BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF010G02

Length=763
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACF05806.1|  PAE                                                     268   3e-84   Litchi chinensis [litchi]
emb|CDP15690.1|  unnamed protein product                                268   6e-84   Coffea canephora [robusta coffee]
ref|XP_010644665.1|  PREDICTED: uncharacterized protein LOC100245856    268   6e-84   Vitis vinifera
ref|XP_010056136.1|  PREDICTED: protein notum homolog                   268   6e-84   Eucalyptus grandis [rose gum]
ref|XP_010244169.1|  PREDICTED: protein notum homolog                   268   6e-84   Nelumbo nucifera [Indian lotus]
ref|XP_004244443.1|  PREDICTED: uncharacterized protein LOC101251798    266   2e-83   Solanum lycopersicum
ref|XP_006878664.1|  hypothetical protein AMTR_s00011p00266820          266   3e-83   Amborella trichopoda
ref|XP_011073252.1|  PREDICTED: protein notum homolog isoform X2        264   3e-82   Sesamum indicum [beniseed]
ref|XP_003628995.1|  Notum-like protein                                 262   9e-82   
gb|KEH20327.1|  pectinacetylesterase family protein                     262   9e-82   Medicago truncatula
ref|XP_011073171.1|  PREDICTED: protein notum homolog isoform X1        263   1e-81   
ref|XP_010244170.1|  PREDICTED: uncharacterized protein LOC104588061    261   2e-81   Nelumbo nucifera [Indian lotus]
gb|AET03471.2|  pectinacetylesterase family protein                     262   2e-81   Medicago truncatula
gb|KCW72720.1|  hypothetical protein EUGRSUZ_E01169                     261   4e-81   Eucalyptus grandis [rose gum]
gb|KDO40415.1|  hypothetical protein CISIN_1g013734mg                   255   4e-81   Citrus sinensis [apfelsine]
ref|XP_009627060.1|  PREDICTED: uncharacterized protein LOC104117690    260   7e-81   Nicotiana tomentosiformis
gb|KDO40411.1|  hypothetical protein CISIN_1g013734mg                   254   1e-80   Citrus sinensis [apfelsine]
ref|XP_009771151.1|  PREDICTED: uncharacterized protein LOC104221730    259   1e-80   Nicotiana sylvestris
gb|KCW72718.1|  hypothetical protein EUGRSUZ_E01169                     259   2e-80   Eucalyptus grandis [rose gum]
ref|XP_010056132.1|  PREDICTED: protein notum homolog isoform X3        260   2e-80   Eucalyptus grandis [rose gum]
ref|XP_010056131.1|  PREDICTED: protein notum homolog isoform X2        260   2e-80   Eucalyptus grandis [rose gum]
ref|XP_010056129.1|  PREDICTED: protein notum homolog isoform X1        260   2e-80   Eucalyptus grandis [rose gum]
gb|KDO40414.1|  hypothetical protein CISIN_1g013734mg                   256   2e-80   Citrus sinensis [apfelsine]
ref|XP_004172255.1|  PREDICTED: protein notum homolog                   259   2e-80   
ref|XP_011082149.1|  PREDICTED: protein notum homolog isoform X1        258   3e-80   
gb|KCW72723.1|  hypothetical protein EUGRSUZ_E01170                     258   3e-80   Eucalyptus grandis [rose gum]
ref|XP_011082152.1|  PREDICTED: protein notum homolog isoform X2        257   4e-80   
ref|XP_008451860.1|  PREDICTED: protein notum homolog isoform X1        257   1e-79   Cucumis melo [Oriental melon]
ref|XP_008451861.1|  PREDICTED: protein notum homolog isoform X2        257   1e-79   Cucumis melo [Oriental melon]
ref|XP_010111521.1|  hypothetical protein L484_021346                   256   1e-79   
gb|AAP72959.1|  pectin acetylesterase                                   256   2e-79   Lactuca sativa [cultivated lettuce]
ref|XP_006471634.1|  PREDICTED: uncharacterized protein LOC102628021    256   3e-79   Citrus sinensis [apfelsine]
gb|ACJ85294.1|  unknown                                                 255   4e-79   Medicago truncatula
ref|XP_004150551.1|  PREDICTED: protein notum homolog                   259   6e-79   
gb|EYU29131.1|  hypothetical protein MIMGU_mgv1a007782mg                254   9e-79   Erythranthe guttata [common monkey flower]
emb|CAA67728.1|  pectinacetylesterase precursor                         254   1e-78   Vigna radiata var. radiata [golden gram]
gb|KDO40410.1|  hypothetical protein CISIN_1g013734mg                   255   2e-78   Citrus sinensis [apfelsine]
ref|XP_009794297.1|  PREDICTED: protein notum homolog                   254   2e-78   Nicotiana sylvestris
ref|XP_004509522.1|  PREDICTED: uncharacterized protein LOC101493...    254   2e-78   Cicer arietinum [garbanzo]
ref|XP_010325633.1|  PREDICTED: uncharacterized protein LOC101257...    253   3e-78   Solanum lycopersicum
ref|XP_010325632.1|  PREDICTED: protein notum homolog isoform X1        253   4e-78   Solanum lycopersicum
ref|XP_010056135.1|  PREDICTED: protein notum homolog                   252   8e-78   Eucalyptus grandis [rose gum]
gb|KCW72721.1|  hypothetical protein EUGRSUZ_E01170                     252   1e-77   Eucalyptus grandis [rose gum]
ref|XP_010677538.1|  PREDICTED: protein notum homolog isoform X1        251   2e-77   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010677539.1|  PREDICTED: protein notum homolog isoform X2        251   2e-77   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU29130.1|  hypothetical protein MIMGU_mgv1a007782mg                251   3e-77   Erythranthe guttata [common monkey flower]
ref|XP_006363875.1|  PREDICTED: protein notum homolog                   250   4e-77   Solanum tuberosum [potatoes]
ref|XP_008808358.1|  PREDICTED: protein notum homolog                   250   5e-77   Phoenix dactylifera
gb|KCW72722.1|  hypothetical protein EUGRSUZ_E01170                     249   8e-77   Eucalyptus grandis [rose gum]
ref|XP_007209211.1|  hypothetical protein PRUPE_ppa006668mg             249   2e-76   Prunus persica
gb|AFK45147.1|  unknown                                                 248   3e-76   Lotus japonicus
ref|XP_004512351.1|  PREDICTED: protein notum homolog isoform X3        249   5e-76   Cicer arietinum [garbanzo]
ref|XP_008238012.1|  PREDICTED: protein notum homolog isoform X2        248   5e-76   Prunus mume [ume]
ref|XP_008238011.1|  PREDICTED: protein notum homolog isoform X1        248   6e-76   Prunus mume [ume]
ref|XP_009616254.1|  PREDICTED: protein notum homolog                   247   7e-76   Nicotiana tomentosiformis
ref|XP_007156330.1|  hypothetical protein PHAVU_003G277500g             247   8e-76   Phaseolus vulgaris [French bean]
ref|XP_004512349.1|  PREDICTED: protein notum homolog isoform X1        249   1e-75   
ref|XP_007156331.1|  hypothetical protein PHAVU_003G277500g             247   1e-75   Phaseolus vulgaris [French bean]
ref|XP_010942975.1|  PREDICTED: protein notum homolog isoform X1        246   1e-75   Elaeis guineensis
gb|KHN41567.1|  Protein notum like                                      246   1e-75   Glycine soja [wild soybean]
ref|XP_006361581.1|  PREDICTED: protein notum homolog                   244   6e-75   Solanum tuberosum [potatoes]
ref|XP_008373439.1|  PREDICTED: protein notum homolog isoform X2        246   7e-75   Malus domestica [apple tree]
ref|XP_006599203.1|  PREDICTED: uncharacterized protein LOC100781...    244   1e-74   Glycine max [soybeans]
ref|XP_010248193.1|  PREDICTED: uncharacterized protein LOC104591101    243   2e-74   
gb|EPS71696.1|  hypothetical protein M569_03061                         243   2e-74   Genlisea aurea
gb|ACR35075.1|  unknown                                                 239   2e-74   Zea mays [maize]
ref|XP_008373438.1|  PREDICTED: protein notum homolog isoform X1        245   2e-74   Malus domestica [apple tree]
ref|XP_010266384.1|  PREDICTED: uncharacterized protein LOC104603...    243   3e-74   Nelumbo nucifera [Indian lotus]
ref|XP_010266383.1|  PREDICTED: uncharacterized protein LOC104603...    243   5e-74   Nelumbo nucifera [Indian lotus]
ref|XP_010266381.1|  PREDICTED: uncharacterized protein LOC104603...    241   1e-73   Nelumbo nucifera [Indian lotus]
ref|XP_006587657.1|  PREDICTED: protein notum homolog isoform X3        241   2e-73   
ref|XP_010266380.1|  PREDICTED: uncharacterized protein LOC104603...    241   2e-73   
ref|XP_006587656.1|  PREDICTED: protein notum homolog isoform X2        241   5e-73   Glycine max [soybeans]
ref|XP_006587655.1|  PREDICTED: protein notum homolog isoform X1        241   5e-73   Glycine max [soybeans]
ref|NP_001151183.1|  LOC100284816 precursor                             239   8e-73   Zea mays [maize]
gb|ACG39759.1|  carboxylic ester hydrolase                              239   9e-73   Zea mays [maize]
ref|XP_006573492.1|  PREDICTED: protein notum homolog isoform X2        238   2e-72   
gb|EYU37455.1|  hypothetical protein MIMGU_mgv1a007934mg                238   2e-72   Erythranthe guttata [common monkey flower]
ref|XP_006573491.1|  PREDICTED: protein notum homolog isoform X1        239   3e-72   Glycine max [soybeans]
gb|KHN41756.1|  Protein notum like                                      239   3e-72   Glycine soja [wild soybean]
ref|XP_007158098.1|  hypothetical protein PHAVU_002G123900g             237   5e-72   Phaseolus vulgaris [French bean]
gb|KHG23648.1|  Notum                                                   236   2e-71   Gossypium arboreum [tree cotton]
gb|KHG23649.1|  Notum                                                   235   2e-71   Gossypium arboreum [tree cotton]
ref|XP_007040902.1|  Pectinacetylesterase family protein                234   5e-71   
gb|KJB24941.1|  hypothetical protein B456_004G175900                    234   8e-71   Gossypium raimondii
gb|AGT16732.1|  carboxylic ester hydrolase                              233   3e-70   Saccharum hybrid cultivar R570
ref|XP_004300391.1|  PREDICTED: pectin acetylesterase 8-like            232   6e-70   Fragaria vesca subsp. vesca
ref|XP_004953590.1|  PREDICTED: protein notum homolog isoform X1        231   9e-70   Setaria italica
ref|NP_001047850.1|  Os02g0702400                                       231   1e-69   
ref|XP_007209217.1|  hypothetical protein PRUPE_ppa006718mg             231   1e-69   Prunus persica
ref|XP_006647750.1|  PREDICTED: uncharacterized protein LOC102707556    228   2e-69   
ref|XP_002519911.1|  pectin acetylesterase, putative                    230   3e-69   
ref|XP_009413211.1|  PREDICTED: protein notum homolog                   229   4e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002454426.1|  hypothetical protein SORBIDRAFT_04g030720          229   5e-69   Sorghum bicolor [broomcorn]
gb|EYU29129.1|  hypothetical protein MIMGU_mgv1a023759mg                227   3e-68   Erythranthe guttata [common monkey flower]
ref|XP_010054028.1|  PREDICTED: uncharacterized protein LOC104442...    227   5e-68   Eucalyptus grandis [rose gum]
dbj|BAD94548.1|  pectinacetylesterase like protein                      219   9e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009350399.1|  PREDICTED: protein notum homolog                   226   9e-68   Pyrus x bretschneideri [bai li]
ref|XP_008355284.1|  PREDICTED: uncharacterized protein LOC103418943    226   9e-68   
ref|XP_010054026.1|  PREDICTED: uncharacterized protein LOC104442...    227   9e-68   Eucalyptus grandis [rose gum]
ref|XP_009398466.1|  PREDICTED: protein notum homolog                   226   9e-68   
ref|XP_008808370.1|  PREDICTED: uncharacterized protein LOC103720...    225   2e-67   
dbj|BAH57249.1|  AT4G19420                                              220   2e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006385135.1|  hypothetical protein POPTR_0004s24220g             224   3e-67   
ref|XP_006494119.1|  PREDICTED: protein notum homolog isoform X1        224   5e-67   
ref|XP_006282674.1|  hypothetical protein CARUB_v10005284mg             222   5e-67   
ref|XP_010676220.1|  PREDICTED: uncharacterized protein LOC104892094    225   5e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003547731.1|  PREDICTED: protein notum homolog isoform X1        224   5e-67   Glycine max [soybeans]
ref|XP_003628996.1|  Carboxylic ester hydrolase                         224   7e-67   Medicago truncatula
ref|XP_008372432.1|  PREDICTED: uncharacterized protein LOC103435796    216   7e-67   
gb|KHN27509.1|  Protein notum like                                      224   7e-67   Glycine soja [wild soybean]
emb|CDY09288.1|  BnaC03g63180D                                          217   7e-67   Brassica napus [oilseed rape]
dbj|BAH20235.1|  AT4G19420                                              221   1e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011028483.1|  PREDICTED: uncharacterized protein LOC105128...    224   2e-66   Populus euphratica
ref|XP_008378614.1|  PREDICTED: uncharacterized protein LOC103441693    223   2e-66   
ref|XP_006432880.1|  hypothetical protein CICLE_v10001467mg             222   2e-66   Citrus clementina [clementine]
ref|XP_006385137.1|  hypothetical protein POPTR_0004s24220g             223   2e-66   
ref|XP_006385138.1|  hypothetical protein POPTR_0004s24220g             223   2e-66   
gb|KDO40409.1|  hypothetical protein CISIN_1g016608mg                   222   2e-66   Citrus sinensis [apfelsine]
ref|XP_008246070.1|  PREDICTED: uncharacterized protein LOC103344226    214   3e-66   Prunus mume [ume]
ref|XP_006385134.1|  hypothetical protein POPTR_0004s24220g             223   3e-66   
ref|XP_010439718.1|  PREDICTED: protein notum homolog                   222   4e-66   Camelina sativa [gold-of-pleasure]
ref|XP_011028482.1|  PREDICTED: uncharacterized protein LOC105128...    224   5e-66   Populus euphratica
ref|XP_007156332.1|  hypothetical protein PHAVU_003G277600g             222   5e-66   Phaseolus vulgaris [French bean]
ref|XP_011028479.1|  PREDICTED: uncharacterized protein LOC105128...    224   5e-66   Populus euphratica
ref|XP_010434420.1|  PREDICTED: protein notum homolog                   221   6e-66   Camelina sativa [gold-of-pleasure]
gb|AFK37852.1|  unknown                                                 221   6e-66   Lotus japonicus
ref|XP_002867938.1|  pectinacetylesterase family protein                221   8e-66   
ref|XP_010449357.1|  PREDICTED: protein notum homolog                   221   1e-65   Camelina sativa [gold-of-pleasure]
ref|XP_009108427.1|  PREDICTED: protein notum homolog                   221   1e-65   Brassica rapa
ref|NP_974575.2|  putative pectinacetylesterase                         220   1e-65   
ref|NP_193677.2|  putative pectinacetylesterase                         221   1e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010235852.1|  PREDICTED: protein notum homolog isoform X2        219   1e-65   Brachypodium distachyon [annual false brome]
emb|CDY67801.1|  BnaAnng25210D                                          220   1e-65   Brassica napus [oilseed rape]
ref|XP_004300392.1|  PREDICTED: pectin acetylesterase 8-like            220   2e-65   Fragaria vesca subsp. vesca
ref|XP_006413980.1|  hypothetical protein EUTSA_v10025385mg             220   2e-65   
ref|XP_010529277.1|  PREDICTED: protein notum homolog                   220   2e-65   Tarenaya hassleriana [spider flower]
emb|CDY09289.1|  BnaC03g63190D                                          220   2e-65   Brassica napus [oilseed rape]
ref|XP_006432881.1|  hypothetical protein CICLE_v10001426mg             219   3e-65   Citrus clementina [clementine]
ref|XP_010235850.1|  PREDICTED: protein notum homolog isoform X1        219   4e-65   Brachypodium distachyon [annual false brome]
ref|XP_010536220.1|  PREDICTED: protein notum homolog isoform X1        219   6e-65   Tarenaya hassleriana [spider flower]
gb|ABK24433.1|  unknown                                                 218   8e-65   Picea sitchensis
gb|ABK24994.1|  unknown                                                 218   1e-64   Picea sitchensis
ref|XP_010536228.1|  PREDICTED: protein notum homolog isoform X2        218   1e-64   Tarenaya hassleriana [spider flower]
ref|XP_009132797.1|  PREDICTED: protein notum homolog                   218   1e-64   Brassica rapa
ref|XP_003547822.1|  PREDICTED: protein notum homolog                   218   1e-64   Glycine max [soybeans]
emb|CDX78933.1|  BnaA01g10000D                                          219   2e-64   
emb|CDX99377.1|  BnaC01g11750D                                          219   2e-64   
ref|XP_008347803.1|  PREDICTED: uncharacterized protein LOC103410929    216   5e-64   
ref|XP_004509558.1|  PREDICTED: protein notum homolog                   215   2e-63   Cicer arietinum [garbanzo]
gb|KHN27511.1|  Protein notum like                                      215   2e-63   Glycine soja [wild soybean]
ref|XP_008808367.1|  PREDICTED: uncharacterized protein LOC103720...    214   3e-63   
ref|XP_008808368.1|  PREDICTED: uncharacterized protein LOC103720...    214   3e-63   
ref|XP_003548585.1|  PREDICTED: protein notum homolog                   213   7e-63   
ref|XP_003547821.1|  PREDICTED: protein notum homolog                   212   3e-62   Glycine max [soybeans]
gb|KDP28068.1|  hypothetical protein JCGZ_19476                         211   4e-62   Jatropha curcas
ref|XP_010325631.1|  PREDICTED: protein notum homolog isoform X2        207   2e-61   Solanum lycopersicum
ref|XP_002519912.1|  pectin acetylesterase, putative                    211   2e-61   
gb|KDO56390.1|  hypothetical protein CISIN_1g026241mg                   204   3e-61   Citrus sinensis [apfelsine]
ref|XP_010325630.1|  PREDICTED: protein notum homolog isoform X1        206   4e-61   
ref|XP_010942974.1|  PREDICTED: protein notum homolog                   206   4e-60   Elaeis guineensis
gb|KCW72726.1|  hypothetical protein EUGRSUZ_E01170                     205   6e-60   Eucalyptus grandis [rose gum]
ref|XP_008797988.1|  PREDICTED: protein notum homolog isoform X2        203   1e-59   
ref|XP_007040900.1|  Pectinacetylesterase family protein                205   1e-59   
gb|EYU35369.1|  hypothetical protein MIMGU_mgv1a0197532mg               197   1e-59   Erythranthe guttata [common monkey flower]
ref|XP_009397056.1|  PREDICTED: protein notum homolog                   205   1e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006423959.1|  hypothetical protein CICLE_v10028674mg             202   2e-59   
gb|KHN13972.1|  hypothetical protein glysoja_043167                     202   3e-59   Glycine soja [wild soybean]
gb|KDP28067.1|  hypothetical protein JCGZ_19475                         204   4e-59   Jatropha curcas
ref|XP_008797987.1|  PREDICTED: protein notum homolog isoform X1        203   5e-59   Phoenix dactylifera
ref|XP_006359968.1|  PREDICTED: protein notum homolog                   202   6e-59   
gb|KDP28066.1|  hypothetical protein JCGZ_19474                         203   8e-59   Jatropha curcas
ref|XP_003613922.1|  Notum-like protein                                 202   1e-58   Medicago truncatula
ref|XP_006423958.1|  hypothetical protein CICLE_v10028674mg             202   1e-58   
ref|XP_006432879.1|  hypothetical protein CICLE_v100013711mg            194   1e-58   
ref|XP_006480336.1|  PREDICTED: protein notum homolog                   202   2e-58   Citrus sinensis [apfelsine]
ref|XP_006652763.1|  PREDICTED: protein notum homolog                   201   3e-58   
ref|XP_008246334.1|  PREDICTED: protein notum homolog isoform X2        202   3e-58   Prunus mume [ume]
ref|XP_003555771.1|  PREDICTED: uncharacterized protein LOC100793403    202   3e-58   Glycine max [soybeans]
gb|KDO40412.1|  hypothetical protein CISIN_1g013734mg                   200   5e-58   Citrus sinensis [apfelsine]
ref|XP_009592441.1|  PREDICTED: uncharacterized protein LOC104089292    201   5e-58   Nicotiana tomentosiformis
gb|KHG09455.1|  Protein notum                                           201   5e-58   Gossypium arboreum [tree cotton]
ref|XP_009610135.1|  PREDICTED: protein notum homolog                   201   5e-58   Nicotiana tomentosiformis
ref|XP_010327278.1|  PREDICTED: uncharacterized protein LOC101257...    196   5e-58   
ref|XP_010911666.1|  PREDICTED: protein notum homolog                   200   7e-58   Elaeis guineensis
ref|XP_007031285.1|  Pectinacetylesterase family protein                201   9e-58   
ref|XP_009797415.1|  PREDICTED: uncharacterized protein LOC104243851    199   1e-57   Nicotiana sylvestris
gb|AFK35535.1|  unknown                                                 200   2e-57   Lotus japonicus
ref|NP_974837.1|  pectinacetylesterase family protein                   196   2e-57   Arabidopsis thaliana [mouse-ear cress]
gb|KJB25081.1|  hypothetical protein B456_004G176200                    197   2e-57   Gossypium raimondii
emb|CDP15161.1|  unnamed protein product                                198   2e-57   Coffea canephora [robusta coffee]
emb|CDX80575.1|  BnaC07g28690D                                          199   3e-57   
ref|XP_009151150.1|  PREDICTED: protein notum homolog                   199   3e-57   Brassica rapa
ref|XP_003536006.1|  PREDICTED: uncharacterized protein LOC100810716    199   3e-57   Glycine max [soybeans]
emb|CBI37039.3|  unnamed protein product                                197   3e-57   Vitis vinifera
ref|XP_011012520.1|  PREDICTED: protein notum homolog                   198   4e-57   Populus euphratica
ref|XP_010649713.1|  PREDICTED: uncharacterized protein LOC100251...    195   6e-57   Vitis vinifera
gb|ACA61623.1|  hypothetical protein AP8_E07.1                          194   6e-57   Arabidopsis lyrata subsp. petraea
gb|KJB25075.1|  hypothetical protein B456_004G176200                    198   6e-57   Gossypium raimondii
ref|XP_009779872.1|  PREDICTED: protein notum homolog                   199   6e-57   Nicotiana sylvestris
gb|KJB81153.1|  hypothetical protein B456_013G131600                    198   7e-57   Gossypium raimondii
ref|XP_002318919.2|  hypothetical protein POPTR_0013s00280g             198   8e-57   
gb|EMT14315.1|  hypothetical protein F775_08483                         197   1e-56   
ref|XP_002280816.3|  PREDICTED: protein notum homolog                   197   1e-56   Vitis vinifera
emb|CAD41867.2|  OSJNBa0041A02.14                                       197   1e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008365263.1|  PREDICTED: protein notum homolog                   194   2e-56   
gb|KJB25078.1|  hypothetical protein B456_004G176200                    198   2e-56   Gossypium raimondii
gb|KHG26188.1|  Protein notum                                           197   2e-56   Gossypium arboreum [tree cotton]
ref|XP_011023896.1|  PREDICTED: protein notum homolog                   197   2e-56   Populus euphratica
ref|NP_850878.2|  pectinacetylesterase family protein                   197   2e-56   Arabidopsis thaliana [mouse-ear cress]
emb|CBI39680.3|  unnamed protein product                                196   2e-56   Vitis vinifera
ref|XP_009129612.1|  PREDICTED: protein notum homolog                   197   2e-56   Brassica rapa
ref|XP_010524828.1|  PREDICTED: protein notum homolog                   197   2e-56   Tarenaya hassleriana [spider flower]
ref|XP_004248530.1|  PREDICTED: protein notum homolog isoform X2        197   2e-56   Solanum lycopersicum
emb|CBI26039.3|  unnamed protein product                                196   2e-56   Vitis vinifera
dbj|BAH19826.1|  AT5G26670                                              197   3e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010327277.1|  PREDICTED: protein notum homolog isoform X1        197   3e-56   Solanum lycopersicum
gb|ABG34280.1|  pectin acetylesterase                                   195   3e-56   Eucalyptus globulus subsp. globulus
gb|ABK26312.1|  unknown                                                 197   3e-56   Picea sitchensis
ref|NP_001053773.1|  Os04g0602500                                       198   3e-56   
gb|KJB82697.1|  hypothetical protein B456_013G211000                    196   4e-56   Gossypium raimondii
emb|CDY27732.1|  BnaA05g31410D                                          196   4e-56   Brassica napus [oilseed rape]
gb|KJB82696.1|  hypothetical protein B456_013G211000                    195   5e-56   Gossypium raimondii
ref|XP_009111712.1|  PREDICTED: protein notum homolog                   196   5e-56   Brassica rapa
ref|NP_566263.1|  pectinacetylesterase family protein                   196   5e-56   Arabidopsis thaliana [mouse-ear cress]
emb|CDY19761.1|  BnaA09g04140D                                          196   5e-56   Brassica napus [oilseed rape]
emb|CDY05211.1|  BnaC05g45920D                                          196   6e-56   
gb|EPS60657.1|  hypothetical protein M569_14145                         190   7e-56   Genlisea aurea
ref|XP_008363955.1|  PREDICTED: protein notum homolog                   196   7e-56   
ref|XP_009366012.1|  PREDICTED: protein notum homolog                   196   7e-56   
ref|XP_002279030.1|  PREDICTED: protein notum homolog                   196   7e-56   Vitis vinifera
gb|KJB82695.1|  hypothetical protein B456_013G211000                    196   7e-56   Gossypium raimondii
emb|CAN62190.1|  hypothetical protein VITISV_020113                     196   7e-56   Vitis vinifera
gb|KCW58690.1|  hypothetical protein EUGRSUZ_H01338                     194   1e-55   Eucalyptus grandis [rose gum]
gb|KJB81156.1|  hypothetical protein B456_013G131600                    195   1e-55   Gossypium raimondii
ref|XP_002884540.1|  hypothetical protein ARALYDRAFT_477888             195   1e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_010433795.1|  PREDICTED: protein notum homolog                   194   1e-55   
ref|XP_010240825.1|  PREDICTED: protein notum homolog                   195   1e-55   Nelumbo nucifera [Indian lotus]
gb|KDO86757.1|  hypothetical protein CISIN_1g014548mg                   191   1e-55   Citrus sinensis [apfelsine]
ref|XP_003580427.1|  PREDICTED: uncharacterized protein LOC100827...    194   1e-55   Brachypodium distachyon [annual false brome]
gb|EEC77932.1|  hypothetical protein OsI_17271                          197   1e-55   Oryza sativa Indica Group [Indian rice]
ref|XP_002275616.1|  PREDICTED: protein notum homolog isoform X1        195   1e-55   Vitis vinifera
ref|XP_009353455.1|  PREDICTED: protein notum homolog                   195   2e-55   
ref|XP_002303225.2|  pectinacetylesterase family protein                194   2e-55   
gb|KFK26428.1|  hypothetical protein AALP_AA8G247000                    194   2e-55   Arabis alpina [alpine rockcress]
gb|AGT17273.1|  hypothetical protein SHCRBa_020_L15_F_100               194   2e-55   Saccharum hybrid cultivar R570
ref|XP_010240371.1|  PREDICTED: uncharacterized protein LOC100827...    194   2e-55   
ref|XP_010070108.1|  PREDICTED: protein notum homolog                   195   2e-55   Eucalyptus grandis [rose gum]
ref|XP_002872227.1|  hypothetical protein ARALYDRAFT_489494             194   2e-55   
ref|XP_010464149.1|  PREDICTED: protein notum homolog                   194   2e-55   Camelina sativa [gold-of-pleasure]
emb|CDY49986.1|  BnaC03g34430D                                          201   2e-55   Brassica napus [oilseed rape]
ref|XP_003591264.1|  Pectin acetylesterase                              194   3e-55   
ref|XP_006338905.1|  PREDICTED: protein notum homolog isoform X2        192   3e-55   Solanum tuberosum [potatoes]
ref|XP_007145058.1|  hypothetical protein PHAVU_007G206300g             194   3e-55   Phaseolus vulgaris [French bean]
ref|XP_008807933.1|  PREDICTED: protein notum homolog                   193   4e-55   Phoenix dactylifera
gb|ABR16604.1|  unknown                                                 194   5e-55   Picea sitchensis
gb|AFK38038.1|  unknown                                                 194   5e-55   Medicago truncatula
ref|XP_011039059.1|  PREDICTED: uncharacterized protein LOC105135...    190   5e-55   Populus euphratica
ref|XP_009116880.1|  PREDICTED: protein notum homolog                   193   5e-55   Brassica rapa
gb|KHN14201.1|  Protein notum like                                      194   5e-55   Glycine soja [wild soybean]
ref|XP_003521640.1|  PREDICTED: protein notum homolog                   194   5e-55   Glycine max [soybeans]
ref|XP_006408013.1|  hypothetical protein EUTSA_v10020818mg             193   5e-55   Eutrema salsugineum [saltwater cress]
ref|XP_010489689.1|  PREDICTED: protein notum homolog                   193   5e-55   
ref|XP_010546781.1|  PREDICTED: protein notum homolog                   193   6e-55   Tarenaya hassleriana [spider flower]
emb|CDY11398.1|  BnaA09g39640D                                          193   6e-55   Brassica napus [oilseed rape]
ref|XP_010914803.1|  PREDICTED: protein notum homolog isoform X1        192   6e-55   Elaeis guineensis
ref|XP_006604777.1|  PREDICTED: protein notum homolog isoform X2        190   7e-55   
ref|XP_003626125.1|  Notum-like protein                                 193   8e-55   Medicago truncatula
ref|XP_011028476.1|  PREDICTED: protein notum homolog                   192   8e-55   Populus euphratica
gb|KFK38001.1|  hypothetical protein AALP_AA3G057300                    193   8e-55   Arabis alpina [alpine rockcress]
ref|XP_004494501.1|  PREDICTED: uncharacterized protein LOC101497...    193   8e-55   Cicer arietinum [garbanzo]
ref|XP_010042504.1|  PREDICTED: protein notum homolog isoform X2        189   8e-55   
ref|XP_010942979.1|  PREDICTED: uncharacterized protein LOC105060...    191   9e-55   Elaeis guineensis
ref|XP_006297778.1|  hypothetical protein CARUB_v10013814mg             192   1e-54   Capsella rubella
ref|XP_010914810.1|  PREDICTED: protein notum homolog isoform X4        189   1e-54   
emb|CDX74124.1|  BnaA03g29230D                                          192   1e-54   
ref|XP_009134857.1|  PREDICTED: protein notum homolog                   192   1e-54   Brassica rapa
ref|XP_006394896.1|  hypothetical protein EUTSA_v10004301mg             192   1e-54   Eutrema salsugineum [saltwater cress]
ref|XP_007222071.1|  hypothetical protein PRUPE_ppa007506mg             191   1e-54   
ref|XP_008800308.1|  PREDICTED: protein notum homolog isoform X1        192   1e-54   
ref|XP_010942978.1|  PREDICTED: uncharacterized protein LOC105060...    191   1e-54   
gb|KCW85006.1|  hypothetical protein EUGRSUZ_B01828                     189   2e-54   
ref|XP_006286504.1|  hypothetical protein CARUB_v10001019mg             192   2e-54   
ref|XP_006338904.1|  PREDICTED: protein notum homolog isoform X1        192   2e-54   
gb|EEE61621.1|  hypothetical protein OsJ_16047                          196   2e-54   
ref|XP_006444639.1|  hypothetical protein CICLE_v10020385mg             191   2e-54   
ref|XP_006358515.1|  PREDICTED: protein notum homolog                   192   2e-54   
ref|XP_004230372.1|  PREDICTED: protein notum homolog                   191   3e-54   
ref|XP_010914805.1|  PREDICTED: protein notum homolog                   191   4e-54   
dbj|BAJ97261.1|  predicted protein                                      190   5e-54   
gb|KEH43169.1|  pectinacetylesterase family protein                     187   6e-54   
ref|XP_009359821.1|  PREDICTED: protein notum homolog                   191   6e-54   
gb|KHG13045.1|  Protein notum                                           192   6e-54   
ref|XP_004135578.1|  PREDICTED: protein notum homolog                   191   6e-54   
ref|XP_008450496.1|  PREDICTED: protein notum homolog                   191   7e-54   
ref|XP_010536197.1|  PREDICTED: protein notum homolog isoform X2        188   7e-54   
gb|KDP23324.1|  hypothetical protein JCGZ_23157                         190   7e-54   
emb|CDX87039.1|  BnaC09g03540D                                          190   7e-54   
ref|XP_011092213.1|  PREDICTED: protein notum homolog                   191   7e-54   
gb|AAC13595.1|  similar to Vigna radiata pectinacetylesterase pre...    191   7e-54   
gb|ADR82372.1|  pectin acetylesterase                                   190   7e-54   
ref|XP_006604776.1|  PREDICTED: protein notum homolog isoform X1        190   8e-54   
ref|XP_006492439.1|  PREDICTED: protein notum homolog                   191   8e-54   
ref|XP_011039058.1|  PREDICTED: protein notum homolog isoform X1        190   8e-54   
ref|XP_006382250.1|  hypothetical protein POPTR_0005s00330g             190   8e-54   
ref|XP_006385133.1|  pectinacetylesterase family protein                189   9e-54   
ref|XP_008369575.1|  PREDICTED: protein notum homolog isoform X2        190   9e-54   
ref|XP_007163281.1|  hypothetical protein PHAVU_001G221400g             190   1e-53   
ref|XP_010421519.1|  PREDICTED: protein notum homolog                   190   1e-53   
ref|XP_010544127.1|  PREDICTED: protein notum homolog isoform X2        190   1e-53   
ref|XP_010544126.1|  PREDICTED: protein notum homolog isoform X1        190   1e-53   
ref|XP_009600844.1|  PREDICTED: protein notum homolog                   190   1e-53   
ref|XP_010455015.1|  PREDICTED: protein notum homolog                   190   1e-53   
ref|XP_010493919.1|  PREDICTED: protein notum homolog                   190   1e-53   
ref|XP_008369574.1|  PREDICTED: protein notum homolog isoform X1        190   2e-53   
ref|NP_001146615.1|  hypothetical protein                               186   2e-53   
ref|XP_009805042.1|  PREDICTED: protein notum homolog                   189   2e-53   
ref|XP_002447050.1|  hypothetical protein SORBIDRAFT_06g027560          188   2e-53   
ref|XP_010914807.1|  PREDICTED: protein notum homolog isoform X1        189   2e-53   
ref|XP_002280865.3|  PREDICTED: protein notum homolog                   189   2e-53   
ref|XP_010042497.1|  PREDICTED: protein notum homolog isoform X1        189   2e-53   
ref|XP_010413312.1|  PREDICTED: protein notum homolog                   187   3e-53   
ref|XP_008360208.1|  PREDICTED: protein notum homolog isoform X3        189   3e-53   
ref|XP_008222318.1|  PREDICTED: protein notum homolog                   189   3e-53   
ref|XP_010536189.1|  PREDICTED: uncharacterized protein LOC104811...    188   3e-53   
ref|XP_011039993.1|  PREDICTED: uncharacterized protein LOC105136378    189   5e-53   
dbj|BAF46305.1|  pectinacetylesterase family protein                    185   6e-53   
ref|XP_009405450.1|  PREDICTED: protein notum homolog                   185   6e-53   
ref|XP_010327577.1|  PREDICTED: uncharacterized protein LOC101244626    187   6e-53   
ref|XP_007051327.1|  Pectinacetylesterase family protein                189   6e-53   
ref|XP_004296984.1|  PREDICTED: pectin acetylesterase 10-like           188   7e-53   
ref|XP_010674458.1|  PREDICTED: protein notum homolog                   186   7e-53   
ref|XP_008807934.1|  PREDICTED: protein notum homolog                   184   7e-53   
gb|KJB41749.1|  hypothetical protein B456_007G118400                    187   8e-53   
ref|XP_002320250.2|  hypothetical protein POPTR_0014s10650g             189   8e-53   
emb|CAA18628.1|  putative pectinacetylesterase protein                  186   8e-53   
gb|KEH43170.1|  pectinacetylesterase family protein                     187   9e-53   
gb|ABG34283.1|  pectin acetylesterase                                   186   9e-53   
ref|XP_010506714.1|  PREDICTED: protein notum homolog isoform X2        185   1e-52   
ref|NP_567585.1|  pectinacetylesterase family protein                   186   1e-52   
ref|XP_009388128.1|  PREDICTED: protein notum homolog                   186   1e-52   
ref|XP_002867940.1|  hypothetical protein ARALYDRAFT_492921             186   2e-52   
ref|XP_011087573.1|  PREDICTED: protein notum homolog isoform X2        185   2e-52   
ref|XP_008667853.1|  PREDICTED: hypothetical protein isoform X1         186   2e-52   
ref|NP_191765.2|  pectinacetylesterase family protein                   187   2e-52   
gb|EYU19372.1|  hypothetical protein MIMGU_mgv1a006907mg                185   2e-52   
emb|CDX76613.1|  BnaC08g31990D                                          186   2e-52   
emb|CAB71866.1|  pectinacetylesterase precursor-like protein            187   2e-52   
gb|KJB41748.1|  hypothetical protein B456_007G118400                    187   2e-52   
dbj|BAK07864.1|  predicted protein                                      180   2e-52   
ref|XP_010507953.1|  PREDICTED: protein notum homolog                   186   2e-52   
ref|XP_006293476.1|  hypothetical protein CARUB_v10023292mg             186   2e-52   
emb|CBI37040.3|  unnamed protein product                                188   3e-52   
ref|XP_010518382.1|  PREDICTED: protein notum homolog isoform X1        186   3e-52   
ref|XP_006840405.1|  hypothetical protein AMTR_s00045p00148030          186   4e-52   
ref|XP_004495849.1|  PREDICTED: protein notum homolog isoform X1        186   5e-52   
ref|XP_010506713.1|  PREDICTED: protein notum homolog isoform X1        186   5e-52   
ref|XP_011087572.1|  PREDICTED: protein notum homolog isoform X1        186   5e-52   
gb|KDP28360.1|  hypothetical protein JCGZ_14131                         186   6e-52   
ref|XP_010045528.1|  PREDICTED: protein notum homolog                   185   7e-52   
ref|XP_006291204.1|  hypothetical protein CARUB_v10017332mg             185   7e-52   
gb|EYU19373.1|  hypothetical protein MIMGU_mgv1a006907mg                185   8e-52   
ref|XP_002876658.1|  pectinacetylesterase family protein                185   8e-52   
ref|XP_007163258.1|  hypothetical protein PHAVU_001G219200g             184   9e-52   
ref|XP_009138739.1|  PREDICTED: protein notum homolog isoform X2        184   1e-51   
ref|XP_002515160.1|  pectin acetylesterase, putative                    184   2e-51   
ref|XP_010468989.1|  PREDICTED: protein notum homolog                   185   2e-51   
ref|XP_010512591.1|  PREDICTED: protein notum homolog                   185   2e-51   
ref|XP_007163257.1|  hypothetical protein PHAVU_001G219200g             185   2e-51   
gb|AFK42918.1|  unknown                                                 184   2e-51   
ref|XP_008381630.1|  PREDICTED: uncharacterized protein LOC103444483    185   2e-51   
ref|XP_010544918.1|  PREDICTED: protein notum homolog isoform X2        184   2e-51   
tpg|DAA36176.1|  TPA: pectinacetylesterase                              186   2e-51   
ref|XP_006604768.1|  PREDICTED: protein notum homolog isoform X2        183   4e-51   
ref|XP_009108426.1|  PREDICTED: protein notum homolog                   182   4e-51   
ref|XP_010544917.1|  PREDICTED: protein notum homolog isoform X1        184   4e-51   
ref|XP_010439720.1|  PREDICTED: uncharacterized protein LOC104723107    182   6e-51   
ref|XP_003626089.1|  Pectin acetylesterase                              182   6e-51   
ref|NP_182216.1|  pectinacetylesterase-like protein                     182   6e-51   
ref|XP_010434424.1|  PREDICTED: uncharacterized protein LOC104718...    182   7e-51   
dbj|BAJ92718.1|  predicted protein                                      177   7e-51   
ref|XP_002512590.1|  pectin acetylesterase, putative                    182   9e-51   
ref|XP_006397884.1|  hypothetical protein EUTSA_v10001449mg             183   1e-50   
ref|XP_003554582.1|  PREDICTED: protein notum homolog isoform X1        183   1e-50   
gb|KHN43400.1|  Protein notum like                                      183   1e-50   
ref|XP_009113357.1|  PREDICTED: protein notum homolog                   182   1e-50   
ref|XP_010449359.1|  PREDICTED: uncharacterized protein LOC104731629    181   1e-50   
emb|CDX93989.1|  BnaC04g21480D                                          182   1e-50   
emb|CDY58759.1|  BnaA04g27440D                                          183   1e-50   
ref|XP_010434425.1|  PREDICTED: uncharacterized protein LOC104718...    181   1e-50   
ref|XP_009138738.1|  PREDICTED: protein notum homolog isoform X1        183   1e-50   
ref|XP_010914808.1|  PREDICTED: uncharacterized protein LOC105040...    181   1e-50   
ref|XP_006402417.1|  hypothetical protein EUTSA_v10005997mg             182   1e-50   
emb|CDX99378.1|  BnaC01g11740D                                          181   1e-50   
ref|XP_006283887.1|  hypothetical protein CARUB_v10005004mg             181   1e-50   
ref|XP_004302322.1|  PREDICTED: pectin acetylesterase 12-like           182   2e-50   
ref|XP_003626088.1|  Pectin acetylesterase                              182   2e-50   
ref|XP_009132784.1|  PREDICTED: uncharacterized protein LOC103857370    181   2e-50   
gb|ABG34282.1|  pectin acetylesterase                                   176   2e-50   
ref|XP_009363058.1|  PREDICTED: LOW QUALITY PROTEIN: protein notu...    182   2e-50   
ref|XP_008227765.1|  PREDICTED: protein notum homolog isoform X2        181   3e-50   
ref|XP_003551008.1|  PREDICTED: protein notum homolog                   181   3e-50   
emb|CDY09287.1|  BnaC03g63170D                                          180   4e-50   
ref|XP_009344788.1|  PREDICTED: protein notum homolog                   182   4e-50   
ref|XP_002880274.1|  hypothetical protein ARALYDRAFT_483863             181   4e-50   
ref|XP_007145083.1|  hypothetical protein PHAVU_007G208200g             181   4e-50   
ref|XP_004494487.1|  PREDICTED: protein notum homolog isoform X3        181   4e-50   
tpg|DAA63795.1|  TPA: hypothetical protein ZEAMMB73_008026              175   6e-50   
emb|CDX78932.1|  BnaA01g09990D                                          179   6e-50   
ref|XP_008360206.1|  PREDICTED: protein notum homolog isoform X1        181   6e-50   
gb|KHG30410.1|  Protein notum                                           180   6e-50   
gb|AAG50747.1|AC079733_15  pectinacetylesterase precursor, putative     180   7e-50   
ref|XP_003521625.1|  PREDICTED: protein notum homolog isoformX1         180   7e-50   
ref|XP_004494486.1|  PREDICTED: protein notum homolog isoform X2        181   7e-50   
emb|CDY66251.1|  BnaC04g52030D                                          179   7e-50   
gb|KJB49685.1|  hypothetical protein B456_008G133500                    180   7e-50   
gb|EMT21027.1|  hypothetical protein F775_18206                         180   8e-50   
gb|AAM74495.1|  At1g57590/T8L23_6                                       180   8e-50   
ref|XP_007154511.1|  hypothetical protein PHAVU_003G124700g             180   9e-50   
ref|XP_008227764.1|  PREDICTED: protein notum homolog isoform X1        181   9e-50   
ref|XP_010094916.1|  hypothetical protein L484_022666                   179   9e-50   
ref|XP_009388076.1|  PREDICTED: protein notum homolog                   179   9e-50   
ref|NP_176072.3|  pectinacetylesterase family protein                   180   1e-49   
ref|XP_007221559.1|  hypothetical protein PRUPE_ppa006038mg             180   1e-49   
ref|XP_004494485.1|  PREDICTED: protein notum homolog isoform X1        180   1e-49   
gb|KHN14241.1|  Protein notum like                                      179   1e-49   
ref|XP_006658006.1|  PREDICTED: protein notum homolog                   179   1e-49   
ref|XP_003542396.2|  PREDICTED: protein notum homolog isoform X1        179   1e-49   
gb|KHN14181.1|  Protein notum like                                      179   1e-49   
ref|XP_003536008.1|  PREDICTED: protein notum homolog isoform X1        179   1e-49   
ref|XP_003518126.1|  PREDICTED: protein notum homolog                   179   1e-49   
ref|XP_006392395.1|  hypothetical protein EUTSA_v10023485mg             179   1e-49   
gb|EMS45878.1|  hypothetical protein TRIUR3_35256                       178   1e-49   
ref|XP_009142580.1|  PREDICTED: protein notum homolog                   179   2e-49   
ref|XP_006577186.1|  PREDICTED: protein notum homolog isoform X2        180   2e-49   
gb|KFK35390.1|  hypothetical protein AALP_AA5G279000                    179   2e-49   
ref|XP_002894676.1|  hypothetical protein ARALYDRAFT_474842             179   2e-49   
ref|NP_001060382.1|  Os07g0634600                                       178   3e-49   
ref|XP_006302295.1|  hypothetical protein CARUB_v10020343mg             178   3e-49   
gb|ABG34281.1|  pectin acetylesterase                                   176   4e-49   
ref|XP_004508066.1|  PREDICTED: protein notum homolog                   178   4e-49   
ref|XP_010999345.1|  PREDICTED: protein notum homolog isoform X2        178   6e-49   
ref|XP_008807935.1|  PREDICTED: protein notum homolog isoform X1        177   6e-49   
ref|XP_006494125.1|  PREDICTED: uncharacterized protein LOC102621758    177   6e-49   
ref|XP_010043350.1|  PREDICTED: protein notum homolog                   177   7e-49   
ref|XP_008807936.1|  PREDICTED: protein notum homolog isoform X2        177   7e-49   
ref|XP_010694126.1|  PREDICTED: protein notum homolog                   177   8e-49   
ref|XP_010060906.1|  PREDICTED: uncharacterized protein LOC104448...    177   8e-49   
ref|XP_010999344.1|  PREDICTED: protein notum homolog isoform X1        177   9e-49   
ref|XP_010060898.1|  PREDICTED: uncharacterized protein LOC104448...    177   1e-48   
ref|XP_006378039.1|  hypothetical protein POPTR_0010s00700g             177   1e-48   
ref|XP_003562611.1|  PREDICTED: protein notum homolog                   177   1e-48   
gb|KCW85365.1|  hypothetical protein EUGRSUZ_B02195                     177   1e-48   
gb|KFK37453.1|  hypothetical protein AALP_AA4G259200                    176   1e-48   
gb|EMT23229.1|  hypothetical protein F775_07306                         172   1e-48   
ref|XP_010511331.1|  PREDICTED: protein notum homolog                   177   1e-48   
emb|CDY41569.1|  BnaC04g00530D                                          176   1e-48   
emb|CDY39939.1|  BnaA09g15210D                                          182   1e-48   
ref|XP_010536210.1|  PREDICTED: uncharacterized protein LOC104811251    176   2e-48   
ref|XP_002461086.1|  hypothetical protein SORBIDRAFT_02g040470          176   2e-48   
ref|XP_004288665.1|  PREDICTED: pectin acetylesterase 3 isoform X2      177   2e-48   
ref|XP_006593986.1|  PREDICTED: protein notum homolog isoform X3        176   2e-48   
ref|NP_001141895.1|  uncharacterized protein LOC100274042 precursor     176   3e-48   
ref|XP_004958440.1|  PREDICTED: protein notum homolog                   175   3e-48   
ref|XP_006593985.1|  PREDICTED: protein notum homolog isoform X2        176   4e-48   
ref|XP_008390267.1|  PREDICTED: uncharacterized protein LOC103452547    167   8e-48   
ref|XP_009401969.1|  PREDICTED: uncharacterized protein LOC103985...    174   9e-48   
ref|XP_010494620.1|  PREDICTED: uncharacterized protein LOC104771742    173   1e-47   
ref|XP_007222070.1|  hypothetical protein PRUPE_ppa007506mg             172   1e-47   
ref|XP_009617653.1|  PREDICTED: uncharacterized protein LOC104109954    170   1e-47   
emb|CDX95291.1|  BnaC09g15790D                                          174   1e-47   
ref|XP_009408703.1|  PREDICTED: protein notum homolog                   174   1e-47   
gb|AFW82856.1|  hypothetical protein ZEAMMB73_240371                    167   2e-47   
ref|XP_010481611.1|  PREDICTED: uncharacterized protein LOC104760390    173   2e-47   
gb|KCW90689.1|  hypothetical protein EUGRSUZ_A02777                     177   2e-47   
gb|KCW90690.1|  hypothetical protein EUGRSUZ_A02777                     177   2e-47   
gb|AAM65412.1|  pectin acetylesterase                                   173   2e-47   
ref|XP_004496556.1|  PREDICTED: protein notum homolog                   173   2e-47   
ref|NP_199341.1|  pectinacetylesterase family protein                   172   3e-47   
ref|XP_007027030.1|  Pectinacetylesterase family protein isoform 1      173   3e-47   
ref|XP_006280604.1|  hypothetical protein CARUB_v10026563mg             172   3e-47   
ref|XP_008366797.1|  PREDICTED: protein notum homolog                   173   4e-47   
ref|XP_003609911.1|  Pectin acetylesterase                              173   4e-47   
ref|XP_002865253.1|  pectin acetylesterase                              172   5e-47   
dbj|BAK01215.1|  predicted protein                                      173   5e-47   
ref|XP_009128780.1|  PREDICTED: uncharacterized protein LOC103853624    172   5e-47   
emb|CDX87799.1|  BnaC02g31500D                                          172   6e-47   
gb|EMS57296.1|  hypothetical protein TRIUR3_09071                       171   6e-47   
gb|EEC73846.1|  hypothetical protein OsI_08601                          169   6e-47   
ref|XP_009776988.1|  PREDICTED: uncharacterized protein LOC104226...    171   7e-47   
ref|XP_011470038.1|  PREDICTED: pectin acetylesterase 3 isoform X1      173   7e-47   
ref|XP_010441760.1|  PREDICTED: uncharacterized protein LOC104724893    171   7e-47   
ref|XP_009407792.1|  PREDICTED: protein notum homolog                   172   7e-47   
ref|XP_006398195.1|  hypothetical protein EUTSA_v10000914mg             171   8e-47   
ref|XP_010253184.1|  PREDICTED: protein notum homolog                   172   8e-47   
gb|ACN26616.1|  unknown                                                 167   9e-47   
ref|NP_001042886.1|  Os01g0319000                                       172   9e-47   
gb|EEC70519.1|  hypothetical protein OsI_01625                          172   9e-47   
ref|NP_001142008.1|  hypothetical protein precursor                     167   1e-46   
ref|XP_009407790.1|  PREDICTED: protein notum homolog                   171   2e-46   



