRPSG  324



>ref|WP_039195170.1| 3-beta hydroxysteroid dehydrogenase [Aureimonas altamirensis]
 gb|KHJ53663.1| 3-beta hydroxysteroid dehydrogenase [Aureimonas altamirensis]
Length=335

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 73/152 (48%), Gaps = 20/152 (13%)
 Frame = -1

Query  808  VTDVASAVIASLKDDGSSMGKVYELGGPEIYTMHQLAELMYDVIREWPRYVKVPFPIAKA  629
            V DVA AV  ++ D     G VYELGGPEI +   L E M  VI    R++ +PF  A+ 
Sbjct  193  VNDVAEAVAKTV-DGAVPGGCVYELGGPEILSFRALMEEMLLVIDRKRRFLDIPFGAAER  251

Query  628  IATPREVLLKKVPFPLPTPSIFNLDLIEALTTDTVVSKDA----LTFDDLGIVPHKLKGY  461
            +A     L+K +P      +    D ++ L  D VVS+ A     TF+  GI P  L+  
Sbjct  252  LAG----LMKYLP-----GAPLTHDQVQQLRQDNVVSQAAKAEGRTFEAFGIQPRTLEAV  302

Query  460  PVEYLIQYR------KGGPQYGSTVSERVSPE  383
               YL+++R      KG P    T+   ++P 
Sbjct  303  LPTYLVRFRPQGQFTKGSPTSDQTIDPEIAPR  334



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1620118203410