>gb|ACF05806.1| PAE [Litchi chinensis]
Length=399

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++KPGLCFFPQ MA  IQTPLF +N+AYDSWQ+KNILAPGVADPHGTWHSCKLDI 
Sbjct  238  SCTSRLKPGLCFFPQYMARQIQTPLFIINAAYDSWQIKNILAPGVADPHGTWHSCKLDIN  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL  MQ FR++FL AL  + NS S+G FI+SCYAHCQTE+QETWLRDDSPVL  T
Sbjct  298  NCSPNQLQTMQSFRLQFLDALSGLGNSTSKGLFIDSCYAHCQTEMQETWLRDDSPVLGKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDWYYDRSPFQKIDCPYPC+ +CHNRVF+
Sbjct  358  TIAKAVGDWYYDRSPFQKIDCPYPCNPTCHNRVFD  392



>emb|CDP15690.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   268 bits (685),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            +CTS+MKPGLCFFPQ MA  I+TPLF  N+AYDSWQ+KNILAPGVADPHG WH+CKLDI 
Sbjct  238  TCTSRMKPGLCFFPQYMAQEIRTPLFITNAAYDSWQIKNILAPGVADPHGLWHNCKLDIT  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            +CS SQL I+QGFR+EFL A+  +  S SRG+FIN CYAHCQTE+QETWLRDDSP L   
Sbjct  298  RCSASQLQIIQGFRLEFLSAVNGLGTSSSRGYFINGCYAHCQTEMQETWLRDDSPRLNDK  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDW+YDRSPFQ IDCPYPCDK+CHNRVFE
Sbjct  358  TIAKAVGDWFYDRSPFQTIDCPYPCDKTCHNRVFE  392



>ref|XP_010644665.1| PREDICTED: uncharacterized protein LOC100245856 [Vitis vinifera]
 emb|CBI29219.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   268 bits (685),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS ++PGLCFFPQNMA  I+TPLF +N+AYDSWQ+KNILAPGVADPHGTWH CKLDI 
Sbjct  238  SCTSSLRPGLCFFPQNMAQQIKTPLFIINAAYDSWQIKNILAPGVADPHGTWHYCKLDIK  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS SQL  MQ FR++FL A+  +  SPS+G FINSCYAHCQTE+QETWLRDDSPVL  T
Sbjct  298  DCSSSQLEAMQDFRVQFLSAIKGLIGSPSKGMFINSCYAHCQTEMQETWLRDDSPVLGKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDWYYDRSPFQKIDC YPCD +CHNRVF+
Sbjct  358  TIAKAVGDWYYDRSPFQKIDCAYPCDSTCHNRVFD  392



>ref|XP_010056136.1| PREDICTED: protein notum homolog [Eucalyptus grandis]
 gb|KCW72724.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
 gb|KCW72725.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=399

 Score =   268 bits (685),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSKMKPGLCFFPQN+ P IQTPLF +N+AYDSWQ+KNILAPGVAD HGTW SCKLDI 
Sbjct  238  SCTSKMKPGLCFFPQNVVPQIQTPLFIINAAYDSWQIKNILAPGVADRHGTWRSCKLDIK  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS +QL IMQ FR+EFL+AL AV  SPSRG FI+SCYAHCQ   QETWLR+DSPV+A T
Sbjct  298  KCSPNQLKIMQDFRLEFLRALSAVGTSPSRGMFIDSCYAHCQAGTQETWLRNDSPVVAKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            SIAKAVGDWYY+R  FQKIDCPYPC+ +CHNR+F+
Sbjct  358  SIAKAVGDWYYERLTFQKIDCPYPCNPTCHNRIFD  392



>ref|XP_010244169.1| PREDICTED: protein notum homolog [Nelumbo nucifera]
Length=401

 Score =   268 bits (685),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+  PGLCFFPQ +AP I TPLF +N+AYDSWQVKNILAPGVADPHGTWH CKLDI 
Sbjct  241  SCTSRFNPGLCFFPQYVAPQISTPLFILNAAYDSWQVKNILAPGVADPHGTWHDCKLDIT  300

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS SQL IMQGFRMEFL  L  +  SP++  FINSCY+HCQT  QETWLRDDSPVL  T
Sbjct  301  KCSSSQLQIMQGFRMEFLSTLTRLMGSPTKALFINSCYSHCQTGTQETWLRDDSPVLDKT  360

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            SI+KAVGDWY+DRS FQKIDCPYPCDKSCHNRVF+
Sbjct  361  SISKAVGDWYFDRSGFQKIDCPYPCDKSCHNRVFD  395



>ref|XP_004244443.1| PREDICTED: uncharacterized protein LOC101251798 [Solanum lycopersicum]
Length=392

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++KPGLCFFPQN+A  IQTPLF VN+AYDSWQ+KNILAPGVADPHGTW +CKLDIL
Sbjct  238  SCTSRLKPGLCFFPQNVAQQIQTPLFLVNAAYDSWQIKNILAPGVADPHGTWRNCKLDIL  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS +QL  MQ FR EFLKAL ++  S +RG++INSCYAHCQT  QETWLRDDSPVL+GT
Sbjct  298  KCSSAQLQTMQAFRSEFLKALNSLGPSSTRGYYINSCYAHCQTGTQETWLRDDSPVLSGT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDWYY+R  FQ+IDCPYPC+K+C NR FE
Sbjct  358  TIAKAVGDWYYERKRFQEIDCPYPCNKTCKNRNFE  392



>ref|XP_006878664.1| hypothetical protein AMTR_s00011p00266820 [Amborella trichopoda]
 gb|ERM94809.1| hypothetical protein AMTR_s00011p00266820 [Amborella trichopoda]
Length=398

 Score =   266 bits (680),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++KP LCFFPQ MA  I+TP F +N+AYDSWQVKN LAPGVADPHGTWH+CKLDI 
Sbjct  237  SCTSRLKPSLCFFPQYMAQGIRTPFFLLNAAYDSWQVKNTLAPGVADPHGTWHNCKLDIK  296

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KC+ SQL  +Q FR+EFL AL  V +SPS G FINSCYAHCQ+EVQETWLRDDSPVL GT
Sbjct  297  KCTASQLQTLQDFRLEFLSALKGVGSSPSIGMFINSCYAHCQSEVQETWLRDDSPVLGGT  356

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            SIAKAVGDW+YDRSPFQKIDC YPCD SCHNR+F+
Sbjct  357  SIAKAVGDWFYDRSPFQKIDCAYPCDSSCHNRIFD  391



>ref|XP_011073252.1| PREDICTED: protein notum homolog isoform X2 [Sesamum indicum]
Length=398

 Score =   264 bits (674),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+MKP LCFFPQNMA  I+TPLF VN+AYDSWQ+KNILAPGVADPHG WH CK DI+
Sbjct  237  SCTSRMKPSLCFFPQNMAQGIRTPLFIVNAAYDSWQIKNILAPGVADPHGLWHDCKTDIV  296

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS +QL  MQ FR++FL AL  + +S SRG+FIN CYAHCQTE+QETW R DSP+L   
Sbjct  297  KCSTTQLQTMQEFRLQFLNALSGLGSSTSRGYFINGCYAHCQTEMQETWFRGDSPLLYNK  356

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDW+YDRSPFQKIDCPYPCDK+CHNRVF+
Sbjct  357  TIAKAVGDWFYDRSPFQKIDCPYPCDKTCHNRVFD  391



>ref|XP_003628995.1| Notum-like protein [Medicago truncatula]
Length=396

 Score =   262 bits (670),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ PGLCFFPQN+A  I+TP+F VN+AYDSWQ+KNILAPGVADPHGTW +CKLDI 
Sbjct  242  SCTSRLSPGLCFFPQNVAAQIKTPIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDIK  301

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL  MQGFR EFLKA+  V+NSPS+G FI+ CY+HCQT +QETW+R DSPVLA T
Sbjct  302  SCSANQLSTMQGFRTEFLKAISVVSNSPSKGMFIDGCYSHCQTGMQETWMRTDSPVLAKT  361

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDWYYDRS FQ+IDCPYPC+ +CHNRVFE
Sbjct  362  TIAKAVGDWYYDRSTFQQIDCPYPCNPTCHNRVFE  396



>gb|KEH20327.1| pectinacetylesterase family protein [Medicago truncatula]
Length=393

 Score =   262 bits (670),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ PGLCFFPQN+A  I+TP+F VN+AYDSWQ+KNILAPGVADPHGTW +CKLDI 
Sbjct  239  SCTSRLSPGLCFFPQNVAAQIKTPIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDIK  298

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL  MQGFR EFLKA+  V+NSPS+G FI+ CY+HCQT +QETW+R DSPVLA T
Sbjct  299  SCSANQLSTMQGFRTEFLKAISVVSNSPSKGMFIDGCYSHCQTGMQETWMRTDSPVLAKT  358

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDWYYDRS FQ+IDCPYPC+ +CHNRVFE
Sbjct  359  TIAKAVGDWYYDRSTFQQIDCPYPCNPTCHNRVFE  393



>ref|XP_011073171.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
Length=422

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+MKP LCFFPQNMA  I+TPLF VN+AYDSWQ+KNILAPGVADPHG WH CK DI+
Sbjct  261  SCTSRMKPSLCFFPQNMAQGIRTPLFIVNAAYDSWQIKNILAPGVADPHGLWHDCKTDIV  320

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS +QL  MQ FR++FL AL  + +S SRG+FIN CYAHCQTE+QETW R DSP+L   
Sbjct  321  KCSTTQLQTMQEFRLQFLNALSGLGSSTSRGYFINGCYAHCQTEMQETWFRGDSPLLYNK  380

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDW+YDRSPFQKIDCPYPCDK+CHNRVF+
Sbjct  381  TIAKAVGDWFYDRSPFQKIDCPYPCDKTCHNRVFD  415



>ref|XP_010244170.1| PREDICTED: uncharacterized protein LOC104588061 [Nelumbo nucifera]
Length=399

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS MKP +CFFPQ M   I+TPLF +N+AYDSWQ+KNILAPGVADPHG WH+CKLDI 
Sbjct  238  SCTSTMKPSMCFFPQYMEQGIRTPLFLLNAAYDSWQIKNILAPGVADPHGYWHNCKLDIK  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS SQ+  MQGFR+EFL AL  + NS  RG FINSCYAHCQ+E+QETWLRDDSPVL  T
Sbjct  298  NCSPSQIQTMQGFRVEFLNALSGLGNSSPRGMFINSCYAHCQSEMQETWLRDDSPVLDKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
             IAKAVGDWYYDRSPFQKIDCPYPCD +CHNR+F+
Sbjct  358  PIAKAVGDWYYDRSPFQKIDCPYPCDATCHNRIFD  392



>gb|AET03471.2| pectinacetylesterase family protein [Medicago truncatula]
Length=424

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ PGLCFFPQN+A  I+TP+F VN+AYDSWQ+KNILAPGVADPHGTW +CKLDI 
Sbjct  270  SCTSRLSPGLCFFPQNVAAQIKTPIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDIK  329

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL  MQGFR EFLKA+  V+NSPS+G FI+ CY+HCQT +QETW+R DSPVLA T
Sbjct  330  SCSANQLSTMQGFRTEFLKAISVVSNSPSKGMFIDGCYSHCQTGMQETWMRTDSPVLAKT  389

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDWYYDRS FQ+IDCPYPC+ +CHNRVFE
Sbjct  390  TIAKAVGDWYYDRSTFQQIDCPYPCNPTCHNRVFE  424



>gb|KCW72720.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
Length=420

 Score =   261 bits (668),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+++PGLCFFPQN+   IQTPLF +N+AYD+WQ+KNILAPGVADPHGTWHSCKLDI 
Sbjct  247  SCTSRLRPGLCFFPQNVVKQIQTPLFILNAAYDAWQIKNILAPGVADPHGTWHSCKLDIN  306

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL IMQ FR +FL AL  V  SPSRG FI+SCYAHCQ+E+QETWLRDDSPVL  T
Sbjct  307  NCSLDQLQIMQDFRQQFLDALSRVGTSPSRGIFIDSCYAHCQSEMQETWLRDDSPVLIET  366

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            SIAKAVGDWYYDR PFQKIDC YPC+ +CHN VF+
Sbjct  367  SIAKAVGDWYYDRRPFQKIDCAYPCNPTCHNMVFD  401



>gb|KDO40415.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=246

 Score =   255 bits (652),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ PGLCFFPQ MA  I TPLF +N+AYDSWQ+KNILAPGVADPHGTWHSCKLDI 
Sbjct  85   SCTSRLSPGLCFFPQYMARQITTPLFIINAAYDSWQIKNILAPGVADPHGTWHSCKLDIN  144

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL  MQ FR +FL AL  +  S SRG FI++CYAHCQTE+QETWLR DSPVL   
Sbjct  145  NCSPTQLQTMQSFRTQFLNALAGLGISSSRGMFIDACYAHCQTEMQETWLRTDSPVLGKM  204

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            SIAKAVGDWYYDRSPFQKIDC YPC+ +CHNRVF+
Sbjct  205  SIAKAVGDWYYDRSPFQKIDCAYPCNPTCHNRVFD  239



>ref|XP_009627060.1| PREDICTED: uncharacterized protein LOC104117690 [Nicotiana tomentosiformis]
 ref|XP_009627061.1| PREDICTED: uncharacterized protein LOC104117690 [Nicotiana tomentosiformis]
Length=402

 Score =   260 bits (664),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++KPGLCFFPQN+A  I+TPLF VN+AYDSWQ+KNILAPGVADP GTW +CKLDIL
Sbjct  238  SCTSRLKPGLCFFPQNVAQQIKTPLFLVNAAYDSWQIKNILAPGVADPRGTWRNCKLDIL  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS +QL  MQG+R EFLKAL  +  S +RG++INSCYAHCQT  QETWLRDDSP LA T
Sbjct  298  KCSSAQLETMQGYRTEFLKALNGLGPSSTRGYYINSCYAHCQTGTQETWLRDDSPRLAST  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDW+YDR+ FQ+IDCPYPCDK+C NR FE
Sbjct  358  TIAKAVGDWFYDRNQFQEIDCPYPCDKTCKNRNFE  392



>gb|KDO40411.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=248

 Score =   254 bits (650),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ PGLCFFPQ MA  I TPLF +N+AYDSWQ+KNILAPGVADPHGTWHSCKLDI 
Sbjct  87   SCTSRLSPGLCFFPQYMARQITTPLFIINAAYDSWQIKNILAPGVADPHGTWHSCKLDIN  146

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL  MQ FR +FL AL  +  S SRG FI++CYAHCQTE+QETWLR DSPVL   
Sbjct  147  NCSPTQLQTMQSFRTQFLNALAGLGISSSRGMFIDACYAHCQTEMQETWLRTDSPVLGKM  206

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            SIAKAVGDWYYDRSPFQKIDC YPC+ +CHNRVF+
Sbjct  207  SIAKAVGDWYYDRSPFQKIDCAYPCNPTCHNRVFD  241



>ref|XP_009771151.1| PREDICTED: uncharacterized protein LOC104221730 [Nicotiana sylvestris]
Length=402

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++KPGLCFFPQN+A  I+TPLF VN+AYDSWQ+KNILAPGVADP GTW +CKLDIL
Sbjct  238  SCTSRLKPGLCFFPQNVAQQIKTPLFLVNAAYDSWQIKNILAPGVADPRGTWRNCKLDIL  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS +QL  MQG+R EFLKAL  +  S +RG++INSCYAHCQT  QETWLRDDSP LA T
Sbjct  298  KCSSAQLETMQGYRNEFLKALNGLGPSSTRGYYINSCYAHCQTGTQETWLRDDSPRLAST  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDW+YDR+ FQ+IDCPYPCDK+C NR FE
Sbjct  358  TIAKAVGDWFYDRNRFQEIDCPYPCDKTCKNRNFE  392



>gb|KCW72718.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
 gb|KCW72719.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
Length=403

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+++PGLCFFPQN+   IQTPLF +N+AYD+WQ+KNILAPGVADPHGTWHSCKLDI 
Sbjct  202  SCTSRLRPGLCFFPQNVVKQIQTPLFILNAAYDAWQIKNILAPGVADPHGTWHSCKLDIN  261

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL IMQ FR +FL AL  V  SPSRG FI+SCYAHCQ+E+QETWLRDDSPVL  T
Sbjct  262  NCSLDQLQIMQDFRQQFLDALSRVGTSPSRGIFIDSCYAHCQSEMQETWLRDDSPVLIET  321

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            SIAKAVGDWYYDR PFQKIDC YPC+ +CHN VF+
Sbjct  322  SIAKAVGDWYYDRRPFQKIDCAYPCNPTCHNMVFD  356



>ref|XP_010056132.1| PREDICTED: protein notum homolog isoform X3 [Eucalyptus grandis]
 gb|KCW72716.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
 gb|KCW72717.1| hypothetical protein EUGRSUZ_E01169 [Eucalyptus grandis]
Length=439

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+++PGLCFFPQN+   IQTPLF +N+AYD+WQ+KNILAPGVADPHGTWHSCKLDI 
Sbjct  238  SCTSRLRPGLCFFPQNVVKQIQTPLFILNAAYDAWQIKNILAPGVADPHGTWHSCKLDIN  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL IMQ FR +FL AL  V  SPSRG FI+SCYAHCQ+E+QETWLRDDSPVL  T
Sbjct  298  NCSLDQLQIMQDFRQQFLDALSRVGTSPSRGIFIDSCYAHCQSEMQETWLRDDSPVLIET  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            SIAKAVGDWYYDR PFQKIDC YPC+ +CHN VF+
Sbjct  358  SIAKAVGDWYYDRRPFQKIDCAYPCNPTCHNMVFD  392



>ref|XP_010056131.1| PREDICTED: protein notum homolog isoform X2 [Eucalyptus grandis]
Length=448

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+++PGLCFFPQN+   IQTPLF +N+AYD+WQ+KNILAPGVADPHGTWHSCKLDI 
Sbjct  247  SCTSRLRPGLCFFPQNVVKQIQTPLFILNAAYDAWQIKNILAPGVADPHGTWHSCKLDIN  306

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL IMQ FR +FL AL  V  SPSRG FI+SCYAHCQ+E+QETWLRDDSPVL  T
Sbjct  307  NCSLDQLQIMQDFRQQFLDALSRVGTSPSRGIFIDSCYAHCQSEMQETWLRDDSPVLIET  366

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            SIAKAVGDWYYDR PFQKIDC YPC+ +CHN VF+
Sbjct  367  SIAKAVGDWYYDRRPFQKIDCAYPCNPTCHNMVFD  401



>ref|XP_010056129.1| PREDICTED: protein notum homolog isoform X1 [Eucalyptus grandis]
 ref|XP_010056130.1| PREDICTED: protein notum homolog isoform X1 [Eucalyptus grandis]
Length=445

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+++PGLCFFPQN+   IQTPLF +N+AYD+WQ+KNILAPGVADPHGTWHSCKLDI 
Sbjct  244  SCTSRLRPGLCFFPQNVVKQIQTPLFILNAAYDAWQIKNILAPGVADPHGTWHSCKLDIN  303

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL IMQ FR +FL AL  V  SPSRG FI+SCYAHCQ+E+QETWLRDDSPVL  T
Sbjct  304  NCSLDQLQIMQDFRQQFLDALSRVGTSPSRGIFIDSCYAHCQSEMQETWLRDDSPVLIET  363

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            SIAKAVGDWYYDR PFQKIDC YPC+ +CHN VF+
Sbjct  364  SIAKAVGDWYYDRRPFQKIDCAYPCNPTCHNMVFD  398



>gb|KDO40414.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=307

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ PGLCFFPQ MA  I TPLF +N+AYDSWQ+KNILAPGVADPHGTWHSCKLDI 
Sbjct  146  SCTSRLSPGLCFFPQYMARQITTPLFIINAAYDSWQIKNILAPGVADPHGTWHSCKLDIN  205

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL  MQ FR +FL AL  +  S SRG FI++CYAHCQTE+QETWLR DSPVL   
Sbjct  206  NCSPTQLQTMQSFRTQFLNALAGLGISSSRGMFIDACYAHCQTEMQETWLRTDSPVLGKM  265

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            SIAKAVGDWYYDRSPFQKIDC YPC+ +CHNRVF+
Sbjct  266  SIAKAVGDWYYDRSPFQKIDCAYPCNPTCHNRVFD  300



>ref|XP_004172255.1| PREDICTED: protein notum homolog [Cucumis sativus]
 gb|KGN53459.1| hypothetical protein Csa_4G056500 [Cucumis sativus]
Length=398

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSKMKP +CFFPQN+   IQTP+F VN+AYDSWQ+KNILAPGVADPHGTWH CKLDI 
Sbjct  238  SCTSKMKPEMCFFPQNVVQLIQTPIFLVNAAYDSWQIKNILAPGVADPHGTWHECKLDIK  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL  MQ FR++FL AL  V +S SRG FI+SCYAHCQTE+QETWLR DSPVL+ T
Sbjct  298  NCSPIQLRTMQDFRVQFLSALNGVGSSLSRGLFIDSCYAHCQTEMQETWLRTDSPVLSKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDW++DR+PFQKIDCPYPC+ +CHNR+FE
Sbjct  358  TIAKAVGDWFFDRAPFQKIDCPYPCNPTCHNRIFE  392



>ref|XP_011082149.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
 ref|XP_011082150.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
 ref|XP_011082151.1| PREDICTED: protein notum homolog isoform X1 [Sesamum indicum]
Length=398

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+MKP LCFFPQ +A  I+TPLF +N+AYDSWQ+KNILAPGVADPHGTWH+CK DI 
Sbjct  237  SCTSRMKPSLCFFPQYVAREIRTPLFIINAAYDSWQIKNILAPGVADPHGTWHNCKTDIN  296

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS +QL  MQGFR+EF++AL  +  S SRG+FINSCYAHCQTE+QETW R DSP L   
Sbjct  297  KCSATQLQTMQGFRLEFIRALYGLGVSTSRGYFINSCYAHCQTEMQETWYRSDSPKLNNK  356

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDW+YDRSPFQK DCPYPCD++CHNRVF+
Sbjct  357  TIAKAVGDWFYDRSPFQKGDCPYPCDRTCHNRVFD  391



>gb|KCW72723.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=392

 Score =   258 bits (659),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSKMKPGLCFFPQN+ P IQTPLF +N+AYDSWQ+KNILAPGVAD HGTW SCKLDI 
Sbjct  238  SCTSKMKPGLCFFPQNVVPQIQTPLFIINAAYDSWQIKNILAPGVADRHGTWRSCKLDIK  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS +QL IMQ FR+EFL+AL AV  SPSRG FI+SCYAHCQ   QETWLR+DSPV+A T
Sbjct  298  KCSPNQLKIMQDFRLEFLRALSAVGTSPSRGMFIDSCYAHCQAGTQETWLRNDSPVVAKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            SIAKAVGDWYY+R   QKIDC YPC+ +CHN +F+
Sbjct  358  SIAKAVGDWYYERITSQKIDCAYPCNPTCHNGMFD  392



>ref|XP_011082152.1| PREDICTED: protein notum homolog isoform X2 [Sesamum indicum]
Length=378

 Score =   257 bits (657),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+MKP LCFFPQ +A  I+TPLF +N+AYDSWQ+KNILAPGVADPHGTWH+CK DI 
Sbjct  217  SCTSRMKPSLCFFPQYVAREIRTPLFIINAAYDSWQIKNILAPGVADPHGTWHNCKTDIN  276

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS +QL  MQGFR+EF++AL  +  S SRG+FINSCYAHCQTE+QETW R DSP L   
Sbjct  277  KCSATQLQTMQGFRLEFIRALYGLGVSTSRGYFINSCYAHCQTEMQETWYRSDSPKLNNK  336

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDW+YDRSPFQK DCPYPCD++CHNRVF+
Sbjct  337  TIAKAVGDWFYDRSPFQKGDCPYPCDRTCHNRVFD  371



>ref|XP_008451860.1| PREDICTED: protein notum homolog isoform X1 [Cucumis melo]
Length=401

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSKMKP +CFFPQN+   IQTP+F VN+AYDSWQ+KNILAPGVADPHGTWH CKLDI 
Sbjct  241  SCTSKMKPEMCFFPQNVVQLIQTPIFLVNAAYDSWQIKNILAPGVADPHGTWHECKLDIK  300

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL IMQ FR++FL AL  V +S SRG FI+SCYAHCQTE+QETWLR DSP+L+ T
Sbjct  301  NCSPIQLRIMQDFRVQFLSALTGVGSSLSRGLFIDSCYAHCQTEMQETWLRSDSPMLSKT  360

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
             IAKAVGDW++DR+PFQKIDCPYPC+ +CHNR+FE
Sbjct  361  PIAKAVGDWFFDRAPFQKIDCPYPCNPTCHNRIFE  395



>ref|XP_008451861.1| PREDICTED: protein notum homolog isoform X2 [Cucumis melo]
Length=398

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSKMKP +CFFPQN+   IQTP+F VN+AYDSWQ+KNILAPGVADPHGTWH CKLDI 
Sbjct  238  SCTSKMKPEMCFFPQNVVQLIQTPIFLVNAAYDSWQIKNILAPGVADPHGTWHECKLDIK  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL IMQ FR++FL AL  V +S SRG FI+SCYAHCQTE+QETWLR DSP+L+ T
Sbjct  298  NCSPIQLRIMQDFRVQFLSALTGVGSSLSRGLFIDSCYAHCQTEMQETWLRSDSPMLSKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
             IAKAVGDW++DR+PFQKIDCPYPC+ +CHNR+FE
Sbjct  358  PIAKAVGDWFFDRAPFQKIDCPYPCNPTCHNRIFE  392



>ref|XP_010111521.1| hypothetical protein L484_021346 [Morus notabilis]
 gb|EXC31044.1| hypothetical protein L484_021346 [Morus notabilis]
Length=386

 Score =   256 bits (654),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ PGLCFFPQ +   IQTP+F VN+AYDSWQ+KNILAPGVADPHGTWH CKLDI 
Sbjct  226  SCTSRLSPGLCFFPQYVVSQIQTPIFFVNAAYDSWQIKNILAPGVADPHGTWHYCKLDIT  285

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS  QL  MQ FR+EFLKA+  V NS S+G FI+SCYAHCQTE+QETWLR +SP L  T
Sbjct  286  KCSSIQLKTMQDFRLEFLKAISVVGNSLSKGLFIDSCYAHCQTEMQETWLRANSPRLGAT  345

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDW+YDRS FQKIDCPYPC+ +CHNRVF+
Sbjct  346  TIAKAVGDWFYDRSAFQKIDCPYPCNPTCHNRVFD  380



>gb|AAP72959.1| pectin acetylesterase [Lactuca sativa]
Length=395

 Score =   256 bits (654),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 132/157 (84%), Gaps = 2/157 (1%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            +C +KM PGLCFFPQNM   I+TP+F +N+AYDSWQVKNILAPGVAD  GTW  CKLDI 
Sbjct  239  ACLAKMSPGLCFFPQNMVQFIKTPIFLINAAYDSWQVKNILAPGVADRKGTWRECKLDIT  298

Query  582  KCSDSQLGIMQGFRMEFLKALGAV--ANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLA  409
            KCS +QL ++QG+R+EFLKAL      NSPSRG FINSCY+HCQT +QETWLR+DSP+L 
Sbjct  299  KCSSAQLNVLQGYRLEFLKALNGFGNGNSPSRGMFINSCYSHCQTGIQETWLRNDSPLLG  358

Query  408  GTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
             T+IAKAVGDWYY+R+ FQKIDC YPCDK+CHNRVFE
Sbjct  359  NTTIAKAVGDWYYERNTFQKIDCAYPCDKTCHNRVFE  395



>ref|XP_006471634.1| PREDICTED: uncharacterized protein LOC102628021 [Citrus sinensis]
 gb|KDO40413.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=399

 Score =   256 bits (653),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ PGLCFFPQ MA  I TPLF +N+AYDSWQ+KNILAPGVADPHGTWHSCKLDI 
Sbjct  238  SCTSRLSPGLCFFPQYMARQITTPLFIINAAYDSWQIKNILAPGVADPHGTWHSCKLDIN  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL  MQ FR +FL AL  +  S SRG FI++CYAHCQTE+QETWLR DSPVL   
Sbjct  298  NCSPTQLQTMQSFRTQFLNALAGLGISSSRGMFIDACYAHCQTEMQETWLRTDSPVLGKM  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            SIAKAVGDWYYDRSPFQKIDC YPC+ +CHNRVF+
Sbjct  358  SIAKAVGDWYYDRSPFQKIDCAYPCNPTCHNRVFD  392



>gb|ACJ85294.1| unknown [Medicago truncatula]
 gb|AFK37076.1| unknown [Medicago truncatula]
Length=393

 Score =   255 bits (652),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ PGLCFFPQN+A  I+TP+F VN+AYDSWQ+KNILAPGVADPHGTW +CKLDI 
Sbjct  239  SCTSRLSPGLCFFPQNVAAQIKTPIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDIK  298

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL  MQGFR EFLKA+  V+NSPS+G FI+ CY+H QT +QETW+R D PVLA T
Sbjct  299  SCSANQLSTMQGFRTEFLKAISVVSNSPSKGMFIDGCYSHRQTGMQETWMRTDFPVLAKT  358

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDWYYDRS FQ+IDCPYPC+ +CHNRVFE
Sbjct  359  TIAKAVGDWYYDRSTFQQIDCPYPCNPTCHNRVFE  393



>ref|XP_004150551.1| PREDICTED: protein notum homolog [Cucumis sativus]
Length=539

 Score =   259 bits (662),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSKMKP +CFFPQN+   IQTP+F VN+AYDSWQ+KNILAPGVADPHGTWH CKLDI 
Sbjct  238  SCTSKMKPEMCFFPQNVVQLIQTPIFLVNAAYDSWQIKNILAPGVADPHGTWHECKLDIK  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL  MQ FR++FL AL  V +S SRG FI+SCYAHCQTE+QETWLR DSPVL+ T
Sbjct  298  NCSPIQLRTMQDFRVQFLSALNGVGSSLSRGLFIDSCYAHCQTEMQETWLRTDSPVLSKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDW++DR+PFQKIDCPYPC+ +CHNR+FE
Sbjct  358  TIAKAVGDWFFDRAPFQKIDCPYPCNPTCHNRIFE  392



>gb|EYU29131.1| hypothetical protein MIMGU_mgv1a007782mg [Erythranthe guttata]
Length=394

 Score =   254 bits (650),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSKMKP LCFFP+NM   IQTP+F VN+AYDSWQ+KNILAPGVADPHG WH+CK DI 
Sbjct  233  SCTSKMKPSLCFFPENMVQAIQTPIFVVNAAYDSWQIKNILAPGVADPHGLWHNCKTDIK  292

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS +QL  MQ +R+EFLKAL  + ++ S+G+FINSCYAHCQTE QETW  + SP+L   
Sbjct  293  KCSTTQLQTMQEYRLEFLKALSGLMSAKSKGYFINSCYAHCQTETQETWSTNISPMLNNK  352

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDW+Y+RSPF+KIDCPYPCDK+CHNR+F+
Sbjct  353  TIAKAVGDWFYERSPFEKIDCPYPCDKTCHNRIFD  387



>emb|CAA67728.1| pectinacetylesterase precursor [Vigna radiata var. radiata]
Length=399

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+++PGLCFFPQN+   I TP+F VN+AYDSWQ+KNILAPG ADPHGTW  CKLDI 
Sbjct  238  SCTSRLRPGLCFFPQNVVSQISTPIFFVNAAYDSWQIKNILAPGAADPHGTWRECKLDIK  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS +QL  MQ FR +FL+A GAV NSPS+G FI+ CYAHCQT  QETWLR+DSPVL  T
Sbjct  298  KCSSNQLSAMQVFRTDFLRAFGAVGNSPSKGHFIDGCYAHCQTGTQETWLRNDSPVLGST  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDWYYDR PF++IDC YPC+ +CHNR+F+
Sbjct  358  TIAKAVGDWYYDRKPFKQIDCAYPCNPTCHNRIFD  392



>gb|KDO40410.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=437

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ PGLCFFPQ MA  I TPLF +N+AYDSWQ+KNILAPGVADPHGTWHSCKLDI 
Sbjct  276  SCTSRLSPGLCFFPQYMARQITTPLFIINAAYDSWQIKNILAPGVADPHGTWHSCKLDIN  335

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL  MQ FR +FL AL  +  S SRG FI++CYAHCQTE+QETWLR DSPVL   
Sbjct  336  NCSPTQLQTMQSFRTQFLNALAGLGISSSRGMFIDACYAHCQTEMQETWLRTDSPVLGKM  395

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            SIAKAVGDWYYDRSPFQKIDC YPC+ +CHNRVF+
Sbjct  396  SIAKAVGDWYYDRSPFQKIDCAYPCNPTCHNRVFD  430



>ref|XP_009794297.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=402

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++KP LCFFPQN+A  ++TPLF VN+AYDSWQ+KNILAP VADP G W +CKLDIL
Sbjct  238  SCTSRLKPNLCFFPQNVAQHVRTPLFLVNAAYDSWQIKNILAPSVADPRGVWRNCKLDIL  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            +CS  QL  MQGFR+ FL+AL A+  S SRG+FINSCYAHCQTEVQETW R DSP LA  
Sbjct  298  RCSSRQLQTMQGFRLGFLRALYALGPSSSRGYFINSCYAHCQTEVQETWFRADSPKLANK  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKA+GDW++D++PFQKIDCPYPCDK+CHNRVF+
Sbjct  358  TIAKALGDWFFDKNPFQKIDCPYPCDKTCHNRVFD  392



>ref|XP_004509522.1| PREDICTED: uncharacterized protein LOC101493258 isoform X1 [Cicer 
arietinum]
 ref|XP_004509523.1| PREDICTED: uncharacterized protein LOC101493258 isoform X2 [Cicer 
arietinum]
Length=400

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ PGLCFFPQN+A  I+TP+F VN+AYDSWQ+KNILAPGVADPHGTW +CKLDI 
Sbjct  239  SCTSRLSPGLCFFPQNVAAQIKTPIFFVNAAYDSWQIKNILAPGVADPHGTWRNCKLDIN  298

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL  MQGFR +FL+A+  ++NSPS+G FI+ CYAHCQT +QETW+R DSPVLA T
Sbjct  299  NCSPNQLTTMQGFRTQFLQAISGLSNSPSKGLFIDGCYAHCQTGMQETWMRSDSPVLANT  358

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDWYYDR  F +IDCPYPC+ +CHNRVF+
Sbjct  359  TIAKAVGDWYYDRKTFHQIDCPYPCNPTCHNRVFD  393



>ref|XP_010325633.1| PREDICTED: uncharacterized protein LOC101257588 isoform X2 [Solanum 
lycopersicum]
Length=397

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CTS++KP LCFFPQN+A  ++TPLF VN+AYDSWQ+KNILAP VADP+G W +CKLDILK
Sbjct  234  CTSRLKPDLCFFPQNVAQHVRTPLFLVNAAYDSWQIKNILAPDVADPYGVWLNCKLDILK  293

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            CS  QL IM G+R+ FL+AL A+  S SRG+FINSCYAHCQTEVQETW R DSP LA  +
Sbjct  294  CSSRQLQIMHGYRLLFLRALNALGPSSSRGYFINSCYAHCQTEVQETWYRADSPKLANKT  353

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IAKA+GDW+YD++PFQKIDCPYPCDK+CHNRVF+
Sbjct  354  IAKALGDWFYDKNPFQKIDCPYPCDKTCHNRVFD  387



>ref|XP_010325632.1| PREDICTED: protein notum homolog isoform X1 [Solanum lycopersicum]
Length=402

 Score =   253 bits (646),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CTS++KP LCFFPQN+A  ++TPLF VN+AYDSWQ+KNILAP VADP+G W +CKLDILK
Sbjct  239  CTSRLKPDLCFFPQNVAQHVRTPLFLVNAAYDSWQIKNILAPDVADPYGVWLNCKLDILK  298

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            CS  QL IM G+R+ FL+AL A+  S SRG+FINSCYAHCQTEVQETW R DSP LA  +
Sbjct  299  CSSRQLQIMHGYRLLFLRALNALGPSSSRGYFINSCYAHCQTEVQETWYRADSPKLANKT  358

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IAKA+GDW+YD++PFQKIDCPYPCDK+CHNRVF+
Sbjct  359  IAKALGDWFYDKNPFQKIDCPYPCDKTCHNRVFD  392



>ref|XP_010056135.1| PREDICTED: protein notum homolog [Eucalyptus grandis]
Length=392

 Score =   252 bits (643),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSKMKPGLCFFPQN+ P IQTPLF +N+AYD+WQ+KNILAPGVADPHGTW+SCKLDI 
Sbjct  238  SCTSKMKPGLCFFPQNVVPQIQTPLFIINAAYDAWQIKNILAPGVADPHGTWNSCKLDIK  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS +QL IMQ FR+EFL+AL AV  SPSRG FI+SC  HCQ   + TWLR+DSP++A T
Sbjct  298  KCSPNQLKIMQDFRLEFLRALSAVGTSPSRGMFIDSCNTHCQAGTEATWLRNDSPIVAKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            SIAKAVGDWYY+R   QKIDC YPC+ +CHN +F+
Sbjct  358  SIAKAVGDWYYERITSQKIDCAYPCNPTCHNGMFD  392



>gb|KCW72721.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=392

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSKMKPGLCFFPQN+ P IQTPLF +N+AYD+WQ+KNILAPGVADPHGTW+SCKLDI 
Sbjct  238  SCTSKMKPGLCFFPQNVVPQIQTPLFIINAAYDAWQIKNILAPGVADPHGTWNSCKLDIK  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS +QL IMQ FR+EFL+AL AV  SPSRG FI+SC  HCQ   + TWLR+DSP++A T
Sbjct  298  KCSPNQLKIMQDFRLEFLRALSAVGTSPSRGMFIDSCNTHCQAGTEATWLRNDSPIVAKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            SIAKAVGDWYY+R   QKIDC YPC+ +CHN +F+
Sbjct  358  SIAKAVGDWYYERITSQKIDCAYPCNPTCHNGMFD  392



>ref|XP_010677538.1| PREDICTED: protein notum homolog isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=389

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK  P LCFFP+  A  IQTPLF +N+AYD+WQ+KN LAPGVAD HGTWH CK DI+
Sbjct  235  SCTSKFDPKLCFFPEYAARGIQTPLFLLNAAYDAWQIKNTLAPGVADRHGTWHDCKSDII  294

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS+SQ+ IM GFR +FL AL ++ NS SRGF+INSCY+HCQ+  QETWLRDDSP+L  T
Sbjct  295  KCSNSQIQIMHGFRQDFLAALSSLGNSNSRGFYINSCYSHCQSGTQETWLRDDSPLLDNT  354

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +I KAVGDW+YDR PFQKIDCPYPC+K+CHNRVFE
Sbjct  355  TICKAVGDWFYDRKPFQKIDCPYPCNKTCHNRVFE  389



>ref|XP_010677539.1| PREDICTED: protein notum homolog isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=388

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK  P LCFFP+  A  IQTPLF +N+AYD+WQ+KN LAPGVAD HGTWH CK DI+
Sbjct  234  SCTSKFDPKLCFFPEYAARGIQTPLFLLNAAYDAWQIKNTLAPGVADRHGTWHDCKSDII  293

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS+SQ+ IM GFR +FL AL ++ NS SRGF+INSCY+HCQ+  QETWLRDDSP+L  T
Sbjct  294  KCSNSQIQIMHGFRQDFLAALSSLGNSNSRGFYINSCYSHCQSGTQETWLRDDSPLLDNT  353

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +I KAVGDW+YDR PFQKIDCPYPC+K+CHNRVFE
Sbjct  354  TICKAVGDWFYDRKPFQKIDCPYPCNKTCHNRVFE  388



>gb|EYU29130.1| hypothetical protein MIMGU_mgv1a007782mg [Erythranthe guttata]
Length=395

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 132/156 (85%), Gaps = 1/156 (1%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSKMKP LCFFP+NM   IQTP+F VN+AYDSWQ+KNILAPGVADPHG WH+CK DI 
Sbjct  233  SCTSKMKPSLCFFPENMVQAIQTPIFVVNAAYDSWQIKNILAPGVADPHGLWHNCKTDIK  292

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAG-  406
            KCS +QL  MQ +R+EFLKAL  + ++ S+G+FINSCYAHCQTE QETW  + SP+L   
Sbjct  293  KCSTTQLQTMQEYRLEFLKALSGLMSAKSKGYFINSCYAHCQTETQETWSTNISPMLNNK  352

Query  405  TSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
             +IAKAVGDW+Y+RSPF+KIDCPYPCDK+CHNR+F+
Sbjct  353  VTIAKAVGDWFYERSPFEKIDCPYPCDKTCHNRIFD  388



>ref|XP_006363875.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=402

 Score =   250 bits (639),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CTS++KP LCFFPQN+A  ++TPLF VN+AYDSWQ+KNILAPGVADP+G W +CKLDILK
Sbjct  239  CTSRLKPDLCFFPQNVAQHVRTPLFLVNAAYDSWQIKNILAPGVADPYGFWLNCKLDILK  298

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            CS  QL IM G+R+ FL+AL A+  S SRG+FINSC+AHCQTEVQETW R DSP LA  +
Sbjct  299  CSSRQLQIMHGYRLLFLRALNALGPSSSRGYFINSCFAHCQTEVQETWYRADSPKLANKT  358

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IAKA+GDW+YD++PFQKIDCPYPCDK+CHNR F+
Sbjct  359  IAKALGDWFYDKNPFQKIDCPYPCDKTCHNRGFD  392



>ref|XP_008808358.1| PREDICTED: protein notum homolog [Phoenix dactylifera]
Length=397

 Score =   250 bits (638),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ P +CFFPQNM   I+TPLF +N+AYDSWQ+KNIL PGVADPHGTWH CKLDI 
Sbjct  238  SCTSRLTPSMCFFPQNMVQKIRTPLFILNAAYDSWQIKNILVPGVADPHGTWHDCKLDIQ  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            +CS SQL IMQGFR +FL AL    +S S G FINSCYAHCQ+E+QETWL  +SPVL   
Sbjct  298  QCSSSQLQIMQGFRTQFLNALAGFGSSSSTGMFINSCYAHCQSEMQETWLSSNSPVLEKI  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
             IAKAVGDW+YDR  FQKIDCPYPCD +CHNR+FE
Sbjct  358  PIAKAVGDWFYDRIAFQKIDCPYPCDSTCHNRIFE  392



>gb|KCW72722.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=392

 Score =   249 bits (637),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSKMKPGLCFFPQN+ P IQTPLF +N+AYDSWQ+KNILAPGVAD HGTW SCKLDI 
Sbjct  238  SCTSKMKPGLCFFPQNVVPQIQTPLFIINAAYDSWQIKNILAPGVADRHGTWRSCKLDIK  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS +QL IMQ FR+EFL+AL AV  SPSRG FI+SC  HCQ   + TWLR+DSP++A T
Sbjct  298  KCSPNQLKIMQDFRLEFLRALSAVGTSPSRGMFIDSCNTHCQAGTEATWLRNDSPIVAKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            SIAKAVGDWYY+R   QKIDC YPC+ +CHN +F+
Sbjct  358  SIAKAVGDWYYERITSQKIDCAYPCNPTCHNGMFD  392



>ref|XP_007209211.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
 ref|XP_007209212.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
 gb|EMJ10410.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
 gb|EMJ10411.1| hypothetical protein PRUPE_ppa006668mg [Prunus persica]
Length=400

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK++PGLCFFPQ MA  IQT +F VN+AYDSWQ+KNILAPGVADPHGTWH CKLDI 
Sbjct  238  SCTSKLRPGLCFFPQYMASQIQTRIFFVNAAYDSWQIKNILAPGVADPHGTWHECKLDIK  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL  MQ FR++FL A+G +   P +G FI+SCYAHCQTE+QETWL  DSPVL  T
Sbjct  298  NCSPTQLKAMQDFRVQFLSAVGGMTGCPLKGMFIDSCYAHCQTEMQETWLMADSPVLNKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IA+AVGDW+Y R+PFQKIDCPYPC+ SCHNRVF+
Sbjct  358  TIAQAVGDWFYGRTPFQKIDCPYPCNPSCHNRVFD  392



>gb|AFK45147.1| unknown [Lotus japonicus]
Length=394

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+++PGLCFFPQN+A  I+TP+  VN+AYDS+QVKNILAPGVADPHGTW  CKLDI 
Sbjct  238  SCTSRLRPGLCFFPQNVAGQIKTPISFVNAAYDSYQVKNILAPGVADPHGTWRDCKLDIK  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS +QL +MQGFR EFLKA+  V NSPS+G F++ CY+HCQT +QETW+R DSPVLA T
Sbjct  298  KCSSNQLTVMQGFRTEFLKAISVVENSPSKGMFVDGCYSHCQTGMQETWMRSDSPVLANT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDW+Y+R  F +IDC YPC+ +CHNRVF+
Sbjct  358  TIAKAVGDWFYERRSFSQIDCSYPCNPTCHNRVFD  392



>ref|XP_004512351.1| PREDICTED: protein notum homolog isoform X3 [Cicer arietinum]
Length=448

 Score =   249 bits (636),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ P LCFFPQ +   I TP+F VN+AYDSWQ+KNILAPGVADPHG WHSCK+DI 
Sbjct  240  SCTSRLNPKLCFFPQYVVSQITTPIFFVNAAYDSWQIKNILAPGVADPHGHWHSCKMDIN  299

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL +MQGFR EFL+AL  + NSPS+G FI+SCYAHCQTE+QETW R DSP+LA T
Sbjct  300  NCSSNQLDLMQGFRTEFLRALTVLGNSPSKGMFIDSCYAHCQTEMQETWFRSDSPLLAKT  359

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAV DW+Y+R  F +IDCPYPC+ SCHNRVFE
Sbjct  360  TIAKAVADWFYERRLFHQIDCPYPCNPSCHNRVFE  394



>ref|XP_008238012.1| PREDICTED: protein notum homolog isoform X2 [Prunus mume]
Length=400

 Score =   248 bits (632),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK++PGLCFFPQ MA  I+T +F VN+AYDSWQ+KNILAPGVADPHGTWH CKLDI 
Sbjct  238  SCTSKLRPGLCFFPQYMASQIRTRIFFVNAAYDSWQIKNILAPGVADPHGTWHECKLDIK  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL  MQ FR++FL A+G +   P +G FI+SCYAHCQTE+QETWL  DSPVL  T
Sbjct  298  NCSPTQLKAMQDFRVQFLSAIGGMTGCPLKGMFIDSCYAHCQTELQETWLMADSPVLNKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IA+AVGDW+Y R+PFQKIDCPYPC+ SCHNRVF+
Sbjct  358  TIAQAVGDWFYGRTPFQKIDCPYPCNPSCHNRVFD  392



>ref|XP_008238011.1| PREDICTED: protein notum homolog isoform X1 [Prunus mume]
Length=401

 Score =   248 bits (632),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK++PGLCFFPQ MA  I+T +F VN+AYDSWQ+KNILAPGVADPHGTWH CKLDI 
Sbjct  239  SCTSKLRPGLCFFPQYMASQIRTRIFFVNAAYDSWQIKNILAPGVADPHGTWHECKLDIK  298

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL  MQ FR++FL A+G +   P +G FI+SCYAHCQTE+QETWL  DSPVL  T
Sbjct  299  NCSPTQLKAMQDFRVQFLSAIGGMTGCPLKGMFIDSCYAHCQTELQETWLMADSPVLNKT  358

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IA+AVGDW+Y R+PFQKIDCPYPC+ SCHNRVF+
Sbjct  359  TIAQAVGDWFYGRTPFQKIDCPYPCNPSCHNRVFD  393



>ref|XP_009616254.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=404

 Score =   247 bits (631),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++KP LCFFPQN+A  ++TPLF VN+AYDSWQ+KNILAP VADP G W +CKLDIL
Sbjct  240  SCTSRLKPNLCFFPQNVAQHVRTPLFLVNAAYDSWQIKNILAPSVADPRGVWRNCKLDIL  299

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            +CS  QL  MQGFR+ FL+AL  +  S SRG+FINSCYAHCQTEVQETW R DSP LA  
Sbjct  300  RCSSRQLQTMQGFRLGFLRALITLGPSSSRGYFINSCYAHCQTEVQETWFRADSPKLANK  359

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IA A+GDW++D++ FQKIDCPYPCDK+CHNRVF+
Sbjct  360  TIAIALGDWFFDKNSFQKIDCPYPCDKTCHNRVFD  394



>ref|XP_007156330.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
 gb|ESW28324.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
Length=397

 Score =   247 bits (630),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++KPGLCFFPQN+   I TP+F VN+AYDSWQ+KNILAPG ADPHG W  CKLDI 
Sbjct  236  SCTSRLKPGLCFFPQNVVSQISTPIFFVNAAYDSWQIKNILAPGAADPHGQWRECKLDIK  295

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL +MQ FR +FL+A GAV NSPS+G FI+ CYAHCQT  QETWLR+DSPVL  T
Sbjct  296  NCSPNQLSVMQVFRTDFLRAFGAVGNSPSKGHFIDGCYAHCQTGTQETWLRNDSPVLGNT  355

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IA+AVGDW+YDR  F +IDC YPC+ +CHNR+F+
Sbjct  356  TIARAVGDWFYDRRAFHQIDCAYPCNPTCHNRIFD  390



>ref|XP_004512349.1| PREDICTED: protein notum homolog isoform X1 [Cicer arietinum]
 ref|XP_004512350.1| PREDICTED: protein notum homolog isoform X2 [Cicer arietinum]
Length=487

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ P LCFFPQ +   I TP+F VN+AYDSWQ+KNILAPGVADPHG WHSCK+DI 
Sbjct  279  SCTSRLNPKLCFFPQYVVSQITTPIFFVNAAYDSWQIKNILAPGVADPHGHWHSCKMDIN  338

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL +MQGFR EFL+AL  + NSPS+G FI+SCYAHCQTE+QETW R DSP+LA T
Sbjct  339  NCSSNQLDLMQGFRTEFLRALTVLGNSPSKGMFIDSCYAHCQTEMQETWFRSDSPLLAKT  398

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAV DW+Y+R  F +IDCPYPC+ SCHNRVFE
Sbjct  399  TIAKAVADWFYERRLFHQIDCPYPCNPSCHNRVFE  433



>ref|XP_007156331.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
 gb|ESW28325.1| hypothetical protein PHAVU_003G277500g [Phaseolus vulgaris]
Length=417

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++KPGLCFFPQN+   I TP+F VN+AYDSWQ+KNILAPG ADPHG W  CKLDI 
Sbjct  256  SCTSRLKPGLCFFPQNVVSQISTPIFFVNAAYDSWQIKNILAPGAADPHGQWRECKLDIK  315

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL +MQ FR +FL+A GAV NSPS+G FI+ CYAHCQT  QETWLR+DSPVL  T
Sbjct  316  NCSPNQLSVMQVFRTDFLRAFGAVGNSPSKGHFIDGCYAHCQTGTQETWLRNDSPVLGNT  375

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IA+AVGDW+YDR  F +IDC YPC+ +CHNR+F+
Sbjct  376  TIARAVGDWFYDRRAFHQIDCAYPCNPTCHNRIFD  410



>ref|XP_010942975.1| PREDICTED: protein notum homolog isoform X1 [Elaeis guineensis]
 ref|XP_010942976.1| PREDICTED: protein notum homolog isoform X1 [Elaeis guineensis]
Length=397

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 122/154 (79%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ P +CFFPQNM   I TPLF +N+AYDSWQ++NIL PGVADPHGTWH CKLDI 
Sbjct  238  SCTSRLTPSMCFFPQNMVQQIHTPLFILNAAYDSWQIRNILVPGVADPHGTWHYCKLDIQ  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            +CS  QL IMQGFR EFL AL     S S G FINSCYAHCQ+E+QETWL  DSPVL   
Sbjct  298  QCSSPQLQIMQGFRTEFLNALAGFGRSSSTGMFINSCYAHCQSEMQETWLSSDSPVLEKM  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
             IAKAVGDW+YDR  FQKIDCPYPCD +CHNR+F
Sbjct  358  PIAKAVGDWFYDRIAFQKIDCPYPCDSTCHNRIF  391



>gb|KHN41567.1| Protein notum like [Glycine soja]
Length=399

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+++PGLCFFPQN+   I TP+F VN+AYDSWQ+KNILAPG ADPHG W  CKLDI 
Sbjct  238  SCTSRLRPGLCFFPQNVVSQISTPIFFVNAAYDSWQIKNILAPGAADPHGQWRECKLDIK  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL +MQGFR +FL+A   V N  S+G FI+ CYAHCQT +QETWLR+DSPV+A T
Sbjct  298  NCSPNQLSVMQGFRTDFLRAFSVVGNGASKGHFIDGCYAHCQTGIQETWLRNDSPVVAKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            SIAKAVGDW+YDR PF++IDC YPC+ +CHNR+F+
Sbjct  358  SIAKAVGDWFYDRRPFREIDCAYPCNPTCHNRIFD  392



>ref|XP_006361581.1| PREDICTED: protein notum homolog [Solanum tuberosum]
Length=387

 Score =   244 bits (624),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++KPGLCFFPQN+A  IQTPLF VN+AYDSWQ+K+ILAP VADPHGTW +CKLDIL
Sbjct  238  SCTSRLKPGLCFFPQNVAQHIQTPLFLVNAAYDSWQIKHILAPEVADPHGTWRNCKLDIL  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL  MQ FR EFLKAL ++  S +RG++INSCYAHCQT  QETWL DDS VL+GT
Sbjct  298  NCSSTQLQTMQAFRSEFLKALNSLGPSSTRGYYINSCYAHCQTGTQETWLMDDSLVLSGT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSC  316
            +IAKAVGDWYY+R  FQ+IDCPYPC+K+C
Sbjct  358  TIAKAVGDWYYERKRFQEIDCPYPCNKTC  386



>ref|XP_008373439.1| PREDICTED: protein notum homolog isoform X2 [Malus domestica]
 ref|XP_008373440.1| PREDICTED: protein notum homolog isoform X2 [Malus domestica]
Length=438

 Score =   246 bits (627),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK+ PGLCFFPQ  A  I+TP+F VN+AYDSWQ+KNILAPGVADPHGTW +CKLDI 
Sbjct  238  SCTSKLSPGLCFFPQYFASQIRTPMFYVNAAYDSWQIKNILAPGVADPHGTWQNCKLDIT  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C  +QL  MQ FR +FL A+G V+ S S+G FI+SCYAHCQTE+QETWL  DSPVL  T
Sbjct  298  HCKPTQLKTMQDFRAQFLSAIGGVSGSRSKGMFIDSCYAHCQTELQETWLMPDSPVLNKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDW+YDR+PFQKIDCPYPC+ +CHNR F+
Sbjct  358  TIAKAVGDWFYDRTPFQKIDCPYPCNPTCHNRNFD  392



>ref|XP_006599203.1| PREDICTED: uncharacterized protein LOC100781246 isoform X1 [Glycine 
max]
 ref|XP_006599204.1| PREDICTED: uncharacterized protein LOC100781246 isoform X2 [Glycine 
max]
 ref|XP_006599205.1| PREDICTED: uncharacterized protein LOC100781246 isoform X3 [Glycine 
max]
Length=399

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+++PGLCFFPQN+   I TP+F VN+AYDSWQ+KNILAPG ADP G W  CKLDI 
Sbjct  238  SCTSRLRPGLCFFPQNVVSQISTPIFFVNAAYDSWQIKNILAPGAADPRGQWRECKLDIK  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL +MQGFR +FL+A   V N+ S+G FI+ CYAHCQT +QETWLR+DSPV+A T
Sbjct  298  NCSPNQLSVMQGFRTDFLRAFSVVGNAASKGHFIDGCYAHCQTGIQETWLRNDSPVVAKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            SIAKAVGDW+YDR PF++IDC YPC+ +CHNR+F+
Sbjct  358  SIAKAVGDWFYDRRPFREIDCAYPCNPTCHNRIFD  392



>ref|XP_010248193.1| PREDICTED: uncharacterized protein LOC104591101 [Nelumbo nucifera]
Length=394

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 128/155 (83%), Gaps = 1/155 (1%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK    LCFFPQN+AP + TPLF +N+AYDS+QVKNILAPG+ADPHGTWH CKLDI 
Sbjct  238  SCTSKGDXTLCFFPQNVAPQVTTPLFILNAAYDSYQVKNILAPGIADPHGTWHDCKLDIT  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCSD+QL  +QGFR EFL A+  V  SP++G FINSCY+HCQ+ +QETWLR+DSPVL   
Sbjct  298  KCSDTQLQAIQGFRKEFLNAIKGVEGSPTKGLFINSCYSHCQSGMQETWLREDSPVLDNM  357

Query  402  SIAKAVGDWYYDRSPFQKID-CPYPCDKSCHNRVF  301
            SI+KAVGDWY+DR   QKI+ C YPCDKSCHNRVF
Sbjct  358  SISKAVGDWYFDRGTVQKIEQCEYPCDKSCHNRVF  392



>gb|EPS71696.1| hypothetical protein M569_03061, partial [Genlisea aurea]
Length=395

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 133/160 (83%), Gaps = 6/160 (4%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CTS++KPGLCFFPQN+A  I+TPLF VN+AYDSWQ+KNILAPGVADPHGTWH CK DI K
Sbjct  230  CTSRLKPGLCFFPQNVAQEIRTPLFIVNAAYDSWQIKNILAPGVADPHGTWHDCKTDITK  289

Query  579  CSDSQLGIMQGFRMEFLKALG-----AVANSP-SRGFFINSCYAHCQTEVQETWLRDDSP  418
            CS SQL  MQ FR +FLK+L      ++ ++P S+G+FINSCYAHCQTE+QETW R DSP
Sbjct  290  CSKSQLQTMQDFRTQFLKSLNDGVGSSLTSTPSSKGYFINSCYAHCQTEMQETWFRSDSP  349

Query  417  VLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +L   +IA+A+GDW++DR+ FQ IDC YPCDK+CHNR+F+
Sbjct  350  LLNDKTIAEAIGDWFFDRNSFQHIDCAYPCDKTCHNRIFD  389



>gb|ACR35075.1| unknown [Zea mays]
Length=271

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS + PG CFFPQN    IQTPLF +N+AYDSWQV+NIL PGVADPHG WHSCK DI 
Sbjct  112  SCTSTLPPGTCFFPQNEVKQIQTPLFILNAAYDSWQVRNILVPGVADPHGKWHSCKHDID  171

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            +CS SQL ++QGFR +FLK +  + NS SRG FINSC+ HCQ+E+QE W   DSPVL  T
Sbjct  172  QCSASQLRVLQGFRGDFLKEVAELGNSDSRGLFINSCFVHCQSEIQELWFSSDSPVLGNT  231

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            ++A AVGDW++DRS FQKIDCPYPCD +CHNR+++
Sbjct  232  TVANAVGDWFFDRSSFQKIDCPYPCDSTCHNRIYD  266



>ref|XP_008373438.1| PREDICTED: protein notum homolog isoform X1 [Malus domestica]
Length=466

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK+ PGLCFFPQ  A  I+TP+F VN+AYDSWQ+KNILAPGVADPHGTW +CKLDI 
Sbjct  266  SCTSKLSPGLCFFPQYFASQIRTPMFYVNAAYDSWQIKNILAPGVADPHGTWQNCKLDIT  325

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C  +QL  MQ FR +FL A+G V+ S S+G FI+SCYAHCQTE+QETWL  DSPVL  T
Sbjct  326  HCKPTQLKTMQDFRAQFLSAIGGVSGSRSKGMFIDSCYAHCQTELQETWLMPDSPVLNKT  385

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDW+YDR+PFQKIDCPYPC+ +CHNR F+
Sbjct  386  TIAKAVGDWFYDRTPFQKIDCPYPCNPTCHNRNFD  420



>ref|XP_010266384.1| PREDICTED: uncharacterized protein LOC104603916 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010266385.1| PREDICTED: uncharacterized protein LOC104603916 isoform X2 [Nelumbo 
nucifera]
Length=391

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CTS MKP +CFFPQ +   I+TPLF +N+AYDSWQ++NIL PGVADPHG W SCKLDI  
Sbjct  237  CTSTMKPSMCFFPQYIVHGIRTPLFLLNAAYDSWQIRNILVPGVADPHGYWLSCKLDIKN  296

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            CS  QL  MQGFRMEFL AL     S SRG FINSCYAHCQ+E+QETWL+DDSPVL  T 
Sbjct  297  CSSIQLQTMQGFRMEFLSALLG-QRSSSRGMFINSCYAHCQSEMQETWLQDDSPVLDNTP  355

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            IAKAVGDWYYDR  FQKIDCPYPCDKSCHN VF
Sbjct  356  IAKAVGDWYYDRRSFQKIDCPYPCDKSCHNHVF  388



>ref|XP_010266383.1| PREDICTED: uncharacterized protein LOC104603916 isoform X1 [Nelumbo 
nucifera]
Length=434

 Score =   243 bits (621),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CTS MKP +CFFPQ +   I+TPLF +N+AYDSWQ++NIL PGVADPHG W SCKLDI  
Sbjct  280  CTSTMKPSMCFFPQYIVHGIRTPLFLLNAAYDSWQIRNILVPGVADPHGYWLSCKLDIKN  339

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            CS  QL  MQGFRMEFL AL     S SRG FINSCYAHCQ+E+QETWL+DDSPVL  T 
Sbjct  340  CSSIQLQTMQGFRMEFLSALLG-QRSSSRGMFINSCYAHCQSEMQETWLQDDSPVLDNTP  398

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            IAKAVGDWYYDR  FQKIDCPYPCDKSCHN VF
Sbjct  399  IAKAVGDWYYDRRSFQKIDCPYPCDKSCHNHVF  431



>ref|XP_010266381.1| PREDICTED: uncharacterized protein LOC104603915 isoform X2 [Nelumbo 
nucifera]
Length=399

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+ +P LCFFPQN+   + T LF +N+AYDSWQ+KN LAPGVADPHG WH CKLDI 
Sbjct  238  SCTSRTEPSLCFFPQNVVQDMYTQLFILNAAYDSWQIKNTLAPGVADPHGHWHYCKLDIK  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS SQL  MQGFR EFL ++G + +S  +G FINSCYAHCQ+EVQETWLR DSPVL  T
Sbjct  298  NCSSSQLQTMQGFRSEFLNSVGELMSSSMKGMFINSCYAHCQSEVQETWLRADSPVLDKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
             IAKAVGDWY DRS F+KIDCPYPCD SCHNRVF
Sbjct  358  PIAKAVGDWYNDRSDFKKIDCPYPCDGSCHNRVF  391



>ref|XP_006587657.1| PREDICTED: protein notum homolog isoform X3 [Glycine max]
 gb|KHN11801.1| Protein notum like [Glycine soja]
Length=400

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ P LCFFPQ +   I TP+F VN+AYDSWQ+KNILAPGVADP G WHSCKLDI 
Sbjct  238  SCTSRLSPRLCFFPQYLVSRITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDIN  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL +MQGFR EFL+A+  + NS S+G FI+SCYAHCQTE+QETWLR DSP L  T
Sbjct  298  NCSPDQLDLMQGFRTEFLRAITVLGNSSSKGMFIDSCYAHCQTEMQETWLRSDSPELKKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAV DW+Y+R PF +IDCPYPC+ +CHNRVF+
Sbjct  358  TIAKAVADWFYERRPFHQIDCPYPCNPTCHNRVFD  392



>ref|XP_010266380.1| PREDICTED: uncharacterized protein LOC104603915 isoform X1 [Nelumbo 
nucifera]
Length=412

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+ +P LCFFPQN+   + T LF +N+AYDSWQ+KN LAPGVADPHG WH CKLDI 
Sbjct  251  SCTSRTEPSLCFFPQNVVQDMYTQLFILNAAYDSWQIKNTLAPGVADPHGHWHYCKLDIK  310

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS SQL  MQGFR EFL ++G + +S  +G FINSCYAHCQ+EVQETWLR DSPVL  T
Sbjct  311  NCSSSQLQTMQGFRSEFLNSVGELMSSSMKGMFINSCYAHCQSEVQETWLRADSPVLDKT  370

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
             IAKAVGDWY DRS F+KIDCPYPCD SCHNRVF
Sbjct  371  PIAKAVGDWYNDRSDFKKIDCPYPCDGSCHNRVF  404



>ref|XP_006587656.1| PREDICTED: protein notum homolog isoform X2 [Glycine max]
Length=450

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ P LCFFPQ +   I TP+F VN+AYDSWQ+KNILAPGVADP G WHSCKLDI 
Sbjct  238  SCTSRLSPRLCFFPQYLVSRITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDIN  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL +MQGFR EFL+A+  + NS S+G FI+SCYAHCQTE+QETWLR DSP L  T
Sbjct  298  NCSPDQLDLMQGFRTEFLRAITVLGNSSSKGMFIDSCYAHCQTEMQETWLRSDSPELKKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAV DW+Y+R PF +IDCPYPC+ +CHNRVF+
Sbjct  358  TIAKAVADWFYERRPFHQIDCPYPCNPTCHNRVFD  392



>ref|XP_006587655.1| PREDICTED: protein notum homolog isoform X1 [Glycine max]
Length=453

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ P LCFFPQ +   I TP+F VN+AYDSWQ+KNILAPGVADP G WHSCKLDI 
Sbjct  241  SCTSRLSPRLCFFPQYLVSRITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDIN  300

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL +MQGFR EFL+A+  + NS S+G FI+SCYAHCQTE+QETWLR DSP L  T
Sbjct  301  NCSPDQLDLMQGFRTEFLRAITVLGNSSSKGMFIDSCYAHCQTEMQETWLRSDSPELKKT  360

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAV DW+Y+R PF +IDCPYPC+ +CHNRVF+
Sbjct  361  TIAKAVADWFYERRPFHQIDCPYPCNPTCHNRVFD  395



>ref|NP_001151183.1| LOC100284816 precursor [Zea mays]
 gb|ACG41900.1| carboxylic ester hydrolase [Zea mays]
Length=398

 Score =   239 bits (610),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS + PG CFFPQN    IQTPLF +N+AYDSWQV+NIL PGVADPHG WHSCK DI 
Sbjct  239  SCTSTLPPGTCFFPQNEVKQIQTPLFILNAAYDSWQVRNILVPGVADPHGKWHSCKHDID  298

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            +CS SQL ++QGFR +FLK +  + NS SRG FINSC+ HCQ+E+QE W   DSPVL  T
Sbjct  299  QCSASQLRVLQGFRGDFLKEVAELGNSDSRGLFINSCFVHCQSEIQELWFSSDSPVLGNT  358

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            ++A AVGDW++DRS FQKIDCPYPCD +CHNR+++
Sbjct  359  TVANAVGDWFFDRSSFQKIDCPYPCDSTCHNRIYD  393



>gb|ACG39759.1| carboxylic ester hydrolase [Zea mays]
Length=398

 Score =   239 bits (610),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS + PG CFFPQN    IQTPLF +N+AYDSWQV+NIL PGVADPHG WHSCK DI 
Sbjct  239  SCTSTLPPGTCFFPQNEVKQIQTPLFILNAAYDSWQVRNILVPGVADPHGKWHSCKHDID  298

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            +CS SQL ++QGFR +FLK +  + NS SRG FINSC+ HCQ+E+QE W   DSPVL  T
Sbjct  299  QCSASQLRVLQGFRGDFLKEVAELGNSDSRGLFINSCFVHCQSEIQELWFSSDSPVLGNT  358

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            ++A AVGDW++DRS FQKIDCPYPCD +CHNR+++
Sbjct  359  TVANAVGDWFFDRSSFQKIDCPYPCDSTCHNRIYD  393



>ref|XP_006573492.1| PREDICTED: protein notum homolog isoform X2 [Glycine max]
Length=400

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++   LCFFPQ +   I TP+F VN+AYDSWQ+KNILAPGVADP G WHSCKLDI 
Sbjct  238  SCTSRLSAKLCFFPQYLVSRITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDIN  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL +MQGFR EFL+A+  + NS S+G FI+SCYAHCQTE+QETWLR DSP L  T
Sbjct  298  NCSPDQLDLMQGFRTEFLRAITVLGNSSSKGMFIDSCYAHCQTEMQETWLRSDSPELKKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAV DW+Y+R PF +IDCPYPC+ +CHNRVF+
Sbjct  358  TIAKAVADWFYERRPFHQIDCPYPCNPTCHNRVFD  392



>gb|EYU37455.1| hypothetical protein MIMGU_mgv1a007934mg [Erythranthe guttata]
Length=390

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 128/160 (80%), Gaps = 7/160 (4%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSKMKP LCFFPQ ++  I+TPLF +N+AYDSWQ+KNILAPGVADPHG WH CK DI 
Sbjct  232  SCTSKMKPSLCFFPQYVSKEIRTPLFVINAAYDSWQIKNILAPGVADPHGIWHDCKTDIT  291

Query  582  KCSDSQLGIMQGFRMEFLKA----LGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPV  415
            KCS  QL  MQGFR+EFLKA    LG + N  +RG+FINSCYAHCQTE+QE W   DSP 
Sbjct  292  KCSTDQLRTMQGFRLEFLKAISSGLGPLIN--TRGYFINSCYAHCQTEMQENWFAIDSPK  349

Query  414  LAGTSIAKAVGDWYYDRS-PFQKIDCPYPCDKSCHNRVFE  298
            L   +IAKAVGDW+YD S PFQ+ DCPYPCDK+CHNRVF+
Sbjct  350  LNNKTIAKAVGDWFYDTSEPFQRGDCPYPCDKTCHNRVFD  389



>ref|XP_006573491.1| PREDICTED: protein notum homolog isoform X1 [Glycine max]
Length=447

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++   LCFFPQ +   I TP+F VN+AYDSWQ+KNILAPGVADP G WHSCKLDI 
Sbjct  238  SCTSRLSAKLCFFPQYLVSRITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDIN  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL +MQGFR EFL+A+  + NS S+G FI+SCYAHCQTE+QETWLR DSP L  T
Sbjct  298  NCSPDQLDLMQGFRTEFLRAITVLGNSSSKGMFIDSCYAHCQTEMQETWLRSDSPELKKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAV DW+Y+R PF +IDCPYPC+ +CHNRVF+
Sbjct  358  TIAKAVADWFYERRPFHQIDCPYPCNPTCHNRVFD  392



>gb|KHN41756.1| Protein notum like [Glycine soja]
Length=449

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++   LCFFPQ +   I TP+F VN+AYDSWQ+KNILAPGVADP G WHSCKLDI 
Sbjct  238  SCTSRLSAKLCFFPQYLVSRITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDIN  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL +MQGFR EFL+A+  + NS S+G FI+SCYAHCQTE+QETWLR DSP L  T
Sbjct  298  NCSPDQLDLMQGFRTEFLRAITVLGNSSSKGMFIDSCYAHCQTEMQETWLRSDSPELKKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAV DW+Y+R PF +IDCPYPC+ +CHNRVF+
Sbjct  358  TIAKAVADWFYERRPFHQIDCPYPCNPTCHNRVFD  392



>ref|XP_007158098.1| hypothetical protein PHAVU_002G123900g [Phaseolus vulgaris]
 gb|ESW30092.1| hypothetical protein PHAVU_002G123900g [Phaseolus vulgaris]
Length=400

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ P LCFFPQ +   I TP+F VN+AYDSWQ+KNILAPGVADP G WHSCKLDI 
Sbjct  238  SCTSRLTPKLCFFPQYLVSHITTPIFFVNAAYDSWQIKNILAPGVADPEGHWHSCKLDIN  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL +MQGFR EFL+AL  + NS  +G FI+SCYAHCQTE+QETWLR+DSP L  T
Sbjct  298  NCSPDQLDLMQGFRTEFLRALTVLGNSSYKGMFIDSCYAHCQTEMQETWLRNDSPELEKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAV DW+Y+R  F +IDCPYPC+ +CHNRV E
Sbjct  358  TIAKAVADWFYERRTFHQIDCPYPCNPTCHNRVLE  392



>gb|KHG23648.1| Notum [Gossypium arboreum]
Length=395

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+MKPGLCFFPQ +A  I+TPLF +N+AYDSWQ++NILAPG+ADPHG W SCKLDI 
Sbjct  234  SCTSRMKPGLCFFPQYIAQQIRTPLFIINAAYDSWQIRNILAPGIADPHGHWESCKLDIK  293

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C  SQ+ +MQ FR++FL AL  +  S SRG FI+SC+AHCQTE+QE W   DSP+L  T
Sbjct  294  NCLPSQIKVMQDFRLQFLVALLRLGKSASRGMFIDSCFAHCQTEMQELWFMQDSPLLNKT  353

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
             I KAVGDW+YDR+PFQKIDC YPC+ +CHNRV++
Sbjct  354  KIGKAVGDWFYDRNPFQKIDCAYPCNPTCHNRVYD  388



>gb|KHG23649.1| Notum [Gossypium arboreum]
Length=381

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+MKPGLCFFPQ +A  I+TPLF +N+AYDSWQ++NILAPG+ADPHG W SCKLDI 
Sbjct  220  SCTSRMKPGLCFFPQYIAQQIRTPLFIINAAYDSWQIRNILAPGIADPHGHWESCKLDIK  279

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C  SQ+ +MQ FR++FL AL  +  S SRG FI+SC+AHCQTE+QE W   DSP+L  T
Sbjct  280  NCLPSQIKVMQDFRLQFLVALLRLGKSASRGMFIDSCFAHCQTEMQELWFMQDSPLLNKT  339

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
             I KAVGDW+YDR+PFQKIDC YPC+ +CHNRV++
Sbjct  340  KIGKAVGDWFYDRNPFQKIDCAYPCNPTCHNRVYD  374



>ref|XP_007040902.1| Pectinacetylesterase family protein [Theobroma cacao]
 gb|EOY25403.1| Pectinacetylesterase family protein [Theobroma cacao]
Length=401

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+M+PGLCFFP+ MA  IQTPLF +N+AYDSWQ++NILAPG+ADP G W SCKLDI 
Sbjct  238  SCTSRMRPGLCFFPEYMAQQIQTPLFFINAAYDSWQIRNILAPGIADPRGYWESCKLDIK  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C  SQ+  MQ FR++FL AL  +  S SRG FI+SCYAHCQTE+Q  WL  DSP+L  T
Sbjct  298  NCLPSQIKTMQDFRLQFLVALLRLGKSSSRGMFIDSCYAHCQTEMQGLWLMPDSPLLNKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            SIAKAVGDW+YDR+PFQKIDC YPC+ +CHNR++E
Sbjct  358  SIAKAVGDWFYDRNPFQKIDCAYPCNPTCHNRIYE  392



>gb|KJB24941.1| hypothetical protein B456_004G175900 [Gossypium raimondii]
Length=400

 Score =   234 bits (597),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+MKPGLCFFPQN+A  I+TPLF +N+AYDSWQ++NILAPG+ADPHG W SCKLDI 
Sbjct  239  SCTSRMKPGLCFFPQNIAQQIRTPLFIINAAYDSWQIRNILAPGIADPHGHWESCKLDIK  298

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C  SQ+ +MQ FR++FL AL  +  S SRG FI+SC+AHCQTE+Q  W   DSP+L  T
Sbjct  299  NCLPSQIKVMQDFRLQFLVALLRLGKSASRGMFIDSCFAHCQTEMQGLWFMQDSPLLNKT  358

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
             I KAVGDW+YD+ PFQKIDC YPC+ +CHNRV++
Sbjct  359  KIGKAVGDWFYDKKPFQKIDCAYPCNPTCHNRVYD  393



>gb|AGT16732.1| carboxylic ester hydrolase [Saccharum hybrid cultivar R570]
Length=398

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCT  + PG+CFFPQN    IQTPLF +N+AYDSWQV+NIL PGVADPHG WHSCK DI 
Sbjct  239  SCTLMLPPGMCFFPQNEVKQIQTPLFILNAAYDSWQVRNILVPGVADPHGQWHSCKHDIG  298

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            +CS SQL ++QGFR +FLK +     S SRG FINSC+ HCQ+E QE WL  DSP+L  T
Sbjct  299  QCSASQLRVLQGFRGDFLKEVSEQWISDSRGLFINSCFVHCQSESQELWLSSDSPMLGNT  358

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IA AVGDW++DRS FQKIDCPYPCD +CHNR++E
Sbjct  359  TIANAVGDWFFDRSTFQKIDCPYPCDSTCHNRIYE  393



>ref|XP_004300391.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011465290.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011465291.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. 
vesca]
Length=399

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK++P LCFFPQ + P I+TP+F VN+AYDSWQ+KNI+ PGVADPHGTW +CKLDI 
Sbjct  239  SCTSKLRPDLCFFPQYVVPQIRTPIFYVNAAYDSWQIKNIVVPGVADPHGTWRNCKLDIK  298

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL  MQ FR++FL A+G V+NS  +G FI+SCY HCQTE+QETW   +SP+L  T
Sbjct  299  NCSPTQLKTMQNFRLQFLSAIGGVSNSAVKGMFIDSCYLHCQTELQETWSMPNSPLLNKT  358

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IA+AVGDW+YDR+ FQKIDCPYPC+ +CH  +F+
Sbjct  359  TIARAVGDWFYDRTSFQKIDCPYPCNPTCHAPIFD  393



>ref|XP_004953590.1| PREDICTED: protein notum homolog isoform X1 [Setaria italica]
Length=401

 Score =   231 bits (590),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS + PG+CFFP N    IQTPLF +N+AYD WQV+NIL PGVAD  GTWHSCK DI 
Sbjct  242  SCTSILPPGVCFFPSNEVKQIQTPLFILNAAYDYWQVRNILVPGVADRRGTWHSCKHDID  301

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            +CS +QL ++QGFR +FLKA+    NS SRG FINSC+ HCQ+E+QE W   DSP+L  T
Sbjct  302  QCSAAQLRVLQGFRDDFLKAVAEQGNSTSRGLFINSCFVHCQSEIQELWFSSDSPMLGNT  361

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IA AVGDW++DRSPFQKIDCPYPCD +CHNR+ +
Sbjct  362  TIAAAVGDWFFDRSPFQKIDCPYPCDSTCHNRIHD  396



>ref|NP_001047850.1| Os02g0702400 [Oryza sativa Japonica Group]
 dbj|BAD07550.1| putative pectin acetylesterase [Oryza sativa Japonica Group]
 dbj|BAD08059.1| putative pectin acetylesterase [Oryza sativa Japonica Group]
 dbj|BAF09764.1| Os02g0702400 [Oryza sativa Japonica Group]
 dbj|BAG91018.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57637.1| hypothetical protein OsJ_08062 [Oryza sativa Japonica Group]
Length=397

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            +CTS++ PG+CFFPQN    IQTPLF +N+AYDSWQV+NIL PG ADPHG WHSCK DI 
Sbjct  238  ACTSRLSPGMCFFPQNEVKQIQTPLFILNAAYDSWQVRNILVPGFADPHGKWHSCKHDID  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            +C  SQL I+QGFR +FLKAL       +RG FINSC+ HCQ+E QETW    SP+L   
Sbjct  298  QCPASQLQILQGFRDDFLKALKEQGTPSTRGLFINSCFVHCQSETQETWFASGSPMLETK  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IA AVGDW+YDR+PFQKIDCPYPCD +CHNR+++
Sbjct  358  TIADAVGDWFYDRNPFQKIDCPYPCDSTCHNRIYD  392



>ref|XP_007209217.1| hypothetical protein PRUPE_ppa006718mg [Prunus persica]
 gb|EMJ10416.1| hypothetical protein PRUPE_ppa006718mg [Prunus persica]
 gb|AIA21744.1| pectin acetylesterase [Prunus persica]
Length=398

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK+ PGLCFFPQN+ P  +TP+F VN+AYDSWQ+KNILAPG+ADP G W  CKLDI 
Sbjct  238  SCTSKLSPGLCFFPQNVVPVTRTPIFLVNAAYDSWQIKNILAPGIADPKGAWKKCKLDIK  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS SQL  MQ +R++FL AL   ++S + G FI+SCYAHCQ   QETWL  DSPVL+ T
Sbjct  298  NCSPSQLQTMQEYRLQFLGALSHASSSTTHGLFIDSCYAHCQIGTQETWLAADSPVLSKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +I KAVGDWY DR+PFQKIDC YPC+ +C NRVF+
Sbjct  358  TIGKAVGDWYTDRTPFQKIDCAYPCNPTCKNRVFD  392



>ref|XP_006647750.1| PREDICTED: uncharacterized protein LOC102707556 [Oryza brachyantha]
Length=304

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS + PG+CFFPQN    IQTPLF +N+AYDSWQV+NILAPG ADPHG WHSCK DI 
Sbjct  146  SCTSNLPPGMCFFPQNEVKHIQTPLFILNAAYDSWQVRNILAPGFADPHGKWHSCKGDIE  205

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            +C  SQL I+QGFR +FL+AL    +  +RG FINSC+ HCQ+E+QE W    +P+L   
Sbjct  206  QCPASQLQILQGFRNDFLEALEEQGSPSTRGLFINSCFVHCQSEMQEIWFASGAPMLGNK  265

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IA AVGDW+YDRSPFQKIDC YPCD +CHNR+++
Sbjct  266  TIADAVGDWFYDRSPFQKIDCAYPCDSTCHNRIYD  300



>ref|XP_002519911.1| pectin acetylesterase, putative [Ricinus communis]
 gb|EEF42515.1| pectin acetylesterase, putative [Ricinus communis]
Length=399

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++KP LCFFPQ +   I+TPLF +N+AYDSWQ+KNILAPGVADP G+W+SCKLDI 
Sbjct  238  SCTSRLKPALCFFPQYLVQQIRTPLFILNAAYDSWQIKNILAPGVADPRGSWNSCKLDIN  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL  MQ FRM FL AL   ANS S+G +I+SCYAHCQTE QETW   DSPVL+ T
Sbjct  298  NCSPIQLKTMQDFRMRFLSALYRSANSSSKGLYIDSCYAHCQTETQETWFMADSPVLSKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHN  310
             IAKAVGDW+YDR PFQKIDCPYPC+ +C N
Sbjct  358  KIAKAVGDWFYDRIPFQKIDCPYPCNPTCSN  388



>ref|XP_009413211.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=397

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+M P +CFFPQ + P ++T LF +N+AYD+WQ+KNILAP  ADPH TW+ CKLDI 
Sbjct  243  SCTSRMTPSMCFFPQYVVPQMRTSLFILNAAYDAWQIKNILAPSAADPHKTWNDCKLDIK  302

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            +CS  QL IMQGFR EFL AL A+ NS +RG FINSCYAHCQ+  Q+TWL  DSP L   
Sbjct  303  QCSSDQLQIMQGFRSEFLNALAALGNSSARGMFINSCYAHCQSGSQDTWLAADSPALDNI  362

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
             I KAVGDW+YDRS F+KIDCPYPCD SC NRV++
Sbjct  363  PIGKAVGDWFYDRSAFRKIDCPYPCDSSCRNRVYD  397



>ref|XP_002454426.1| hypothetical protein SORBIDRAFT_04g030720 [Sorghum bicolor]
 gb|EES07402.1| hypothetical protein SORBIDRAFT_04g030720 [Sorghum bicolor]
Length=398

 Score =   229 bits (585),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS + PG+CFFP+N    I TPLF +N+AYDSWQV+NIL PGVADPHG WHSCK DI 
Sbjct  239  SCTSMLPPGMCFFPKNEVKQIHTPLFILNAAYDSWQVRNILVPGVADPHGKWHSCKHDIG  298

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            +CS SQL ++QGFR +FLK +   ANS SRG FINSC+ HCQ+E QE W   DSP L  T
Sbjct  299  QCSASQLRVLQGFRGDFLKEVSEQANSDSRGLFINSCFVHCQSESQELWFSSDSPKLGNT  358

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IA AVGDW++ RS FQKIDCPYPCD +CHN ++E
Sbjct  359  TIANAVGDWFFGRSSFQKIDCPYPCDSTCHNGIYE  393



>gb|EYU29129.1| hypothetical protein MIMGU_mgv1a023759mg [Erythranthe guttata]
Length=384

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSKMKPGLCFFPQ +   IQTPLF VN+AYD+WQ+KN+LAP +ADP G W++C  DI 
Sbjct  223  SCTSKMKPGLCFFPQQVVQEIQTPLFIVNAAYDAWQIKNVLAPAIADPSGIWYNCTTDIR  282

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL  + GFR EFL    A+  S +RG+FINSC+AHCQTE+Q TW + +SP L   
Sbjct  283  NCSTAQLQTLHGFRKEFLNEFSAIGTSITRGYFINSCFAHCQTEMQITWFKPNSPKLNNK  342

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDW++DRSPFQ IDCPYPCDK+C+N V +
Sbjct  343  TIAKAVGDWFFDRSPFQTIDCPYPCDKTCNNLVLQ  377



>ref|XP_010054028.1| PREDICTED: uncharacterized protein LOC104442333 isoform X2 [Eucalyptus 
grandis]
 gb|KCW78411.1| hypothetical protein EUGRSUZ_D02577 [Eucalyptus grandis]
Length=400

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS   PGLCFFPQ MA  +QTPLF +N+AYDSWQ+KNILAPGVADP GTWH C+LDI 
Sbjct  239  SCTSIFSPGLCFFPQYMARQMQTPLFILNAAYDSWQIKNILAPGVADPQGTWHGCELDIN  298

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL +MQ FR+EF+ +LG + +S SRG FI+SCYAHCQ+E QETWL  DSPVLA T
Sbjct  299  NCSPNQLKVMQDFRLEFMYSLGRLGSSSSRGLFIDSCYAHCQSETQETWLWGDSPVLAKT  358

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            SIA+AVGDW++DR PFQKIDC YPC+ +CHNRVF+
Sbjct  359  SIARAVGDWFFDRKPFQKIDCAYPCNPTCHNRVFD  393



>dbj|BAD94548.1| pectinacetylesterase like protein [Arabidopsis thaliana]
Length=195

 Score =   219 bits (559),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ P +CFFPQ +A  I+TPLF +N+AYDSWQ+KNILAP  ADP+G W SC+LDI 
Sbjct  34   SCTSRLTPAMCFFPQYVARQIRTPLFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIK  93

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C  SQ+ +MQ FR+EFL A+  +  S SRG FI+SCY HCQTE Q +W   DSP+L  T
Sbjct  94   NCHPSQIKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSPILNRT  153

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            +IAKAVGDW YDR+ FQKIDCPYPC+ +CH+RVF
Sbjct  154  TIAKAVGDWVYDRTLFQKIDCPYPCNPTCHHRVF  187



>ref|XP_009350399.1| PREDICTED: protein notum homolog [Pyrus x bretschneideri]
Length=398

 Score =   226 bits (576),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+M PGLCFFPQN+ P  +TP+F VN+AYDSWQ+KNILAPGVADP G W +CKL I 
Sbjct  238  SCTSRMSPGLCFFPQNVVPQTRTPIFFVNAAYDSWQIKNILAPGVADPKGAWKNCKLSIK  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS SQL  MQ +R++FL A+   ++S S G FI+SCYAHCQ   QETWL  DSP+L+ T
Sbjct  298  NCSPSQLQTMQEYRLQFLNAIAGASSSSSNGLFIDSCYAHCQIGTQETWLATDSPMLSKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDWYYDR+PF+ IDCPYPC+ +C NR F+
Sbjct  358  TIAKAVGDWYYDRTPFKNIDCPYPCNPTCKNREFD  392



>ref|XP_008355284.1| PREDICTED: uncharacterized protein LOC103418943 [Malus domestica]
Length=398

 Score =   226 bits (576),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+M PGLCFFPQN+ P  +TP+F VN+AYDSWQ+KNILAPGVADP G W +CKL I 
Sbjct  238  SCTSRMSPGLCFFPQNVVPQTRTPIFFVNAAYDSWQIKNILAPGVADPKGAWKNCKLSIK  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS SQL  MQ +R++FL A+   ++S S G FI+SCYAHCQ   QETWL  DSP+L+ T
Sbjct  298  NCSPSQLQTMQEYRLQFLNAVAGASSSSSNGLFIDSCYAHCQIGTQETWLATDSPMLSKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDWYYDR+PF+ IDCPYPC+ +C NR F+
Sbjct  358  TIAKAVGDWYYDRTPFKNIDCPYPCNPTCKNREFD  392



>ref|XP_010054026.1| PREDICTED: uncharacterized protein LOC104442333 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010054027.1| PREDICTED: uncharacterized protein LOC104442333 isoform X1 [Eucalyptus 
grandis]
Length=434

 Score =   227 bits (579),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS   PGLCFFPQ MA  +QTPLF +N+AYDSWQ+KNILAPGVADP GTWH C+LDI 
Sbjct  273  SCTSIFSPGLCFFPQYMARQMQTPLFILNAAYDSWQIKNILAPGVADPQGTWHGCELDIN  332

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL +MQ FR+EF+ +LG + +S SRG FI+SCYAHCQ+E QETWL  DSPVLA T
Sbjct  333  NCSPNQLKVMQDFRLEFMYSLGRLGSSSSRGLFIDSCYAHCQSETQETWLWGDSPVLAKT  392

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            SIA+AVGDW++DR PFQKIDC YPC+ +CHNRVF+
Sbjct  393  SIARAVGDWFFDRKPFQKIDCAYPCNPTCHNRVFD  427



>ref|XP_009398466.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009398467.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009398468.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009398469.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=395

 Score =   226 bits (576),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CTS ++PG+CFFPQ MA  I++PLF +N+AYDSWQ+KNIL P VAD HG+WH+CKLDI  
Sbjct  237  CTSMIEPGMCFFPQYMAQEIESPLFILNAAYDSWQIKNILVPTVADRHGSWHNCKLDIKL  296

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            CS +QL IMQ FR+EFL A+  +    SRG FINSCYAHCQ+E+QETWL  +SP+L    
Sbjct  297  CSSAQLQIMQEFRLEFLNAVNGLGTPSSRGLFINSCYAHCQSEMQETWLLPNSPMLDKIP  356

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHN  310
            IA+AVGDW+Y+RS FQKIDCPYPCD +CHN
Sbjct  357  IAEAVGDWFYNRSAFQKIDCPYPCDSTCHN  386



>ref|XP_008808370.1| PREDICTED: uncharacterized protein LOC103720446 isoform X3 [Phoenix 
dactylifera]
Length=401

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+  P +CFFPQ +  +++TPLF +N+AYD+WQ+KNILAP  +DP   W  CKLDI 
Sbjct  242  SCTSRFPPSMCFFPQYVVQSMRTPLFILNAAYDAWQIKNILAPSPSDPRKVWGECKLDIK  301

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS +QL +MQGFR +FL AL    +S S G FINSCYAHCQ+E+QETWL  +SPVL   
Sbjct  302  KCSSNQLQVMQGFRTQFLNALAGFGSSSSTGMFINSCYAHCQSEMQETWLSSNSPVLEKI  361

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
             IAKAVGDW+YDR  FQKIDCPYPCD +CHNR+FE
Sbjct  362  PIAKAVGDWFYDRIAFQKIDCPYPCDSTCHNRIFE  396



>dbj|BAH57249.1| AT4G19420 [Arabidopsis thaliana]
Length=246

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ P +CFFPQ +A  I+TPLF +N+AYDSWQ+KNILAP  ADP+G W SC+LDI 
Sbjct  85   SCTSRLTPAMCFFPQYVARQIRTPLFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIK  144

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C  SQ+ +MQ FR+EFL A+  +  S SRG FI+SCY HCQTE Q +W   DSP+L  T
Sbjct  145  NCHPSQIKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSPILNRT  204

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            +IAKAVGDW YDR+ FQKIDCPYPC+ +CH+RVF
Sbjct  205  TIAKAVGDWVYDRTLFQKIDCPYPCNPTCHHRVF  238



>ref|XP_006385135.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62932.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=367

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS +KP  CFFPQ +AP ++TPLF +N+AYDSWQ++NILAP +ADP G W SCKLDI 
Sbjct  206  SCTSVLKPSFCFFPQYVAPQVRTPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDIN  265

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL  MQ FR++FL AL    NS SRG +I+SCYAHCQTE QE W  +DSPVL   
Sbjct  266  NCSPLQLKSMQDFRLQFLNALNKSTNSSSRGLYIDSCYAHCQTETQEKWFMEDSPVLGKK  325

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHN  310
             IAKAVGDW+YDR+PFQKIDCPYPC+ SC N
Sbjct  326  KIAKAVGDWFYDRNPFQKIDCPYPCNPSCQN  356



>ref|XP_006494119.1| PREDICTED: protein notum homolog isoform X1 [Citrus sinensis]
 ref|XP_006494120.1| PREDICTED: protein notum homolog isoform X2 [Citrus sinensis]
Length=392

 Score =   224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ PGLCFFPQN+A  ++TPLF +NSAYDSWQ+ NIL P  ADP GTW SCK+DI 
Sbjct  240  SCTSRLSPGLCFFPQNVAGQVKTPLFIINSAYDSWQITNILVPDDADPKGTWSSCKVDIK  299

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL  MQGFR++FL AL  + NS SRG  I+SCY HC+TE QE WL  DSPVL  T
Sbjct  300  TCSSTQLQTMQGFRVQFLNALAELGNSSSRGMLIDSCYTHCRTEYQEAWLSADSPVLDKT  359

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCD  325
             IAKAVGDWYYDRSPFQKIDCPYPC+
Sbjct  360  PIAKAVGDWYYDRSPFQKIDCPYPCN  385



>ref|XP_006282674.1| hypothetical protein CARUB_v10005284mg [Capsella rubella]
 gb|EOA15572.1| hypothetical protein CARUB_v10005284mg [Capsella rubella]
Length=317

 Score =   222 bits (565),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ P +CFFPQ +A  I+TPLF +N+AYDSWQ+KNILAP  ADP+G W SC+LDI 
Sbjct  156  SCTSRLTPAMCFFPQYVAREIRTPLFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIK  215

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C  SQL +MQ FR+EFL A+  +  S SRG FI+SCY HCQTE Q +W   DSP+L  T
Sbjct  216  NCHPSQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSPILNRT  275

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            +IAKAVGDW YDR+ FQKIDCPYPC+ +CH+RVF
Sbjct  276  TIAKAVGDWVYDRTLFQKIDCPYPCNPTCHHRVF  309



>ref|XP_010676220.1| PREDICTED: uncharacterized protein LOC104892094 [Beta vulgaris 
subsp. vulgaris]
Length=439

 Score =   225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCT  +KP +CFFPQ MA   +TPLF +N+AYDSWQ+KNILAP VADP G W  CK+DI 
Sbjct  238  SCTRSLKPVMCFFPQYMAKRTRTPLFILNAAYDSWQIKNILAPVVADPRGLWSDCKIDIK  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL +MQ FR EFL A+  +  SPSRG FINSCYAHCQTE+QETW    SPVL  T
Sbjct  298  NCSTNQLSVMQDFRSEFLNAISKLGKSPSRGLFINSCYAHCQTEMQETWFSHHSPVLHKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDW+Y+R   Q IDC YPCD SC NR+FE
Sbjct  358  TIAKAVGDWFYNRRQLQMIDCAYPCDGSCQNRIFE  392



>ref|XP_003547731.1| PREDICTED: protein notum homolog isoform X1 [Glycine max]
 ref|XP_006599118.1| PREDICTED: protein notum homolog isoform X2 [Glycine max]
Length=398

 Score =   224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK+ P LCFFPQ +A  I TP+F VNSAYD WQ++NI  PG ADP  +WHSCK++I 
Sbjct  237  SCTSKLNPALCFFPQYVASHISTPIFVVNSAYDRWQIRNIFIPGSADPSNSWHSCKINIS  296

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL  +QGF+ EF +AL  V +SPS+G FI+SCYAHCQTE+QETWL+ DSP LA T
Sbjct  297  NCSTDQLSKIQGFKSEFERALSEVGDSPSKGMFIDSCYAHCQTELQETWLKSDSPQLANT  356

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            +IAKAVGDW+Y RS F  +DC +PC+ +CHNRVF
Sbjct  357  TIAKAVGDWFYGRSSFHHVDCNFPCNPTCHNRVF  390



>ref|XP_003628996.1| Carboxylic ester hydrolase [Medicago truncatula]
 gb|AET03472.1| pectinacetylesterase family protein [Medicago truncatula]
Length=406

 Score =   224 bits (571),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS + PGLCFFPQ MA +IQTP+F VN+AYDSWQ+KNILAPG ADP G W SCK ++ 
Sbjct  238  SCTSMLSPGLCFFPQYMASSIQTPIFIVNAAYDSWQIKNILAPGDADPDGQWRSCKTNLN  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL IMQ +R +FL+AL  ++NSPS G FI+SCY HCQTE QETW + DSP++   
Sbjct  298  NCSPEQLNIMQDYRTQFLEALSPISNSPSNGMFIDSCYVHCQTEPQETWFKSDSPMVGNK  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            ++AKAVGDW+Y+RSP ++IDC YPC+ +C NRV+E
Sbjct  358  TVAKAVGDWFYERSPSREIDCTYPCNPTCQNRVWE  392



>ref|XP_008372432.1| PREDICTED: uncharacterized protein LOC103435796 [Malus domestica]
Length=156

 Score =   216 bits (550),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = -2

Query  747  MKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILKCSDS  568
            M PGLCFFPQN+ P  +TP+F VN+AYDSWQ+KNILAPGVADP G W +CKL I  CS S
Sbjct  1    MSPGLCFFPQNVVPQTRTPIFFVNAAYDSWQIKNILAPGVADPKGAWKNCKLSIKNCSPS  60

Query  567  QLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTSIAKA  388
            QL  MQ +R++FL A+   ++S S G FI+SCYAHCQ   QETWL  DSP+L+ T+IAKA
Sbjct  61   QLQTMQEYRLQFLNAVAGASSSSSNGLFIDSCYAHCQIGTQETWLATDSPMLSKTTIAKA  120

Query  387  VGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            VGDWYYDR+PF+ IDCPYPC+ +C NR F+
Sbjct  121  VGDWYYDRTPFKNIDCPYPCNPTCKNREFD  150



>gb|KHN27509.1| Protein notum like [Glycine soja]
Length=398

 Score =   224 bits (570),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK+ P LCFFPQ +A  I TP+F VNSAYD WQ++NI  PG ADP  +WHSCK++I 
Sbjct  237  SCTSKLNPALCFFPQYVASHISTPIFVVNSAYDRWQIRNIFIPGSADPSNSWHSCKINIS  296

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL  +QGF+ EF +AL  V +SPS+G FI+SCYAHCQTE+QETWL+ DSP LA T
Sbjct  297  NCSTDQLSKIQGFKSEFERALSEVGDSPSKGVFIDSCYAHCQTELQETWLKSDSPQLANT  356

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            +IAKAVGDW+Y RS F  +DC +PC+ +CHNRVF
Sbjct  357  TIAKAVGDWFYGRSSFHHVDCNFPCNPTCHNRVF  390



>emb|CDY09288.1| BnaC03g63180D [Brassica napus]
Length=186

 Score =   217 bits (552),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            +CTS++ P +CFFPQ +A  I+TP+F +N+AYDSWQ+KNILAP  ADP+G W SC+LDI 
Sbjct  25   TCTSRLTPAMCFFPQYVARQIRTPVFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIK  84

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C  +QL +MQ FR+EFL A+  +  S SRG FI+SCY HCQTE Q +W   DSP+L  T
Sbjct  85   NCQPNQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSPILNRT  144

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            +IAKAVGDW YDR  FQKIDCPYPC+ +CH+RVF
Sbjct  145  TIAKAVGDWVYDRKLFQKIDCPYPCNPTCHHRVF  178



>dbj|BAH20235.1| AT4G19420 [Arabidopsis thaliana]
Length=305

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ P +CFFPQ +A  I+TPLF +N+AYDSWQ+KNILAP  ADP+G W SC+LDI 
Sbjct  144  SCTSRLTPAMCFFPQYVARQIRTPLFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIK  203

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C  SQ+ +MQ FR+EFL A+  +  S SRG FI+SCY HCQTE Q +W   DSP+L  T
Sbjct  204  NCHPSQIKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSPILNRT  263

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            +IAKAVGDW YDR+ FQKIDCPYPC+ +CH+RVF
Sbjct  264  TIAKAVGDWVYDRTLFQKIDCPYPCNPTCHHRVF  297



>ref|XP_011028483.1| PREDICTED: uncharacterized protein LOC105128479 isoform X3 [Populus 
euphratica]
 ref|XP_011028484.1| PREDICTED: uncharacterized protein LOC105128479 isoform X3 [Populus 
euphratica]
Length=427

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS +KP  CFFPQ +AP ++TPLF +N+AYDSWQ++NILAP +ADP G W SCKLDI 
Sbjct  238  SCTSMLKPSFCFFPQYVAPQVRTPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDIN  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL  MQ FR++FL AL    NS SRG +I+SCYAHCQTE QE W  +DSPVL   
Sbjct  298  NCSPLQLKSMQDFRLQFLNALKTSTNSSSRGLYIDSCYAHCQTETQEKWFMEDSPVLGKK  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHN  310
             IAKAVGDW+YDR+PFQKIDCPYPC+ SC N
Sbjct  358  KIAKAVGDWFYDRNPFQKIDCPYPCNPSCQN  388



>ref|XP_008378614.1| PREDICTED: uncharacterized protein LOC103441693 [Malus domestica]
 ref|XP_008347801.1| PREDICTED: uncharacterized protein LOC103410927 [Malus domestica]
Length=393

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+M PGLCFFPQN+ P  +TP+F VN+AYD WQ++NILAP VADP G W  CKL+I 
Sbjct  238  SCTSRMSPGLCFFPQNVVPLTRTPIFFVNAAYDWWQIQNILAPDVADPEGAWKKCKLNIK  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS SQL  MQ FR++FLK +   +NS S G+FI+SCYAHCQ E+QETWL  DSP+L  T
Sbjct  298  NCSPSQLQTMQEFRLQFLKTITGASNSSSHGWFIHSCYAHCQIEMQETWLAADSPMLCKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IA+AVGDWYYD +PF+KIDCPYPC+ +C N  F+
Sbjct  358  TIAEAVGDWYYDLTPFRKIDCPYPCNPTCKNAEFD  392



>ref|XP_006432880.1| hypothetical protein CICLE_v10001467mg [Citrus clementina]
 ref|XP_006471635.1| PREDICTED: protein notum homolog isoform X1 [Citrus sinensis]
 ref|XP_006471636.1| PREDICTED: protein notum homolog isoform X2 [Citrus sinensis]
 gb|ESR46120.1| hypothetical protein CICLE_v10001467mg [Citrus clementina]
 gb|KDO40407.1| hypothetical protein CISIN_1g016608mg [Citrus sinensis]
 gb|KDO40408.1| hypothetical protein CISIN_1g016608mg [Citrus sinensis]
Length=386

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ PGLCFFP+N+A  I+TPLF +NSAYDSWQ+ NIL P  ADP G W SCK+DI 
Sbjct  234  SCTSRLSPGLCFFPENVAGQIKTPLFIINSAYDSWQISNILVPEDADPKGAWSSCKVDIK  293

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL  MQGFR++FL AL  + NS SRG F++SCY HC+T+ QETW   DSPVL  T
Sbjct  294  TCSSTQLQTMQGFRVQFLNALAGLGNSSSRGMFVDSCYTHCRTDYQETWFSADSPVLDKT  353

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCD  325
             IAKAVGDWYYDRSPFQKIDCPYPC+
Sbjct  354  PIAKAVGDWYYDRSPFQKIDCPYPCN  379



>ref|XP_006385137.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 ref|XP_006385139.1| pectinacetylesterase family protein [Populus trichocarpa]
 gb|ERP62934.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62936.1| pectinacetylesterase family protein [Populus trichocarpa]
Length=399

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS +KP  CFFPQ +AP ++TPLF +N+AYDSWQ++NILAP +ADP G W SCKLDI 
Sbjct  238  SCTSVLKPSFCFFPQYVAPQVRTPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDIN  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL  MQ FR++FL AL    NS SRG +I+SCYAHCQTE QE W  +DSPVL   
Sbjct  298  NCSPLQLKSMQDFRLQFLNALNKSTNSSSRGLYIDSCYAHCQTETQEKWFMEDSPVLGKK  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHN  310
             IAKAVGDW+YDR+PFQKIDCPYPC+ SC N
Sbjct  358  KIAKAVGDWFYDRNPFQKIDCPYPCNPSCQN  388



>ref|XP_006385138.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62935.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=402

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS +KP  CFFPQ +AP ++TPLF +N+AYDSWQ++NILAP +ADP G W SCKLDI 
Sbjct  241  SCTSVLKPSFCFFPQYVAPQVRTPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDIN  300

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL  MQ FR++FL AL    NS SRG +I+SCYAHCQTE QE W  +DSPVL   
Sbjct  301  NCSPLQLKSMQDFRLQFLNALNKSTNSSSRGLYIDSCYAHCQTETQEKWFMEDSPVLGKK  360

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHN  310
             IAKAVGDW+YDR+PFQKIDCPYPC+ SC N
Sbjct  361  KIAKAVGDWFYDRNPFQKIDCPYPCNPSCQN  391



>gb|KDO40409.1| hypothetical protein CISIN_1g016608mg [Citrus sinensis]
Length=372

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ PGLCFFP+N+A  I+TPLF +NSAYDSWQ+ NIL P  ADP G W SCK+DI 
Sbjct  220  SCTSRLSPGLCFFPENVAGQIKTPLFIINSAYDSWQISNILVPEDADPKGAWSSCKVDIK  279

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL  MQGFR++FL AL  + NS SRG F++SCY HC+T+ QETW   DSPVL  T
Sbjct  280  TCSSTQLQTMQGFRVQFLNALAGLGNSSSRGMFVDSCYTHCRTDYQETWFSADSPVLDKT  339

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCD  325
             IAKAVGDWYYDRSPFQKIDCPYPC+
Sbjct  340  PIAKAVGDWYYDRSPFQKIDCPYPCN  365



>ref|XP_008246070.1| PREDICTED: uncharacterized protein LOC103344226, partial [Prunus 
mume]
Length=161

 Score =   214 bits (546),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = -2

Query  732  CFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILKCSDSQLGIM  553
            CFFPQN+ P  +TP+F VN+AYDSWQ+KNILAPG+ADP G W  CKLDI  CS SQL  M
Sbjct  11   CFFPQNVVPVTRTPIFLVNAAYDSWQIKNILAPGIADPKGAWKKCKLDIKNCSPSQLQTM  70

Query  552  QGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWY  373
            Q +R++FL AL   ++S S G FI+SCYAHCQ   QETWL  DSPVL+ T+I KAVGDWY
Sbjct  71   QEYRLQFLGALSQASSSTSHGLFIDSCYAHCQIGTQETWLAADSPVLSKTTIGKAVGDWY  130

Query  372  YDRSPFQKIDCPYPCDKSCHNRVFE  298
            +DR+PFQKIDC YPC+ +C NRVF+
Sbjct  131  HDRTPFQKIDCAYPCNPTCKNRVFD  155



>ref|XP_006385134.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
 gb|ERP62931.1| hypothetical protein POPTR_0004s24220g [Populus trichocarpa]
Length=430

 Score =   223 bits (568),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS +KP  CFFPQ +AP ++TPLF +N+AYDSWQ++NILAP +ADP G W SCKLDI 
Sbjct  241  SCTSVLKPSFCFFPQYVAPQVRTPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDIN  300

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL  MQ FR++FL AL    NS SRG +I+SCYAHCQTE QE W  +DSPVL   
Sbjct  301  NCSPLQLKSMQDFRLQFLNALNKSTNSSSRGLYIDSCYAHCQTETQEKWFMEDSPVLGKK  360

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHN  310
             IAKAVGDW+YDR+PFQKIDCPYPC+ SC N
Sbjct  361  KIAKAVGDWFYDRNPFQKIDCPYPCNPSCQN  391



>ref|XP_010439718.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=397

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 121/154 (79%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ P +CFFPQ +A  I+TPLF +N+AYDSWQ+KNILAP  ADP+G W SC+LDI 
Sbjct  236  SCTSRLTPAMCFFPQYVARQIRTPLFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIK  295

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C  SQL +MQ FR+EFL A+ ++  S SRG FI+SCY HCQTE Q +W   DSP+L  T
Sbjct  296  NCHPSQLKVMQDFRLEFLSAVISLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSPILNRT  355

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            +IAKAVGDW YDR+ FQKIDCPYPC+ +CH+RVF
Sbjct  356  TIAKAVGDWVYDRTLFQKIDCPYPCNPTCHHRVF  389



>ref|XP_011028482.1| PREDICTED: uncharacterized protein LOC105128479 isoform X2 [Populus 
euphratica]
Length=481

 Score =   224 bits (571),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS +KP  CFFPQ +AP ++TPLF +N+AYDSWQ++NILAP +ADP G W SCKLDI 
Sbjct  320  SCTSMLKPSFCFFPQYVAPQVRTPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDIN  379

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL  MQ FR++FL AL    NS SRG +I+SCYAHCQTE QE W  +DSPVL   
Sbjct  380  NCSPLQLKSMQDFRLQFLNALKTSTNSSSRGLYIDSCYAHCQTETQEKWFMEDSPVLGKK  439

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHN  310
             IAKAVGDW+YDR+PFQKIDCPYPC+ SC N
Sbjct  440  KIAKAVGDWFYDRNPFQKIDCPYPCNPSCQN  470



>ref|XP_007156332.1| hypothetical protein PHAVU_003G277600g [Phaseolus vulgaris]
 gb|ESW28326.1| hypothetical protein PHAVU_003G277600g [Phaseolus vulgaris]
Length=399

 Score =   222 bits (565),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK+  GLCFFPQ +A  I TP+F VNSAYDSWQ++NILAPG ADP   WHSCKLD+ 
Sbjct  238  SCTSKLSSGLCFFPQYVASHISTPIFIVNSAYDSWQIRNILAPGAADPSDNWHSCKLDLA  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS  QL I+QGF+ EF KA+  V +S S G FINSCY HCQTE QETW + DSP LA T
Sbjct  298  KCSPDQLSIVQGFKKEFEKAVSVVGDSSSNGMFINSCYDHCQTESQETWSKSDSPHLANT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRV  304
            +I+KAVG+W+YDRSPF  +DC YPC+ +C N V
Sbjct  358  TISKAVGNWFYDRSPFHHVDCNYPCNPTCQNTV  390



>ref|XP_011028479.1| PREDICTED: uncharacterized protein LOC105128479 isoform X1 [Populus 
euphratica]
 ref|XP_011028480.1| PREDICTED: uncharacterized protein LOC105128479 isoform X1 [Populus 
euphratica]
 ref|XP_011028481.1| PREDICTED: uncharacterized protein LOC105128479 isoform X1 [Populus 
euphratica]
Length=509

 Score =   224 bits (572),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS +KP  CFFPQ +AP ++TPLF +N+AYDSWQ++NILAP +ADP G W SCKLDI 
Sbjct  320  SCTSMLKPSFCFFPQYVAPQVRTPLFILNAAYDSWQIRNILAPSIADPLGVWKSCKLDIN  379

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL  MQ FR++FL AL    NS SRG +I+SCYAHCQTE QE W  +DSPVL   
Sbjct  380  NCSPLQLKSMQDFRLQFLNALKTSTNSSSRGLYIDSCYAHCQTETQEKWFMEDSPVLGKK  439

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHN  310
             IAKAVGDW+YDR+PFQKIDCPYPC+ SC N
Sbjct  440  KIAKAVGDWFYDRNPFQKIDCPYPCNPSCQN  470



>ref|XP_010434420.1| PREDICTED: protein notum homolog [Camelina sativa]
 ref|XP_010434421.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=397

 Score =   221 bits (564),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ P +CFFPQ +A  I+TPLF +N+AYDSWQ+KNILAP  ADP+G W SC+LDI 
Sbjct  236  SCTSRLTPAMCFFPQYVARQIRTPLFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIK  295

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C  SQL +MQ FR+EFL A+  +  S SRG FI+SCY HCQTE Q +W   DSP+L  T
Sbjct  296  NCHPSQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSPILNRT  355

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            +IAKAVGDW YDR+ FQKIDCPYPC+ +CH+RVF
Sbjct  356  TIAKAVGDWVYDRTLFQKIDCPYPCNPTCHHRVF  389



>gb|AFK37852.1| unknown [Lotus japonicus]
Length=399

 Score =   221 bits (564),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 116/155 (75%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+  PGLCFFPQ +A  I TP+F VN+AYD+WQ+ NI A G ADPHG WH+CKLDI 
Sbjct  238  SCTSRRSPGLCFFPQYVASEISTPIFYVNAAYDTWQIHNIFARGSADPHGIWHNCKLDIN  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL  +QGFR EF+KAL    NS S G FI+SCY HCQTE QE+WL  DSP LA T
Sbjct  298  NCSPDQLTAIQGFRTEFIKALSVTENSRSEGMFIDSCYVHCQTETQESWLSSDSPQLANT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
             + KAVGDW+Y+RSPFQKIDC +PC+ +C N  F+
Sbjct  358  KLGKAVGDWFYERSPFQKIDCSFPCNPTCRNLAFD  392



>ref|XP_002867938.1| pectinacetylesterase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44197.1| pectinacetylesterase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=380

 Score =   221 bits (562),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ P +CFFPQ +A  I+TPLF +N+AYDSWQ+KNILAP  ADP+G W SC+LDI 
Sbjct  219  SCTSRLTPAMCFFPQYVARQIRTPLFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIK  278

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C  SQ+ +MQ FR+EFL A+  +  S SRG FI+SCY HCQTE Q +W   DSP+L  T
Sbjct  279  NCHPSQIKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSPILNRT  338

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            +IAKAVGDW YDR+ FQKIDCPYPC+ +CH+RVF
Sbjct  339  TIAKAVGDWVYDRTLFQKIDCPYPCNPTCHHRVF  372



>ref|XP_010449357.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=397

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ P +CFFPQ +A  I+TPLF +N+AYDSWQ+KNILAP  ADP+G W SC+LDI 
Sbjct  236  SCTSRLTPAMCFFPQYVARQIRTPLFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIK  295

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C  SQL +MQ FR+EFL A+  +  S SRG FI+SCY HCQTE Q +W   DSP+L  T
Sbjct  296  NCHPSQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSPILNRT  355

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            +IAKAVGDW YDR  FQKIDCPYPC+ +CH+RVF
Sbjct  356  TIAKAVGDWVYDRKLFQKIDCPYPCNPTCHHRVF  389



>ref|XP_009108427.1| PREDICTED: protein notum homolog [Brassica rapa]
Length=397

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ P +CFFPQ +A  I+TP+F +N+AYDSWQ+KNILAP  ADP G W SC+LDI 
Sbjct  236  SCTSRLNPAMCFFPQYVARQIRTPVFVLNAAYDSWQIKNILAPRAADPEGKWQSCQLDIK  295

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C  SQL +MQ FR+EFL A+  +  S SRG FI+SCY HCQTE Q +W   DSP+L  T
Sbjct  296  NCQRSQLKVMQDFRLEFLSAVIGLGRSASRGMFIDSCYTHCQTETQTSWFWQDSPILNRT  355

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            +IAKAVGDW YDR+ FQKIDCPYPC+ +CH+RVF
Sbjct  356  TIAKAVGDWVYDRNLFQKIDCPYPCNPTCHHRVF  389



>ref|NP_974575.2| putative pectinacetylesterase [Arabidopsis thaliana]
 gb|AEE84179.1| putative pectinacetylesterase [Arabidopsis thaliana]
Length=365

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ P +CFFPQ +A  I+TPLF +N+AYDSWQ+KNILAP  ADP+G W SC+LDI 
Sbjct  204  SCTSRLTPAMCFFPQYVARQIRTPLFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIK  263

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C  SQ+ +MQ FR+EFL A+  +  S SRG FI+SCY HCQTE Q +W   DSP+L  T
Sbjct  264  NCHPSQIKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSPILNRT  323

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            +IAKAVGDW YDR+ FQKIDCPYPC+ +CH+RVF
Sbjct  324  TIAKAVGDWVYDRTLFQKIDCPYPCNPTCHHRVF  357



>ref|NP_193677.2| putative pectinacetylesterase [Arabidopsis thaliana]
 sp|Q6DBP4.1|PAE8_ARATH RecName: Full=Pectin acetylesterase 8; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAT70429.1| At4g19420 [Arabidopsis thaliana]
 gb|AAU45212.1| At4g19420 [Arabidopsis thaliana]
 gb|AEE84180.1| putative pectinacetylesterase [Arabidopsis thaliana]
Length=397

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ P +CFFPQ +A  I+TPLF +N+AYDSWQ+KNILAP  ADP+G W SC+LDI 
Sbjct  236  SCTSRLTPAMCFFPQYVARQIRTPLFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIK  295

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C  SQ+ +MQ FR+EFL A+  +  S SRG FI+SCY HCQTE Q +W   DSP+L  T
Sbjct  296  NCHPSQIKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSPILNRT  355

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            +IAKAVGDW YDR+ FQKIDCPYPC+ +CH+RVF
Sbjct  356  TIAKAVGDWVYDRTLFQKIDCPYPCNPTCHHRVF  389



>ref|XP_010235852.1| PREDICTED: protein notum homolog isoform X2 [Brachypodium distachyon]
Length=353

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 116/150 (77%), Gaps = 2/150 (1%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK+ PG+C FPQN    IQTPLF +N+AYDSWQV+NIL PG +DPH  W SCK DI 
Sbjct  198  SCTSKLPPGMCLFPQNEVKQIQTPLFILNAAYDSWQVRNILVPGGSDPH--WRSCKHDIN  255

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            +CS+ QL  +QGFR +FLKAL    +S SRG FINSC+AHCQ+E+QE W   DSPVL   
Sbjct  256  QCSEKQLKTLQGFRDDFLKALEEQGSSSSRGLFINSCFAHCQSEIQEIWFAPDSPVLGNK  315

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCH  313
             IA A+GDW+YDRSPFQ+IDCPYPCD SCH
Sbjct  316  KIANAIGDWFYDRSPFQEIDCPYPCDSSCH  345



>emb|CDY67801.1| BnaAnng25210D, partial [Brassica napus]
Length=383

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ P +CFFPQ +A  I+TP+F +N+AYDSWQ+KNILAP  ADP G W SC+LDI 
Sbjct  222  SCTSRLTPAMCFFPQYVARQIRTPVFVLNAAYDSWQIKNILAPRAADPEGKWQSCQLDIK  281

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C  SQL +MQ FR+EFL A+  +  S SRG FI+SCY HCQTE Q +W   DSP+L  T
Sbjct  282  NCQRSQLKVMQDFRLEFLSAVIGLGRSASRGMFIDSCYTHCQTETQTSWFWQDSPILNRT  341

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            +IAKAVGDW YDR+ FQKIDCPYPC+ +CH+RVF
Sbjct  342  TIAKAVGDWVYDRNLFQKIDCPYPCNPTCHHRVF  375



>ref|XP_004300392.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011465292.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011465293.1| PREDICTED: pectin acetylesterase 8-like [Fragaria vesca subsp. 
vesca]
Length=394

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 118/154 (77%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ PGLCFFPQN+ PT++TP+F VN+AYDSWQ+KNILAP  ADP G+W SCK+ I 
Sbjct  238  SCTSRLNPGLCFFPQNVVPTLRTPIFLVNAAYDSWQIKNILAPSAADPKGSWKSCKMGIK  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +Q+  MQ +R  FL  L     SPS G FI+SCYAHCQ   QETWL  DSPV+  T
Sbjct  298  NCSPAQIQTMQDYRTTFLNVLNGGLTSPSHGAFIDSCYAHCQIGTQETWLAADSPVVGKT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            +IAKAVGDWYY+RSP +KIDCPYPC+ +C N+ F
Sbjct  358  TIAKAVGDWYYNRSPSKKIDCPYPCNPTCKNKEF  391



>ref|XP_006413980.1| hypothetical protein EUTSA_v10025385mg [Eutrema salsugineum]
 gb|ESQ55433.1| hypothetical protein EUTSA_v10025385mg [Eutrema salsugineum]
Length=397

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 121/154 (79%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ P +CFFPQ +A  I+TPLF +N+AYDSWQ+KNILAP  ADP+G W SC+LDI 
Sbjct  236  SCTSRLTPAMCFFPQYVARQIRTPLFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIK  295

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C  +QL +MQ FR+EFL+A+  +  S SRG FI+SCY HCQTE Q +W   DSP+L  T
Sbjct  296  NCQPNQLKVMQDFRLEFLRAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSPILNRT  355

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            +IAKAVGDW YDR+ FQKIDCPYPC+ +CH++VF
Sbjct  356  TIAKAVGDWVYDRTLFQKIDCPYPCNPTCHHKVF  389



>ref|XP_010529277.1| PREDICTED: protein notum homolog [Tarenaya hassleriana]
Length=401

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 118/154 (77%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK+ P LCFFPQ +A  I+TPLF +N+AYDSWQ+KNILAP  ADP+G W SC+LDI 
Sbjct  238  SCTSKLNPALCFFPQYVARRIRTPLFLLNAAYDSWQIKNILAPRAADPNGKWQSCELDIK  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C  +Q+ +MQ FR++FL A+  +  SPSRG FI SCY HCQTE Q +W   DSP L  T
Sbjct  298  NCQPNQIKVMQDFRLQFLSAVTGLGKSPSRGMFIVSCYTHCQTETQTSWFWTDSPRLNRT  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            +IA+AVGDW YDR  FQKIDCPYPC+ +CHNRVF
Sbjct  358  TIARAVGDWVYDRKLFQKIDCPYPCNPTCHNRVF  391



>emb|CDY09289.1| BnaC03g63190D [Brassica napus]
Length=397

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ P +CFFPQ +A  I+TP+F +N+AYDSWQ+KNILAP  ADP G W SC+LDI 
Sbjct  236  SCTSRLTPAMCFFPQYVARQIRTPVFVLNAAYDSWQIKNILAPRAADPDGKWQSCQLDIK  295

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C  SQL +MQ FR+EFL A+  +  S SRG FI+SCY HCQTE Q +W   DSP+L  T
Sbjct  296  NCQRSQLKVMQDFRLEFLSAVIGLGRSASRGMFIDSCYTHCQTETQTSWFWQDSPILNRT  355

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            +IAKAVGDW YDR+ FQKIDCPYPC+ +CH+RVF
Sbjct  356  TIAKAVGDWVYDRNLFQKIDCPYPCNPTCHHRVF  389



>ref|XP_006432881.1| hypothetical protein CICLE_v10001426mg [Citrus clementina]
 gb|ESR46121.1| hypothetical protein CICLE_v10001426mg [Citrus clementina]
Length=392

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ PGLCFFPQN+A  ++TPLF +NSAYDSWQ++NIL P  ADP GTW  CK DI 
Sbjct  240  SCTSRLSPGLCFFPQNVAGQVKTPLFIINSAYDSWQIRNILVPDNADPKGTWRRCKKDIK  299

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL  MQGFR++FL AL  + NS SRG  I+SCY HC+T  QE WL  DSPVL  T
Sbjct  300  TCSSTQLQTMQGFRVQFLNALAGLGNSSSRGMLIDSCYTHCRTVFQEAWLSADSPVLDKT  359

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCD  325
             IAKAVGDWYYDR+PFQKIDCPYPC+
Sbjct  360  PIAKAVGDWYYDRNPFQKIDCPYPCN  385



>ref|XP_010235850.1| PREDICTED: protein notum homolog isoform X1 [Brachypodium distachyon]
 ref|XP_010235851.1| PREDICTED: protein notum homolog isoform X1 [Brachypodium distachyon]
Length=395

 Score =   219 bits (559),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 116/150 (77%), Gaps = 2/150 (1%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK+ PG+C FPQN    IQTPLF +N+AYDSWQV+NIL PG +DPH  W SCK DI 
Sbjct  240  SCTSKLPPGMCLFPQNEVKQIQTPLFILNAAYDSWQVRNILVPGGSDPH--WRSCKHDIN  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            +CS+ QL  +QGFR +FLKAL    +S SRG FINSC+AHCQ+E+QE W   DSPVL   
Sbjct  298  QCSEKQLKTLQGFRDDFLKALEEQGSSSSRGLFINSCFAHCQSEIQEIWFAPDSPVLGNK  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCH  313
             IA A+GDW+YDRSPFQ+IDCPYPCD SCH
Sbjct  358  KIANAIGDWFYDRSPFQEIDCPYPCDSSCH  387



>ref|XP_010536220.1| PREDICTED: protein notum homolog isoform X1 [Tarenaya hassleriana]
Length=399

 Score =   219 bits (557),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ P LCFFPQ +A  I+TPLF +N+AYDSWQ+KNILAP  ADP+G W SC+LDI 
Sbjct  238  SCTSRLNPALCFFPQYVAQHIRTPLFVLNAAYDSWQIKNILAPRAADPNGKWQSCQLDIK  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C  +QL +MQ FR+EFL A+  +  S SRG FI+SCYAHCQTE Q +W   DSP L   
Sbjct  298  NCQPNQLKVMQDFRLEFLSAVIGLGKSSSRGMFIDSCYAHCQTESQTSWFWPDSPRLDRV  357

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            +IAKAVGDW YDR+ FQKIDCPYPC+ +CHNRVF
Sbjct  358  TIAKAVGDWVYDRTLFQKIDCPYPCNPTCHNRVF  391



>gb|ABK24433.1| unknown [Picea sitchensis]
Length=399

 Score =   218 bits (556),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 119/154 (77%), Gaps = 1/154 (1%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            +CT K+    CFFPQ + P IQTPLF +N+ YDSWQ+KNI+APGVADPHG WH+CKLDI 
Sbjct  242  ACTEKLGTQ-CFFPQYLLPYIQTPLFLLNAGYDSWQIKNIVAPGVADPHGLWHNCKLDIK  300

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS +QL  MQGFR+E L AL    NS S G FINSCYAHCQ+E+QETWL +DSP L G 
Sbjct  301  KCSPNQLETMQGFRLEMLNALKIFQNSASGGMFINSCYAHCQSEMQETWLANDSPKLNGL  360

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            SIA+AV +WY+ +   ++ DCPYPCD +CHNRVF
Sbjct  361  SIAEAVQNWYFGQGIVKETDCPYPCDSTCHNRVF  394



>gb|ABK24994.1| unknown [Picea sitchensis]
Length=399

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 119/154 (77%), Gaps = 1/154 (1%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            +CT K+    CFFPQ + P IQTPLF +N+ YDSWQ+KNI+APGVADPHG WH+CKLDI 
Sbjct  242  ACTEKLGT-QCFFPQYLLPYIQTPLFLLNAGYDSWQIKNIVAPGVADPHGLWHNCKLDIK  300

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS +QL  MQGFR+E L AL    NS S G FINSCYAHCQ+E+QETWL +DSP L G 
Sbjct  301  KCSPNQLETMQGFRLEMLNALKIFQNSASGGMFINSCYAHCQSEMQETWLANDSPKLNGL  360

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            SIA+AV +WY+ +   ++ DCPYPCD +CHNRVF
Sbjct  361  SIAEAVQNWYFGQGIVKETDCPYPCDSTCHNRVF  394



>ref|XP_010536228.1| PREDICTED: protein notum homolog isoform X2 [Tarenaya hassleriana]
Length=397

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ P LCFFPQ +A  I+TPLF +N+AYDSWQ+KNILAP  ADP+G W SC+LDI 
Sbjct  236  SCTSRLNPALCFFPQYVAQHIRTPLFVLNAAYDSWQIKNILAPRAADPNGKWQSCQLDIK  295

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C  +QL +MQ FR+EFL A+  +  S SRG FI+SCYAHCQTE Q +W   DSP L   
Sbjct  296  NCQPNQLKVMQDFRLEFLSAVIGLGKSSSRGMFIDSCYAHCQTESQTSWFWPDSPRLDRV  355

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            +IAKAVGDW YDR+ FQKIDCPYPC+ +CHNRVF
Sbjct  356  TIAKAVGDWVYDRTLFQKIDCPYPCNPTCHNRVF  389



>ref|XP_009132797.1| PREDICTED: protein notum homolog [Brassica rapa]
Length=397

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            +CTS++ P +CFFPQ +A  I+TP+F +N+AYDSWQ+KNILAP  ADP+G W SC+LDI 
Sbjct  236  TCTSRLTPAMCFFPQYVARQIRTPVFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIK  295

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C  +QL +MQ FR+EFL A+  +  S SRG FI+SCY HCQTE Q +W   DSP+L  T
Sbjct  296  NCQPNQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSPILNRT  355

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            +IAKAVGDW YDR  FQKIDCPYPC+ +CH+RVF
Sbjct  356  TIAKAVGDWVYDRKLFQKIDCPYPCNPTCHHRVF  389



>ref|XP_003547822.1| PREDICTED: protein notum homolog [Glycine max]
 gb|KHN26082.1| Protein notum like [Glycine soja]
Length=398

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK  P LCFFPQ +A  I TP+F VN+AYDSWQ++NI  PG ADP  +WHSCKLDI 
Sbjct  237  SCTSKFSPELCFFPQYVASHISTPIFVVNAAYDSWQIQNIFVPGSADPSDSWHSCKLDIS  296

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL  MQ F+ EF KA+  V +S S+G FI+SCYAHCQTE QETW + DSP LA T
Sbjct  297  NCSPDQLSKMQDFKSEFEKAVSVVGDSSSKGMFIDSCYAHCQTESQETWYKSDSPQLANT  356

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDW+Y RS F+ +DC YPC+ SC NRVF+
Sbjct  357  TIAKAVGDWFYGRSSFRHVDCNYPCNPSCQNRVFD  391



>emb|CDX78933.1| BnaA01g10000D [Brassica napus]
Length=452

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            +CTS++ P +CFFPQ +A  I+TP+F +N+AYDSWQ+KNILAP  ADP+G W SC+LDI 
Sbjct  291  TCTSRLTPAMCFFPQYVARQIRTPVFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIK  350

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C  +QL +MQ FR+EFL A+  +  S SRG FI+SCY HCQTE Q +W   DSP+L  T
Sbjct  351  NCQPNQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSPILNRT  410

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            +IAKAVGDW YDR  FQKIDCPYPC+ +CH+RVF
Sbjct  411  TIAKAVGDWVYDRKLFQKIDCPYPCNPTCHHRVF  444



>emb|CDX99377.1| BnaC01g11750D [Brassica napus]
Length=452

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            +CTS++ P +CFFPQ +A  I+TP+F +N+AYDSWQ+KNILAP  ADP+G W SC+LDI 
Sbjct  291  TCTSRLTPAMCFFPQYVARQIRTPVFILNAAYDSWQIKNILAPRAADPYGKWQSCQLDIK  350

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C  +QL +MQ FR+EFL A+  +  S SRG FI+SCY HCQTE Q +W   DSP+L  T
Sbjct  351  NCQPNQLKVMQDFRLEFLSAVIGLGRSSSRGMFIDSCYTHCQTETQTSWFWQDSPILNRT  410

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            +IAKAVGDW YDR  FQKIDCPYPC+ +CH+RVF
Sbjct  411  TIAKAVGDWVYDRKLFQKIDCPYPCNPTCHHRVF  444



>ref|XP_008347803.1| PREDICTED: uncharacterized protein LOC103410929 [Malus domestica]
Length=401

 Score =   216 bits (551),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+M PGLCFFPQN+ P   TP+F VN+AYDSWQ+KNILAPGVADP G W  CKL+I 
Sbjct  241  SCTSRMSPGLCFFPQNVVPQTXTPIFLVNAAYDSWQIKNILAPGVADPKGAWKKCKLNIK  300

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS SQL  +Q +R++FLK +   + S S G FI+SC+AHCQ   QETWL  DSP+L+ T
Sbjct  301  NCSPSQLQTLQEYRLQFLKTIAXSSTSSSHGAFIDSCFAHCQIGTQETWLAADSPMLSKT  360

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IA AVGDWYYDR+ F+K DCPYPC+ +C NR F+
Sbjct  361  TIANAVGDWYYDRTAFKKFDCPYPCNPTCKNREFD  395



>ref|XP_004509558.1| PREDICTED: protein notum homolog [Cicer arietinum]
Length=397

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS + PGLCFFPQ MA  I+TP+F VN+AYDSWQ+KNILAPG ADP+G W SCK +++
Sbjct  236  SCTSTLSPGLCFFPQYMASGIKTPIFIVNAAYDSWQIKNILAPGAADPNGQWRSCKTNLI  295

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL IMQ +R +FLKAL  V NS S G FI+SCY HCQTE QETWL+ DSP +A  
Sbjct  296  NCSPKQLNIMQDYRSQFLKALSVVGNSSSNGMFIDSCYIHCQTEPQETWLQSDSPTVANK  355

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRV  304
            +IA AV DW+Y+RS  ++IDC YPC+ +C +RV
Sbjct  356  TIAGAVADWFYERSASREIDCSYPCNPTCQDRV  388



>gb|KHN27511.1| Protein notum like [Glycine soja]
Length=398

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 116/155 (75%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK+ P LCFFPQ +A  I TP+F VNSAYD WQ+ NI  P  ADP  +WHSCKL++ 
Sbjct  237  SCTSKLNPALCFFPQYVASHISTPIFVVNSAYDWWQIGNIFVPSSADPSNSWHSCKLNLS  296

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL  +QGF+ EF +AL  V +SPS+G FI+SCYAHCQTE QETW +  S +LA  
Sbjct  297  NCSPDQLSKLQGFKSEFQRALSEVGDSPSKGMFIDSCYAHCQTETQETWFKSGSQLLANK  356

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDW+Y RSPF  IDC +PC+ +CHNRVF+
Sbjct  357  TIAKAVGDWFYGRSPFHHIDCNFPCNPTCHNRVFQ  391



>ref|XP_008808367.1| PREDICTED: uncharacterized protein LOC103720446 isoform X1 [Phoenix 
dactylifera]
Length=399

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 120/155 (77%), Gaps = 2/155 (1%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+  P +CFFPQ +  +++TPLF +N+AYD+WQ+KNILAP  +DP   W  CKLDI 
Sbjct  242  SCTSRFPPSMCFFPQYVVQSMRTPLFILNAAYDAWQIKNILAPSPSDPRKVWGECKLDIK  301

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS +QL +MQGFR EF++AL   ANS S G FI+SCY+HCQ+  QETWLR DSPV+   
Sbjct  302  KCSSNQLQVMQGFRSEFMRAL--PANSSSIGMFIDSCYSHCQSGAQETWLRSDSPVIDKM  359

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
             IAKAVGDWY+ R+  +KIDCPYPCD +CHNR+FE
Sbjct  360  PIAKAVGDWYFGRTSMRKIDCPYPCDSTCHNRIFE  394



>ref|XP_008808368.1| PREDICTED: uncharacterized protein LOC103720446 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008808369.1| PREDICTED: uncharacterized protein LOC103720446 isoform X2 [Phoenix 
dactylifera]
Length=396

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 120/155 (77%), Gaps = 2/155 (1%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+  P +CFFPQ +  +++TPLF +N+AYD+WQ+KNILAP  +DP   W  CKLDI 
Sbjct  239  SCTSRFPPSMCFFPQYVVQSMRTPLFILNAAYDAWQIKNILAPSPSDPRKVWGECKLDIK  298

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS +QL +MQGFR EF++AL   ANS S G FI+SCY+HCQ+  QETWLR DSPV+   
Sbjct  299  KCSSNQLQVMQGFRSEFMRAL--PANSSSIGMFIDSCYSHCQSGAQETWLRSDSPVIDKM  356

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
             IAKAVGDWY+ R+  +KIDCPYPCD +CHNR+FE
Sbjct  357  PIAKAVGDWYFGRTSMRKIDCPYPCDSTCHNRIFE  391



>ref|XP_003548585.1| PREDICTED: protein notum homolog [Glycine max]
Length=398

 Score =   213 bits (543),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 115/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK  P LCFFPQ +A  I TP+F VNSAYD WQ+ NI  P  ADP  +WHSCKL++ 
Sbjct  237  SCTSKHNPALCFFPQYVASHISTPIFVVNSAYDWWQIGNIFVPSSADPSNSWHSCKLNLS  296

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL  +QGF+ EF +AL  V +SPS+G FI+SCYAHCQTE QETW +  S +LA  
Sbjct  297  NCSPDQLSKLQGFKSEFQRALSEVGDSPSKGMFIDSCYAHCQTETQETWFKSGSQLLANK  356

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAVGDW+Y RSPF  IDC +PC+ +CHNRVF+
Sbjct  357  TIAKAVGDWFYGRSPFHHIDCNFPCNPTCHNRVFQ  391



>ref|XP_003547821.1| PREDICTED: protein notum homolog [Glycine max]
 gb|KHN26083.1| Protein notum like [Glycine soja]
Length=398

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK+ P LCFFPQ +A  I TP+F VNSAYDSWQ++ I  PG ADP  +W+SCK+++ 
Sbjct  237  SCTSKLSPTLCFFPQYVASHISTPIFVVNSAYDSWQIRYIFVPGSADPSDSWNSCKVNMS  296

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL  +QGF+ EF +AL  V +SPS+G FI+SCYAHCQTE QETW + DSP LA T
Sbjct  297  NCSPDQLSKLQGFKSEFERALSEVGDSPSKGMFIDSCYAHCQTEPQETWFKTDSPKLANT  356

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +IAKAV DW+Y RS F+ +DC YPC+ SC NRVF+
Sbjct  357  TIAKAVADWFYGRSSFRHVDCNYPCNPSCQNRVFD  391



>gb|KDP28068.1| hypothetical protein JCGZ_19476 [Jatropha curcas]
Length=400

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 112/149 (75%), Gaps = 0/149 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++KP LCFFPQ +   I+TPLF +N+AYDSWQ+KNILAPGVADPHG W  CKLDI 
Sbjct  239  SCTSRLKPALCFFPQYVVQQIRTPLFILNAAYDSWQIKNILAPGVADPHGAWKGCKLDIS  298

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL  MQ FR++FL AL     S SRG +I+SCY HCQ+E QETW   DSPVL  +
Sbjct  299  NCSLLQLKTMQDFRLQFLNALYRSTTSSSRGLYIDSCYIHCQSETQETWFMADSPVLGRS  358

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSC  316
             IAKAVGDW+YDR   QKIDC YPC+ +C
Sbjct  359  KIAKAVGDWFYDRISVQKIDCAYPCNPTC  387



>ref|XP_010325631.1| PREDICTED: protein notum homolog isoform X2 [Solanum lycopersicum]
Length=308

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK++PGLCFFPQN+A  IQTPLF +N+AYD+WQV+NILAP   DP G W SC  +I 
Sbjct  159  SCTSKLEPGLCFFPQNVAQQIQTPLFIINAAYDNWQVRNILAPPGTDPKGAWKSCGANIK  218

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C+  QL ++QGFR++FLKAL  + +S +RG++INSC+AHCQT+ Q TW   +SP L   
Sbjct  219  TCTADQLKVLQGFRLDFLKALEGLGSSSTRGYYINSCFAHCQTQKQATWFGLNSPRLLNK  278

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSC  316
            +IA+AVGDW  +R+ FQ+IDCPYPCDK+C
Sbjct  279  TIAEAVGDWVLERNQFQQIDCPYPCDKTC  307



>ref|XP_002519912.1| pectin acetylesterase, putative [Ricinus communis]
 gb|EEF42516.1| pectin acetylesterase, putative [Ricinus communis]
Length=452

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCT+KM+P LCFFPQ +A T++TPLF +NSAYDSWQ+KN+LAP   D  G+W SCKLD+ 
Sbjct  296  SCTAKMRPELCFFPQYVAQTMRTPLFLINSAYDSWQIKNVLAPSAVDKKGSWKSCKLDLK  355

Query  582  KCSDSQLGIMQGFRMEFLKAL-GAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAG  406
            KCS +QL  +Q FR +F+ AL G V N P+ G+FINSCYAHCQ+    TWL D SPV++ 
Sbjct  356  KCSAAQLQTVQDFRTQFIGALSGGVTNKPANGYFINSCYAHCQSGSLATWLADKSPVVSN  415

Query  405  TSIAKAVGDWYYDRSPFQKIDCPYPCDKSC  316
            T I KAVGDW+YDR+ FQKIDCPYPC+ +C
Sbjct  416  TKIGKAVGDWFYDRATFQKIDCPYPCNPTC  445



>gb|KDO56390.1| hypothetical protein CISIN_1g026241mg [Citrus sinensis]
Length=241

 Score =   204 bits (520),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 115/154 (75%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+   ++TPLF +N+AYDSWQ+++ LAP  ADPHG WH C+L+  K
Sbjct  86   CTNHLDPTSCFFPQNIIRQVRTPLFILNAAYDSWQIQSSLAPPSADPHGHWHDCRLNHAK  145

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            CS SQ+  +QGFR + LKA+   + S   G FINSC+AHCQTE Q+TW  DDSPV+   +
Sbjct  146  CSASQIRFLQGFRNQVLKAVRGFSMSKQNGLFINSCFAHCQTERQDTWFADDSPVVGNKA  205

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IA AVGDWY+DRS  + +DCPYPCDK+CHN VF+
Sbjct  206  IAIAVGDWYFDRSGIKIVDCPYPCDKTCHNLVFQ  239



>ref|XP_010325630.1| PREDICTED: protein notum homolog isoform X1 [Solanum lycopersicum]
Length=315

 Score =   206 bits (525),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK++PGLCFFPQN+A  IQTPLF +N+AYD+WQV+NILAP   DP G W SC  +I 
Sbjct  166  SCTSKLEPGLCFFPQNVAQQIQTPLFIINAAYDNWQVRNILAPPGTDPKGAWKSCGANIK  225

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C+  QL ++QGFR++FLKAL  + +S +RG++INSC+AHCQT+ Q TW   +SP L   
Sbjct  226  TCTADQLKVLQGFRLDFLKALEGLGSSSTRGYYINSCFAHCQTQKQATWFGLNSPRLLNK  285

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSC  316
            +IA+AVGDW  +R+ FQ+IDCPYPCDK+C
Sbjct  286  TIAEAVGDWVLERNQFQQIDCPYPCDKTC  314



>ref|XP_010942974.1| PREDICTED: protein notum homolog [Elaeis guineensis]
Length=391

 Score =   206 bits (524),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 117/155 (75%), Gaps = 2/155 (1%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+  P +CFFPQ +  +++TPLF +N+AYD+WQ+KNILAP  +DP   W  CKLDI 
Sbjct  239  SCTSRFPPSMCFFPQYVVQSMRTPLFILNAAYDAWQIKNILAPSPSDPRKFWGECKLDIK  298

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS SQL +MQGFR EFL+AL   ANSPS G FI+SCY+HCQ+  QETWL  DSP +   
Sbjct  299  KCSSSQLQVMQGFRSEFLRAL--PANSPSIGMFIDSCYSHCQSGAQETWLSSDSPAINKM  356

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
             IAKAVGDWY+ R+  +KIDCPYPC+ +CHNR  +
Sbjct  357  PIAKAVGDWYFGRTAMKKIDCPYPCNPTCHNREID  391



>gb|KCW72726.1| hypothetical protein EUGRSUZ_E01170 [Eucalyptus grandis]
Length=373

 Score =   205 bits (522),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSKMKPGLCFFPQN+ P IQTPLF +N+AYDSWQ+KNILAPGVAD HGTW SCKLDI 
Sbjct  238  SCTSKMKPGLCFFPQNVVPQIQTPLFIINAAYDSWQIKNILAPGVADRHGTWRSCKLDIK  297

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS +QL IMQ FR+EFL+AL AV  SPSRG FI+SCYAHCQ   QETWLR+DSPV+A T
Sbjct  298  KCSPNQLKIMQDFRLEFLRALSAVGTSPSRGMFIDSCYAHCQAGTQETWLRNDSPVVAKT  357



>ref|XP_008797988.1| PREDICTED: protein notum homolog isoform X2 [Phoenix dactylifera]
Length=337

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 114/155 (74%), Gaps = 2/155 (1%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+  P LCFFPQ +   ++TPLF +N+AYD+WQ+KNI AP  +DP   W  CKLDI 
Sbjct  185  SCTSRFPPSLCFFPQYVVQNMRTPLFILNAAYDAWQIKNIFAPSPSDPRKIWSECKLDIK  244

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS SQL  +QGFR EFL+AL    NSPS G FI+SCY+HCQ+  QETWL  +SP +   
Sbjct  245  KCSSSQLQALQGFRSEFLRAL--PRNSPSVGMFIDSCYSHCQSGAQETWLSSNSPAIDRM  302

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            SIAKAVGDW+Y RS  QKIDCPYPC+ +CHNR  +
Sbjct  303  SIAKAVGDWFYGRSAVQKIDCPYPCNPTCHNREID  337



>ref|XP_007040900.1| Pectinacetylesterase family protein [Theobroma cacao]
 gb|EOY25401.1| Pectinacetylesterase family protein [Theobroma cacao]
Length=399

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 113/153 (74%), Gaps = 2/153 (1%)
 Frame = -2

Query  762  SCTSKM--KPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLD  589
            SCTS+M  KP LCFFPQ +  T+QTP+F +N+AYDSWQ+KNILAP  AD    W SCKLD
Sbjct  237  SCTSRMSMKPELCFFPQYVVQTMQTPIFFINAAYDSWQIKNILAPTAADSGKAWKSCKLD  296

Query  588  ILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLA  409
            + KC+  QL I+Q FR +FL AL    NS SRG FI+SCYAHCQ   Q TW  ++SP + 
Sbjct  297  LKKCTPGQLKIIQDFRAQFLSALTGAGNSSSRGMFIDSCYAHCQAGKQITWSSNNSPAVG  356

Query  408  GTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHN  310
             T IAKAVGDWYY+RSP QKIDCPYPC+ +C N
Sbjct  357  NTKIAKAVGDWYYERSPVQKIDCPYPCNPTCQN  389



>gb|EYU35369.1| hypothetical protein MIMGU_mgv1a0197532mg, partial [Erythranthe 
guttata]
Length=167

 Score =   197 bits (502),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 110/155 (71%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            +CT ++ P  CFFPQN+   I+TPLF +N+AYD+WQV+  LAP  ADPHG WH CKL+  
Sbjct  9    TCTDRLDPTSCFFPQNLIANIKTPLFLLNAAYDAWQVQASLAPPTADPHGNWHDCKLNNE  68

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            +CS +Q+  +QGFR E L A+     S   G FINSC+AHCQ+E Q+TW  DDSP++   
Sbjct  69   RCSATQIQFLQGFRNEMLNAVKGFGTSKQNGLFINSCFAHCQSERQDTWFADDSPIINNK  128

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
             +A AVGDWY+DR+  + IDC YPCD +CHN VF+
Sbjct  129  PVAIAVGDWYFDRASVKAIDCAYPCDTTCHNLVFK  163



>ref|XP_009397056.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009397057.1| PREDICTED: protein notum homolog [Musa acuminata subsp. malaccensis]
Length=393

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 116/155 (75%), Gaps = 1/155 (1%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ P +CFFPQN+ P + TPLF +N+AYD+WQ+KN LAP  ADP  +W++CKL+I 
Sbjct  240  SCTSRLSPSMCFFPQNVVPKMSTPLFILNAAYDAWQIKNTLAPSSADPRKSWNACKLNIK  299

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS  QL  MQ FR EFL+AL A  N PS G FI SCYAHCQ+  Q+TWL  DSP++   
Sbjct  300  SCSSDQLEKMQEFRSEFLRALPASGN-PSTGMFIISCYAHCQSGSQDTWLGADSPMIDKM  358

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
             IAKAVGDW+Y RS  +KIDCPYPC+ SC NRV+E
Sbjct  359  PIAKAVGDWFYGRSVVRKIDCPYPCNSSCRNRVYE  393



>ref|XP_006423959.1| hypothetical protein CICLE_v10028674mg [Citrus clementina]
 gb|ESR37199.1| hypothetical protein CICLE_v10028674mg [Citrus clementina]
Length=300

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 114/154 (74%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+   ++TPLF +N+AYDSWQ+++ LAP  AD HG WH C+L+  K
Sbjct  145  CTNHLDPTSCFFPQNIIRQVRTPLFILNAAYDSWQIQSSLAPPSADRHGHWHDCRLNHAK  204

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            CS SQ+  +QGFR + LKA+   + S   G FINSC+AHCQTE Q+TW  DDSPV+   +
Sbjct  205  CSASQIRFLQGFRNQVLKAVRGFSMSKQNGLFINSCFAHCQTERQDTWFADDSPVVGNKA  264

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IA AVGDWY+DRS  + +DCPYPCDK+CHN VF+
Sbjct  265  IAIAVGDWYFDRSGIKIVDCPYPCDKTCHNLVFQ  298



>gb|KHN13972.1| hypothetical protein glysoja_043167 [Glycine soja]
Length=321

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 113/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CTS + P  CFFPQN+   I+TPLF +N+AYDSWQV++ LAP  ADPHG WH C+L+  K
Sbjct  168  CTSHLDPTSCFFPQNLIAGIRTPLFILNTAYDSWQVQSSLAPSSADPHGFWHDCRLNHAK  227

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            C+ SQ+  +QGFR + L A+   + SP  G FINSC+AHCQ+E Q+TW  D+SPV+   +
Sbjct  228  CTSSQIQYLQGFRNQMLNAIKGFSRSPQNGLFINSCFAHCQSERQDTWFADNSPVIGNKA  287

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IA +VGDWY+DR+  + IDCPYPCD +CH+ VF 
Sbjct  288  IALSVGDWYFDRAVVKAIDCPYPCDNTCHHLVFR  321



>gb|KDP28067.1| hypothetical protein JCGZ_19475 [Jatropha curcas]
Length=394

 Score =   204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 114/150 (76%), Gaps = 1/150 (1%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSKMKP LCFFP+N+A T+QTPLF +NSAYD WQ+KN+LAP  AD  GT+ SCKLD+ 
Sbjct  238  SCTSKMKPELCFFPENVAQTMQTPLFVINSAYDFWQLKNVLAPSAADRKGTFKSCKLDLT  297

Query  582  KCSDSQLGIMQGFRMEFLKALG-AVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAG  406
            KC  +QL  +Q FR +F+ AL   + N    G+FI+SCYAHCQT     WL + SPVL  
Sbjct  298  KCKPAQLETVQDFRTQFINALNIGLGNKTVNGYFIDSCYAHCQTGSPLVWLAEKSPVLND  357

Query  405  TSIAKAVGDWYYDRSPFQKIDCPYPCDKSC  316
            T IAKAVGDWY+DR+PFQKIDCPYPC+ +C
Sbjct  358  TRIAKAVGDWYFDRAPFQKIDCPYPCNPTC  387



>ref|XP_008797987.1| PREDICTED: protein notum homolog isoform X1 [Phoenix dactylifera]
Length=391

 Score =   203 bits (517),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 114/155 (74%), Gaps = 2/155 (1%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+  P LCFFPQ +   ++TPLF +N+AYD+WQ+KNI AP  +DP   W  CKLDI 
Sbjct  239  SCTSRFPPSLCFFPQYVVQNMRTPLFILNAAYDAWQIKNIFAPSPSDPRKIWSECKLDIK  298

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS SQL  +QGFR EFL+AL    NSPS G FI+SCY+HCQ+  QETWL  +SP +   
Sbjct  299  KCSSSQLQALQGFRSEFLRAL--PRNSPSVGMFIDSCYSHCQSGAQETWLSSNSPAIDRM  356

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            SIAKAVGDW+Y RS  QKIDCPYPC+ +CHNR  +
Sbjct  357  SIAKAVGDWFYGRSAVQKIDCPYPCNPTCHNREID  391



>ref|XP_006359968.1| PREDICTED: protein notum homolog, partial [Solanum tuberosum]
Length=369

 Score =   202 bits (515),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK+KP LCFFPQN+A  IQTPLF +NSAYDSWQV+NIL P   DP G W+SC  +I 
Sbjct  220  SCTSKLKPSLCFFPQNVAQQIQTPLFIINSAYDSWQVRNILVPRGTDPKGAWNSCGANIK  279

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C+  QL ++QGFR+ FLKAL  +  S +RG++INSC+AHCQT+ Q +W   +SP L   
Sbjct  280  TCTPDQLKVLQGFRLNFLKALEGLGPSSTRGYYINSCFAHCQTQKQASWFGPNSPRLFNK  339

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSC  316
            +IA+AVGDW  +R+ F++IDCPYPCDK+C
Sbjct  340  TIAEAVGDWVLERNQFRQIDCPYPCDKTC  368



>gb|KDP28066.1| hypothetical protein JCGZ_19474 [Jatropha curcas]
Length=395

 Score =   203 bits (516),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 115/150 (77%), Gaps = 1/150 (1%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS+M+P LCFFPQN+A T+QTPLF +NSAYDSWQ+KNILAP   D  G++ SCK D+ 
Sbjct  239  SCTSRMRPELCFFPQNVAQTMQTPLFVINSAYDSWQIKNILAPSAVDKKGSFKSCKTDLK  298

Query  582  KCSDSQLGIMQGFRMEFLKALGA-VANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAG  406
            KCS SQL  +Q FR++F+ AL + VAN P+ G FINSC+AHCQ+    TW    SPVL+ 
Sbjct  299  KCSASQLQTVQDFRLQFINALNSGVANKPANGMFINSCHAHCQSGSVSTWFDAKSPVLSN  358

Query  405  TSIAKAVGDWYYDRSPFQKIDCPYPCDKSC  316
            T I KAVGDW+YDR+ F+KIDC YPC+ +C
Sbjct  359  TKIGKAVGDWFYDRASFKKIDCAYPCNPTC  388



>ref|XP_003613922.1| Notum-like protein [Medicago truncatula]
 gb|AES96880.1| pectinacetylesterase family protein [Medicago truncatula]
Length=394

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 114/153 (75%), Gaps = 4/153 (3%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK+KP LCFFPQN    I TP+F VNS  DS+Q+KNILAP   D    W +CKLDI 
Sbjct  240  SCTSKLKPELCFFPQNFVSQITTPIFVVNSPIDSYQIKNILAPDADD----WKNCKLDIT  295

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KC+ +QL  +QGFR EFL+AL  + NS S G FI+SCY HCQTE+QE WL + SP+LA T
Sbjct  296  KCTPAQLNQVQGFRKEFLRALAPIGNSSSVGTFIDSCYLHCQTELQEFWLFNGSPLLANT  355

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRV  304
            +IAK+V DW+YDR PF +IDCPYPC+ +CH  V
Sbjct  356  TIAKSVADWFYDRRPFHQIDCPYPCNPTCHTHV  388



>ref|XP_006423958.1| hypothetical protein CICLE_v10028674mg [Citrus clementina]
 gb|ESR37198.1| hypothetical protein CICLE_v10028674mg [Citrus clementina]
Length=375

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 114/154 (74%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+   ++TPLF +N+AYDSWQ+++ LAP  AD HG WH C+L+  K
Sbjct  220  CTNHLDPTSCFFPQNIIRQVRTPLFILNAAYDSWQIQSSLAPPSADRHGHWHDCRLNHAK  279

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            CS SQ+  +QGFR + LKA+   + S   G FINSC+AHCQTE Q+TW  DDSPV+   +
Sbjct  280  CSASQIRFLQGFRNQVLKAVRGFSMSKQNGLFINSCFAHCQTERQDTWFADDSPVVGNKA  339

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IA AVGDWY+DRS  + +DCPYPCDK+CHN VF+
Sbjct  340  IAIAVGDWYFDRSGIKIVDCPYPCDKTCHNLVFQ  373



>ref|XP_006432879.1| hypothetical protein CICLE_v100013711mg, partial [Citrus clementina]
 gb|ESR46119.1| hypothetical protein CICLE_v100013711mg, partial [Citrus clementina]
Length=124

 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = -2

Query  648  NILAPGVADPHGTWHSCKLDILKCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCY  469
            NILAPGVADPHGTWHSCKLDI  CS +QL  MQ FR +FL AL  +  S SRG FI++CY
Sbjct  1    NILAPGVADPHGTWHSCKLDINNCSPTQLQTMQSFRTQFLNALAGLGISSSRGMFIDACY  60

Query  468  AHCQTEVQETWLRDDSPVLAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            AHCQTE+QETWLR DSPVL   SIAKAVGDWYYDRSPFQKIDC YPC+ +CHNRVF+
Sbjct  61   AHCQTEMQETWLRTDSPVLGKMSIAKAVGDWYYDRSPFQKIDCAYPCNPTCHNRVFD  117



>ref|XP_006480336.1| PREDICTED: protein notum homolog [Citrus sinensis]
Length=423

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 114/154 (74%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+   ++TPLF +N+AYDSWQ+++ LAP  AD HG WH C+L+  K
Sbjct  268  CTNHLDPTSCFFPQNIIRQVRTPLFILNAAYDSWQIQSSLAPPSADRHGHWHDCRLNHAK  327

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            CS SQ+  +QGFR + LKA+   + S   G FINSC+AHCQTE Q+TW  DDSPV+   +
Sbjct  328  CSASQIRFLQGFRNQVLKAVRGFSMSKQNGLFINSCFAHCQTERQDTWFADDSPVVGNKA  387

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IA AVGDWY+DRS  + +DCPYPCDK+CHN VF+
Sbjct  388  IAIAVGDWYFDRSGIKIVDCPYPCDKTCHNLVFQ  421



>ref|XP_006652763.1| PREDICTED: protein notum homolog [Oryza brachyantha]
Length=383

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 113/153 (74%), Gaps = 1/153 (1%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSKM P +CFFPQN+ PT++TPLF +N+AYDSWQ+KN+LAP  AD   TW  CKLDI 
Sbjct  228  SCTSKMSPDMCFFPQNVVPTLRTPLFILNAAYDSWQIKNVLAPSAADKKKTWAQCKLDIK  287

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANS-PSRGFFINSCYAHCQTEVQETWLRDDSPVLAG  406
             CS SQL I+Q FR EFL AL     S P+   FI+SC+AHCQ+  Q+TWL +DSP +  
Sbjct  288  SCSSSQLTILQNFRAEFLAALPKPGQSPPTMSMFIDSCHAHCQSGSQDTWLEEDSPKVEK  347

Query  405  TSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNR  307
            T I +AVGDW+YDR   ++IDCPYPC+ +C NR
Sbjct  348  TQIGRAVGDWFYDREVSRRIDCPYPCNPTCKNR  380



>ref|XP_008246334.1| PREDICTED: protein notum homolog isoform X2 [Prunus mume]
Length=415

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 112/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+   IQTPLF +N+AYDSWQ+++ LAP  ADP G WH C+L+  K
Sbjct  259  CTNHLDPTSCFFPQNLIANIQTPLFILNAAYDSWQIQSSLAPASADPAGFWHECRLNHAK  318

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            C+ SQ+  +QGFR + L A+   + S   G FINSC+AHCQTE Q+TW  DDSP++   +
Sbjct  319  CTPSQINFLQGFRNQMLNAVKRFSMSKKNGLFINSCFAHCQTERQDTWFADDSPIIGKKA  378

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IA AVGDWY+DR+  + +DCPYPCD SCHN VF+
Sbjct  379  IAIAVGDWYFDRTSVKAVDCPYPCDNSCHNLVFQ  412



>ref|XP_003555771.1| PREDICTED: uncharacterized protein LOC100793403 [Glycine max]
Length=424

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 112/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+   I+TPLF +N+AYDSWQV+  LAP  ADPHG WH C+L+  K
Sbjct  271  CTNHLDPTSCFFPQNLIAGIRTPLFILNTAYDSWQVQTSLAPSSADPHGFWHDCRLNHAK  330

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            C+ SQ+  +QGFR + L A+   + SP  G FINSC+AHCQ+E Q+TW  D+SPV+   +
Sbjct  331  CTSSQIQYLQGFRNQMLNAIKGFSRSPQNGLFINSCFAHCQSERQDTWFADNSPVIGNKA  390

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IA AVGDWY+DR+  + IDCPYPCD +CH+ VF 
Sbjct  391  IALAVGDWYFDRAVVKAIDCPYPCDNTCHHLVFR  424



>gb|KDO40412.1| hypothetical protein CISIN_1g013734mg [Citrus sinensis]
Length=373

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 108/155 (70%), Gaps = 26/155 (17%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS++ PGL                          +KNILAPGVADPHGTWHSCKLDI 
Sbjct  238  SCTSRLSPGL--------------------------IKNILAPGVADPHGTWHSCKLDIN  271

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS +QL  MQ FR +FL AL  +  S SRG FI++CYAHCQTE+QETWLR DSPVL   
Sbjct  272  NCSPTQLQTMQSFRTQFLNALAGLGISSSRGMFIDACYAHCQTEMQETWLRTDSPVLGKM  331

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            SIAKAVGDWYYDRSPFQKIDC YPC+ +CHNRVF+
Sbjct  332  SIAKAVGDWYYDRSPFQKIDCAYPCNPTCHNRVFD  366



>ref|XP_009592441.1| PREDICTED: uncharacterized protein LOC104089292 [Nicotiana tomentosiformis]
Length=394

 Score =   201 bits (510),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK+KP LCFFPQN+A  +QTPLF +N+AYD WQV+NIL P  ADP G W +CK D+ 
Sbjct  236  SCTSKLKPSLCFFPQNVAHQLQTPLFIINAAYDHWQVRNILVPSTADPTGAWTNCKADMR  295

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C+ S+L ++QGFR+ FLK L  +  S +RG++INSC++HCQT+ Q  W   +SP L   
Sbjct  296  NCTLSELKVLQGFRLNFLKVLEGLGPSSTRGYYINSCFSHCQTQQQAYWFGPNSPRLFNK  355

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSC  316
            +IA+A GDW+++R+ FQ+IDCPYPCDK+C
Sbjct  356  TIAEATGDWFWERNQFQEIDCPYPCDKTC  384



>gb|KHG09455.1| Protein notum [Gossypium arboreum]
Length=397

 Score =   201 bits (510),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 115/153 (75%), Gaps = 4/153 (3%)
 Frame = -2

Query  762  SCTSKM--KPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLD  589
            SCTS+M  +P LCFFPQ +  T+QTP+F VNSAYDSWQ+KNILAP  AD    W SCKLD
Sbjct  238  SCTSRMGARPELCFFPQYVVQTMQTPIFFVNSAYDSWQIKNILAPSAADKSKEWKSCKLD  297

Query  588  ILKCSDSQLGIMQGFRMEFLKAL--GAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPV  415
            + KC+++QL I+Q FR +FL AL    V NSPS+G FI+SCYAHCQ   Q  W  D SPV
Sbjct  298  LKKCTETQLKIIQDFRTQFLSALNRAGVINSPSKGMFIDSCYAHCQVGKQIQWSSDSSPV  357

Query  414  LAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSC  316
            ++   IAKAVGDWYY+RSP +K+DCPYPC+ +C
Sbjct  358  VSNMKIAKAVGDWYYERSPIKKLDCPYPCNPTC  390



>ref|XP_009610135.1| PREDICTED: protein notum homolog [Nicotiana tomentosiformis]
Length=427

 Score =   201 bits (512),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            +CTSK+ P  CFFPQN+   I+TPLF +N+AYDSWQV++ LAP VADP G WH CKL+  
Sbjct  273  TCTSKLDPTSCFFPQNLISNIKTPLFLLNAAYDSWQVQSSLAPPVADPKGLWHDCKLNNE  332

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            +CS SQ+  +QGFR + L A+   A S   G FINSC+AHCQ+E Q+TW  DDSP++   
Sbjct  333  QCSASQIQFLQGFRNDMLNAVKGFAASTQNGLFINSCFAHCQSERQDTWFADDSPLIDNK  392

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
             +A AVGDWY+DR+  + IDC YPCDK+CHN VF+
Sbjct  393  PVALAVGDWYFDRAGVKSIDCAYPCDKTCHNLVFK  427



>ref|XP_010327278.1| PREDICTED: uncharacterized protein LOC101257906 isoform X3 [Solanum 
lycopersicum]
 ref|XP_010327279.1| PREDICTED: uncharacterized protein LOC101257906 isoform X3 [Solanum 
lycopersicum]
Length=246

 Score =   196 bits (499),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 109/153 (71%), Gaps = 0/153 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            +CT+K+ P  CFFPQN+   I+TPLF +N+AYD WQ+++ LAP VADPHG WH CK D  
Sbjct  92   NCTNKLDPTSCFFPQNLIGNIKTPLFLLNAAYDFWQIQSSLAPPVADPHGLWHDCKRDYK  151

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS SQ+  +Q FR + L A+     S   G FINSC+AHCQ+E Q+TW  DDSP++   
Sbjct  152  KCSASQIQFLQDFRNDMLNAIKGFGASTQSGLFINSCFAHCQSERQDTWFADDSPLIDNK  211

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRV  304
            +IA AVGDWY+DR   + IDC YPCDK+CHN V
Sbjct  212  TIALAVGDWYFDREGMKAIDCAYPCDKTCHNMV  244



>ref|XP_010911666.1| PREDICTED: protein notum homolog [Elaeis guineensis]
Length=388

 Score =   200 bits (509),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 114/155 (74%), Gaps = 2/155 (1%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTS   P +CFFPQ +  +++TPLF +N+AYD+WQ+KNILAP  +DP   W  CKLDI 
Sbjct  236  SCTSSFPPSMCFFPQYVVQSMRTPLFILNAAYDAWQIKNILAPSPSDPSKVWGECKLDIK  295

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS SQL ++Q FR EFL AL   ANSPS G FI+SCY+HCQ+  QETWL  +SP +   
Sbjct  296  KCSSSQLQVLQDFRSEFLHAL--PANSPSTGLFIDSCYSHCQSGAQETWLSSNSPAIDKM  353

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            SIAKAVGDW+Y RS  QKIDCPYPC+ +C NR  +
Sbjct  354  SIAKAVGDWFYGRSAIQKIDCPYPCNPTCVNREID  388



>ref|XP_007031285.1| Pectinacetylesterase family protein [Theobroma cacao]
 gb|EOY11787.1| Pectinacetylesterase family protein [Theobroma cacao]
Length=439

 Score =   201 bits (511),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 111/154 (72%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+   IQTPLF +N+AYDSWQ+++ +AP  ADPHG WH C+L+  K
Sbjct  286  CTNHLDPTSCFFPQNLISHIQTPLFILNAAYDSWQIQSSIAPPSADPHGYWHDCRLNHAK  345

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            CS SQ+  +QGFR + L A+   + S   G FINSC+AHCQTE Q+TW  DDSP +    
Sbjct  346  CSASQIRFLQGFRTQMLNAIKGFSMSRQNGLFINSCFAHCQTERQDTWFADDSPEIRNKP  405

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IA AVGDWY+DR+  + IDCPYPCDK+CHN VF 
Sbjct  406  IAIAVGDWYFDRAGVRSIDCPYPCDKTCHNLVFR  439



>ref|XP_009797415.1| PREDICTED: uncharacterized protein LOC104243851 [Nicotiana sylvestris]
Length=388

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 113/149 (76%), Gaps = 0/149 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK+ P LCFFPQN+A  IQTPLF +N+AYD WQV+NIL P  ADP G W +CK D+ 
Sbjct  234  SCTSKLNPSLCFFPQNVAHQIQTPLFIINAAYDHWQVRNILVPSTADPTGAWTNCKADMR  293

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C+ S+L ++QGFR+ FLK L  +  S +RG++INSC++HCQT+ Q  W   +SP L   
Sbjct  294  NCTLSELQVLQGFRLNFLKVLEGLGPSSTRGYYINSCFSHCQTQQQAYWFGPNSPRLFNK  353

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSC  316
            +IA+A GDW+++R+ FQ+IDCPYPCDK+C
Sbjct  354  TIAEATGDWFWERNQFQEIDCPYPCDKTC  382



>gb|AFK35535.1| unknown [Lotus japonicus]
Length=422

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 112/153 (73%), Gaps = 0/153 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+  +++TPLF +N+AYDSWQ+++ LAP  ADPHG WH C+L+  K
Sbjct  269  CTNHLDPTSCFFPQNLISSVRTPLFILNAAYDSWQIQSSLAPPTADPHGYWHDCRLNHAK  328

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            CS SQ+  +QGFR   L  +   + S   G FINSC+AHCQ+E Q+TW  D+SPV+   +
Sbjct  329  CSRSQVQFLQGFRNRMLNVIKDFSRSNRNGLFINSCFAHCQSERQDTWFSDNSPVIGNKA  388

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            IA AVGDWY+DR+  + IDCPYPCDK+CHN +F
Sbjct  389  IAVAVGDWYFDRAGVKAIDCPYPCDKTCHNLIF  421



>ref|NP_974837.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 dbj|BAF00247.1| pectin acetylesterase precursor - like protein [Arabidopsis thaliana]
 gb|ABK32181.1| At5g26670 [Arabidopsis thaliana]
 gb|AED93579.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=298

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 113/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+   ++TPLF VN+AYD WQ+++ +AP  ADP G WH C+L+  +
Sbjct  145  CTNHLNPTSCFFPQNLISQMKTPLFIVNAAYDIWQIQSSIAPPSADPSGYWHECRLNHGR  204

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            C+ +Q+  +QGFR + L+A+   +NS   G FINSC+AHCQTE Q+TW  DDSPV+   +
Sbjct  205  CTPAQIRFLQGFRNQMLRAVSGFSNSKKNGLFINSCFAHCQTERQDTWFADDSPVIHKKA  264

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +A AVGDWY+DR+  + IDCPYPCD+SCHN VF 
Sbjct  265  VAIAVGDWYFDRAEVKLIDCPYPCDRSCHNLVFR  298



>gb|KJB25081.1| hypothetical protein B456_004G176200 [Gossypium raimondii]
Length=334

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 113/153 (74%), Gaps = 4/153 (3%)
 Frame = -2

Query  762  SCTSKM--KPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLD  589
            SCTS+M  +P LCFFPQ +  T+QTP+F VNSAYDSWQ+KNILAP  AD    W SCKLD
Sbjct  175  SCTSRMGARPELCFFPQYVVQTMQTPIFFVNSAYDSWQIKNILAPSAADKSKAWKSCKLD  234

Query  588  ILKCSDSQLGIMQGFRMEFLKAL--GAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPV  415
            + KC+ +QL  +Q FR +FL AL    V NSPS+G FI+SCYAHCQ   Q  W  D SPV
Sbjct  235  LKKCTAAQLKTIQDFRTQFLSALNRAGVVNSPSKGMFIDSCYAHCQVGKQIQWSSDSSPV  294

Query  414  LAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSC  316
            ++   IAKAVGDWYY+RSP +K+DCPYPC+ +C
Sbjct  295  VSNMKIAKAVGDWYYERSPIKKLDCPYPCNPTC  327



>emb|CDP15161.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 109/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT    P  CFFPQN+   ++TPLF +N+AYDSWQV+  LAP  ADPHGTWH CKL+  K
Sbjct  212  CTRYRDPTSCFFPQNLIDNVKTPLFILNAAYDSWQVQASLAPPAADPHGTWHDCKLNHAK  271

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            CS SQ+  +Q FR+  L ++ + A S   G FINSC+AHCQ+E Q+TW  DDSP +    
Sbjct  272  CSASQIRFLQAFRIRMLNSVRSFAMSGQNGLFINSCFAHCQSERQDTWFADDSPAIGNKG  331

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IA AVGDWY+DR+  + IDC YPCDK+CHN VF+
Sbjct  332  IALAVGDWYFDRTGIKAIDCAYPCDKTCHNLVFK  365



>emb|CDX80575.1| BnaC07g28690D [Brassica napus]
Length=417

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 113/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+   ++TPLF VN+AYD WQ+++ +AP  ADPHG WH C+L+  +
Sbjct  264  CTNHLNPTSCFFPQNLISQMKTPLFIVNAAYDIWQIQSSIAPTSADPHGYWHECRLNHGR  323

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            C+ +QL  +QGFR + L+A+   + S   G FINSC+AHCQTE Q+TW  DDSPV+   +
Sbjct  324  CNAAQLRFLQGFRNQMLRAVTGFSKSRKNGLFINSCFAHCQTERQDTWFADDSPVIHKKA  383

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +A AVGDWY+DR+  + IDCPYPCD+SCHN VF 
Sbjct  384  VAIAVGDWYFDRAEVKLIDCPYPCDRSCHNLVFR  417



>ref|XP_009151150.1| PREDICTED: protein notum homolog [Brassica rapa]
 emb|CDY68463.1| BnaA06g39520D [Brassica napus]
Length=417

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 113/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+   ++TPLF VN+AYD WQ+++ +AP  ADPHG WH C+L+  +
Sbjct  264  CTNHLNPTSCFFPQNLISQMKTPLFIVNAAYDIWQIQSSIAPTSADPHGYWHECRLNHGR  323

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            C+ +QL  +QGFR + L+A+   + S   G FINSC+AHCQTE Q+TW  DDSPV+   +
Sbjct  324  CNAAQLRFLQGFRNQMLRAVTGFSKSRKNGLFINSCFAHCQTERQDTWFADDSPVIHKKA  383

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +A AVGDWY+DR+  + IDCPYPCD+SCHN VF 
Sbjct  384  VAIAVGDWYFDRAEVKLIDCPYPCDRSCHNLVFR  417



>ref|XP_003536006.1| PREDICTED: uncharacterized protein LOC100810716 [Glycine max]
Length=421

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 112/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CTS + P  CFFPQN+   I+TPLF +N+AYDSWQV++ LAP  ADPHG WH C+L+  K
Sbjct  268  CTSHLDPTSCFFPQNLIAGIRTPLFILNTAYDSWQVQSSLAPSSADPHGFWHDCRLNHAK  327

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            C+ SQ+  +QGFR + L A+   + S   G FINSC+AHCQ+E Q+TW  D+SPV+   +
Sbjct  328  CTSSQIQYLQGFRNQMLNAIKGFSRSRQNGLFINSCFAHCQSERQDTWFADNSPVIGNKA  387

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IA +VGDWY+DR+  + IDCPYPCD +CH+ VF 
Sbjct  388  IALSVGDWYFDRAVVKAIDCPYPCDNTCHHLVFR  421



>emb|CBI37039.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 109/155 (70%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            +CT+++ P  CFFP+N+   I+TPLF +N+AYD+WQ +  L P  ADPHG W  CKL+ +
Sbjct  211  TCTTRLDPTSCFFPENLIDNIKTPLFLLNAAYDAWQFQESLVPSSADPHGEWKGCKLNHV  270

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C+ +Q+  +Q FRME L  +   A     G FINSC+AHCQTE+Q+TW  DDSP L   
Sbjct  271  NCNSTQIQFLQDFRMEMLDDVKGFARDDQNGLFINSCFAHCQTELQDTWFADDSPFLGKR  330

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
             IA++VGDWY+DR P + IDCPYPCD +CHN VF+
Sbjct  331  KIAESVGDWYFDRRPVKAIDCPYPCDNTCHNLVFK  365



>ref|XP_011012520.1| PREDICTED: protein notum homolog [Populus euphratica]
Length=394

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 112/150 (75%), Gaps = 1/150 (1%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK +P LCFFPQ +A T++TPLF +NSAYDSWQ+KNILAP   D    W +CKLD+ 
Sbjct  238  SCTSKTRPELCFFPQYVAQTMRTPLFIINSAYDSWQIKNILAPTAVDSKKEWKNCKLDLK  297

Query  582  KCSDSQLGIMQGFRMEFLKALG-AVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAG  406
            KCS +QL  +Q +R +FLKA+   + +S SRG +INSCYAHCQ+    TWL D SPV+  
Sbjct  298  KCSATQLQTVQNYRTQFLKAVNTGLGSSSSRGLWINSCYAHCQSGSVSTWLADKSPVVGN  357

Query  405  TSIAKAVGDWYYDRSPFQKIDCPYPCDKSC  316
              I KAVGDW+YDRS F+KIDCPYPC+ +C
Sbjct  358  AKIGKAVGDWFYDRSAFEKIDCPYPCNPTC  387



>ref|XP_010649713.1| PREDICTED: uncharacterized protein LOC100251007 isoform X3 [Vitis 
vinifera]
Length=301

 Score =   195 bits (496),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 110/158 (70%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            +CTS + P LCFFPQN+ P  +TPLF +N+AYDSWQ+   LAP  ADP G W  C+L+  
Sbjct  144  ACTSHLNPTLCFFPQNLIPLTKTPLFLLNAAYDSWQILASLAPHSADPRGYWQKCRLNYA  203

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS SQ+ ++Q FR + L A+   + S   G FINSC+AHCQTE Q+TW   +SP +   
Sbjct  204  YCSSSQIQVLQDFRKQMLNAVSGFSGSKRNGLFINSCFAHCQTERQDTWFAHNSPRIGNK  263

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE*AF  289
             IA++VGDWY+DR+  + IDCPYPCDK+CHN VF  +F
Sbjct  264  GIAQSVGDWYFDRAEVKSIDCPYPCDKTCHNLVFRQSF  301



>gb|ACA61623.1| hypothetical protein AP8_E07.1 [Arabidopsis lyrata subsp. petraea]
Length=257

 Score =   194 bits (492),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 112/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+   ++TPLF VN+AYD WQ+++ +AP  ADP G WH C+L+  +
Sbjct  104  CTNHLNPTSCFFPQNLISQMKTPLFIVNAAYDIWQIQSSIAPPSADPSGYWHECRLNHGR  163

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            C+ +Q+  +QGFR + L+A+   +N    G FINSC+AHCQTE Q+TW  DDSPV+   +
Sbjct  164  CTPAQIRFLQGFRNQMLRAVRGFSNLKKNGLFINSCFAHCQTERQDTWFADDSPVIHKKA  223

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +A AVGDWY+DR+  + IDCPYPCD+SCHN VF 
Sbjct  224  VAIAVGDWYFDRAEVKLIDCPYPCDRSCHNLVFR  257



>gb|KJB25075.1| hypothetical protein B456_004G176200 [Gossypium raimondii]
 gb|KJB25076.1| hypothetical protein B456_004G176200 [Gossypium raimondii]
 gb|KJB25077.1| hypothetical protein B456_004G176200 [Gossypium raimondii]
 gb|KJB25079.1| hypothetical protein B456_004G176200 [Gossypium raimondii]
 gb|KJB25080.1| hypothetical protein B456_004G176200 [Gossypium raimondii]
Length=397

 Score =   198 bits (503),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 113/153 (74%), Gaps = 4/153 (3%)
 Frame = -2

Query  762  SCTSKM--KPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLD  589
            SCTS+M  +P LCFFPQ +  T+QTP+F VNSAYDSWQ+KNILAP  AD    W SCKLD
Sbjct  238  SCTSRMGARPELCFFPQYVVQTMQTPIFFVNSAYDSWQIKNILAPSAADKSKAWKSCKLD  297

Query  588  ILKCSDSQLGIMQGFRMEFLKAL--GAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPV  415
            + KC+ +QL  +Q FR +FL AL    V NSPS+G FI+SCYAHCQ   Q  W  D SPV
Sbjct  298  LKKCTAAQLKTIQDFRTQFLSALNRAGVVNSPSKGMFIDSCYAHCQVGKQIQWSSDSSPV  357

Query  414  LAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSC  316
            ++   IAKAVGDWYY+RSP +K+DCPYPC+ +C
Sbjct  358  VSNMKIAKAVGDWYYERSPIKKLDCPYPCNPTC  390



>ref|XP_009779872.1| PREDICTED: protein notum homolog [Nicotiana sylvestris]
Length=423

 Score =   199 bits (505),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 113/155 (73%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            +CT+K+ P  CFFPQN+   I+TPLF +N+AYDSWQV++ LAP VADP G WH CKL+  
Sbjct  269  TCTNKLDPTSCFFPQNLIDNIKTPLFLLNAAYDSWQVQSSLAPPVADPKGLWHDCKLNNE  328

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            +CS SQ+  +QGFR + L  +   A S   G FINSC+AHCQ+E Q+TW  DDSP++   
Sbjct  329  QCSASQIQFLQGFRNDMLNVVKGFAASTQNGLFINSCFAHCQSERQDTWFADDSPLIDNK  388

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
             +A AVGDWY+DR+  + IDC YPCDK+CHN VF+
Sbjct  389  PVALAVGDWYFDRAGVKSIDCAYPCDKTCHNLVFK  423



>gb|KJB81153.1| hypothetical protein B456_013G131600 [Gossypium raimondii]
Length=413

 Score =   198 bits (504),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 111/154 (72%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT    P  CFFPQN+   I+TPLF +N+AYDSWQ+++ +AP  ADPHG WH C+L+  K
Sbjct  260  CTIHSDPTSCFFPQNLISNIRTPLFILNAAYDSWQIQSSIAPPSADPHGYWHECRLNHAK  319

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            CS SQ+  +QGFR+E L A+   + S   G FINSC+AHCQTE Q+TW   +SP +   +
Sbjct  320  CSASQMRFLQGFRIEMLNAIKGFSQSRENGLFINSCFAHCQTERQDTWFAANSPEIRNKA  379

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IA AVGDWY+DR+  + IDCPYPCDKSCHN VF+
Sbjct  380  IAIAVGDWYFDRAGVKIIDCPYPCDKSCHNLVFK  413



>ref|XP_002318919.2| hypothetical protein POPTR_0013s00280g [Populus trichocarpa]
 gb|EEE94842.2| hypothetical protein POPTR_0013s00280g [Populus trichocarpa]
Length=419

 Score =   198 bits (504),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 110/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+   ++ PLF +N+AYDSWQ+++ LAP  ADPHG W +C+ D  K
Sbjct  266  CTNHLDPTSCFFPQNIIGNVKAPLFILNTAYDSWQIQSSLAPPSADPHGYWSNCRKDHSK  325

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            CS SQL  +QGFR + L A+   +NS   G FINSC+AHCQ+E Q+TW  DDSPVL    
Sbjct  326  CSASQLQFLQGFRNQMLNAIKGFSNSRQNGLFINSCFAHCQSERQDTWFADDSPVLGSRP  385

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IA AVGDWY+DR+  + IDCPYPCD SCHN VF 
Sbjct  386  IALAVGDWYFDRAGEKAIDCPYPCDNSCHNLVFR  419



>gb|EMT14315.1| hypothetical protein F775_08483 [Aegilops tauschii]
Length=400

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 110/154 (71%), Gaps = 7/154 (5%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CTSK+  G+C FPQN    IQTPLF +N+AYDSWQV+NIL PG +DP   W SCK DI +
Sbjct  241  CTSKLPAGMCLFPQNEVKQIQTPLFILNAAYDSWQVRNILVPGGSDPR--WRSCKHDIKQ  298

Query  579  CSDSQLGIMQ-----GFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPV  415
            CS  QL I+Q     GFR  FL+A+ A  +SP+RG FINSC+AHCQ+E+QE W    SPV
Sbjct  299  CSAKQLKILQDGADAGFRDHFLEAIEAQGDSPTRGLFINSCFAHCQSEIQEIWFAPGSPV  358

Query  414  LAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSCH  313
            L    IA AVGDW+Y RS FQK DCPYPCD +CH
Sbjct  359  LGDKRIASAVGDWFYGRSWFQKTDCPYPCDSTCH  392



>ref|XP_002280816.3| PREDICTED: protein notum homolog [Vitis vinifera]
Length=408

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 109/155 (70%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            +CT+++ P  CFFP+N+   I+TPLF +N+AYD+WQ +  L P  ADPHG W  CKL+ +
Sbjct  254  TCTTRLDPTSCFFPENLIDNIKTPLFLLNAAYDAWQFQESLVPSSADPHGEWKGCKLNHV  313

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C+ +Q+  +Q FRME L  +   A     G FINSC+AHCQTE+Q+TW  DDSP L   
Sbjct  314  NCNSTQIQFLQDFRMEMLDDVKGFARDDQNGLFINSCFAHCQTELQDTWFADDSPFLGKR  373

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
             IA++VGDWY+DR P + IDCPYPCD +CHN VF+
Sbjct  374  KIAESVGDWYFDRRPVKAIDCPYPCDNTCHNLVFK  408



>emb|CAD41867.2| OSJNBa0041A02.14 [Oryza sativa Japonica Group]
 emb|CAH67867.1| B0403H10-OSIGBa0105A11.19 [Oryza sativa Indica Group]
Length=396

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSKM P LCFFPQN+ PT++TPLF +N+AYD+WQ+KN+LAP  AD   TW  CKLDI 
Sbjct  241  SCTSKMSPDLCFFPQNVVPTLRTPLFILNAAYDAWQIKNVLAPSAADKKKTWAKCKLDIT  300

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSR-GFFINSCYAHCQTEVQETWLRDDSPVLAG  406
             CS SQL  +Q FR +FL AL     SP+    FI+SCYAHCQ+  Q+TWL   SPV+  
Sbjct  301  ACSSSQLTTLQNFRTDFLAALPKPEQSPANLSIFIDSCYAHCQSGSQDTWLAQGSPVVEK  360

Query  405  TSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNR  307
            T I KAVGDW++DR   ++IDCPYPC+ +C NR
Sbjct  361  TQIGKAVGDWFHDREVSRRIDCPYPCNPTCKNR  393



>ref|XP_008365263.1| PREDICTED: protein notum homolog [Malus domestica]
Length=300

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 110/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+  +I+TPLF +N+AYDSWQ++  LAP  ADP G W  C+L+  K
Sbjct  145  CTNHLDPTSCFFPQNLISSIKTPLFILNAAYDSWQIQTSLAPPAADPAGYWRDCRLNHEK  204

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            C+ SQ+  +QGFR + L A+   + S   G FINSC+AHCQ+E Q+TW  DDSPV+   +
Sbjct  205  CTPSQINFLQGFRNQMLNAVKQFSMSEQNGLFINSCFAHCQSERQDTWFADDSPVIGKKA  264

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IA AVGDWY+DR+  + IDCPYPCD SCHN  FE
Sbjct  265  IAIAVGDWYFDRTSVKIIDCPYPCDNSCHNLNFE  298



>gb|KJB25078.1| hypothetical protein B456_004G176200 [Gossypium raimondii]
Length=433

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 113/153 (74%), Gaps = 4/153 (3%)
 Frame = -2

Query  762  SCTSKM--KPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLD  589
            SCTS+M  +P LCFFPQ +  T+QTP+F VNSAYDSWQ+KNILAP  AD    W SCKLD
Sbjct  274  SCTSRMGARPELCFFPQYVVQTMQTPIFFVNSAYDSWQIKNILAPSAADKSKAWKSCKLD  333

Query  588  ILKCSDSQLGIMQGFRMEFLKAL--GAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPV  415
            + KC+ +QL  +Q FR +FL AL    V NSPS+G FI+SCYAHCQ   Q  W  D SPV
Sbjct  334  LKKCTAAQLKTIQDFRTQFLSALNRAGVVNSPSKGMFIDSCYAHCQVGKQIQWSSDSSPV  393

Query  414  LAGTSIAKAVGDWYYDRSPFQKIDCPYPCDKSC  316
            ++   IAKAVGDWYY+RSP +K+DCPYPC+ +C
Sbjct  394  VSNMKIAKAVGDWYYERSPIKKLDCPYPCNPTC  426



>gb|KHG26188.1| Protein notum [Gossypium arboreum]
Length=413

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 110/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT    P  CFFPQN+   I+TPLF +N+AYDSWQ+++ +AP  ADPHG WH C+L+  K
Sbjct  260  CTIHRDPTSCFFPQNLISNIRTPLFILNTAYDSWQIQSSIAPPSADPHGYWHECRLNHAK  319

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            CS SQ+  +QGFR+E L  +   + S   G FINSC+AHCQTE Q+TW   +SP +   +
Sbjct  320  CSASQMRFLQGFRIEMLNVIKGFSQSRENGLFINSCFAHCQTERQDTWFAANSPEIRNKA  379

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IA AVGDWY+DR+  + IDCPYPCDKSCHN VF+
Sbjct  380  IAIAVGDWYFDRAGVKVIDCPYPCDKSCHNLVFK  413



>ref|XP_011023896.1| PREDICTED: protein notum homolog [Populus euphratica]
Length=419

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 110/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+   ++ PLF +N+AYDSWQ+++ LAP  ADPHG W +C+ D  K
Sbjct  266  CTNHLDPTSCFFPQNIIGNVKAPLFILNTAYDSWQIQSSLAPPSADPHGYWSNCRKDHSK  325

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            CS SQL  +QGFR + L A+   +NS   G FINSC+AHCQ+E Q+TW  DDSPVL    
Sbjct  326  CSASQLQFLQGFRNQMLNAIKGFSNSRQNGLFINSCFAHCQSERQDTWFADDSPVLGSKP  385

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IA AVGDWY++R+  + IDCPYPCD SCHN VF 
Sbjct  386  IALAVGDWYFERAGEKAIDCPYPCDNSCHNLVFR  419



>ref|NP_850878.2| pectinacetylesterase family protein [Arabidopsis thaliana]
 sp|Q66GM8.1|PAE10_ARATH RecName: Full=Pectin acetylesterase 10; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAU05497.1| At5g26670 [Arabidopsis thaliana]
 gb|AED93578.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=416

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 113/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+   ++TPLF VN+AYD WQ+++ +AP  ADP G WH C+L+  +
Sbjct  263  CTNHLNPTSCFFPQNLISQMKTPLFIVNAAYDIWQIQSSIAPPSADPSGYWHECRLNHGR  322

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            C+ +Q+  +QGFR + L+A+   +NS   G FINSC+AHCQTE Q+TW  DDSPV+   +
Sbjct  323  CTPAQIRFLQGFRNQMLRAVSGFSNSKKNGLFINSCFAHCQTERQDTWFADDSPVIHKKA  382

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +A AVGDWY+DR+  + IDCPYPCD+SCHN VF 
Sbjct  383  VAIAVGDWYFDRAEVKLIDCPYPCDRSCHNLVFR  416



>emb|CBI39680.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 110/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            C +++ P  CFFPQN+   I+TPLF +N+AYDSWQV+  LAP  ADPHG W+ CK +  +
Sbjct  212  CLNRLDPTSCFFPQNVISNIKTPLFLLNAAYDSWQVQASLAPPSADPHGYWNECKKNHAQ  271

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            CS SQ+  +QGFR + L A+   + S   G FINSC+AHCQTE Q+TW  D+SP++    
Sbjct  272  CSPSQIQFLQGFRNQMLNAIKGFSMSKQNGLFINSCFAHCQTERQDTWFADNSPIIKNKG  331

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IA AVGDWY+DRS  + IDCPYPCDK+CHN VF 
Sbjct  332  IALAVGDWYFDRSGIKAIDCPYPCDKTCHNLVFR  365



>ref|XP_009129612.1| PREDICTED: protein notum homolog [Brassica rapa]
Length=414

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 112/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+   ++TPLF VN+AYD+WQ+++ +AP  ADP G WH C+L+  K
Sbjct  261  CTNHLDPTSCFFPQNLISQMKTPLFIVNAAYDTWQIQSSIAPTSADPRGFWHDCRLNHAK  320

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            C+ SQ+  +QGFR + L+ +   + S   G FINSC+AHCQTE Q+TW  DDSPV+   +
Sbjct  321  CTPSQIRFLQGFRDQMLRVVKGFSMSRHNGLFINSCFAHCQTERQDTWFADDSPVIRKKA  380

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +A AVGDWY+DR+  + IDCPYPCDKSCHN VF 
Sbjct  381  VAIAVGDWYFDRAEVKLIDCPYPCDKSCHNLVFR  414



>ref|XP_010524828.1| PREDICTED: protein notum homolog [Tarenaya hassleriana]
Length=415

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 112/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+   I+TPLF VN+AYD+WQ+++ +AP  ADP G W  C+L+  +
Sbjct  262  CTNHLDPTSCFFPQNLISQIKTPLFIVNAAYDTWQIQSSIAPPTADPIGYWRDCRLNHGR  321

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            C+ +Q+  +QGFR + L+ +G    S   G FINSC+AHCQTE Q+TW  DDSPV+  T+
Sbjct  322  CTPAQIQFLQGFRNQMLRTVGGFLESKQNGLFINSCFAHCQTERQDTWFADDSPVIQKTA  381

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +A AVGDWY+DR+  + IDCPYPCDKSCHN VF 
Sbjct  382  VAIAVGDWYFDRAEVKLIDCPYPCDKSCHNLVFR  415



>ref|XP_004248530.1| PREDICTED: protein notum homolog isoform X2 [Solanum lycopersicum]
Length=413

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 109/153 (71%), Gaps = 0/153 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            +CT+K+ P  CFFPQN+   I+TPLF +N+AYD WQ+++ LAP VADPHG WH CK D  
Sbjct  259  NCTNKLDPTSCFFPQNLIGNIKTPLFLLNAAYDFWQIQSSLAPPVADPHGLWHDCKRDYK  318

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS SQ+  +Q FR + L A+     S   G FINSC+AHCQ+E Q+TW  DDSP++   
Sbjct  319  KCSASQIQFLQDFRNDMLNAIKGFGASTQSGLFINSCFAHCQSERQDTWFADDSPLIDNK  378

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRV  304
            +IA AVGDWY+DR   + IDC YPCDK+CHN V
Sbjct  379  TIALAVGDWYFDREGMKAIDCAYPCDKTCHNMV  411



>emb|CBI26039.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 110/158 (70%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            +CTS + P LCFFPQN+ P  +TPLF +N+AYDSWQ+   LAP  ADP G W  C+L+  
Sbjct  211  ACTSHLNPTLCFFPQNLIPLTKTPLFLLNAAYDSWQILASLAPHSADPRGYWQKCRLNYA  270

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS SQ+ ++Q FR + L A+   + S   G FINSC+AHCQTE Q+TW   +SP +   
Sbjct  271  YCSSSQIQVLQDFRKQMLNAVSGFSGSKRNGLFINSCFAHCQTERQDTWFAHNSPRIGNK  330

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE*AF  289
             IA++VGDWY+DR+  + IDCPYPCDK+CHN VF  +F
Sbjct  331  GIAQSVGDWYFDRAEVKSIDCPYPCDKTCHNLVFRQSF  368



>dbj|BAH19826.1| AT5G26670 [Arabidopsis thaliana]
Length=416

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 113/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+   ++TPLF VN+AYD WQ+++ +AP  ADP G WH C+L+  +
Sbjct  263  CTNHLNPTSCFFPQNLISQMKTPLFIVNAAYDIWQIQSSIAPPSADPSGYWHECRLNHGR  322

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            C+ +Q+  +QGFR + L+A+   +NS   G FINSC+AHCQTE Q+TW  DDSPV+   +
Sbjct  323  CTPAQIRFLQGFRNQMLRAVSGFSNSKKNGLFINSCFAHCQTERQDTWFADDSPVIHKKA  382

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +A AVGDWY+DR+  + IDCPYPCD+SCHN VF 
Sbjct  383  VAIAVGDWYFDRAEVKLIDCPYPCDRSCHNLVFR  416



>ref|XP_010327277.1| PREDICTED: protein notum homolog isoform X1 [Solanum lycopersicum]
Length=416

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 109/153 (71%), Gaps = 0/153 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            +CT+K+ P  CFFPQN+   I+TPLF +N+AYD WQ+++ LAP VADPHG WH CK D  
Sbjct  262  NCTNKLDPTSCFFPQNLIGNIKTPLFLLNAAYDFWQIQSSLAPPVADPHGLWHDCKRDYK  321

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            KCS SQ+  +Q FR + L A+     S   G FINSC+AHCQ+E Q+TW  DDSP++   
Sbjct  322  KCSASQIQFLQDFRNDMLNAIKGFGASTQSGLFINSCFAHCQSERQDTWFADDSPLIDNK  381

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRV  304
            +IA AVGDWY+DR   + IDC YPCDK+CHN V
Sbjct  382  TIALAVGDWYFDREGMKAIDCAYPCDKTCHNMV  414



>gb|ABG34280.1| pectin acetylesterase [Eucalyptus globulus subsp. globulus]
Length=350

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 111/154 (72%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+  +I+TPLF +N+AYD+WQ++  LAP  ADPHG W  C L+  +
Sbjct  196  CTNHLNPTSCFFPQNLIASIKTPLFLLNAAYDAWQLQASLAPSSADPHGHWRQCTLNHAR  255

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            CS SQ+  +QGFR + L A+   ++S   G F+NSC+AHCQ+E Q+TW  D+SP +   +
Sbjct  256  CSASQIQFLQGFRNQMLNAIRGFSSSRQNGLFLNSCFAHCQSERQDTWFADNSPTIGNKA  315

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IA AVGDWY+DR+  + IDCPYPCDK+CHN VF 
Sbjct  316  IALAVGDWYFDRAAVKAIDCPYPCDKTCHNLVFH  349



>gb|ABK26312.1| unknown [Picea sitchensis]
 gb|ACN40309.1| unknown [Picea sitchensis]
Length=421

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 113/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  756  TSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILKC  577
            +S+  P  CFFPQ + P IQTP+F +N+AYD+WQV NILAPG  DPHG WH CK + + C
Sbjct  269  SSQSDPTQCFFPQYVLPYIQTPIFVLNAAYDTWQVHNILAPGSEDPHGHWHYCKQNPVNC  328

Query  576  SDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTSI  397
            + SQL I+QG+RME L AL     S + G FINSC+ HCQ+E Q+TW + +SP++   +I
Sbjct  329  TSSQLEILQGYRMEMLNALETFKPSETGGMFINSCFCHCQSENQDTWFQSNSPMMNNKTI  388

Query  396  AKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            A+AVGDWY++R   +++DCPYPCD++CHN VF
Sbjct  389  AQAVGDWYFERCTVKEVDCPYPCDQTCHNLVF  420



>ref|NP_001053773.1| Os04g0602500 [Oryza sativa Japonica Group]
 dbj|BAF15687.1| Os04g0602500 [Oryza sativa Japonica Group]
 dbj|BAG93730.1| unnamed protein product [Oryza sativa Japonica Group]
Length=466

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSKM P LCFFPQN+ PT++TPLF +N+AYD+WQ+KN+LAP  AD   TW  CKLDI 
Sbjct  311  SCTSKMSPDLCFFPQNVVPTLRTPLFILNAAYDAWQIKNVLAPSAADKKKTWAKCKLDIT  370

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSR-GFFINSCYAHCQTEVQETWLRDDSPVLAG  406
             CS SQL  +Q FR +FL AL     SP+    FI+SCYAHCQ+  Q+TWL   SPV+  
Sbjct  371  ACSSSQLTTLQNFRTDFLAALPKPEQSPANLSIFIDSCYAHCQSGSQDTWLAQGSPVVEK  430

Query  405  TSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNR  307
            T I KAVGDW++DR   ++IDCPYPC+ +C NR
Sbjct  431  TQIGKAVGDWFHDREVSRRIDCPYPCNPTCKNR  463



>gb|KJB82697.1| hypothetical protein B456_013G211000 [Gossypium raimondii]
Length=401

 Score =   196 bits (498),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 111/154 (72%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+   I+TPLF +N+AYDSWQ+++ +AP  ADPHG WH C+L+  K
Sbjct  248  CTNHLDPTSCFFPQNVINHIRTPLFILNAAYDSWQIQSSIAPPSADPHGYWHDCRLNHAK  307

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            CS SQL  +QGFR + L A+   + S   G FINSC+AHCQ+E Q+TW  D+SP +    
Sbjct  308  CSASQLRYLQGFRTQMLNAIKGFSMSRENGLFINSCFAHCQSERQDTWFADNSPEIRNKP  367

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IA AVGDWY+DR+  + +DCPYPCDK+CHN VF 
Sbjct  368  IAIAVGDWYFDRTAVKVVDCPYPCDKTCHNLVFR  401



>emb|CDY27732.1| BnaA05g31410D [Brassica napus]
Length=414

 Score =   196 bits (499),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 112/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+   ++TPLF VN+AYD+WQ+++ +AP  ADP G WH C+L+  K
Sbjct  261  CTNHLDPTSCFFPQNLISQMKTPLFIVNAAYDTWQIQSSIAPTSADPSGFWHDCRLNHAK  320

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            C+ SQ+  +QGFR + L+ +   + S   G FINSC+AHCQTE Q+TW  DDSPV+   +
Sbjct  321  CTPSQIRFLQGFRDQMLRVVKGFSMSRHNGLFINSCFAHCQTERQDTWFADDSPVIRKKA  380

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +A AVGDWY+DR+  + IDCPYPCDKSCHN VF 
Sbjct  381  VAIAVGDWYFDRAEVKLIDCPYPCDKSCHNLVFR  414



>gb|KJB82696.1| hypothetical protein B456_013G211000 [Gossypium raimondii]
Length=389

 Score =   195 bits (496),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 111/154 (72%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+   I+TPLF +N+AYDSWQ+++ +AP  ADPHG WH C+L+  K
Sbjct  236  CTNHLDPTSCFFPQNVINHIRTPLFILNAAYDSWQIQSSIAPPSADPHGYWHDCRLNHAK  295

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            CS SQL  +QGFR + L A+   + S   G FINSC+AHCQ+E Q+TW  D+SP +    
Sbjct  296  CSASQLRYLQGFRTQMLNAIKGFSMSRENGLFINSCFAHCQSERQDTWFADNSPEIRNKP  355

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IA AVGDWY+DR+  + +DCPYPCDK+CHN VF 
Sbjct  356  IAIAVGDWYFDRTAVKVVDCPYPCDKTCHNLVFR  389



>ref|XP_009111712.1| PREDICTED: protein notum homolog [Brassica rapa]
Length=416

 Score =   196 bits (498),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 111/154 (72%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT  + P  CFFPQN+   ++TPLF VN+AYD WQV++ LAP  ADP G WH C+L+  +
Sbjct  263  CTDHLNPTSCFFPQNLISEMKTPLFIVNAAYDIWQVQSSLAPPSADPSGYWHECRLNHGR  322

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            C+ +Q+  +QGFR + L+A+    N+   G FINSC+AHCQTE Q+TW  DDSPV+   +
Sbjct  323  CTPAQILFLQGFRDQMLRAVSGFLNARKNGLFINSCFAHCQTERQDTWFADDSPVINKKA  382

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +A AVGDWY+DR+  + IDCPYPCD+SCHN VF 
Sbjct  383  VATAVGDWYFDRAEVKLIDCPYPCDRSCHNLVFR  416



>ref|NP_566263.1| pectinacetylesterase family protein [Arabidopsis thaliana]
 sp|Q9SFF6.1|PAE12_ARATH RecName: Full=Pectin acetylesterase 12; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF23225.1|AC013454_12 putative pectinacetylesterase [Arabidopsis thaliana]
 gb|AAL16135.1|AF428303_1 AT3g05910/F2O10_3 [Arabidopsis thaliana]
 gb|AAK92782.1| putative pectinacetylesterase [Arabidopsis thaliana]
 gb|AAM20385.1| putative pectinacetylesterase [Arabidopsis thaliana]
 gb|AEE74314.1| pectinacetylesterase family protein [Arabidopsis thaliana]
Length=415

 Score =   196 bits (498),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 112/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+   ++TPLF VN+AYD+WQ+++ +AP  ADP G WH C+L+  K
Sbjct  262  CTNHLDPTSCFFPQNLISQMKTPLFIVNAAYDTWQIQSSIAPTSADPSGFWHDCRLNHGK  321

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            C+ +QL  +QGFR + L+ +   + S   G FINSC+AHCQTE Q+TW  DDSPV+   +
Sbjct  322  CTPAQLRFLQGFREQMLRVVKGFSMSRQNGLFINSCFAHCQTERQDTWFADDSPVIRKKA  381

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +A AVGDWY+DR+  + +DCPYPCDKSCHN VF 
Sbjct  382  VAIAVGDWYFDRAEVKLVDCPYPCDKSCHNLVFR  415



>emb|CDY19761.1| BnaA09g04140D [Brassica napus]
Length=416

 Score =   196 bits (498),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 111/154 (72%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT  + P  CFFPQN+   ++TPLF VN+AYD WQV++ LAP  ADP G WH C+L+  +
Sbjct  263  CTDHLNPTSCFFPQNLISEMKTPLFIVNAAYDIWQVQSSLAPPSADPSGYWHECRLNHGR  322

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            C+ +Q+  +QGFR + L+A+    N+   G FINSC+AHCQTE Q+TW  DDSPV+   +
Sbjct  323  CTPAQILFLQGFRDQMLRAVSGFLNARKNGLFINSCFAHCQTERQDTWFADDSPVINKKA  382

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +A AVGDWY+DR+  + IDCPYPCD+SCHN VF 
Sbjct  383  VATAVGDWYFDRAEVKLIDCPYPCDRSCHNLVFR  416



>emb|CDY05211.1| BnaC05g45920D [Brassica napus]
Length=413

 Score =   196 bits (497),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 112/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+   ++TPLF VN+AYD+WQ+++ +AP  ADP G WH C+L+  K
Sbjct  260  CTNHLDPTSCFFPQNLISQMKTPLFIVNAAYDTWQIQSSIAPTSADPSGFWHDCRLNHAK  319

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            C+ SQ+  +QGFR + L+ +   + S   G FINSC+AHCQTE Q+TW  DDSPV+   +
Sbjct  320  CTPSQIRFLQGFRDQMLRVVRGFSMSRHNGLFINSCFAHCQTERQDTWFADDSPVIRKKA  379

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +A AVGDWY+DR+  + +DCPYPCDKSCHN VF 
Sbjct  380  VAIAVGDWYFDRAEVKLVDCPYPCDKSCHNLVFR  413



>gb|EPS60657.1| hypothetical protein M569_14145, partial [Genlisea aurea]
Length=224

 Score =   190 bits (483),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 108/154 (70%), Gaps = 0/154 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SC  +M P  CFFPQN    I+TPLF +N+AYDSWQ++  LAP  ADPHGTW  CK++  
Sbjct  71   SCARRMDPTSCFFPQNSIANIRTPLFILNAAYDSWQLQESLAPPTADPHGTWRDCKMNNQ  130

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            +CS SQ+  +Q FR E + A+   + S   G F+NSC+AHCQ+E Q+TW  D+SP +   
Sbjct  131  RCSPSQIQFLQNFRNEMVNAVRGFSGSRQAGLFVNSCFAHCQSERQDTWFADNSPTINNK  190

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVF  301
            ++A AVGDW++DR   ++IDC YPCD+SCHN VF
Sbjct  191  AVAIAVGDWFFDRGTVKEIDCAYPCDRSCHNLVF  224



>ref|XP_008363955.1| PREDICTED: protein notum homolog [Malus domestica]
Length=414

 Score =   196 bits (497),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 111/154 (72%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+  +++TPLF +N+AYDSWQ+++ LAP  ADP G W  C+L+  K
Sbjct  259  CTNHLDPTSCFFPQNLISSVKTPLFILNAAYDSWQIQSSLAPPAADPAGYWRBCRLNHAK  318

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            C+ SQ+  +QGFR + L A+   + S   G FINSC+AHCQ+E Q+TW  DDSPV+   +
Sbjct  319  CTSSQINFLQGFRNQMLNAVKRFSMSKQNGLFINSCFAHCQSERQDTWFADDSPVIGNKA  378

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IA AVGDWY+DR+  + +DCPYPCD SCHN  FE
Sbjct  379  IAIAVGDWYFDRTSVKAVDCPYPCDNSCHNLNFE  412



>ref|XP_009366012.1| PREDICTED: protein notum homolog [Pyrus x bretschneideri]
Length=414

 Score =   196 bits (497),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 111/154 (72%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+  +++TPLF +N+AYDSWQ+++ LAP  ADP G W  C+L+  K
Sbjct  259  CTNHLDPTSCFFPQNLISSVKTPLFILNAAYDSWQIQSSLAPPAADPAGYWRDCRLNHAK  318

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            C+ SQ+  +QGFR + L A+   + S   G FINSC+AHCQ+E Q+TW  DDSPV+   +
Sbjct  319  CTSSQINFLQGFRNQMLNAVKRFSMSKQNGLFINSCFAHCQSERQDTWFADDSPVIGKKA  378

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IA AVGDWY+DR+  + IDCPYPCD SCHN  FE
Sbjct  379  IAIAVGDWYFDRTSVKAIDCPYPCDNSCHNLNFE  412



>ref|XP_002279030.1| PREDICTED: protein notum homolog [Vitis vinifera]
Length=423

 Score =   196 bits (498),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 110/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            C +++ P  CFFPQN+   I+TPLF +N+AYDSWQV+  LAP  ADPHG W+ CK +  +
Sbjct  270  CLNRLDPTSCFFPQNVISNIKTPLFLLNAAYDSWQVQASLAPPSADPHGYWNECKKNHAQ  329

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            CS SQ+  +QGFR + L A+   + S   G FINSC+AHCQTE Q+TW  D+SP++    
Sbjct  330  CSPSQIQFLQGFRNQMLNAIKGFSMSKQNGLFINSCFAHCQTERQDTWFADNSPIIKNKG  389

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IA AVGDWY+DRS  + IDCPYPCDK+CHN VF 
Sbjct  390  IALAVGDWYFDRSGIKAIDCPYPCDKTCHNLVFR  423



>gb|KJB82695.1| hypothetical protein B456_013G211000 [Gossypium raimondii]
Length=412

 Score =   196 bits (497),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 111/154 (72%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+   I+TPLF +N+AYDSWQ+++ +AP  ADPHG WH C+L+  K
Sbjct  259  CTNHLDPTSCFFPQNVINHIRTPLFILNAAYDSWQIQSSIAPPSADPHGYWHDCRLNHAK  318

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            CS SQL  +QGFR + L A+   + S   G FINSC+AHCQ+E Q+TW  D+SP +    
Sbjct  319  CSASQLRYLQGFRTQMLNAIKGFSMSRENGLFINSCFAHCQSERQDTWFADNSPEIRNKP  378

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IA AVGDWY+DR+  + +DCPYPCDK+CHN VF 
Sbjct  379  IAIAVGDWYFDRTAVKVVDCPYPCDKTCHNLVFR  412



>emb|CAN62190.1| hypothetical protein VITISV_020113 [Vitis vinifera]
Length=423

 Score =   196 bits (497),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 110/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            C +++ P  CFFPQN+   I+TPLF +N+AYDSWQV+  LAP  ADPHG W+ CK +  +
Sbjct  270  CLNRLDPTSCFFPQNVISNIKTPLFLLNAAYDSWQVQASLAPPSADPHGYWNECKKNHAQ  329

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            CS SQ+  +QGFR + L A+   + S   G FINSC+AHCQTE Q+TW  D+SP++    
Sbjct  330  CSPSQIQFLQGFRNQMLNAIKGFSMSKQNGLFINSCFAHCQTERQDTWFADNSPIIKNKG  389

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IA AVGDWY+DRS  + IDCPYPCDK+CHN VF 
Sbjct  390  IALAVGDWYFDRSGIKAIDCPYPCDKTCHNLVFR  423



>gb|KCW58690.1| hypothetical protein EUGRSUZ_H01338 [Eucalyptus grandis]
Length=386

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 111/154 (72%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+  +I+TPLF +N+AYD+WQ++  LAP  ADPHG W  C L+  +
Sbjct  232  CTNHLDPTSCFFPQNLIASIKTPLFLLNAAYDAWQLQASLAPSSADPHGHWRQCTLNHAR  291

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            CS SQ+  +QGFR + L A+   ++S   G F+NSC+AHCQ+E Q+TW  D+SP +   +
Sbjct  292  CSASQIQFLQGFRNQMLNAIRGFSSSRQNGLFLNSCFAHCQSERQDTWFADNSPTIGNKA  351

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IA AVGDWY+DR+  + IDCPYPCDK+CHN VF 
Sbjct  352  IALAVGDWYFDRAAVKAIDCPYPCDKTCHNLVFH  385



>gb|KJB81156.1| hypothetical protein B456_013G131600 [Gossypium raimondii]
Length=395

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 108/145 (74%), Gaps = 0/145 (0%)
 Frame = -2

Query  732  CFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILKCSDSQLGIM  553
            CFFPQN+   I+TPLF +N+AYDSWQ+++ +AP  ADPHG WH C+L+  KCS SQ+  +
Sbjct  251  CFFPQNLISNIRTPLFILNAAYDSWQIQSSIAPPSADPHGYWHECRLNHAKCSASQMRFL  310

Query  552  QGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTSIAKAVGDWY  373
            QGFR+E L A+   + S   G FINSC+AHCQTE Q+TW   +SP +   +IA AVGDWY
Sbjct  311  QGFRIEMLNAIKGFSQSRENGLFINSCFAHCQTERQDTWFAANSPEIRNKAIAIAVGDWY  370

Query  372  YDRSPFQKIDCPYPCDKSCHNRVFE  298
            +DR+  + IDCPYPCDKSCHN VF+
Sbjct  371  FDRAGVKIIDCPYPCDKSCHNLVFK  395



>ref|XP_002884540.1| hypothetical protein ARALYDRAFT_477888 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60799.1| hypothetical protein ARALYDRAFT_477888 [Arabidopsis lyrata subsp. 
lyrata]
Length=415

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 112/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+   ++TPLF VN+AYD+WQ+++ +AP  ADP G WH C+L+  K
Sbjct  262  CTNHLDPTSCFFPQNLISQMKTPLFIVNAAYDTWQIQSSIAPTSADPSGFWHDCRLNHGK  321

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            C+ +QL  +QGFR + L+ +   + S   G FINSC+AHCQTE Q+TW  DDSPV+   +
Sbjct  322  CTPAQLRFLQGFRDQMLRVVRGFSMSRQNGLFINSCFAHCQTERQDTWFADDSPVIRKKA  381

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +A AVGDWY+DR+  + +DCPYPCDKSCHN VF 
Sbjct  382  VAIAVGDWYFDRAEVKLVDCPYPCDKSCHNLVFR  415



>ref|XP_010433795.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=364

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 111/154 (72%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+   P  CFFPQN+   ++TPLF VN+AYD+WQ+++ +AP  ADP G WH C+L+  K
Sbjct  211  CTNHHDPTTCFFPQNLISQMKTPLFIVNAAYDTWQIQSSIAPTSADPSGFWHDCRLNHGK  270

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            C+ +QL  +QGFR + L+ +   + S   G FINSC+AHCQTE Q+TW  DDSPV+   +
Sbjct  271  CTPAQLRFLQGFRDQMLRVVKGFSMSRQNGLFINSCFAHCQTERQDTWFADDSPVIRKKA  330

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +A AVGDWY+DR+  + +DCPYPCDKSCHN VF 
Sbjct  331  VAIAVGDWYFDRAEVKLVDCPYPCDKSCHNLVFR  364



>ref|XP_010240825.1| PREDICTED: protein notum homolog [Nelumbo nucifera]
Length=410

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 111/155 (72%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            +C + + P  CFFPQN+   IQTPLF +N+AYD+WQ++  LAP  ADPHG W  CKL+  
Sbjct  256  TCLNHLDPTSCFFPQNLIANIQTPLFLLNAAYDAWQLQASLAPPSADPHGYWRGCKLNHA  315

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            +C+ SQ+  +QGFR + L A+   + S   G FINSC+AHCQTE Q+TW  DDSP++   
Sbjct  316  QCTASQIQFLQGFRNQMLNAIKGFSMSRKNGLFINSCFAHCQTERQDTWFADDSPLIGNK  375

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
             IA++VGDWY+DR+  + IDC YPCDK+CHN VF+
Sbjct  376  GIAQSVGDWYFDRAGVRAIDCEYPCDKTCHNLVFK  410



>gb|KDO86757.1| hypothetical protein CISIN_1g014548mg [Citrus sinensis]
Length=298

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 108/155 (70%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            +CTS++ P  CFFPQN+   I+TP+F +N+AYD+WQV+  LAP  ADPHG W  CK D  
Sbjct  144  TCTSQLDPTSCFFPQNLVANIKTPMFLLNAAYDAWQVQASLAPPTADPHGYWSDCKSDHA  203

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             C+ SQ+   Q FR + L A+   + S   G FINSC+AHCQ+E Q+TW  DDSP +   
Sbjct  204  HCNSSQIQFFQDFRNQMLNAVEVFSKSNENGLFINSCFAHCQSERQDTWYADDSPRIGDK  263

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
             IAK+VGDWY+DR+  + IDCPYPCDK+C N VF+
Sbjct  264  GIAKSVGDWYFDRAALKAIDCPYPCDKTCRNLVFK  298



>ref|XP_003580427.1| PREDICTED: uncharacterized protein LOC100827238 isoform X2 [Brachypodium 
distachyon]
Length=391

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 109/152 (72%), Gaps = 0/152 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK  P LCFFPQ + PT++TPLF +N+AYD+WQ++NILAP  ADP  TW  CKLDI 
Sbjct  237  SCTSKRSPELCFFPQYVIPTLRTPLFILNAAYDTWQIRNILAPNAADPKKTWAKCKLDIK  296

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS SQL  +Q FR +FL AL     SPS G FI+SC+AHCQ+  Q+TW+ + SP +   
Sbjct  297  SCSSSQLVTLQNFRKDFLAALPQPGQSPSLGIFIDSCFAHCQSGAQDTWIGEGSPSIQKM  356

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNR  307
             I KAVGDW+Y+R   Q IDCPYPC+ +C NR
Sbjct  357  RIGKAVGDWFYNRHVSQLIDCPYPCNPTCKNR  388



>gb|EEC77932.1| hypothetical protein OsI_17271 [Oryza sativa Indica Group]
Length=530

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSKM P LCFFPQN+ PT++TPLF +N+AYD+WQ+KN+LAP  AD   TW  CKLDI 
Sbjct  375  SCTSKMSPDLCFFPQNVVPTLRTPLFILNAAYDAWQIKNVLAPSAADKKKTWAKCKLDIT  434

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSR-GFFINSCYAHCQTEVQETWLRDDSPVLAG  406
             CS SQL  +Q FR +FL AL     SP+    FI+SCYAHCQ+  Q+TWL   SPV+  
Sbjct  435  ACSSSQLTTLQNFRTDFLAALPKPEQSPANLSIFIDSCYAHCQSGSQDTWLAQGSPVVEK  494

Query  405  TSIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNR  307
            T I KAVGDW++DR   ++IDCPYPC+ +C NR
Sbjct  495  TQIGKAVGDWFHDREVSRRIDCPYPCNPTCKNR  527



>ref|XP_002275616.1| PREDICTED: protein notum homolog isoform X1 [Vitis vinifera]
Length=422

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 110/158 (70%), Gaps = 0/158 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            +CTS + P LCFFPQN+ P  +TPLF +N+AYDSWQ+   LAP  ADP G W  C+L+  
Sbjct  265  ACTSHLNPTLCFFPQNLIPLTKTPLFLLNAAYDSWQILASLAPHSADPRGYWQKCRLNYA  324

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS SQ+ ++Q FR + L A+   + S   G FINSC+AHCQTE Q+TW   +SP +   
Sbjct  325  YCSSSQIQVLQDFRKQMLNAVSGFSGSKRNGLFINSCFAHCQTERQDTWFAHNSPRIGNK  384

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE*AF  289
             IA++VGDWY+DR+  + IDCPYPCDK+CHN VF  +F
Sbjct  385  GIAQSVGDWYFDRAEVKSIDCPYPCDKTCHNLVFRQSF  422



>ref|XP_009353455.1| PREDICTED: protein notum homolog [Pyrus x bretschneideri]
Length=428

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 115/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCT+++ P LCFFPQ++  +++TPLF VN+AYD+WQ++  LAP  ADP+G WH+C  +  
Sbjct  274  SCTNRLHPTLCFFPQHLIASVKTPLFLVNAAYDTWQIQASLAPRTADPNGHWHACTKNNG  333

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
            +C+  Q+  +QGFR++ LKA+   + +   G FINSC++HCQTE Q+TW   +SP++   
Sbjct  334  RCAAWQMNFLQGFRIQMLKAVSGFSRAGKNGLFINSCFSHCQTERQDTWFSQNSPLIGNK  393

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
             IAK+VG+WY+DR   + IDCPYPCDK+CHN VF+
Sbjct  394  GIAKSVGNWYFDRYSIKAIDCPYPCDKTCHNLVFK  428



>ref|XP_002303225.2| pectinacetylesterase family protein [Populus trichocarpa]
 gb|ABK93778.1| unknown [Populus trichocarpa]
 gb|ABK95483.1| unknown [Populus trichocarpa]
 gb|EEE78204.2| pectinacetylesterase family protein [Populus trichocarpa]
Length=394

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 110/150 (73%), Gaps = 1/150 (1%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK +P LCFFPQ +A  ++TPLF +NSAYDSWQ+KNILAP   D    W +CKLD+ 
Sbjct  238  SCTSKTRPELCFFPQYVAQAMRTPLFIINSAYDSWQIKNILAPTAVDSKKEWKNCKLDLK  297

Query  582  KCSDSQLGIMQGFRMEFLKALG-AVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAG  406
            KCS +QL  +Q +R +FLKA+   + +S SRG +INSCYAHCQ+    TWL D SPV+  
Sbjct  298  KCSATQLQTVQNYRTQFLKAVNIGLGSSSSRGLWINSCYAHCQSGSVSTWLADKSPVVGN  357

Query  405  TSIAKAVGDWYYDRSPFQKIDCPYPCDKSC  316
              I KAVGDW+YDRS F+KIDC YPC+ +C
Sbjct  358  VKIGKAVGDWFYDRSAFEKIDCAYPCNPTC  387



>gb|KFK26428.1| hypothetical protein AALP_AA8G247000 [Arabis alpina]
Length=416

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 112/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+   ++TPLF VN+AYD WQ+++ +AP  ADP G WH C+L+  +
Sbjct  263  CTNHLNPTSCFFPQNLISQMKTPLFIVNAAYDIWQIQSSIAPPRADPSGYWHECRLNHGR  322

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            C+ +Q+  +QGFR + L+ +   +NS   G FINSC+AHCQTE Q+TW  DDSPV+   +
Sbjct  323  CTPAQIRFLQGFRDQMLRVVSEFSNSRKNGLFINSCFAHCQTERQDTWFADDSPVIHKKA  382

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +A AVGDWY+DR+  + IDCPYPCD+SCHN VF 
Sbjct  383  VAIAVGDWYFDRAEVKLIDCPYPCDRSCHNLVFR  416



>gb|AGT17273.1| hypothetical protein SHCRBa_020_L15_F_100 [Saccharum hybrid cultivar 
R570]
Length=375

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 109/152 (72%), Gaps = 3/152 (2%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK  P LC FPQ + PT++TPLF +N+AYDSWQVKN+LAP  ADP  TW  CKLDI 
Sbjct  224  SCTSKQSPELCMFPQYVVPTMRTPLFILNAAYDSWQVKNVLAPSPADPKKTWAQCKLDIK  283

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS SQL  +Q FR +FL AL     +PS G FI+SC AHCQ+  Q+TWL D SP +  T
Sbjct  284  SCSPSQLTTLQNFRTDFLAAL---PTTPSVGMFIDSCNAHCQSGSQDTWLADGSPTVNRT  340

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNR  307
             I KAVGDWYYDR   ++IDCPYPC+ +C NR
Sbjct  341  QIGKAVGDWYYDREVSRQIDCPYPCNPTCKNR  372



>ref|XP_010240371.1| PREDICTED: uncharacterized protein LOC100827238 isoform X1 [Brachypodium 
distachyon]
Length=404

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 109/152 (72%), Gaps = 0/152 (0%)
 Frame = -2

Query  762  SCTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDIL  583
            SCTSK  P LCFFPQ + PT++TPLF +N+AYD+WQ++NILAP  ADP  TW  CKLDI 
Sbjct  250  SCTSKRSPELCFFPQYVIPTLRTPLFILNAAYDTWQIRNILAPNAADPKKTWAKCKLDIK  309

Query  582  KCSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGT  403
             CS SQL  +Q FR +FL AL     SPS G FI+SC+AHCQ+  Q+TW+ + SP +   
Sbjct  310  SCSSSQLVTLQNFRKDFLAALPQPGQSPSLGIFIDSCFAHCQSGAQDTWIGEGSPSIQKM  369

Query  402  SIAKAVGDWYYDRSPFQKIDCPYPCDKSCHNR  307
             I KAVGDW+Y+R   Q IDCPYPC+ +C NR
Sbjct  370  RIGKAVGDWFYNRHVSQLIDCPYPCNPTCKNR  401



>ref|XP_010070108.1| PREDICTED: protein notum homolog [Eucalyptus grandis]
 gb|KCW58691.1| hypothetical protein EUGRSUZ_H01338 [Eucalyptus grandis]
Length=424

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 111/154 (72%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+  +I+TPLF +N+AYD+WQ++  LAP  ADPHG W  C L+  +
Sbjct  270  CTNHLDPTSCFFPQNLIASIKTPLFLLNAAYDAWQLQASLAPSSADPHGHWRQCTLNHAR  329

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            CS SQ+  +QGFR + L A+   ++S   G F+NSC+AHCQ+E Q+TW  D+SP +   +
Sbjct  330  CSASQIQFLQGFRNQMLNAIRGFSSSRQNGLFLNSCFAHCQSERQDTWFADNSPTIGNKA  389

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            IA AVGDWY+DR+  + IDCPYPCDK+CHN VF 
Sbjct  390  IALAVGDWYFDRAAVKAIDCPYPCDKTCHNLVFH  423



>ref|XP_002872227.1| hypothetical protein ARALYDRAFT_489494 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48486.1| hypothetical protein ARALYDRAFT_489494 [Arabidopsis lyrata subsp. 
lyrata]
Length=416

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 112/154 (73%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+ + P  CFFPQN+   ++TPLF VN+AYD WQ+++ +AP  ADP G WH C+L+  +
Sbjct  263  CTNHLNPTSCFFPQNLISQMKTPLFIVNAAYDIWQIQSSIAPPSADPSGYWHECRLNHGR  322

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            C+ +Q+  +QGFR + L+A+   +N    G FINSC+AHCQTE Q+TW  DDSPV+   +
Sbjct  323  CTPAQIRFLQGFRNQMLRAVRGFSNLKKNGLFINSCFAHCQTERQDTWFADDSPVIHKMA  382

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +A AVGDWY+DR+  + IDCPYPCD+SCHN VF 
Sbjct  383  VAIAVGDWYFDRAEVKLIDCPYPCDRSCHNLVFR  416



>ref|XP_010464149.1| PREDICTED: protein notum homolog [Camelina sativa]
Length=415

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 111/154 (72%), Gaps = 0/154 (0%)
 Frame = -2

Query  759  CTSKMKPGLCFFPQNMAPTIQTPLFXVNSAYDSWQVKNILAPGVADPHGTWHSCKLDILK  580
            CT+   P  CFFPQN+   ++TPLF VN+AYD+WQ+++ +AP  ADP G WH C+L+  K
Sbjct  262  CTNHHDPTTCFFPQNLISQMKTPLFIVNAAYDTWQIQSSIAPTSADPSGFWHDCRLNHGK  321

Query  579  CSDSQLGIMQGFRMEFLKALGAVANSPSRGFFINSCYAHCQTEVQETWLRDDSPVLAGTS  400
            C+ +QL  +QGFR + L+ +   + S   G FINSC+AHCQTE Q+TW  DDSPV+   +
Sbjct  322  CTPAQLRFLQGFRDQMLRVVKGFSMSRQNGLFINSCFAHCQTERQDTWFADDSPVIRKKA  381

Query  399  IAKAVGDWYYDRSPFQKIDCPYPCDKSCHNRVFE  298
            +A AVGDWY+DR+  + +DCPYPCDKSCHN VF 
Sbjct  382  VAIAVGDWYFDRAEVKLVDCPYPCDKSCHNLVFR  415



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680